3ZRFC

Pvhl54-213-elob-eloc complex_apo
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
142
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Targeting the Von Hippel-Lindau E3 Ubiquitin Ligase Using Small Molecules to Disrupt the Vhl/Hif-1Alpha Interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 32
structure length 142
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3zrfC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3zrfC01
4W9GC 3ZTDC 4AWJC 4W9JC 4W9IC 4BKSC 4AJYV 4W9CC 3ZTCC 4WQOA 4W9KC 4W9DC 5LLIC 4B9KC 1LQBC 3ZRCC 4BKTC 3ZUNC 4W9LC 3ZRFC 4W9EC 1LM8V 1VCBC 4W9FC 4W9HC 4B95C
chains in the Genus database with same CATH superfamily
3L2MA 3QYCA 3V4PL 1KJ3H 2C7UA 1H8SA 5T33L 3L9RA 2VMFA 2BSTB 2VC2H 4OIIL 1PLCA 2GABA 3FT9A 5MHSE 5HD8C 2AMGA 2PCYA 5D4QA 4PJIE 5E56A 3GBML 3U79A 1GZQB 3HMWH 5K39B 2F19H 2Q0ZX 4UV7H 2OL3H 2BP0B 3VDCA 3OLIA 4UQCA 1G6RH 1U21A 2YGNA 5E2WH 5IW3A 3IRPX 4N1HB 4B7IA 2XVGA 5I0WA 5F0MB 4L3EA 3BH9B 1HS6A 2TRYA 4L8SA 2LE9A 3GS4A 4LCWD 3VTAA 3RTQC 4KTYA 4EI5D 1B3JA 1SXZA 2WYIA 3FSVA 4JKLA 4L3AA 3CMOL 3R0MA 4U3XA 4EZJA 1MG3C 2A6JA 4HULB 4UTBA 4L0YA 1J1OH 1YUHA 3P9MB 4O9HH 4DP1X 4R5VA 3H9YA 1MW3A 2YPLA 2VDKB 1T66D 3ARUA 3QR0A 2QPDB 1WT5A 4LPXA 1RIVL 5B1CA 2HLEB 4X4YA 1BF5A 1G84A 1HHHA 3PWNA 4PJ6A 5CEXB 4JL1A 2BIPA 3ATFA 1NGXB 2NNAA 3S36X 1U95A 4PVNA 3FRPB 2WLKA 1RHHA 5FHBL 2F54D 1SDAB 3O2DA 1OQXA 3PABB 5E1AA 1TO4A 3GZOA 3WJLC 4NHCH 1UCBH 1DBKH 2GUYA 4YSQA 3DHPA 4N25A 2VWEE 4OM0L 2DYSB 4LO9A 3IE9A 2F2HA 3L9YA 5EFIA 1T1XB 3DC0A 2EIZB 2RH0A 2PR4H 1IAKB 1PG7W 3CHRA 5ABDE 5IMKA 3GMQA 4J2XA 1I8KA 4CSTA 3CLEH 1O6SA 4XP1H 4X9GA 1P53A 1V3KA 1HQRB 2O5XL 1ZIBA 3PHOB 4XI5D 1YDPB 4RQQB 1XCQB 3L95B 4FS0A 3N0AA 5HYEA 1F90H 1QSFB 4JDTH 3NA4A 3VE0A 2X2JA 2IMNA 3OZKA 5E9DB 4FYQA 4J8RB 4KO6A 3V4VH 2XTJB 3V95A 3P02A 4MNGB 4RZCB 2PXYC 1EHNA 3GEFA 4N8VB 5GSVB 1B2YA 3RWCB 3U46A 1A1OA 1N26A 1TTAA 1SVZA 2E7BA 2QSTA 4AIXA 1UXWA 1T1YB 2FTAA 1BQSA 4D2NA 3WMPA 4GAJH 3ARBB 4NI3A 5E6UB 1FSKB 3NK4A 1NPNA 4G9FB 3MKKA 5GJSH 1S9KC 4WTZG 2NY6D 1BM3H 4WI4A 2XA3A 2QQNH 2KH2B 1CXFA 4JCWA 1ILUA 1EFXA 3JT0A 4MVBC 3U6XA 4X8CA 4PS4H 2QGDA 3SOBH 4IBZA 3UJJL 4M4PA 3QDME 1NCDL 4TQEL 1F56A 2E7LC 1X4YA 4JFWA 1GGTA 4H8WH 3S5LB 4UQBA 4H0LC 3RJQB 5J12C 3TA3B 4QTHA 4X6DE 4Y5XA 3VI4E 3EOAB 4BUQA 3CVHL 1F4XH 5CILH 5BUPA 3EFDH 2B2XL 5G4NA 4FXGB 4NAQA 1WZKA 2YGQA 4LU5H 5HYJB 5D96B 4U6YB 1XGQA 2C5DC 2K9FB 3F85A 3JV6A 3L4WA 2YD2A 1UENA 2NQ3A 4L8DB 4F2FA 5L4IA 1A0QL 1T83C 1DUZB 1YMHB 4NERA 5CUSH 1MPAL 2H9GA 2VM3A 1BJ1J 3B3IA 3QZPA 4ANXA 5C0CE 5LG1A 1RULH 2YN3A 4YHML 1AG6A 2YXVA 3NZ8B 5KYUA 1UD4A 4HXAL 4R2GB 1Q72L 5A1AA 3KPQA 5F7DA 4F5CE 5ALCH 3VD2A 1OT4A 2PWFA 5TE7L 2HG0A 2DICA 1J5IA 3WAJA 5BW7C 1KCRH 3OG4B 2IQ9H 1JWMA 4KI5C 1DLHA 4XPGL 2AQ3A 3FH8A 2ZCLH 1F4AA 4S1RL 4HJ0C 4QT5A 5E8PA 4B6ZA 5ADOH 4I18B 4PJ7F 5FB8A 1DVFC 1P4BL 2XLLA 4AUJA 2R1YB 4G8EB 5BJTA 2ZUWA 4NB7A 1JRHH 4JFXB 5EF1A 2N0KA 3MRHA 2ZWZA 3HN3A 3LEVL 4N9OB 5C0BA 4FA8A 4WSKA 3RAJH 1OPGL 5DO2C 5D7IB 5KANI 3X14A 3O2VH 2BNUA 5EUOB 1CXHA 2YMOA 1LP9B 1WYJA 3VXUA 1CF8L 3WHXA 4EZLA 2IMMA 4HV8B 5FA4B 4CNIB 2F53A 4XWOD 5L8LB 1J5OL 3IMSA 4C4KO 5BRQA 1RUAL 4W4OA 5K69A 3V6ZA 1OE3A 3MMEA 2R0WH 3QISA 1P7QB 3FT3A 5KG9A 3A21A 4HWNA 5HHPA 4AW7A 3CLFH 1NMAH 1UM5H 2FT8A 4Q58C 1NLBL 1BAFH 4PTUB 2IVFC 1QABA 3S34H 1KN2L 1PY0A 5IVOA 5DYFA 3OQRA 4Q9QH 3C8HA 3IGLA 1HL5A 3PL6D 4JY4B 4XCNB 5TDNA 5DQDL 2BHFA 4J6RL 2BZCA 2JQZA 4YFLI 5I0ZA 3HB3C 3G08A 1BG9A 1QI3A 5FOBB 4OY9A 3EGXA 1KEGL 3JWNC 3MRKB 3QUGA 3NGBC 4CC4C 1RZ7H 3VFMB 3DO7A 2J6EH 2DF3A 3FFDA 2G2NA 1WF5A 3L3KB 4LLUB 3TPKA 5DEFB 4HDIB 4PBVC 4KNUA 3WIAA 3OVUB 3NIDB 4QLRA 4AQOA 5MEPB 2F8OA 4FDWA 4KK9D 4GP5B 1KCLA 3UG3A 4QRPB 4QHUA 3NJJA 4X6FB 4R9HA 3SE8L 2C4FT 3QH3B 1BP3B 4M1DH 3X2QB 1XMWA 5J11C 1BBJA 4YSDA 3WDJA 1UXSB 2CKBH 4ZMZA 4KJPD 1MCOL 4WUUB 1SOSA 1JK9B 4G7VL 3HVDA 5EEUA 3PWJA 4BSVA 1PIGA 4AJYV 2OKMA 1XGTB 3QZMA 2IPTL 1L5GB 2PLTA 1GZHA 1XF2A 4UIKL 1F4YL 4KROC 4PJAE 4PJBF 3GXNA 3SBWC 43CAA 5J57B 4K3JL 4YS4A 5AD0B 5IB2A 3AGVA 1OCWH 1G9NC 1MHHB 2AK1H 3E80A 3W11D 1AVAA 2LHAA 1D5BB 1RZ8A 5MENB 4GQQA 3UZQA 5MEOA 1OSZB 3B1TA 5AKRA 3NACH 4NQVB 2C3VA 4LLVA 2Z0BA 1QHQA 1GHFH 3D12B 4I1PA 4NENB 2AJYL 4PP1C 4WEUD 2O5YL 4WI6A 4Z8FH 4WHTA 1O9WA 1Q38A 5EZPA 3VWKC 1HDMA 1X5AA 1NEPA 5JUEH 1GH7A 3D0VB 2BIIA 1ACCA 4QAMB 4X7FC 3FOLA 4V1DE 1XV8A 1YMMD 4ODBD 1OP3H 1J5CA 3S35L 4PJGB 1T2JA 1BX2B 5CINH 3CDFA 3U0WL 2HFEB 1GCFA 4JQIL 1A7BA 1SEBA 1B3IA 2G4EA 2J1KA 2X2YA 4HIPA 1SHXA 3MU3A 4G59C 1TENA 3C87A 1NBCA 1R3KA 3DSFH 3D3VD 1MF2L 4F37F 3DX6B 3S3PA 2XN0A 5D2NA 3ECBB 4Y89A 2QHRH 5IJVB 3MV7A 5FKPA 1G7IB 1P4IH 4L8SC 3L2LA 4FN0A 4Z3TA 2NY0D 1AQKH 4HXBH 5I76A 3L4YA 4GSQA 2AXGB 3KNBB 1XCWA 3QZOA 3LKRB 3UL4A 2AJ3B 2UX7A 2J5LB 1JCKA 1XR8B 5CEYB 2JKJA 3PXLA 4NCDA 2J3SA 2IV8A 4P2OC 1GGIH 1WT5C 4PJCA 3NCJL 2YO3A 1VKXB 2NYYD 3TEYA 1HKLL 3EJZC 3VFTB 5IFHL 1HWHB 1E2WA 1CL7I 1KACB 3KEHA 1CYGA 4JVUA 4PGBA 3NIGB 3UH8A 2Y7LA 4KI5F 3MFFA 4L1TA 5TGBB 1ZVNA 4CBZA 4WQOA 4R97B 5GIRA 3N44F 5J3HC 4QRRB 1XWVA 3MV8D 5HDBE 5HJDA 4X2UA 3BP5A 3IPFA 4ZTOH 3JXAA 3FKUS 4QRUA 5FDWA 5GRVL 3MJ9H 4PLJC 3C6LA 4KV5F 5ISZB 5B7EA 3SDCB 1I8AA 1GXEA 4DO4A 2D2CC 3WFZA 2OJEB 3QRLA 1VAHA 3A24A 1MRCL 5KVMC 3MBXL 4P2YA 1A9BB 1TYJA 3RNQB 3QYMA 3PAUA 4XBEL 1M9WA 3DX7A 1H5BA 2VSMB 4URKA 2NY5H 1ZD6A 2G2RA 5J6SA 2ZWNA 4JGHA 1GC1L 3CC5B 3MJ7A 5CHNA 3SDYL 5B3JF 3KPTA 3CIAA 4KXAA 2FWOB 1DHKA 3LX9A 3EHBC 2CLRB 3IGAA 2WVVA 4YDMA 3FO1A 2OYMA 4DW2H 4M5YH 3GO1L 4BUGA 1VB9A 1LYQA 1NCNA 4YK4C 1A3LH 5FOJA 2X4SB 2FQFA 4PGDB 4ZNEE 1WGOA 3CFEB 1GMIA 3LYRA 3FF8A 3JV0A 3SDAD 5C71A 5EU3B 3FQUB 5GRJH 1IGFH 2FWUA 4S0SD 1MXGA 2H2PC 5D1ZI 4NO3A 4W9JC 3C60D 1TQSA 4CADA 4HFUH 4KX9A 5I1IH 2CMRH 2CU9A 2IBZY 4KVNH 4JG1H 3ZKSD 2CO6B 3UAJD 1G7LB 3K1DA 5EIVA 1RZGB 4OR1A 1CPUA 3T77B 5ICZB 3HJ0A 4HCIA 4Y5XC 3HFML 2V8LA 1K9TA 2OI9B 2QR0B 3U2SA 3NUKA 5D72H 3CHSA 5CZVL 2Q3AA 5FW8A 5DJ2B 3QWOB 2VE6A 2VZOA 4NQEE 4UV4H 3NIFB 2VDLH 3D9AL 4YZFE 4ZUWA 3MN8A 4UT7L 4LSUH 4WRLA 2VSCA 2J56A 1EDHA 3IB4A 4QRTB 5IR1A 3B7YA 1J0YA 3FPYA 4X5WB 2JCCF 3QFJD 1KIRA 3T08A 1E5YA 3HC2A 1CC3A 4DGVH 3FO9A 1OW0A 1OCRB 2OXGA 1SEQH 3Q1EA 1UWEL 1FLTX 2HCZX 3UJIL 2ZX5A 4N85A 4F7MB 3CD4A 3PJSA 3VJ6A 3IRZA 3KPOA 4EO5A 4JFOA 2IDTA 1JPTH 4YSUA 2K9UA 5IG7B 2LR4A 5IQ9B 4IOSA 4WU5B 2NY4D 4XGZA 5DFTA 4UM8B 3QUYD 4MZ3A 5JPMB 4KMTL 1WZ1H 2E47A 3Q9QA 4OIBA 3G6JB 3MA9H 3QJZA 3O11B 1AR1D 3IDGA 4UB0L 4NPYA 2Y7QA 3P54A 1KG0A 1SF3A 4BE6A 2XI9A 2X12A 1K5WA 2Z4QB 4LMQE 1TQCC 1F8TH 3GGWA 3KH3A 1X5LA 3LHPH 4I2XE 1A7QH 2IQAB 3EAKA 4KKAD 4MNQD 2EE6A 1F2QA 4DZ8A 1JPST 1DO6A 4JGUA 2ZIDA 5FGSA 1I7ZB 2EKSA 4A6YA 2VIRA 5CLTA 1QLEH 3ARVA 4WHYG 3VH8G 3WD5H 1UKSA 2P42B 1MN4A 4ZODA 5E2TH 1KJ2B 2D0FA 4HCRA 3TEXA 5I6KA 2Y5EA 4YBHA 3PDDA 5IMMA 3I74A 5DI8B 5IB5A 2VR9A 4A7SA 3ESPA 2ED6A 4W4OC 3FUNA 1SLUA 4DGYH 2HFGL 1IC7H 4ZD3L 5DUBB 1C7SA 5B4MD 1PIFA 2VLLB 2FR4A 2DWEA 3CE1A 4HMDA 5T3XL 2GBTA 4AV5A 1IIIA 3K46A 4H25B 1KXTA 4BFGA 3LZPA 5B21A 3RDTD 3AT9A 4YNYB 2OYLA 2YSSA 2YAEA 1E5BA 1UACH 1JXGA 3BXNA 4KTEH 1FE8L 1MVFA 3RWFA 2J6EA 3IFNH 4JO4H 4MQTB 4YAQA 5JW4Q 4HH9B 2HJFB 3DUSA 1A7NH 4FP8H 4KNTA 3TNNA 1MJJB 2R9HC 3MLYH 2A7BA 1LO0H 1TKWB 2GJ6D 3BPOB 1UH4A 1NGQL 4DOHB 1VFMA 2VR5A 2E46A 3MGTA 4IW4C 3LV3B 3QRGH 5JO5B 4DHLA 4HVBA 3QA3A 1FV1B 4X0NA 4BK8A 3CFBB 4Z3IA 4E36A 1U8PB 4NXSA 4UQ2B 4Y4HD 3IMUA 2YD7A 1I9JL 1N7ML 1CTMA 1U8KB 5D1QD 2ZAIA 2DI7A 1NMBH 2KLSA 5ESQB 4YHYB 2IPUG 5E7BA 1NGZA 3DX0A 3FU6A 2DL2A 5DMGC 4FRWA 3T0EA 4HLJA 3CPUA 3SE6A 5KVFH 4ZPVB 1S8DB 3HZMB 3B5HA 4BA8A 3US9A 3VFVA 1F5WA 2MCPH 4RH4A 5T3ZL 3MO1A 1GZHC 1JFQL 1MFCL 5J13C 2BFGA 2GITA 2PF6A 1JXJA 2PW2A 3L3DA 3N42B 4Z7VE 1IX2A 1VEMA 3MLZH 2EYRA 4Y0GA 2CJ3A 5IJKA 2VKXA 4OF7A 4P5TA 3AADB 3CNKA 3D34A 4E68A 3D69A 1W8OA 2ED9A 2JELL 4MCZB 1MI5A 4ZK8A 4NAMA 4NO5B 5CCHE 1OP5H 2CALA 4JKKA 5HDLA 1KCUL 4UAOB 1F18A 4GQPH 3UAFA 1TZIA 2YWZA 4P3CL 1UYWL 2Z93A 2HB0A 3SOTA 4DP9X 5E4AA 1T80A 2OCFD 2XQYG 3MLTA 1A1NA 2MMXA 2O5ZH 4EKJA 1CL7H 3V79C 2YMXL 5GGTH 1INEL 4RRPM 1CGTA 4WJG3 3MJ8A 1VFAB 4XN4A 3IRCA 1FNEA 3LCYA 4RX4A 5KUKA 2AXFA 3F7VB 4G2AA 1IAOA 4RZKA 4LCIH 2MEJB 2VLKB 4AYFB 1YRKA 1IGYB 4JS7A 5I66B 1EEYB 1GA2A 1XGYL 4HX1A 4ZUUB 5B7MA 3OZ9L 5L9DH 5I17B 5D2NC 1Q90A 1JGVH 3IDNA 2GUOA 1F42A 4RNRA 2EXYD 5D6DA 1ZLWH 4MX7B 2VITB 3A4FA 4X8GA 2R8SH 4Y2LA 4BKSC 2KZKA 4PRHD 3RU8H 4K5NA 1YYMH 3RHWF 1TEGA 5D93C 1WQVT 3SPHA 4F24A 2C3HA 1W0YT 3ELQA 3OX8B 4R3SA 2OSWA 3NP3A 2Y9RT 2AV1A 2N7SA 5HPMB 5TF0A 3RL2B 1L0XA 2JIXA 4IM8A 5EOQH 4ZW7A 2JSFA 1H6FA 4JFDB 3FRUB 1NA8A 1IQWH 3C09B 2R2HA 4APQB 2WC7A 2ESVD 2CUHA 3IJYB 4QF1B 4RIRA 1EAJA 3O6LH 3S3DB 1YN7A 3BCFA 5DWPA 2YR3A 3MLUH 3MREB 5EU7E 2MIZA 5SX5H 5DEGA 2ITDA 3C6LC 3GPEA 1M2OA 1KF9B 3K6NA 3RKDD 5CKAA 2EH8H 5L4MA 3VXSA 1KBKA 2ADGA 1E90A 4AG4L 1IC5H 4OF3A 5CGTA 4BFJA 1C5DB 5TJWK 4OIAA 4X8XA 3FQWB 2XETA 3B9EA 2AGJL 1H5BC 4IOFD 4MZ2A 4O51B 4YBQC 3QEGL 3QJTB 5LBSL 2DQMA 1UURA 3DV4B 5IUCA 4DKFL 1CFSB 1SOKA 4XO8A 5DFWH 3OGCB 4BZ1L 3KVPA 1ICTA 3EO1A 3ZIYA 2WLIA 2MNWA 1EZLA 3PWPD 1CQKA 1OB1A 5I6PA 4F33A 3OR6A 5CFHA 1JYXA 4PG2A 5DR5H 1LD9A 2HRPL 2Y22A 1NUFA 2CGYA 2FZ3B 1EHLH 3UTTA 1TZAA 2BHZA 2NW2A 4ISVB 5DJDA 3BYTA 2Q8BL 4IU3B 2M83A 2WQSA 3OD3A 2H47C 3M7FB 4KDTA 5HVHB 3SHSA 3DNKA 3QUZD 2J5WA 1UWGL 3HR5B 4LSVH 1Q9WB 3LH2L 4PGCA 1I7TB 3B83A 1HKFA 3BVTA 3O9WA 1OAXH 1D9KD 4G9DA 1GGBL 3AU1B 1T1ZA 3PQYB 3TO4A 5J06A 2Q6WB 5FKAB 4NPKA 5H8DA 4EDXA 2RHEA 1WSST 5C9JB 2WNKA 4YGVA 2ATPB 1CD8A 2NCMA 5AAPA 4FTVD 3B5TA 3K0YA 3IMRA 3L08A 1NIDA 4HIEB 1QFOA 2UYLA 4C47A 4UQ3B 5F1KC 3E0GA 2Y6SC 5I0XA 2BOCA 5GRUL 4Y4KB 5IQ7H 2ZNXA 3C9NB 2VLJE 4FOMA 5AZEH 3BZEA 4QOKE 4KFMA 5I1KL 3ZZ1A 3M1CA 1OW0C 5EN3A 4F7KA 4DN3H 3TJEL 3D18B 1MCJA 4BFKA 2UZYA 2O6DA 1BGXL 2QQQA 3BPNB 1KY7A 5DWUL 1H3PH 4MXQD 1MW2A 4ZDHB 3EF4A 4KK6D 2A83B 3FUEA 1ONQA 2R69A 2E75C 5F6HJ 2X4TA 1TJHH 3LZQA 4U1NA 3LEYL 4JR9H 1CIUA 3HE6A 4LXFA 4XWGH 1IC4L 2XIBA 4OFYA 3UG4A 2NR6A 3BSHA 1ETA1 2Y2WA 3H9SB 3ML9A 4BHUI 5C8JB 5CD3A 4Q0XH 4TV3A 5I15H 1IGMH 1WFIA 4UNIA 1BJ1H 1S3KH 3NSJA 5KJ7E 4YO0A 5HGDB 1EHXA 2DWDB 2DMGA 3ZKMC 2ODIA 2BP3A 2D3NA 3ALXA 4NBXB 1RUKL 2OMXB 4LHUG 1TPXB 5F0PB 4N24A 3P0VH 3F7PC 3I2CL 2HLAA 3BEWA 1XF1A 2YAHA 3GSOB 3QIWA 4Z7UB 4JVPA 4UU9B 3VTMA 5D7KD 3GMLA 2SEBB 3T3ME 1IQDB 1B0IA 1OE1A 2DQJL 1FVCA 4KKPA 1RL1A 3THMH 1YJDL 3HI1A 3OXRB 4N90D 3IETB 1IEAB 2RCSH 1BMGA 4LRNH 4LDOB 4KMQA 1CGXA 4PV9A 2DQFB 5EU6B 4IRSB 3MLSL 2CLVA 4PR5A 3V5DA 3HC3L 3M1BB 2BRRL 1CICA 1SN0A 2P5WD 3BKCH 1Z0MA 5IVZB 5E08L 4E9QA 4KH9A 2CE6A 2OMBA 2I69A 4WTZA 1AFVH 2YBGA 1A1MB 2AANA 2WQWA 4PJCF 5IB1B 3IM1A 5MERB 2M1KA 1QW8A 5IT2L 3BJLA 4UUJB 3ZKXB 3H3BC 1NEZB 4WU7B 3DVFA 3IFPB 1A7RL 3T6WA 4DAGH 5BMFH 2I9LA 3TVMB 2OTWA 3IU3B 4E9XA 5FV2A 2KQMA 5KN5A 2X4UB 1J5DA 1NFDB 2ENPA 2Y4SA 2Y1YA 4Y5VA 4AL8C 1J12A 4M93B 5JPNB 1FZOB 4OBRA 3BVUA 4WY7L 5IESL 3WUWB 4MMXA 4XPTH 2Q7NA 3JBG7 1FZKA 4JFYA 5CU9A 1SJHB 1U41A 1UB5A 3Q2LA 4YPGB 5BZDB 1AO7D 2Y1AA 4BA0A 1Y0LB 1RY7B 3T0EC 5LG6A 1FLRH 4RA3A 3CLWA 1XIWB 4N8CL 3QI9D 1Z9MA 4KNSA 3FRPG 2DMBA 4XMWA 1N0LA 1OTTC 2RGSA 2VB5A 3WN5B 3MLWL 5JIQA 2MJWA 3TOPA 1Y6MR 3BKML 4FXTA 1HHKB 3OKOB 4Q4IA 3RUGE 5LJYH 4MA3A 4Q9RL 1BA9A 4B9IA 4AH2A 5IJKC 2UXVA 3FFCD 2FNWA 1TVBB 1ZLUK 1G4MA 4JGJA 2FSEB 3GMNA 1ZV9A 5JHLA 1O5PA 3QR2A 1FNSH 2VDMB 1IB5A 3VFWA 4OFVA 4W9GC 3HMXH 2X87A 3QG7L 2YKKA 3MODL 5C6TL 4L8BB 3P4OB 3GSXB 4WWID 4AXWB 5IB4B 3LJ3A 1CTNA 2XN9D 4WTXA 1HILA 2EXWC 4IRZH 3GSUB 2ZOWA 1OGTB 1DSYA 1VZHA 2D73A 3GXTA 5HJ3B 3ME0A 3HPLA 4PCYA 3ARZA 1IM3B 2G5BA 3CVBA 3QGVA 4GH7B 2WPGA 2GJZB 2O61B 3BESR 2P8PA 5EOTA 4WHYH 3ZJAA 3IMTA 4LK4A 1NUGA 1ORQA 4MDIB 4BFIA 1BOGB 2WO2B 4D9LL 2DQCH 1RZJL 4G6FB 4M9OA 4Q9CA 3PV6A 3US1A 4H13C 1YG9A 1PYWB 1QSED 4KK8D 4Y19B 2E7DA 3O45A 2OYPA 4PGZA 4U7MA 5D6DC 3S5LG 4KZDL 4XNZC 1Z2KA 3FQYA 2D3VA 3GMPA 3IFLH 4F7CA 1G7MA 2J1WA 1PDKB 3BZDA 5AZ2L 3B6SA 3EJSA 5GZNA 3S8FB 3PJLA 4O2EB 5GGVH 3U0TA 2WWOA 5DMJB 3KGSA 1THCA 1S7UB 3V7AG 1KWGA 5GPRA 4TTDD 2XWTA 3U4BH 4PRIE 4X8JA 5KS9A 5D1ZA 5AVQB 4KRPC 3D25B 1G7QB 3IPBA 2NQDA 2HKHL 3BZ4B 1A4CA 4JM2D 2I7OA 1TZHB 1FQ9C 3D3VE 3M45A 4FI6A 1RJZB 3VQ2C 3BT0A 1ESOA 3DHJA 4YC2C 3BHBB 2VR8A 1M6UA 5D8JL 1I8UA 2JJSA 5TE6H 1MNUL 4XNUL 2DYPD 5FWQA 2H3KA 3ISYA 2K0RA 2NY5C 1I75A 3QFDB 4TF4A 4DPRA 4OCWH 3HFFA 1AGBA 1XH1A 6FABL 4JFEA 1N67A 5KVEE 1XF5A 3DTXA 3WG7B 4R90H 5T5FH 3CCHB 4UT6H 2FBOJ 3BN9C 3AVEA 3LNEA 4H0HB 4PWEA 3I3EA 3RNKA 4AMXA 4LSRH 5DD0L 5FYLH 4OKVB 1JPFA 3HPJA 4H26A 4X98B 2XQBL 1MRDL 3OSVA 4EBQH 2KPNA 3HE7A 4B9ZA 2VERA 2RMNA 3AT0A 2NW3B 1HC1A 3WL9A 2H1PH 1JGDB 5ETUA 2W0FB 3S88L 5T5NG 3DOSA 3ILPB 3RVWC 1MQKH 4PG2C 1DQIA 5D1XA 1PZ2A 1NKRA 5IQNA 5EEWA 4TUUA 4MJIE 3QDGB 2EEAA 4M56A 5F44A 4Y88A 5A2JH 4HJJL 2AAVA 4WJ5B 7FABH 4WZ9A 5LQBL 1CDBA 3LQMA 2IJ0C 4N0FA 5EDSA 4J12A 3MTRA 4M61B 2CO3A 4GKZA 3PDOA 3IVKA 3DBXA 2CIKB 4KDWA 1T20A 5EOCJ 3O9WC 2DEYX 4IEFB 4TNWK 4UQ9A 3TO4C 2AITA 1ACYL 3T0WA 3PREA 3GMRA 1LGVA 1KC5L 1YPZE 4HKZA 4BJLA 4X4ME 2VN3A 3X12B 1AS6A 1GIGH 4P2OD 3CK0L 1HQ4A 3CMGA 4GQRA 3ULUD 3NCFB 3N91A 4QGYA 2J55A 2ORBH 3NDYE 2NZ1A 2FIKA 1HH6B 4OZFB 2ZUUA 5A3ID 4K71B 2YPVL 3PPEA 3P2BA 1FYTB 4OFQA 2JXMA 4P4KD 4PHZA 4YSPA 4E42B 1JZ5A 4GUOA 4JNXA 4M3HA 2BSSB 3AGWA 2ZX8A 1URZA 1EHAA 3D4GA 4HS6A 2AQSA 3QUHA 2UY7A 1J8HE 3EYFB 5ID1A 3WIIH 5FYLD 4OZHE 3U1SL 5DRWA 2KS0A 2ZX6A 4LEXH 1ET7A 2HVKB 5TQ0H 1JPSH 3RFRA 1MFAH 1E6JL 3CZFA 1KLUB 4GP8B 3T8XA 4PRBA 2OYKA 1H8NA 3ESMA 4JZNB 4MJ5B 4X6BA 4XNXL 5I73C 1WG3A 1MHPL 2NX5A 3HE6C 1DCLA 3LPOA 5DD1H 5EORL 2ZF8A 1W6WA 2ZXWB 3S36L 4ABQA 3W1ZA 2NR6C 5DJ0A 1P5UB 3FU8A 4G3YL 3QHTC 4ORZC 4PY7A 2VRAA 1FFOA 1ZLEA 2DV6A 5EZJA 3BAIA 1J05A 2YHGA 4HUMB 4D9RD 2ZUSA 4ADJA 4ELKA 4Z7WE 3T0BA 2KLRA 2ZX7A 1CU4H 1G7PA 4JAMB 2BXZA 4CVZA 3OJDA 3LXUX 2FL5B 1H3XA 1MJ7L 4YHOH 4U1GB 5T1KD 1U58B 2P7TA 4HK3N 3T6VA 3DX4A 4NDMA 1P4UA 1CMOA 4TN9A 5K1NA 5DLML 3O6ML 1E67A 4B96A 3S98A 5DQJA 2W0LA 4ONHB 5C0FA 3QIWC 1UT9A 3ZOAA 3L4ZA 4NUGL 4K7PL 4BFNA 3DKHA 4WDIA 2CKNA 3I50L 4ATTA 5JXAL 3L6FB 1ROCA 4X6EA 4GRLB 3WY4A 3ATBA 5JW4M 2GI7A 2JKXA 1JZFA 1N5YL 1CQYA 4MQSB 2MCG1 2XA8L 4GW4A 2Z8RA 3SKMB 2AERT 1BAGA 1QYGH 1SMDA 5FUOL 3G04A 4A37A 3IJEB 4Z77B 4MQXC 2PW1B 2Y06H 3UYOD 1ULVA 1CICC 3LVTA 1BD2B 1ET5A 4L4VA 4MNQE 4TSCH 1ASQA 4LSSH 4KNQA 1KSRA 1X5YA 4XP6H 1N0XH 1E65A 1MIEL 4LKXB 3ZE0E 1V7NH 1T22B 1W72B 3B8SA 2PTTB 5EZIH 1ES0B 4XNYL 5F6HI 1N9PA 3GRWA 3TLRA 5GSRB 2W9DH 1ZEAH 2H0JA 3L3GA 4HA1A 3P3SA 3OPZL 2F1EA 2UXGA 1AHMA 3C08H 4Y5VC 3S2CA 3ZNGA 3WKQA 4HIXL 2ZKWA 2Q2EB 3L9BA 2WCSA 3ETBF 2LQRA 4NX0A 5C7XH 3HNTH 3P73A 4MMXC 5SWSB 4HIHA 4KH2A 3MQIA 4FNPA 3CFQA 1BBDL 2OX5A 1MFVA 2ADYA 4XNBA 3EJUA 1RJYA 4RETB 1OAYH 2EEXA 4FG6D 2YK1H 3BP6A 3ZDZB 1BXVA 5JORB 5HHQB 4E2OA 2AQNA 4L2YA 3V4LA 3BVNB 2HT2D 2XG4B 1CG9B 3GKWH 4ZPTA 1P1ZB 1RP8A 5JMOC 4HHWA 5CS7A 4MD4B 4DCQB 2X5PA 5LO7A 1AJ7H 3SKOB 3SQOH 3ULAB 3KM2A 4WO0A 4QRSA 1DBML 1YEGL 3DTDA 3T0AA 4POZC 5ES4B 1F00I 1IAII 2V9RA 1KLFB 2H0PA 1YO4A 3HI6H 3MXVL 3VFNB 4MA7L 5E5MB 5GS1A 5D1QE 4BKTC 4M48L 5C08D 3WIHL 3SDDB 3KLAB 1TETH 2VGLM 1NBVH 1GZPB 1Y18B 2CR3A 4XE5B 5F3BB 2BP8A 4G6MH 1WAAE 2W88A 2QQLH 1SBBA 3GZKA 2DKSA 3VXNB 1JDCA 2QJDA 4XXDB 4ZMQA 2PCFB 4TOYH 3ARWA 5AW2B 1MLCB 3B9AA 4XCEA 4WCYL 4NN7B 2GAZB 3GS0A 4A2FA 4RGNC 1NCAH 4IU2A 3HG3A 5E24E 5GGSY 3C6EA 1KXQA 2MSPA 4H88L 3T8VA 3GTTA 1P6AB 2ITEA 2DQTL 1C5BL 3GBDA 3MACH 4E41A 1SLWA 1X3DA 5IUSA 1V10A 4YHNA 2YAOA 2E9IA 4IDJL 2COQA 3NJHA 4XBGA 3QUXA 4XRCB 1ZT7A 1CE6B 3ZDXE 2A9MH 3QZNA 3KE0A 4F27A 4X9BA 3AABA 3RJDA 1JZ4A 1KWKA 5HHME 3CC1A 3FSAA 1OANA 2FX8L 4XMVA 3RVVD 5GZNC 3JWOC 1ECYA 3QHZL 2WWKO 2N7AA 2WXLA 5DC9B 5J6HB 5IROD 3R7RA 3FAWA 4HUWA 1IKNA 5J1TC 4L4TA 3WFCL 1VEPA 1DN0A 1IBGH 2Z6FA 3TJHC 5JLZA 4HKXB 4QHLB 1U6AL 5D1ZC 4NKMA 4FFWD 2LVEA 3UAEA 2NYZA 3QCVH 5ALBL 2GCYB 5I1DA 2P5ED 5ANMB 4L1HA 2VRKA 5F1IB 3O3EB 3MGOB 4LVNB 1JWSB 3OAZK 1DVXA 4YFLF 3AG2B 3KBPA 4AV4A 4N26A 2AK4B 4YE4L 4OD1H 2JJSC 2IANB 4JDZB 4ZTEA 1AI1L 5D7HA 2Y23A 3HAEB 5L0QC 2FEEI 4N2KA 4KDVA 4JCLA 5H2BA 3HEIB 1E9QB 2YQ2A 4BZ2H 4FQCH 1GYUA 5DK2B 5K9JH 4UINL 1LM8V 4ZTPL 4FZEL 2E9GA 4LHUD 2VDKH 2VKWA 3L81A 4MAYB 5AW5B 2IF7A 5JW3L 3SPVB 1FFQA 3HE7C 4K9EH 3S37H 3UZEA 4S0HA 2EE0A 3VXTA 3HNSL 5C0JB 5KAQG 1Z32X 3S2AA 1E8XA 3VMPA 5I0YA 3T6QC 3A6CH 3LKOA 3BWZA 4P59H 5D1XC 3VXRA 4K8RC 4TUOA 5T8IA 3MOBH 4FNLH 5F1NA 3BH8A 3CDZA 3OMIB 3DIFB 4CVUA 4HS3A 5CWSA 5DVOA 2YGOA 3RZCB 2H7WA 1IT9H 4PJ7E 5IJCC 3CVIH 1W91A 4UMGA 3H7BA 3UABA 4NS0A 4GFXA 4C56E 1EGJH 2F68X 4DN4L 3DMMD 3QDJD 4CVXB 2XQYA 2YIHA 2Y07H 3ORJA 4LHJB 1UOLA 4MMZB 4PJFE 4GINA 2FYYA 4ONGL 2VXQA 3KXFD 1CFQA 4MB4A 2AXHA 3F7YB 1T0NA 1FORL 4LSPH 2HZHA 1BJMA 3PWPE 5KYNA 4AK1A 2UUDK 2X0VA 4I0PA 3SO5A 1GYVA 1RJLB 4X0KA 2P80A 4ABVA 5KYXA 4Z76B 2ENSA 3MFGB 2XWBA 4G6AD 3EJCA 4HT1L 3D39B 5GXBB 2I9TA 3BP7B 4X80L 2AEPH 2ZCKH 5IEHA 4GXVH 4NT6A 5DO8A 3MJ6A 3VI3E 1H3GA 5J9PA 1YY8B 1FFNA 3WTSA 4CSPA 2ZOKB 4HMCA 4BDVB 4KQ4L 4XAKD 4XMXA 1ZA3B 1MOEA 5GGSA 2OTPA 1ZHKA 2BNQD 3B9KD 4FTVE 5DTFA 4YDVB 5GGUA 2BWQA 4JFFB 2HTKC 5B22A 4Z78A 5I1JL 5BRZD 1TQWA 3QAZB 1UZ6F 3WFBH 5FYJE 2X4PA 2B4CH 4XHJC 2HT4D 1X9RA 5F9OH 2ARWA 2J2ZA 3LRGA 1ZLSL 2R29A 5AVZB 3V52H 2A9CA 3S4SA 4PJ5D 2XG5A 5C3IA 2VYRE 1F58L 1QI4A 4FXLA 3RWHB 2HVJB 4J6IA 5JR1H 1FG9C 3VAEA 1T4KA 5IV2A 1I1YA 2VLRD 2XWCA 4P05A 4TSAH 3DRTB 2X42A 4PJAB 4PRDB 2QHLA 4M7JL 1MFUA 3QJHA 4AGLA 1A7PH 5L88L 1TCRB 2Y3AA 2AEQH 4OV5A 2BC4B 1N12A 2BW5A 4P5RA 1GMEA 1JV2A 1KIPA 3RA7H 3L13A 5DFAA 2F5BH 2ITCA 5A7BA 1E9PB 1FVEB 1PZBA 4QUOA 1Y6KR 3ZTNH 5I24A 1A6WL 1KFAH 2CGRL 4QYAA 1WFJA 1AGCB 5ABZA 1K4CB 1DQQB 1G0DA 4O2FA 3SKNA 4Z0BL 2DQGL 4NC2B 5G5DA 1BVLB 2BNRB 3V0WH 4V1DB 3L4UA 4HETA 3UZVA 4W9FC 4LLYB 3DXAD 4WFFD 4D7BA 1TG8A 2NLJB 1GYCA 3BD5A 5TFSL 4R8WL 1AKJB 3D0LA 5KS9F 3FTYA 3WJMA 3KCWA 1E4HA 4L5FH 1MWAL 2OMWA 4AITA 3VDBA 1INQA 2WQUA 4MHHG 4AOFA 1BJ8A 4Z5RB 5D7KE 1I9IL 2WUBH 2OR7A 1JXFA 4PI2A 4PJEE 5HVFB 2DWXA 2Z8VC 5CJQL 2VISA 3VXME 5T1DH 4GAGL 3UTSE 1KTKE 1J87A 3TV3H 2JTDA 4XMKL 1SJEA 3G5XB 5I5MA 4Y5YA 5T1LD 4GBXD 5FECA 5JW5B 1E28A 3Q44A 3T2NH 1T5XA 4N5EC 4J3VA 1QLFB 2P5WE 1P0SE 4HD5A 2HFTA 3SIKA 3FQ2A 5K9KB 1YEEL 2I07B 5IFJA 4NZ8A 5J4MA 4OLXL 3WSQL 1Q1JH 1A14H 5LWYL 3TURA 1W15A 1JN6A 3A4AA 1L6PA 4Q8BA 4W81A 2EAEA 4RBPK 4L1DA 1MW1A 4Y2DA 1C8PA 2PYEA 2J8OA 4I9WE 1B9KA 5DEJA 1AQMA 3GXUB 4EQ3A 5I75C 1RP9A 1OAQH 2P5PA 2XRAL 3KYOA 3NVQA 4RMVA 5IHUL 2QQKL 5FX3A 3X1BA 4N2DA 4JFSA 4KQ3L 1HZKA 2R4RH 3OKNA 3OAUL 4P2RA 3D2UD 1N3NA 4MAUL 2GK0A 4NQDA 5GS1C 4B5EA 4EN3B 1I8MA 1N6UA 2IDSA 1R3JB 4JRYB 3VFPB 3SBPA 4UQAA 2ODHA 1I3VA 4FNSA 4YXLL 4ZMPA 5ITBH 4KV5E 1KYDA 2B59A 1KXHA 4DK5A 3GFUA 1FVDA 1KTBA 5CCKL 4U3HA 2IH9A 3WXWL 4XMPH 2BP5M 3T4AA 1I1FA 3PGCB 2CDEA 4OB5L 5CGYD 4JPKL 4NCC2 1DVTA 1U42A 1UB6B 1RIUH 2R2BB 3B43A 4U6XA 5F89A 4BFBD 5GJTH 1UUNA 2GSIA 4RFEB 1ZVSA 3LVEA 2AABL 4WNQB 3VXOA 5JQHC 3BZFA 2RFXB 1E3XA 1LHZA 2DEWX 1JI2A 3MR9A 4ECNA 2D4FA 3QUXC 1FH5L 4HGMA 5DMKA 5JIIA 4JN1L 5HSFA 2EDKA 5I8CA 1BEYH 2ZYIA 4PUBL 2WKOA 2E0PA 4Z7OB 4U6HA 5E8OB 3EH2A 5EH1A 3L5XH 4GMTH 2BSTA 2HWZH 4Y9EA 2XN9E 2WW8A 1G94A 3N85L 4WGKA 4HISA 1IKNC 2XBDA 1EK3A 3SB3A 1GZQA 2FAUA 2QVKA 1C12B 3KPSD 2BIQA 1KJVB 4LPTA 5K39A 4F3FB 1M1XB 3P9LB 4LGSB 1DEEB 3H8NA 4OJEH 2CAKA 1KEMH 3JWNE 1J1XH 3BQUB 3BH9A 1IFRA 1PQZA 1DDTA 4I77L 2DY2A 4KKBC 4XP9H 4N2HA 4E9VA 4QXGL 4PSRA 1OM9A 4R26L 5EA0L 2LABA 3BZ5A 3EYQD 3TN0B 3GIVB 1BQHB 4DP2X 1CDUA 1JHTB 2UXFA 4UQEA 4UWQB 5I2IB 3P9MA 5I74B 5CSZB 1T1WB 2FSDA 1CK0L 1EANA 4AZUA 3MRDB 4RMWA 4R96B 5CEXA 4PRPB 3QXWA 1MAJA 1NGXA 1FHNA 1UGNA 3LQZB 2BJML 2YN5A 2AJXH 3FRPA 4P23D 4YHZH 4ZUTB 1OD7A 1QBLH 4ZSOA 3MNMA 3PABA 4M6OL 3UZEC 1BFVH 2O5NA 5KTEL 4NO0B 2JB6B 1U8QB 1T1XA 2WB7A 4OD3L 2EIZA 5SWZD 1LILA 1NL0L 3EKCA 3AMKA 2VH5L 5FA3A 5HHVL 1BVNP 3B2PA 4HPYL 4B27A 4GRWE 5FYKH 1RXLA 3WEMA 4HEPA 3ZE2E 4MHHI 1HQRA 4N0CD 1QFUH 3PHOA 1YDPA 4NIYE 1XCQA 3L95A 4RQQA 2H41A 4UM9B 4HGWB 1QSFA 2WV3A 4FQIH 3CBRA 1KELH 3MRMB 4JHVA 5E9DA 4J8RA 1I9RL 4M6MH 5ILTH 4WSJA 5IVNA 5AOZA 3KVQA 3WEXB 1TITA 4JRXD 1KMGA 2MQ3A 4RZCA 5GSVA 3RY6A 4N8VA 5JNYB 2VR7A 5LCVL 3RWCA 2Q7YB 1MCIA 4CDGC 3KW8A 3JT2A 4NRZB 4I0PC 3CN0A 1T1YA 3Q5OA 3P3TA 3AWEA 4APXB 1UXWB 3ARBA 3IGUA 4G9FA 1DQVA 3HG1D 4HUUB 1VDGA 5EOCH 2FEDD 5HDQH 3F04A 3PNWB 8PAZA 4ONFH 1MCWW 4ZX4A 4AEIH 3RVUD 3O2WL 1FH2A 3S5LA 3F62A 5KVGL 4NNPL 3F7KA 3SO3B 3E7JA 4YHLH 3EOAA 1WH0A 3LZNA 3SYPA 1G9NL 1SLVA 1IILE 4FXGA 2WKGA 5HYJA 3DJ9A 3KGRA 4W4NA 3ULUE 3HA0A 1HXMB 4U6YA 3NSFA 2VO5A 4OLYH 5FYKD 1OSPL 1XGQB 5DT1H 3AJ7A 4L8DA 2JLLA 2BDNH 5KSVB 2XSKA 2V3FA 1I53A 1DUZA 4XZ4A 1YMHA 2GFBB 4G8GB 3ZRCC 5EEVA 2VLMD 1ZY9A 2H9GB 1JZ3A 4P0DA 3C8KB 4PW3A 1DVQA 4HBCL 3NZ8A 3NRQA 2YEQA 2OR8A 3J07A 1E27B 4NQQA 1OLLA 1INDL 4NQSB 4LAQH 4TSBH 4Z95L 1N8ZA 5D4HA 2R7EB 3GB7B 1TYEB 5KZCB 1WZMA 2NNRA 1O75A 5C0GB 5CEZH 2NY1D 4ZO8A 3W0WD 2Y5TB 1PLGH 1S7QB 2PP9A 1U3YA 4TQPA 3S9DB 4I18A 1JZIA 1ZPLA 4G82A 2R1YA 4G8EA 5E8PB 1M4KA 1YNKH 2SODB 3IXTB 5FAAA 4OI7A 4AVHA 3IWVA 1OSEA 3KLSA 4M7LH 4OJFL 1FFPB 4L0ZA 2C4XA 4UTBL 2V5TA 4NKQB 3HBQA 1RZFH 1ZCRA 2V5SA 25C8H 4ODSL 5D7IA 2G5UA 3MROB 5EUOA 3WN6A 1OARL 2NNFA 3GSWB 1LP9A 2ZXEB 1IGJB 2GTWB 4MJ4A 2X89D 4PH8A 5I1EL 3GUTB 3VXUB 4HJGB 4HV8A 5FA4A 3FCBA 4CNIA 3FMGH 2KI6A 4L2LA 5D71H 3QORB 4A7UA 2F53B 1YY9C 5BV7B 5FUZL 5CBEB 4P5MB 3O2DL 1E4WH 3MV01 5BS0D 4B9FA 3K2UH 4D7PA 4LNRB 3EW3B 3V6ZB 5HGHB 1UZGA 1P7QA 1AY1H 2NNXA 4JUTA 5I19L 4ANVA 4GEIA 1WD8A 5DEZA 5EZLB 1SNRA 4NO2B 2APXA 3QZBA 4EOWH 4PTUA 4XVSH 2F58L 1E0OB 1HXYB 3BEVB 4ESKA 4J4PD 2VR6A 4GJTB 4Y5YC 5E6YA 2JNZA 5KWYC 4UAHA 3QE5A 4LPYA 4JY4A 3BRDA 4GO9A 4XCNA 5EWIH 5CEZD 3QB7C 5D2LF 4GKSB 4K2UL 2X9YA 3B56A 1BLIA 3TYFB 5FOBA 2QT6A 4HUXB 2QSCL 3EBIA 3MRKA 1EZUA 2BY1A 4OTXH 3EGXB 2JJWA 1TUPA 2MTAA 3VFMA 2YOAA 1Q0YL 3A6OA 1NTDA 3N2JA 4P9ML 2WVTA 3CFJB 1JF6A 4Y2DC 3L3KA 4PQXA 4LLUA 4AMKH 3LDBC 2L0DA 4TRPH 4HDIA 5DEFA 3EXJA 1SXSA 4N1EA 4NEHB 2A6KB 3ARQA 4HHGA 4QRPA 4X6FA 2D2OA 2K6WA 3QH3A 3SCMD 4BXSV 4LCWB 3U7YL 2ICCA 4UF7C 4WWOA 4JKNA 4TKWA 2PNDA 3T71A 4EI5B 3H9ZA 2NXZC 4WUUA 1JK9A 1PG7H 1X5HA 1TFHA 1XGTA 2XIIA 4Q2ZB 3ILQC 1L5GA 4GQ9H 5C0BE 4AEHH 2Q76B 1AD9B 1MLBB 2OR9H 5AD0A 4Y1SA 43CAB 4KJWD 3PP3H 1MHHA 3S5ZA 4F8PA 4JMNA 1D5BA 4ODHH 1AE6L 1OSZA 2F54B 4Y4FD 2CJUH 3VB9A 4NQVA 3W2DL 2NSMA 5E0FA 2WXIA 2V17L 4NENA 3BAXA 1A6VH 3NJVA 5LGHL 1IVLA 1CGSH 1J9CT 2NXYD 2WOYA 4K3DH 3CU1A 5L4FA 5HTSA 2X1WL 2KZ1B 5C08E 2VC2B 2VMCA 3D0VA 3M8OH 1ZIAA 4LLMB 5C3TA 3QRBA 3CH8A 3RWJB 4J8QA 1EAOA 2BIMA 2WBXA 4PJGA 3FUFA 5E70A 4N2AA 1KYUA 4KXCA 1RKRA 1RPKA 4UOQA 2OL3B 1BQUA 1N8OE 4XVUD 1BX2A 5DD5H 2HFEA 5DUPL 4HZLB 5EBLB 4TUKL 1G6RB 2P49B 3OKLB 4UDUB 3ATEA 5F7EH 5GISH 1PW3A 4XVTH 1CZ8H 5C2BH 5I16B 1G9ML 3DX6A 2F7RA 1HE7A 2EZ0C 3VU1A 3ECBA 5DJZB 5IJVA 5C3LD 1WFOA 1G7IA 3H85A 5FFGA 1AOZA 2N7BA 2AXGA 4A7VA 1N59B 1OTSC 3KNBA 2CK0H 3DJSA 3LKRA 3PNRB 4LT7A 2AJ3A 2IALA 4PJHB 2NZIA 1XR8A 3FUIA 3NCWA 4UMSA 5CEYA 2H1LM 2NY6B 1EMTL 4JPSA 5I30H 3DX3A 5BV7L 4NRYB 2X4NB 3ZQ9A 4ZS6C 3EYVB 4U7SA 3VFTA 2YD4A 4FQ2H 3EYSH 5K5YA 5ACZA 1QTPA 5GGRB 1KGIA 3OF6A 4XZUB 5GGQL 3V0DA 2ZOLB 3QQ9D 5TGBA 3UERA 3UJTL 2VT0A 5AW3B 5EB9A 4M1GL 3A67L 4CRPA 5AVRB 4P5KB 1DQML 4DFIA 4G42B 2Q3XA 3ZU8A 5ISZA 2P5EE 1MAML 3SDCA 2WWMD 3I6KB 4KY2A 4J3BA 2OJEA 1CDHA 4I13B 1A9BA 1SXNA 1NSNH 3EDDA 3X3GL 3GKZA 1U9KA 3EJYD 4XTRD 4WAFA 5DJCB 1LO5B 3F6IA 3K71B 4U49A 2OBGA 1OWWA 2ZXAA 3CC5A 4RFOH 2BMKB 3CXDL 3IS0X 1FGVL 2WCGA 4D0DB 1AZBA 2OP4L 4S11A 3V4VB 2FWOA 3UTQB 2CLRA 5IF0B 1BZ9B 1FRGH 2LU4A 2PO6D 3S6CA 5D70L 4HMEA 4QXTB 2XTJC 2EDLA 5ICXB 4LOUD 2QGEA 2X4SA 3VWJD 4PGDA 3RY6C 3CFEA 3P3RA 3TWCL 5JQ6L 4O2CB 2Q9OA 4PMEA 4B50A 5EU3A 3FQUA 1KDIA 3F58H 5AOJA 3TH2T 1E40A 2YZ1A 3HJEA 3G7TA 4TULH 2PABA 3ARBC 4R6UA 1FSKC 1GS7A 2CO7B 1ZANH 2C9RA 2FVNA 4U3SB 4AC2A 5HY9B 3ERXA 2JKSA 3ZMEA 3OAWA 3SYCA 3MV7E 4M5ZL 3OKKB 2Y7OA 2CO6A 4OQTA 3VG0H 1G7LA 1RZGA 1BZOA 1DSFH 4AYMC 3T77A 2XX0A 4NN6B 3TA3C 5ICZA 2X3CA 1S7RB 4KUZH 3QDJE 1S2EA 4CW1B 5HHOD 4KXZI 4RMTA 3MCKB 3E1F1 1PL3A 2QR0A 3ESOA 3BJ91 2H32H 4FXGC 1OAZH 2DLEA 5DJ2A 3QWOA 2CG9X 3EUDA 1OQOA 1YQVL 4ZOEA 5D96C 4LVHB 3LS5L 3MCLL 2JMRA 2UVEA 4I4WB 1KJ3L 5I1AB 4ZUWB 3QYNA 1QATA 4QRTA 4S1DC 1DL7L 5H35B 4X5WA 2VC2L 1QTYT 4PMFA 3FS9A 1DZBA 4LF3B 4X6CB 4F7MA 4D0CB 5EF3A 2B8OT 2B9BA 1A22B 4TVPH 4OLVL 3NJNA 3HMWL 3E38A 5E00B 2F19L 4UV7L 4FFYH 2OL3L 3BVDB 4JG0H 3PL6B 4R2GC 4HUCA 4K23L 4N68A 5E2WL 4EMZA 4B97A 2CCLA 4IJ3B 7TAAA 5IG7A 5IQ9A 5CSGA 4WU5A 2H3XC 4UM8A 3ILEA 4XAKE 5JPMA 3RUGB 2D7TH 1QTSA 3TC9A 3S8GB 1A3RH 2OJ1A 5DVKA 4CAGA 3UYRH 3G6JA 1I85A 2OAAA 1WZLA 3O11A 3KJ6H 3B8YA 4I18C 3L4XA 1JZEA 4HS8H 4O9HL 5I1CH 5DXWA 3FTXA 1JZDC 3I75B 2Z4QA 3FUHA 5IY5B 4OZIE 2YA2A 3ATAA 2PWHA 5BRZE 3GHPA 4BCXA 3OHXB 3IMVA 1PJWA 3QWRD 2IQAA 1BQLH 3ZSSA 1Q94B 2YGPA 4PJ5E 1L3NA 2WKOF 1I7ZA 4HSAC 2NYKA 1VADB 1HOCB 3Q8AA 4JG9A 5L2JB 1AIZA 4M1CD 2VIRB 1KJ2A 5K59F 1UCBL 2IFFH 4ICWA 1TOXA 4R4FH 4RCAA 2QVIA 3HKFA 5DI8A 3S3CB 4P48A 5FS5A 4C57C 3ZW3A 5IB5B 1F86A 3VNZA 4CKVX 3ARFD 4C4KT 4DIXA 1U2CA 4B9PA 1CVSC 4POZD 1S9VB 3FC8A 3OTTA 5DUBA 4NSKB 2CPUA 3EDFA 4XC1H 3LXBA 4TVPD 3QIUD 4AQ1A 4BIKA 3SE3A 2I24N 1XGRB 3CLEL 1V55B 3ALWA 4XP1L 2XBZA 5CD5C 2PKDA 4MXWH 5C0NC 4H25A 1OPOA 1RI8A 1F90L 3QO0B 4JDTL 4YXKL 1L6XA 5IK3B 3KPLB 4YNYA 1WIUA 2OQJB 1ZLDA 4K5LA 2ED8A 5DFVC 4ODTL 3V4VL 5JA9A 3CHPA 4UILH 4HH9A 5GHWL 1YMMB 1DBAL 2HJFA 4K3EL 4DGIH 1X6NA 1MJJA 3DXAE 3T0DA 3P3UA 3FOMB 3S96B 1TKWA 4MDRA 5LBSA 1VFOA 2BM3A 5BO0D 4M6NL 3V0IA 3LV3A 5JO5A 4FX5A 1FV1A 4GSRA 4JHBA 1H6UA 1QASA 3KR3L 1BM3L 3ATDA 3CFBA 1M3JA 2BVPB 2QQNL 4JUSA 3G5YB 2KZBA 2QVTA 5SX4I 5ESVA 3JVFC 4UQ2A 3UPCA 3D3VB 3ZGIA 1TCMA 3SOBL 5I1GH 1U8KA 3L5IA 2CKBB 4FJYA 2ETWA 1XDTT 5IMLB 4OJCA 3DECA 5F7WC 2NY0B 4P07A 2K3HA 2LU7A 3BIKB 5B39B 4MS8D 3EFDL 2XJLA 4ZPVA 1S8DA 2W80C 3HZMA 1TXKA 4LU5L 4ZZFA 2YAFA 4MA8H 2P9RA 2QPFA 1RAMA 1GAFL 4K94H 4ZMLA 4EI0A 4IBSA 4LIQH 3WNMA 5CIPH 2BINA 3OMZA 2C9WA 2D31B 2PR9A 5AKSA 5CUSL 1OP3K 5CLWA 3EBHA 4IBVA 4P5TB 4MCZA 3MNDA 1V3LA 4I7ZC 5KUMA 5AG9A 1A2YB 4NO5A 3PDGA 3Q1SL 1RULL 1GY2A 1ITCA 2ITFA 2WQXA 4KVPA 4DP7X 3MV8B 3O4OB 4H7VA 2BIHA 4H8PA 1EJFA 4FYRA 3PFUA 2UZXB 4F2MB 2FBJL 1KCRL 3BT2H 2JI3A 3ARDD 2BERA 1T5KA 4N5ED 2CBOA 1XCTB 3ZN6A 5ADOL 1J86A 1VFAA 2I7SA 1KB5H 2QPUA 4N0UE 3UBXG 3F7VA 3UO1H 5E8DL 3FB5B 1U8MB 2VLKA 4J27A 3KBEA 2R23B 1SOQA 1IGYA 4UCFA 5I66A 1EEYA 3QXTA 4FQPA 1QUNB 3RAJL 4ZUUA 4GAYB 3EIFA 1MRFH 3DGCR 3ZO9A 4K9JA 2C34A 1KULA 2FJFB 3H2WA 4YOKA 3SDAB 2CXKA 4DK6A 3MAWA 3HI5H 3VD4A 2Z1PA 4MX7A 4BSJA 1UJTA 2A1WL 2VITA 1TJIH 3P3YA 2J5LC 4OLZH 4N8UA 3C60B 3RIFK 2VDPL 5DUML 3FSZA 4OZHB 4XP4H 3P4MB 3L5JA 3ZZSA 4FXKB 3FQRB 4AK2A 2D9CA 4L3CB 4WUKH 5HPMA 1KGJA 3RL2A 4QXWA 3CLFL 1UM5L 3H1ZA 4ZS7H 2XV2A 3EF7A 3KPSE 4JFDA 3FRUA 4WO4D 2HX9A 3ECQA 4R97C 2R4SL 4QF1A 3IJYA 2EDRA 3E6HA 4Q9QL 1MCQA 2FJSA 3MREA 3IK2A 5CN2A 4B7LA 4OLEA 1G9EA 4JFPB 3P4NB 1HOEA 1G1CA 5M95B 2V7HB 1FO0B 1PD6A 1SY6H 3BQVA 3DETC 3SDCC 5T5NF 3WMQA 3Q13A 3C5JB 1PMYA 2B20A 3QFJB 5D7IF 4NUPA 4AX3A 1ZE3C 1C5DA 5DMIH 5EUOF 1RZ7L 1LP9F 3U6XS 3FQWA 1LL1A 1QBBA 1BVNT 2J6EL 5I1LB 1VACB 2OS7A 4O51A 2WXMA 4AVKA 1CI5A 1JK8B 3DV4A 4OGXH 1PNDA 3HZKB 3VFOA 1CFSA 1AYOA 4HFWA 2A0LD 3DDFA 4YLCA 3OGCA 1ZK5A 4E5XG 2NY4B 2AJSH 4M1DL 3EDJA 4J2QA 5B38B 3QUYB 2ZCHL 1YEKH 2WLIB 4LL1A 2CKBL 2J72A 2QVFB 2DLTA 3CFUA 2FZ3A 2OMZA 3CX5K 3K74B 2QKIB 3GK8H 5D9SB 1LD9B 2MCAA 4GW1B 4ISVA 4E9YA 4IU3A 3DSNB 2GBUA 3UG5A 4LP4A 5SWZE 4FMKA 1KLGB 4N2BA 5I8KL 3HR5A 2C9QA 4RA0C 1Q9WA 2WAQA 1I7TA 3F6LA 2GTZB 2IG2H 1P7HL 3PQYA 2Q6WA 5FKAA 2AK1L 2F15A 1SDDB 4D9QD 1S78D 1EXUB 2J20A 5C9JA 2P45B 2Q20A 3NACL 1I7RB 2X1OA 3BFOA 3NA9L 4JFTA 1GHFL 2OI9C 4HIEA 4OSUH 4Z8FL 1R3HB 4UQ3A 3ZPDA 2X40A 5F3HA 3NIDF 2RIKA 4Y4KA 3C9NA 3TYGH 1TVDA 4I3SL 4KOCA 2G0LA 4K4KA 4F58H 5E1QA 3Q2NA 3QXVA 3D18A 1J18A 3DPBA 4CMMA 5CINL 1JUFA 2VMDA 5E8EB 1YEDA 1QFWI 3RDTB 2YKLH 4NWUH 1YYCA 4ZDHA 1N6QH 2WYHA 3DSFL 2A83A 3CZNA 4S1QH 2QGCA 2YBRB 1QG3A 4BBWA 4KUCF 3LAFA 2YZ8A 1NIFA 4D8PB 5EEXA 1RVFH 4JFZH 4KZCA 5JPMC 1ILSA 2GJ6B 1XR9B 4PCKA 4JHZA 1I85C 1FAKT 1CFMA 2P24B 2OXHB 2DB8A 3H9SA 5C8JA 1CFNB 1OV8A 2A77H 1DANU 1U3JA 4P04A 3V4PH 2IDFA 3MC0A 3RQ3A 2ROXA 1FAIH 4Y4HB 1I7UB 4OIIH 3UBFA 1PCSA 3HRPA 3UBXI 2QDWA 2DWDA 1D7DA 3B37A 4NXKA 3UX9B 1QLEB 3ZE1F 3DRQB 3UAAA 2VLME 5SV3A 2OMXA 4IMKC 3N43F 4RGMB 2KBGA 4I5BA 4W1TA 2H2SD 5TDOB 2XVBA 4PM1A 5FK9B 1JVOA 3QEQD 2A9NL 4Z7UA 1P84K 4A1RA 3MJ9L 4UU9A 5AWNL 2KZWA 3FCSA 3LD8B 5H4ZA 2DWYA 2SEBA 5SX4H 1R75A 3BAJA 1IQDA 4KK5D 5PAZA 5HYSG 1JG9A 2AS5M 3D85D 1PX4A 4FG2A 4XX1E 1JGIA 2JV6A 3VFUB 5C09A 3SE3C 2FDBP 2WTPA 3OXRA 2NY5L 3IETA 1IEAA 3O4LD 2ICEB 5EU6A 2DQFA 4IRSA 4C59B 1R17A 4JPIB 3M1BA 2P8LB 4WKZB 5KBLA 3ZDXB 1H0DB 5IVZA 1KTCA 1P1VA 2G75B 3GSQB 3WE1A 3IJSB 1EV2E 2BFVH 1YNLH 2XIDA 2FCBA 5AUMB 4DW2L 3QULB 1T0PB 3GMOA 2J21A 2J43A 1Y7VA 1P4LB 2XY2A 4KKRA 4PRNB 5AOKA 3WNJA 1Z5LB 4Z9KB 3WY2A 5IB1A 1A3LL 3H0TB 3FL7A 5MERA 3FH7A 4DNLA 4UUJA 4NUMA 1KGWA 1NEZA 2XWRA 4WU7A 3IFPA 1YYLL 2PWEA 5GRJL 3BPOC 3NIGF 1WBZB 3TVMA 1W72H 3IU3A 1B0RB 1IGIH 4LOVA 5FUCC 4F7TB 4YSOA 2X4UA 4NHUA 1NFDA 1A66A 4L18A 5AW4B 2FGZA 3W9DB 4HFUL 5JPNA 3LH9A 3N9GH 2CMRL 2OMYB 1FZOA 4OF6A 5DA4A 3WUWA 4I3RH 2EUZA 1BQRA 2MRYA 3TTYA 1NCHA 5EZOH 2WBKA 1SJHA 4Q7DA 4YPGA 1QNZL 4YHYC 5BZDA 2R39A 3DURB 1F1AA 1XIWA 5D72L 1ORSB 1ADWA 4LPWA 8CGTA 1PF3A 4M00A 5CEZE 3CDYA 4P46D 4UV4L 4YDZA 3VCLB 3BFQG 3WN5A 4PRHB 2VDLL 4JVWA 1THAA 3H4FA 4DEPB 2H5UA 1PEWA 4LSUL 4O02B 4JFHD 2X44D 3O6KL 4U6VH 1E6OH 1HHKA 3ARED 3OKOA 1X5KA 3NJFA 3EJJX 3A0OA 5DZVA 5JTWA 2FUQA 3NQIA 4DGVL 4QHMB 3S48A 1TVBA 1KBPA 3LN4B 3AMLA 5IW1B 1SEQL 1UT2A 2XPGB 5DJXB 2FSEA 1IBYA 2D7PA 1QPKA 1SXAA 4FFZH 4HU8A 1I1CA 2YC1B 3BUQA 4PJDE 2ESVB 3B2UC 3ZVVA 3MLVH 2XX1A 2C1PB 4UAOC 5F72S 3IDYB 3UJJH 4DQOL 1NCDH 4QXVA 2APWA 2XV0A 3E3QC 3DOIA 3Q2CA 3NBNA 3NJMA 4L8BA 3P4OA 3RX8A 3GSXA 4AXWA 5IB4A 5E6ID 2QVMA 1WZ1L 1O9ZA 2VXVL 2B2XH 5MHSD 3GSUA 1OGTA 2CLZB 3MA9L 1Z3RA 1B4RA 2F8VA 1ZLWK 2QLVB 3IMBA 5HJ3A 5HDWA 2AHIA 1FBIH 4V2CB 1IM3A 5F71A 7CGTA 3Q6GH 3WDIA 3WV0A 3LHPL 5A7EA 1UA6H 1EEQA 5SWQB 4ZFOB 1A7QL 1OF0A 2GJZA 2O61A 1A0QH 4RGOH 3MLPA 2BXYA 1CCZA 1OHZA 5HI4C 3PWPB 4MDIA 4ALAC 3KVDD 1BOGA 1QLEL 3PIQB 1QBML 3WD5L 1PYWA 5E2TL 4Y19A 1BVOA 4JPVH 3CN3A 3D30A 4H8HA 1PDKA 3QUZB 4Q97A 1ZA6B 5L9DL 4O2EA 4DGYL 1XBDA 1IC7L 2WMPB 1D9KB 1VRSA 1S7UA 2YXMA 3BUYB 2DJSA 3EZJB 3SYAA 1JD7A 2B1OA 3D25A 1G7QA 2APVA 2KDYA 2ZT9C 3G6JF 2Z91B 2VDQL 3BZ4A 3C09C 4APQC 4NN5B 5J6GB 1TZHA 1XO8A 2ZQKA 1RJZA 4F91B 4PIRF 5JHDD 2Y7NA 3BHBA 4WENB 5KAQF 2GHZA 3IFNL 1JZ6A 4XMTA 2ZSWB 4ZAKA 3V10A 1A7NL 2G3XA 4XXCA 3MLYL 3QFDA 4OKDA 5FGBA 1LO0L 5JYMA 1NCOA 1R34A 1UZ6E 3CWGA 1QFWM 2CHNA 2WBJD 2RQEA 3QRGL 3CCHA 4L9LB 1X7QB 3DTXB 5BPPA 2OZ4A 4TVUA 1JV5B 1JYWA 4DUVA 4WI5A 4OKVA 3MV9D 4TVSa 4X98A 3OAZH 1JPFB 1RLBA 2NW3A 3SODB 1U8NB 1JGDA 1NLBH 2DIJA 4KTDH 2W0FA 1F13A 3HG5A 1W0WB 4UIMA 3ILPA 4PJXB 2IBGA 4NC0B 5BUGA 5KVFL 4JO2H 5L2KD 3MUJA 3QDGA 4RGNE 5DQDH 4B3EA 2MCPL 4WJ5A 3NK3A 4KY1H 3CHOA 5HVHC 1T3FB 2H0FA 3KL0A 1F11B 4F9PC 4M61A 1QFWH 2V2WB 1PFCA 4LEEA 2CIKA 3MLZL 1YEIH 2ZKHH 3ML8A 3QDMD 4WJKB 4IEFA 4PGEB 2MOVA 2QZ5A 3IN2A 1TTGA 3PWUB 3NYKA 1LDSA 3MBED 3X12A 1XGZA 1KJMB 5DHEA 2GSGB 2HXAA 1A9EB 3G5ZB 5E6SB 5D7LD 1WWAX 4OGAD 2XKUA 2DI8A 1MCDA 3SE8H 5JHLL 4X7SL 5IBLD 3WLBB 1HH6A 2X6AA 4OZFA 3AQXA 2HMIC 4PJEB 2ERJB 1MCOH 4Y4KC 3S5YA 5KS9E 3HZYB 1FYTA 2O5ZL 2PPEA 3FB7B 2IPTH 4RISL 1CL7L 2BSSA 4G70B 5E2VL 5GGTL 3ZKND 3UCRA 2QGBA 2F74B 1WA0X 3D06A 3LQAH 1F4YH 5D4JA 5C0CD 3D50A 3EYFA 3OKEB 1PCXA 2QSVA 3O81A 2DRUA 3BPNC 1MELA 3K2MC 1D7FA 3MPCA 4LMQI 1JI1A 2HVKA 3Q9PA 3FQ1A 2FJGB 4FQLL 1RFDH 3N42F 2BRQA 1UHVA 2UUDH 1KLUA 4K5PA 2WXOA 4TS6A 3N41F 2K78A 4JZNA 4MJ5A 4JFEE 4P57B 1OGAD 4UYQA 3X11B 2B08A 5BCAA 5A6IA 1AZZC 1WJ3A 3FT2B 1P5UA 4PG9B 4GPVA 1WTLA 3LSOB 2R8SL 5F1SA 3ULVC 2IPKB 4H5SA 3RU8L 2HRLA 2WXNA 4JQVA 5B1AB 2WJ7A 3ABGA 3GI8L 3FDWA 1KTLB 3LN9A 2X1PA 2OLDA 4JAMA 5D1XE 2WZPD 3JWOL 2MFNA 2GIYA 2FL5A 5EOQL 3K4DA 3DV6A 1AO7B 1U58A 4F8NA 2FWSA 2X09A 1IQWL 1TPXC 3HHSB 2Z31D 3QI9B 1HN1A 1L4IA 3MLUL 1S5HB 4ONHA 1T0OA 3IYLW 1XAKA 1CF1A 2DH3A 5FDYA 1HHIB 4J3OD 1UQSB 9CGTA 2Z0UA 3TA3D 3L6FA 1PKQE 1AHWB 1NDTA 4PLKD 4PJ8D 4GRLA 4OQ1A 1NOLA 2RTTA 5FWRA 1IC5L 1S3RA 2OSXA 3FFCB 5KSBE 3KCPA 3QPXH 2XACC 2AQ1A 3C8DA 3DUUB 1HI6B 3SKMA 4MKMA 1DUYB 2DLHA 1JZ8A 4HWZB 4ENEC 3IJEA 3X1EA 4Z77A 4IRSC 2PW1A 1E4XI 4D94A 5CZXC 5I0VA 5IFHH 5ITFB 3X17A 4FABL 1RH8A 2WLJA 2YD3A 2L3BA 3QIBD 4LKXA 3L3IB 1T22A 1W72A 3QR1A 2PTTA 2XN9B 1ES0A 1UTDA 1N4XH 3ZKXC 1EHLL 3HG0A 3TZVD 4R2GD 1OD9A 1SVCP 2FX9L 2WLNA 1X5GA 3TVMC 4IHOB 5AALA 3CZGA 3MUUA 2R15A 2CA4A 3CZUB 2O6CA 2R1XA 2FT7A 3L1OL 4ILDA 4K8RL 4M93C 5JPNC 3X1NA 3IDIB 1OAXL 3SDXF 4IKJA 3TL5A 2R0ZL 4TVPE 5ACLA 1JHLH 5SWSA 4F92B 2NX5E 3P73B 4OJAA 3QHFH 1GC1H 1HZHL 5EG6C 1SRDA 1QSEB 5FFLA 1BZDA 2APTA 2A6IB 3L7EB 1XIWC 5AOMA 5E99L 3BP6B 5JORA 2WSDA 5HHQA 4MXVE 3VMNA 3BVNA 3E6FB 3R8QA 3WN5C 4Z7AA 4EZMA 2XG4A 1CG9A 3RTLA 1P1ZA 3FSOA 4NBZB 4XN8A 3LTVA 1RPQA 3U9PH 1KTJA 3R1GL 4KFZC 4V2BA 4OVVA 5B1BB 4MD4A 4DCQA 5DRZB 4DO5A 3L54A 1W80A 4S2SB 1C5CL 4BRVA 2WIIB 1WK0A 3EGDB 1XD1A 2GHWB 3IS1X 2KLTA 3Q5TA 4TL4A 3TNMB 5CLYA 3O0RH 1UOKA 3TIDB 5L6YL 4RDQF 4NFBA 1LWRA 4H2CA 1KLFA 4JM2B 5JXED 4ERSH 3VFNA 3BUPA 5E8NB 5E5MA 1BZ7B 3FU3A 2DEXX 3MUZ1 3SDDA 3KLAA 1I3GL 4BQ6A 1QEWB 5AB9A 2DYPB 1RURL 1GZPA 1TJHL 4QI3A 4RBPH 1Y18A 4JR9L 5F3BA 4HZ1A 4G8IB 1XFPA 4BRJA 1QFPA 2ICWJ 4XWGL 5AZUA 4BUHA 2ZUYA 3S8WA 3ZE2B 3VXNA 5CZVH 4W9KC 4XMLH 2IH8A 1XL4A 4XXDA 4CU6A 2PCFA 5I15L 3D9AH 4Q0XL 2VW6A 1KCSL 3HG4A 1M42A 1IGML 1MLCA 2WGNB 3BPLB 3OHMB 2JI2A 5A2KH 5F6IB 2GAZA 3NCMA 5CFAA 1PG7X 1JZHA 1S3KL 2CGZA 4JREB 4NPJA 5DJ6B 3VH8B 4DUWA 3LB6C 1ACZA 1JTOA 3A23A 2CJSA 4MA1B 4A2MA 1PX3A 3DX8B 1UWEH 3UJIH 1M05B 1A65A 3SJVD 4AZ8B 1CFTB 3NSCA 1BHGA 1NCCH 5DZOA 5JHBA 1K2DB 4XRCA 3P0VL 1CE6A 1E7VA 4M6AA 4IS6B 1L9MA 4BQ9A 3GJFK 1MY5A 1WIOA 35C8L 3FTSA 2P46B 3GMMB 3LH8A 1FN4B 2V8MA 4WI3A 4GXUN 4DKDC 4KMTH 1NFIB 4P3WA 2VQUA 2KKQA 4X6DA 2CDGB 4YUEH 1SBSL 5E4EB 3GJFB 3KPRD 4JGMA 2ADJB 3THML 4HKXA 3AM8A 1YEFL 4QHLA 2RCSL 4QWWC 5LNEA 3V9FA 1L9SA 1BPVA 3BKCL 4KX7A 2GK2A 1EFQA 2GCYA 2M26A 3ULVF 4M9PA 5ANMA 5F1IA 4A68A 2WXKA 2JKRM 3O3EA 2W81C 3MGOA 2X6UA 1JWSA 4ZJ9A 2AK4A 3UXFA 1KTDB 1UWFA 1UWYA 2IANA 3IKKA 4JDZA 5JIMA 3CAFA 3IXAB 4P4KB 3HAEA 3W81A 4F8QA 2NY2D 4DAGL 5BMFL 5FGBC 1QLRB 3LIZA 1E9QA 2K4WA 4QRAA 2AKRB 1U8HB 2UVFA 4O4YH 1SHWA 1X5ZA 5D2LB 5DK2A 4TPRL 2XYBA 3L5WB 1J10A 1VPOL 2HFGH 3VACA 4ZD3H 5C07D 4NBYB 5CJXA 4MAYA 1CGVA 3ECWA 3QFGA 3SPVA 4F1ZA 1KBBA 1G4RA 1SMOA 5T3XH 5C0JA 1QZ1A 2Z9TA 4JMXA 1NPJA 1B6DA 1NJ9B 1ZS8B 1MDAA 1FJ1B 1CYXA 3K2KA 4PBXA 3F3HA 5FO8B 3ZT7A 5IZ7A 3LRLA 4M5TA 3DIFA 3HRZB 3IGKA 3M86A 3RZCA 1JNNH 4R7NB 1JZGA 5CWSB 3TEZA 5CR1A 3BAKA 4OLWH 5MI0B 3EYOB 1RJCA 2B16A 2R51A 3H3PL 1NGQH 2HT3D 4CVXA 1NCWH 2FT6A 5T1KB 3FH5A 4MMZA 1WFMA 1FNSL 4AYBA 1T5WB 4LCYA 1AS8A 1D5IL 2ZOOA 3BPCB 2YWYA 3CX5J 4YR6B 4LOFA 1I9JH 3F7YA 3D51A 3HMXL 1NFDF 4NQED 4ZOBA 3KLHC 3HNVL 4ZOCA 2FLBT 4PCTA 1RJLA 4L4TE 4RFNB 4Z76A 5D55A 4K71C 2Q8AH 4HG4K 1CVRA 4QRRD 4AKQA 1NMCB 1F0LA 4IRZL 3D39A 1CO1A 1OGSA 5DJYB 3BP7A 1MFCH 2XPZA 4M3JA 2NY7H 3DETD 3T3PE 1P2CB 1UZ8B 4AGPA 3VFSB 3RHWK 2J8UE 2EUWA 5B1JA 2DDQL 3KLKA 1FNAA 1YY8A 4AEFA 3G6DH 5T3XD 2ZOKA 4BDVA 1TZGL 4ZFQA 4CN6A 1ZA3A 3K8LA 4JZJB 2QEJA 4FQXD 2DQCL 3WOVA 2QPSA 5AB0A 2V9UA 4JL2A 3IU4H 5KBDA 3MUGB 4YDVA 2C1OA 2WSPA 3Q7JA 4C58B 2G4GA 2EEFA 4JFFA 4HIJA 3IFLL 2VNCA 3ISRA 1UYWH 1P5UC 4S0TD 2XFGB 1U3HD 4J3TA 4BCZA 5B39G 5GS0C 4QJ4B 5GGVL 3UO8B 4JQVC 1E4XH 3FK3A 5DDHB 1IV8A 5LKNA 5CXPA 5I6MA 2XU9A 2YMXH 2BX5A 2JJTA 4GIAA 3RWHA 4C54A 2HVJA 2H3NB 3U2IA 1HSAA 3GSRB 4FD0A 3U4BL 2WINB 5KSAD 2G9HB 3EO0A 5TQ2H 3VXRE 4U1GC 3L9EA 4XVOA 4BWWA 4PJAA 1XGYH 3QQ4B 5DS8B 4FFVC 4PRDA 4NZTH 4K73A 3K6SB 3IAGC 5FCSH 2V9TA 3HBPA 5TE6L 3V0HA 2VSKB 1TCRA 2F7PA 4ES8A 3RVTC 3UPRB 4GG6B 2BC4A 1AQDB 1YZZA 2ZKYA 4IGBA 4GRLC 3SZ6A 4OCWL 4E5XA 2OMUB 2XNAB 1E9PA 1FVEA 2EVFA 2DQEH 4JKPH 4Q6YA 2ITCB 4R90L 1DVZA 1F4WH 5T5FL 2A5UA 1DJZA 2DKMA 1NINA 2AEOA 4GIOA 1G87A 3ZT5A 3UTPD 1AGCA 1RPUA 4Q56A 2CBTA 5FYLL 1K4CA 1DQQA 5C08B 4NUQA 4MYWB 3FYIB 2NY3D 3JZYA 1HX0A 1BVLA 2BNRA 3GS7A 1H15B 4V1DA 2H1PL 1P84J 4BFRA 4O58L 2IIJA 1JPGB 2EDDA 2HUHA 1EEZB 4LLYA 3TT1L 5GZOA 1UJ3B 2NLJA 1QWNA 3O8XC 2C3XA 3HHMA 1AKJA 1A47A 1I4FB 3QEQE 2N3JA 4KJYB 3MYJB 3TCLB 1Z7JA 5C0AD 7FABL 4TUJB 2TAAA 5DHVB 4PSPA 4TL5A 4Z5RA 4AEEA 3RYMA 1H8LA 1IBFA 2DLIA 3E9TA 4LP8A 4PIBA 4DEUA 2AW2A 1WP6A 4AG4H 5AYTA 2ZX9A 3DJTA 1HSBB 1TQVA 1JP5A 4LQFH 2AGJH 3N06B 1JD9A 5JW5A 4OD2B 4LOEA 1CLZL 1JRHI 1DBJH 3QEGH 5K1JA 4N2OA 1HAWA 1QLFA 3FQ4A 3V0FA 4LSQH 2E59A 5K9KA 2I07A 4I89A 1X5JA 4BZ1H 4EF3A 4P9HC 4YL4A 2ORBL 3ZL2A 1SFDA 2VXQL 3VGEA 4XBPB 1NC2D 3LPFA 3PLYA 1Z9PA 2I5YH 1IGCL 4YSTA 1OO2A 1MCHA 5FM8A 1RZPA 2ZWLT 3QXDB 2BSED 1YEJH 4ZMTA 4DETA 4MFHA 2Q8BH 2QADD 3P40A 1DR9A 4R4NC 1SJXA 3QQDB 3PWLB 3V6OE 1S7SB 2AQQA 2NT0A 4P2QD 3OBAA 1ID2A 5BZWB 1UCTA 3WIIL 3LH2H 3FQTB 5LCVA 2EDEA 2P5EB 1SZNA 1GGBH 5TQ0L 1JPSL 3OKNB 3SDDC 3IDXH 4P2RB 4WFGE 1R3JA 4JRYA 1MFAL 2GK0B 4NQDB 4ADIA 3VFPA 15C8L 5FYJU 2HH0H 4XPHH 3FBKA 2MNJB 4U1IB 2GJPA 5DD1L 3MRCB 2J44A 5GRXG 2BO0A 2H8PB 3QAQA 4HK3J 3TIEB 1HCZA 3U4EB 5G2NA 1NAKL 3PGCA 3QK0A 4W93A 3DDGA 5GRUH 3UC0H 4JFHE 4HKBB 1A7OH 1UB6A 4JHWH 4LHUB 4NN7C 2R2BA 2XTLA 5HI3C 4XN1A 4ZX3A 4TNWF 4Y9FA 3P11L 2VXUH 4FQ1L 4RAHA 4U6XB 4WNQA 4GW5B 1CU4L 4DWHA 4ZNEA 3ZSTA 2RFXA 4KI1A 3TJEH 5EF0A 1NAMH 4BH8B 4N6QA 1M7DB 4Z7QE 1MAKA 3LNDA 2HYMA 4ODVL 4PYGA 3B5GA 1A4AA 2EIMB 4KZEH 2Z8WC 2H1XA 3MR9B 4IK6A 1UEMA 3SGKA 1Y1DA 2EH7L 4FLOA 5E8OA 5I8CB 1U2HA 2VXSH 1N6VA 4U6HB 3B7SA 2OCCB 5I5RA 3DA0A 3T4YA 2V2TA 2V0AA 5DVMA 3DMMB 1EXGA 3QDJB 3AG1B 1R0AH 1C12A 4F3FA 1KJVA 1M1XA 1OTUC 3AM8C 5A40E 3KXFB 3P9LA 2CR6A 1DEEA 3VGFA 3LKSB 4DPBX 1A6PA 1EAQA 1C7TA 3BQUA 2WLMA 1XH2A 1CLOH 3M07A 4LSSL 4LVNC 1PQZB 2K45A 1AYRA 1S9XB 2OW7A 1RUKH 3LOWA 2PYEE 1V7NL 5E1HB 4OLUH 4W68A 3TN0A 3GIVA 1BQHA 4NC1C 2K8QA 1U8IB 5EZIL 3X13B 1VLXA 1JHTA 2HLFD 2VXTH 3TM6A 3CH1B 5I2IA 3WFHB 5TE4L 3HUJB 5DHXB 1DJGA 5CSZA 5D5ME 1T1WA 1ZEAL 2ICWI 2FD6L 4PP2B 3MRDA 4QYOB 4R96A 4AYEC 2EDHA 2NRDA 4PRPA 3C08L 3OR7B 1JNLL 3V5KB 5DZPA 2V2XB 3QCTH 4X99B 3I9PA 2DQ6A 3QEHB 5FHAH 5JOPE 3LQZA 3C5ZD 5CJXC 1UD8A 5AVWB 3HNTL 3C5XA 4MAYC 5C7XL 4ZUTA 2AZAA 1YJDH 2NDGA 2BNQB 2YQBA 4ZSOB 1PS3A 5ICYB 3B9KB 3MLSH 1JZ2A 1KENL 3KWXA 4NO0A 1OAYL 2BRRH 2JB6A 3O3DB 3P77B 1EJOL 1MW0A 1QO3B 1U8QA 2X2IA 2YK1L 3QP3A 2ATKB 5BXFB 2XTSA 2XXFA 5JHDE 5BRZB 5JZ7C 4Y2NA 4I2XA 3RZCC 1WVZA 4GP4B 5IGXH 2WIMA 1U2YA 2HTLC 3AFLA 5DK3A 5FA3B 4KBPA 4P2CG 4WTWA 3BSZA 1Y6NR 3QARA 2HN7B 4PJ5B 5TPWH 1AJ7L 1UATA 3SQOL 4NZUL 3Q3GB 3ZQWA 1OXYA 3OWEA 4UM9A 4HGWA 3VVVA 43C9B 3G9VA 2VLRB 4MMZC 3MRMA 1AR2A 3PGDA 5IJDC 2X9ZA 2YS4A 4WY7H 3HI6L 3MV9E 4OM1L 3WEXA 1NCIA 1Z9OA 5JNYA 3MX0B 5E0QA 2Q7YA 1TETL 3RWIA 1NBVL 4NRZA 5CJOH 2LTQB 4K15A 2VLJD 3LQAC 4G6ML 4KRLB 4APXA 4QOKD 4APQD 5L2KE 4KVCL 4KKLC 1CGWA 4NYLB 3VQMA 5EV7A 4HUUA 4N8PA 4TOYL 1DVYA 3PNWA 3A5VA 1DTUA 3ZDZF 1VFUA 4Q9RH 1NCAL 1BYNA 2ZONA 1EVTC 5B1JC 5EUKB 4YWGH 2OMTB 1WRFA 1EUTA 3MACL 3MRBB 4Q89A 4X7TB 5MP6L 4UTAA 2EDJA 1QFHA 3DXAB 3QPQD 1K85A 1NUDA 4PJ9D 3KLQA 4AYID 5D7LE 3CFCH 4M02A 4JO8A 1HXMA 1DJXA 4JY5L 4KTGA 2ZKMX 3QG7H 2PP7A 5F96L 3LRKA 1M53A 1VCAA 3FCUB 3QAZC 5KSVA 5EC2B 1YUKB 3ARTA 5DJAB 5JHMA 1XTLA 2GFBA 3RX7A 4G8GA 3TO2B 3WU1A 2MQCA 3DHMA 1L7IL 5T1LB 4GBXB 3T1WA 2JJTC 3C8KA 4OBSA 1IBGL 1WZAA 4HBQA 4X5QA 3UTOA 1E27A 4NQSA 3N50A 3QCVL 3EH4B 2R7EA 3GB7A 3RZWA 4MNHB 1N8ZB 2DBJA 3VFRB 3FN0L 5C0GA 5TK2A 1FA4A 2Y5TA 1S7QA 4D9LH 4KJQC 4FQJH 3WKYA 1P7BA 4CGTA 5EIIG 1J11A 1JMZA 3L48A 1OGAE 1QSFE 2FRGP 5ENWB 4YDNA 1H3UA 4O00A 2JJUA 3IXTA 3K8KA 1MCKA 5E9DE 5EHFA 5AZ2H 1FFPA 4FQCL 1QWUA 2Y2TA 4MNGE 2O4EA 5CMAB 5K9JL 4NJAL 2HMID 3SGEI 4UBDC 2VW4A 2FJUB 1S9YB 3CUPB 1DDHB 2FECI 4ZMYA 3MROA 2VDKL 3GSWA 3D2UB 4P4RB 4LSTH 1IGJA 2GTWA 4IRJD 3GUTA 1AGFB 4ZQKB 4BE5A 4K9EL 2Z92B 4QHNB 3BW9B 3AXIA 1KPVB 4HJGA 4G9FE 1RD6A 4DTGH 3ROOB 5GZOC 3QORA 4X6DF 2FQGA 3NAAL 3ASWA 1NC4D 3M6DA 4P59L 3NJIA 1IVTA 4N0UB 4IKNA 1Z1WA 5CBEA 4P5MA 5EBMB 4BK4A 3MOBL 4ODWB 4C4BA 3FSWA 2DM3A 3VDAA 2IGTA 4LNRA 5HGHA 3ZHDA 1ADQA 5GGRY 1IT9L 4G5ZH 2IAMD 4HAKA 5EZLA 4NO2A 3KPMB 3AT8A 5LGJB 5IOPB 3CSYB 2EEDA 4R0LB 4RRPG 5I71B 1R33A 6FABH 1HXYA 3BEVA 5HYJE 1OT1A 2FUTA 1KGXA 3FQXA 4Y16D 4OT1L 1QX1A 2Y07L 2WJ5A 1UFGA 2LFEA 4LNVA 3JVGA 3BFWA 1ZV2A 3MRJB 4GKSA 3ZO0A 1I9EA 3LS4H 4LSPL 1PVHA 3TYFA 1QR1B