3ZRFC

Pvhl54-213-elob-eloc complex_apo
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
142
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting the Von Hippel-Lindau E3 Ubiquitin Ligase Using Small Molecules to Disrupt the Vhl/Hif-1Alpha Interaction
pubmed doi rcsb
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
molecule tags Transcription
source organism Homo sapiens
total genus 32
structure length 142
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3zrfC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3zrfC01
4W9GC 4AJYV 4W9DC 4W9KC 1LM8V 4B9KC 3ZTCC 3ZRFC 1VCBC 3ZUNC 5LLIC 1LQBC 4B95C 4W9LC 4WQOA 4W9CC 4BKTC 4W9EC 4W9JC 4AWJC 4W9FC 4W9HC 4W9IC 3ZTDC 4BKSC 3ZRCC
chains in the Genus database with same CATH superfamily
2A1WL 4TSAH 2NY4D 5F1NA 2EVHA 4FC3E 4HZLA 4M02A 2B1HH 1T0NA 1KZQA 4Q7DA 1IT9H 4Z77B 2Q8BH 1Y0LA 1U91A 2BNQE 3LHAA 3QA3A 4G43B 5I1LA 4JUSA 3F8UB 1TR7A 1IC5L 2XWBA 3MYJA 4U1MA 5DFTA 4RRPG 3TASA 2FHCA 4JHBA 4ELMA 3ECQA 5C09D 1RVFH 3QCVL 5DD0L 1W0WA 4UT6L 5F7HA 3JBG7 5DRZA 3RILA 2L04A 2DQJH 1HINL 2WQAA 2NY5L 3WYRA 2CLRB 2BH0A 1L4IA 4A6YH 3JV4B 2LGNA 3WNOA 2Q86B 3CD4A 3S0PA 1MFNA 3ARRA 4HJEA 3DV6A 1I8AA 5INCA 2OSLB 2BVTA 4WW1A 2F19L 3LRMA 4DQOH 3B6SA 1LEIA 5FK9B 1D7FA 4XCYA 1AACA 2GK0B 1U8PB 2ZCHL 3X1EA 5LXGH 5EO0A 2EVFA 3HAEG 1UXMA 5ICUA 1I85C 1TJHH 4E68A 4D9LH 3HG1B 3DECA 2R7EB 4YHIA 2M1KA 4BZ2A 3LRKA 2OR9L 1KJMA 1WWCA 1NPJA 4A66A 4GAAA 1TLMA 3MRDA 1U2HA 4X6BA 5C0BA 3U1QA 2AQ1A 1GCYA 3RB7A 3BPLC 4GKLA 1J9TA 4PS4H 3QRBA 2AERT 4UM9A 3M7OA 3N6YA 2HH0L 4KMTH 4JFXB 2CG9X 5BUGA 1QQDB 2MFNA 3L4YA 1AZVA 4D0BB 1A6WL 4IRJA 3KH4A 4DP8X 5KYUA 1Z9LA 2QKIB 4OZ4B 5TE4H 3ABKB 1TQTA 1IGYB 4QRPA 1LQBC 5JHBA 4AZ8B 4B97A 5T1DL 2O6EA 3ASOB 2F6AA 3WLBA 3WNIA 2C34A 4EIGB 4FTDA 2XIIA 4G6KL 4JPVH 4RMTA 1N3NB 2XVLA 5T33L 2ZQKA 4XPAL 3VFUB 1TQSA 3D9AH 2DKSA 4WO4C 5I74B 1AO7B 1N4XL 1N6QH 2OMNA 2Y06L 4FA7B 2AXJA 3BD4A 1GOHA 4YHLL 3T0EB 1OCZB 3EFDL 2VN4A 4IQHA 4LQ1A 1P7KB 4WJ5B 1SJEB 4AKQA 5A2JH 1I75A 3S48A 5JIPA 4JFEE 3F01A 5DJ0B 3HCVA 5GS1C 4XVSL 1NSNH 3NCJL 4F5CE 5I1CH 5ILTL 3U30C 3ABMB 1OAYL 2CGZA 4CNIA 1E42A 4JO3H 1PEZA 4XODA 1FL5B 1I8KA 2NR6D 2NNAA 3MGOA 4Q0XH 2NY0B 2DWTA 2Q8AL 4KH9A 1F41A 1U8KA 2E5EA 2V7HB 1S7VA 5EEXA 4U3SB 1N5AA 5D1ZI 3BUIA 2J88H 4E9QA 3HBZA 4B96A 3ISWA 1KJ3L 1YN7A 1U33A 1V27A 2X87A 3UP1A 1NAKH 4U1JB 3CMGA 1HXYA 4PREB 3FTSA 5JQ6H 3CVHL 1HOEA 4Z76A 1BECA 2GUOB 2Z93B 1DUZB 4Q4IA 1ZA6A 1LO4H 4JFQB 2DQCH 3VI3B 1PX3A 3TO2B 3TT3H 3RWCA 2CCVA 3ZZQA 3WFEH 1FL6A 4I0PB 2J5LB 4JLRB 4MXQD 4WI2A 5JO5A 3BWAA 2DD8H 2RQEA 4DUVA 3AWFA 1FO0L 2X10A 4UV7H 5B39G 1MHCA 1SOKA 1AS6A 4PMEA 1W8EA 3VU2A 3IU4H 4BSWA 4FEIA 3BGMB 4ZOAA 4QHLA 4QRRB 1T22A 4JQIA 4LSUL 5HDQH 4ZPTB 4ODTL 4UZGA 3TTYA 3ZDZE 4AEHH 5IWLC 4PJIE 4W9FC 2YUZA 3I6LE 3OKLA 4H0GA 5JW4R 1MAMH 2E4FA 3BPCB 4MNHA 4N2CA 1UCBH 1J0ZA 1RURL 3DTDA 3CFBA 3LS5H 4X7SL 4Q9QL 4QRSA 5SWZD 5BO1H 5AZUA 2GKIA 2EQDA 1VIWA 4M00A 1KCLA 3SPJA 3KWUA 4N3TA 3MLYL 1EAQA 1TT6A 1TXKA 1EBPA 1JNHB 3VFNA 4WTWA 1GC1L 2VLKA 2YEVB 2NY6C 4OZHA 4M8QA 1OZTG 1JZFA 3QDGA 1PY9A 5DMGC 3ZW3A 1QNZH 2A5UA 1AO7D 1AZZC 3BW9B 4JHZA 1OAKL 1EFXB 1RIUL 3U9PH 3CLWA 3FC8A 4XE5B 2BS8A 3CDGA 1ES0B 3GTTA 4DKEL 3RVVD 3U6XS 3ULVC 4QYAA 5BRZE 1AGBA 4IS6A 5CFAA 5AVRB 4FNLH 5IT2L 4XAWL 2NXZC 4YK4B 4UANA 3ZTCC 4G7SB 5E6IC 4QF1B 1KCVL 2P45B 3ZUNC 3C87A 5B3SB 1L7TL 2V2WB 4XBPB 4EUPH 2HVKA 2BHZA 3HRZA 3EG9B 3U6RA 4EI5B 1G9EA 1YNTF 5KG9A 2WXFA 4KK9C 4GRWF 4FFZL 3SB3A 4OZIE 3ZX1A 2PYEB 1ROWA 1CPUA 3QIUD 4OLXH 4YHNB 4AQAA 4GG6B 5EUOB 2NY0D 3STLA 2X5PA 1KBVA 2XN9E 3LSOA 4KU1A 5ALBH 2GTWA 1CR9L 4EN3B 1EXGA 2OMBA 4HIEB 3PGFH 2EH7H 1HHJA 3ZRFC 3FDWA 4MQXC 3BYYA 4KPHL 4XN2A 4HJ1A 2GIMA 3CSBA 4E9RA 3HR6A 5B1JC 2GI7A 1OARL 1NUNB 1U8QB 5HSFA 3C8HA 4X98A 1V5JA 4BUQA 5GZNA 1V7NL 1QP1A 3FO2A 3W5MA 3ZIYA 3WCYA 1JDCA 4KO5A 1NCBL 2Y2TA 2X1PA 2WBXA 3TLRA 5D9SB 5E24E 1YJDC 3QA3B 5I1LB 1TTFA 1OT4A 4L8CB 4XPHL 1UB6B 3K2IA 4U1MB 4UIMB 3KYNA 3C5ZC 4WNSA 1K9TA 4HWBA 2YARA 4ZSOB 4JY5H 2CH8A 1IBGH 4PJDA 5F70A 5IY5B 3RQ3A 3IDYB 3CHSA 2BY1A 5D7IF 5DRZB 3TJPA 4YL9A 1HEHC 3VRLE 3QG7H 4QRRD 2PTVA 4QNPE 3ZL2A 2VLLA 1GIGH 3KYOA 4OFYD 4L37B 4XPFH 4XVOA 3KWWB 3CDZB 3DV6B 4KI5E 4NBZB 2QT6A 5INCB 1CGTA 1VEMA 1OM9A 1BG1A 4NUGH 2IIJA 4G7RB 4JFYB 4FHJA 3ZR5A 1WV7T 1ZIBA 4JO8A 4XZ4A 4PV8B 4XPBL 1OCWH 2V9TA 4PSRA 5DQDL 2DI8A 5I8KH 3FQUB 4YHIB 5DEGA 3NZUA 3DYMA 3DX6A 5JW4Q 1KJMB 1AQKH 1CXFA 1UWEH 3MJ9H 1BF2A 4W6XB 5C0BB 4ZNEA 3K8LA 1EFXD 4N26A 3D4CA 1R5VB 1CDBA 1WAAF 1OHZA 2R4RH 3LV3A 4ENZA 3LXCA 3L3IB 1TKWA 4J39A 2YFNA 3HNVL 5IVXB 1EAPA 2BXYA 3QZBA 1Z2KA 4AJWA 5KYUB 5TF1H 5JIMA 4DZBA 3IFPA 2HWZH 1CFTA 4OFIA 4Z7OB 1A5FH 5CFHA 3X13A 1NC2A 2BP0A 1WRFA 2IGFL 2XKNA 4NJAH 4QOKD 2NY1B 4DKFH 5AAWA 2EDTA 4DO4A 3ESUF 3EJPA 3NDZE 1AGCB 2HFEA 1IKNC 3FH8A 3BLPX 1SBSL 4AITA 4AMKH 1FL3A 2CKNA 5AL0A 2YAMA 2IDUA 1NMAL 3F6IA 1OLLA 1R5WA 2TSAA 1LWJA 2FJGA 4WNQA 4XWOD 4LLUA 2Q3ZA 3IKCB 4OCXL 4R5VA 4KK5D 1W2KT 3DROA 1A9EA 4MNGB 3LZLA 3HCVB 2B77A 5TDNA 4DPAX 3M17A 1OD7A 1OP4A 2OMXA 1T0PB 2FLMA 3BX7C 3STZA 2A0LC 3EAKA 1J1XL 5FUOL 1FFTB 3BVTA 4DCQB 3CFDA 2C9PA 5D96B 1V3JA 1WP6A 3QHFL 4HD5A 1UM5L 3TA3C 4F37K 1NMBH 3MGOB 1F3DJ 4Z0XA 1OWRM 3FUFA 5AYUH 4P4RA 1H6FA 2BMKB 1XF1A 2WQWA 1S7VB 3G5WA 2WB1A 4MWFB 2ZYRA 4OUUB 2BSDA 1AY1H 2ZICA 4LPWA 1LNUB 3B1UA 5C0IB 4IK7A 3UADA 1YN7B 2QSCL 2WBJB 1KBGL 3RNQA 2H2SC 4AIOA 3V6FA 3K71B 1T83C 2KMWA 2O5ZH 1MSPA 4AZUA 1LD9B 4X9HA 4S2SB 3B7SA 3R19A 1KJVA 2EDOA 1ZA6B 3IWVA 3SQOL 3DXAB 4JGMA 3ZTNH 4N2NA 4TUOA 4UAHA 5JO5B 4UNVA 4P5TA 3U2SB 3BWAB 1H6TA 2NTSP 3RTLA 4EDXA 3GMPB 3RYMA 3DJSA 4X0NA 2BNUA 1XF2A 3IJEA 3UG4A 2J12B 3ZU8A 3PHQB 3KG5A 1ZLSL 4DO6A 1TUPA 4NO0D 4BSWB 1Y6KR 3DUSA 3FB6B 4X5XA 1K6QL 5FYKH 4NIKB 1BOYA 1P7QB 3QI9C 3T9WA 1T22B 1CBVL 4IMLB 2MNJB 3SGDI 3NCBB 5J12C 3MXVL 3OKLB 4U6XA 3CDYA 4Y19D 3D69A 4MNHB 5EBLB 2C7UA 15C8L 3FU5A 3CFBB 3U9UA 4KTEL 3S34H 4QRSB 2C9XA 3V0IA 2VJ8A 5HHPA 1HFUA 4P9ML 1IO4C 1WTGT 1ID2A 2J8UE 3WIHL 5IQLA 5KSVA 4NBYB 3VFNB 3LEYH 2ZUUA 2H1LM 1O9VA 2WLNA 4L9DA 5F3HB 2NY1D 4NQEE 4WW2C 1IVTA 1SLXA 4KX7A 1M05A 3MCKA 5T1MA 2J1YA 1Q4NX 1KCUH 3U1PA 2A74C 5M94B 2F5AL 3HMWL 3IDGB 4ODUB 4XOEA 3P0YH 5C0EA 5JHAA 1ZLEA 2VLRE 3CDGB 4PJAA 5L2KD 1X6NA 1XCWA 1PU0A 3L1GA 3BP4A 5I24A 2VDQH 2UUDK 4YSTA 4PJCE 2NYYD 4IS6B 2N59A 3P3RA 5EUKB 3TO4C 5E1IA 5LN4A 3CNKA 1EZLA 2IANB 4FYRA 5HP5A 2O5YH 4LASL 3QIWC 2HT4C 3HIZA 1IQWL 4FNTA 5BS0D 1DBAH 4UV4L 2EDRA 2G9KA 4FXGB 5GPRA 1T7WA 1CIDA 3TWCL 3ZKXC 1PSKH 3U6RB 1QW9A 1U3JA 5KG9B 2QVIA 4QPEA 5C7XL 3Q05A 5F97E 3CK0H 1LDSA 2ZF9A 1EXUA 2DIEA 3GMLA 1A6AA 2P8MA 4Q2ZA 5C6TH 4NC1C 1EVUA 1FNAA 5I8OL 3BVNB 3W38A 1A22B 4OB5H 2Q6WB 4YXHH 3LSOB 3L4TA 4HCIA 2DLIA 2HKHH 3LKOA 2GTWB 5D1XD 3RFZC 1OGSA 2Z31A 3CVHB 3BLBA 3D05A 2XZCH 4GFXA 2EDLA 4MMXC 1HHJB 4YEEA 3HZ3A 5F9WC 4NNYB 2WBJD 4A38A 4R9HA 3Q6GH 5DHEA 4JFFE 5E2VH 2XCMC 4PJEB 2Z35B 3S37H 2Y24A 2XV2A 4N2DA 4K94L 4DFHA 4ZAKA 4XGZA 3AXIA 1FO0B 3MRLB 4PTUA 3U4BH 4PY7A 1U0QA 5CD3B 1DVFB 1HQ4B 3PWPD 3BQUC 4JFZH 3OKYA 4GAYB 3DXAD 4GKZB 2ILLA 3FTXA 1KG0B 4KQ4L 4NN7C 5J1AA 2OKMA 2CU9A 1RZKC 2XBDA 1YYML 3I3BA 5I30H 2D7NA 3X12A 4ES8A 2AS5M 4BK5A 5LBVA 1QA9A 3GDBA 3LZPA 3VFRA 1ZXQA 1XSOA 3S96B 5C71A 3FH5A 1P7QD 3ZYJA 2ZG1A 5LJYH 3DGCR 5DO2D 1FNSL 3KH3A 1NCDH 2FECL 2IAMD 3EYFB 2A9MH 2OXGA 2YLKA 2DYRB 3UTSD 3G5XB 5FHBL 3VWJA 5DC0A 1ZD6A 2XN2A 5FHAL 4W4NA 1G4RA 5BOJA 4ANUA 4O02A 5J89A 5KS9E 3QCUL 2RMNA 3DX6B 1KV7A 3KPTA 2BVEA 4UQ2A 1G6RH 3FO1B 4I88A 3MFFA 5E6RB 3ZT7A 4F24A 1QFPA 1FAIL 1GA2A 1LO5B 1PKQE 1SFHA 1DBJH 3ZQWA 4UQ3A 4X4ME 5CP3H 3SO3B 1NCCL 5MEPB 4YXLL 3EYSH 4U1NB 1ZT4A 2DH3A 4P2CG 4ODXA 3UZQB 3F6JA 1K8IB 3WHE0 3C08L 4J4PA 3RAJH 2IAND 4Q97A 1CFTB 4KTDL 1PCXA 2FIKA 2F15A 3P3TA 2LU5A 4XT1C 4AG4L 4BUGA 3UEQA 1YEKH 1YHPA 2XKNB 3L9BA 5B7EA 1CGSL 1KB5A 4NPJA 3ETTA 5LWYL 1W8NA 2FT6A 4APQB 2HFEB 1MI5A 3B1TA 4GBXA 3N1MC 2X05A 4QWWD 1BV8A 4R3SA 4XMTA 3VXTA 4JQXC 4L5FE 3H3PH 5EA0L 4LLWB 2GQHA 3S2AA 4OCRH 3EYQD 4LLUB 4ANVA 5I0ZA 2AV7A 4X6DF 2VABA 3OMIB 1QO3A 5IJBC 3UBXG 3DJZA 1A9EB 1SVZA 4KXBA 4CVWA 3AWEA 4V1DD 5KYWB 4LU5H 2J4WH 1IL1A 3LKQA 5CJXC 1E43A 2R23A 5TDNB 5KBNC 2HX8A 4CILA 2OMXB 1QBLL 1JDAA 3QUYB 1IUZA 1NJ9A 1KGIA 3QJVB 2HFFA 1BCIA 4FFYL 4I77L 2OBGA 3LB6D 5IBTL 3EFFB 2ALAA 5I8EB 3FQNA 3EOYG 1FC1A 1WT5A 3NP3A 1YUKB 2A9AA 4BWTA 3H7LA 5JDJA 2IFFH 1FVDA 2ZX5A 1T5WB 2Z3FA 4OZGE 4MQTB 4TM9A 5EU7C 2ADYA 2C3WA 4N6QA 4HFUH 1PDKB 1E6OL 4X6CB 2YJLA 3SE3C 3V6FB 4LF3B 1OAUL 3IN2A 3FCUB 4L8BB 5I76B 1S7QA 4RX4A 1TLKA 4HXAH 4B9KC 1EH9A 3WJLC 3GQFA 4CMMA 2WW8A 1NFAA 4L9LC 1S7WB 1R4XA 5F7YC 2BY2A 3BCFA 4TUOB 2DTML 4WKZB 2JCCF 1OTSC 2E27L 1F42A 1RPQA 2I07B 2Y6SD 4B9PA 1UT1A 1LE5B 1NAMA 1HILB 2BNUB 2EABA 2J73A 4ZO9A 4R7VA 4HUVB 3CSYB 3UBGA 2IADA 2ZD0A 1JXJA 4WFHD 5B7MA 4NRYB 2DQIL 1OP5K 4GQPH 2F18A 4B3EA 2YOCA 3WUWA 4NCC1 1PEWA 1UKQA 2PCFA 2ATPB 3NFNB 2MOGA 3F7VB 3D69B 4X2UA 5C08D 4HYTB 3U9UB 4KH2A 4IKNA 2ITCB 4FQXA 3VACA 1SJXA 5KSVB 4N8CL 5HJBA 2X4RB 3D08A 3QXTA 3V5HB 4ODBD 3MA9L 5BUPA 3HI1A 4LAQL 4WWKA 3QIBD 4K3EH 4NNPH 5HJDA 1M05B 4U6VH 3MCKB 4APQD 1MIMH 2VYRE 3HE6D 4ZMWA 2IPTH 1XT5A 4NQSA 5D1QE 5FXCH 4AJ0A 3AADB 1J7VR 3OGCB 4Q89A 4LKXB 1RZJH 3QT2A 5FWRA 3ARTA 3SKOA 4BSVB 1V7MH 2G3NA 4FTVA 4BH8B 4MNQA 1IU1A 4HHWA 2NMSA 3BP4B 2WUCH 4K4KA 2C5DC 3QQDB 4N9GB 3VG0H 3FO9B 3QZOA 1MJUH 2R2EA 2YA1A 2DDQL 3HS0A 3MCYA 3OD3A 1URZA 3LEXB 4K23L 5KZCB 1E6JH 2Z9TA 3L3GA 2P7TA 3IS1X 3QUYD 2E7BA 4Z3HA 1KTDA 3WXVH 5FM8A 4ONHA 2DI7A 3AT8A 4XP4L 1EXUB 3FCSB 3GMLB 4O58L 4I1PA 2E8ZA 1TMCB 2P8MB 2Q10A 4W6WB 1S7TB 1LEGA 5GZOA 3FQYA 4JM2D 1EA9C 3T3MF 1RKRA 2SEBA 1MRCH 1YYLH 2B3IA 4MZIA 35C8H 1KLUA 3SBWC 2RIKA 4JDZA 2ERJB 3WDIA 1R47A 5G5DB 4WY7H 1IRAY 1R3IL 4LCYB 4HS6B 4AM0A 5I1GH 4CVZB 2C3XA 2QTEA 3G5YA 4MA8H 4Y9GA 4Z7QF 1EGJH 1KTJA 1NOLA 5I6OA 1O6VA 4OH2A 4ZAKB 1MCIA 1S2EA 3FOLB 3QEUB 4PJBB 4AMWA 1JIBA 3UMNA 4LESA 1XR9B 4KRPB 4LCWA 4UINH 3A6OA 5D8JH 4YGAB 5I1HL 4J3WA 4ZOCA 2H47C 1A14H 2AW2A 5BZZA 4U4IA 4OZFH 2AXGB 5I1IL 4H8WL 2JXMB 4ZS6D 2AJYL 4GIAA 2N4IA 4R0LA 2P80D 4C56B 1QA9B 3QULA 5FDWA 3BKYH 3UX9B 4BZ1H 3RGHA 2CKBA 1HCYA 2ZNWA 3DO4A 2BVPA 2EIZB 1T1YB 2YBRA 4KI1A 2PXYC 2AJZB 2WUBL 3P9WB 4XPGH 3WJMA 2J1KA 3OF6A 2NNFA 3L5IA 3CCHA 1H8LA 4L05A 2WVSA 3HUJB 1CDJA 2XY1A 3FK3A 1A6VL 1G9MH 3N91A 3OZ9H 3QQ9C 3PFQA 1Y1DA 4FZEL 3VWJB 4LSSH 2AAAA 4FJYA 3RGVD 4UQEA 2PW1B 2ITDB 4UWQB 1KMGA 1GZHC 2YAOA 3D3VD 5IMOA 4H25A 4QXTB 5E00A 5I6KA 3OPZH 4U1GC 1F4WL 5F6IB 1PLCA 4KVPA 1K5NB 4P2AA 1G7PB 3QQ4B 4UQ2B 5EZPA 4F7TA 4WKXA 2XTSA 1HZHL 5B8CC 1I3UA 4H1LH 1L6PA 5ELIA 5DXWA 1IAIM 4IMKA 3EW3B 4OM0L 1ED3A 4TNFA 4Y5VC 3S3JA 3EOBB 3ZJAA 3U4AA 4QYOB 5J9PA 1OXYA 1HJBC 3FFOA 1MCDA 5F9JA 3MRPA 3EO9L 1KULA 2WXNA 3EZ8A 2APSA 1LP9E 2Z92B 2EIJB 4E0RA 1KB5B 4JPWL 4ONGL 1ZLVK 4P0DA 3N3EA 1YEEH 1MI5B 2PETA 3VGHA 4MB3A 4GBXB 2GT9A 2AJVL 4JBSA 3ILQD 4JZNA 3LQZB 1MFVA 1GSMA 1BQHA 1OE1A 1YEIH 1J1OL 1DLFL 1V54B 2H6UA 2W1NA 3EF7A 4MRBA 3ZL1A 4HKXB 3H6JA 5IHZA 1AH1A 4PM1A 4FG6D 4N9OB 2DQGH 3C60C 1B0WA 4RDQG 1PFOA 4WSKA 2NCMA 4Y4KD 2K70A 1OGTA 3CHXA 3IMRA 1IB5A 4K5MA 4R97C 4YVNA 3QC6X 1IL1B 1TTCA 1TYEB 1BD2A 3CIAA 2NSXA 3WHXA 1VJSA 1BF5A 1ZWIA 4RGNC 4LAJH 1AAJA 1I1AA 5AW4B 5DK2A 2DTSA 4K15A 4KRPD 3VO0A 2QQLL 3THMH 5BOPA 4ZTPL 4XOBA 2R39A 3LIUA 2L4OA 5DC9B 4U3HA 5CEXB 1IEAA 3BXNA 4O2FB 5AOLA 1Q1JL 2B0SL 4CN1A 1W6LA 5DFWH 4OGXH 4K8RC 2EYTA 3JWDL 4NRXA 3E6FB 4Y4HC 2W0FA 5FYKU 2JI1A 4PWEA 2OX5B 4PJ7A 3EGSB 1LE9A 2G5UA 5KVDL 3WEXA 1PZ5A 3HNSL 1S7QB 4LSVL 3P11H 1U8OA 4A7GF 4K0OA 3UROR 5C07B 2EVIA 4CMMB 2AC0A 1FVCB 1IIIA 3BHBB 3BT2H 1KLGB 4LO9A 3BVUA 3N40F 4CJ1A 4HQQH 3ARBD 3E8UL 4XE0A 1N59B 4ESKA 2IXQA 4G8IA 3Q06A 1NAMB 4RZCB 5GQBA 4GW4B 5BOZG 3RX8A 5FO7B 2P8LA 4AI7A 1BMZA 4AK2A 3DO7B 2UXVA 1NMCC 4KHTL 3G9VA 4PW9A 2AV1B 2X3BA 3L5XH 2FLBT 3H2WA 4N0CC 4Z9KB 1J5OH 1UH2A 4ZTEA 3WUWB 3QNYB 4Y4FB 5C0CE 1VKXA 2UZYA 4IGBB 4GQ9L 3S3CB 5IEKA 3PNWB 1QRNB 5I5JA 1TITA 3LN4B 2Q3XA 4RGMB 3P54A 2OMYA 5A2LH 2OMTB 4FQXB 3QDJE 1RQ5A 1INEH 2GJ6B 4BXSV 1MIEH 1WBXA 4QHMB 1UZ6F 5I75C 3ESNA 2XSKA 3KWXA 2G60L 1LMKA 4G1MA 3Q48A 4JPQA 3FU3A 3VXQB 1FNGA 1S9WB 1E27A 5J13C 3U4KA 2EIKB 3RPKA 2YD5A 4TSCH 5IV2A 3U2IA 4I0KA 4N28A 4M6NH 3TTSA 1ET7A 2YD4A 2EH8H 4MNQB 1KWGA 2W5PA 1U58B 2EO7A 4NQDE 1OB0A 1TG8A 1YECL 3DX9A 3QO0B 5H37A 4AH2A 4QXGH 1NKOA 2AEPH 3QEGH 5LBSA 1I8MA 5KYYB 2NR6A 1AS8A 4EKXA 4TLUA 3T3PB 5JDSB 1LO2H 5A6IA 1UVQB 4U1KA 4PR5B 3I02A 2H0PA 4OLZH 3TXAA 1R1CA 3VGAB 3RVTD 1WK0A 2X70B 4HEPA 1GGYA 4G8GA 1OTTC 4KQ3L 5C3LD 3O2VL 1WWWX 1LEGB 3A6CL 1TSHA 1UA6H 3O0LA 1WO2A 3V4VH 5ABAA 3WO3B 1MJJA 1KLUB 2VAJA 5MERA 5D5MB 3ZHKA 4OBRA 2GIYA 4R8WH 4Y1TA 3QZPA 4IJ3B 3GBDA 1CFSA 3VI3F 4YFEA 3CPUA 4QGTA 2AKRA 2P5PA 3ATFA 3ZZ1A 3ZKMD 4LVHB 4AIEA 3JV6A 3TURA 3BSZA 5BRQA 1YPZA 4GUPB 2A9CA 3ABZA 3AT0A 4F7PA 4LLMA 4RGOH 5KVEL 1G1YA 3ZHNA 4FQLH 3EFOA 1BGXH 1KPRB 4KKQA 3RL2B 2WLLA 3KGSA 5DVLA 2ESVB 4P5RA 2VMCA 2VM9A 2W9LA 2GHZA 3QULB 1ORQA 1QYGH 3EJYC 3LNFA 5E8NB 3IGUA 3QEQB 1KZYA 1TENA 2OL3A 4JO5A 4YE0A 4YDIL 2VB5A 5FGRA 3F7YB 4Y4FD 4YHOL 5I1KL 3MXWL 1U3ZA 4IGBD 1SY6A 2UY7A 3SCMC 1JYWA 4PG9B 1QRND 4FFWC 3WFHA 3ZKSD 1IEHA 2ETWA 4U1LA 2ZOKA 4PJ8B 5DD5L 4LOFA 4Z7UE 1SNRA 1KPUA 1QABA 2CHXA 1LK3H 4AV5A 1M2VA 1WZ1H 3LKNA 4H25B 3FU7B 2AEWA 2WWMD 4K71C 1R3KA 2HLAB 4GKSB 5I17B 3D6GA 2C4XA 3WKYA 4B53A 4S11A 1JGIA 2V0AA 1VB9A 3DPDA 4RRPA 5HGBB 1AQ8A 4N4YB 4R4BA 1PLGH 2YOAA 5GRJL 1Z9SB 4EVNA 4XO5A 1AGEA 4FOMA 4YFDB 5JIKA 4R6UA 3GM8A 2FR4B 2XA8L 1Q94A 1YEDB 3EYVB 5JMOC 2OMWB 4P07A 5DZVA 2X4QB 3CUPB 3MRPB 3ES6A 4GG6F 1OSPL 2XNAA 3ULSB 4I2XB 3NACL 1FG2B 1D6EB 3W56A 2OV0A 3ARFC 1BVNP 4GXVL 1YN6A 2G5RA 4JAMB 5I6XC 4KZEL 3EUDA 3MA7A 2VXQL 2WLIB 1QI5A 4GI6A 5DU7A 2GT9B 3HAEA 3AREC 4OGAD 3LXBA 2EKSA 1MCWW 3WIFA 5IB3B 2DLFH 1EK3A 1A4AA 3W5NA 1MQ8A 1BQHB 4F8NA 3JUYA 3U0TA 4M7JH 4WI5A 5LKNA 4H2CA 1QTYT 4KK8C 1JZ3A 4ERSL 1IGFL 2UZPA 3I6GB 2EDDA 4U1IA 1TNMA 4HJJH 1BSIA 2FX7H 1S78D 2NDFA 2R51A 1C5BL 4NM8L 5D70L 4WI3A 5MHSD 4RETB 3WE6B 3DIVA 1BD2B 2FNBA 5HHQB 5EIIB 3MV7B 3CPLA 2ENJA 3PQYE 1H0DB 3MX0B 3GRGA 4TVPE 2HB0A 1F18A 2JJTA 3UGUA 5EU4A 4PLOB 2Y5TA 4LKCA 3ZE1B 2QGEA 5C2BH 2YJQA 3HMXL 4OIIH 5H35A 3K72A 1HNYA 3CG8A 1Z9NA 1X9LA 3HR5A 4PJ9A 1KY6A 3SZ6A 1WE5A 3FT4B 1A4JA 1VFBA 2FEDC 3KGRA 4XZUB 5K39A 3V9EA 4ACPA 5F89B 1SEQL 2FVNA 2JE8A 4OVVA 5DRNA 4FG0A 4P2RB 1JUFB 4UYQA 5GSVA 4PQXA 4YR6A 4OFYA 3BZ4A 3K0YA 2YD9A 4UTBH 1SFDA 3ISRA 4PJ7B 1L9RA 2MCAA 3S7GA 3FXIC 3E8VA 2XZZA 5MENE 2ZWNA 3ARPA 3EBGA 4JG1H 3TPUA 5FYJE 1EANA 3FCBA 3NBNA 2V5SA 3ORJA 2A1WH 2KZWA 3HE7A 2DM3A 1BVNT 4RVBA 2ZP0T 4HC1L 1BQLL 5ICXA 5L4IA 1J11A 3WNKA 1CDIA 3N5AA 2LU4A 5BXFA 3W9EA 5D2LE 1D9KD 3BUYA 4QT5B 1IC5H 3L5HA 3HBGA 1KN2L 3F62A 5C0AA 5IZ7A 1P5VB 2FQDA 5DD3L 2EC9T 2OMVB 2WLJA 3T65A 1I1YA 1LM8V 1KCSL 3QCVH 4U7MA 4UT6H 5DD0H 5F6HJ 5IVXF 5FR3A 4PLKD 5I71B 5I82A 1XB6A 5ADOL 1HINH 4NKQB 3TT1L 2NY5H 3EO1B 4Z7OF 1K5WA 1CI5A 3HFML 2ZXQA 3H55A 2MPVA 4M6ML 3VGDA 2F19H 2DQFB 4Y7MA 1VADA 2GY5A 3EDJA 3MBWA 5ECJE 3RWJB 3CZGA 5E0FA 3VCLA 3QJFB 3LY6A 4PCSA 2ZCHH 1HXMA 3ULUL 3FRPB 3KYKL 3FU6A 2PWGA 4MA3A 1Z32X 2J1XA 3H8NA 1RUML 2NZ9C 3APDA 1QFWL 3ETBJ 5BZWB 1VZGA 3O6FD 5JHDA 3QR1A 4Y0GA 4MMZA 3OKNA 3KLAA 4TUJA 2HH0H 5JXEA 3Q8BA 3B9EA 4Q6IC 1X9QA 5FO9B 4L3EE 3KVDD 2CA3A 1YZZA 3DHPA 1ZJAA 4AH2B 1S3RA 2X2HA 3PV7A 4JFHE 4MSWA 2DJUA 3O2WL 2F0CA 4YHML 1AKPA 4G83A 3ZYZA 2QDWA 1OF0A 1RUKL 4G6KH 1I8MB 1FH5L 3MV7D 5T33H 2EDBA 3PHSA 2J1WA 4KITB 3KPRE 4U1KB 2ICEA 1SVCP 4HIIA 1ZHKB 3PL6D 4WEEA 3WN5C 5CCJA 1A25A 1WA2X 2IH8A 4OCYH 5IVOA 3QAZC 1N4XH 3LRLA 5LUMA 4JHAL 4YHLH 1KBWA 2NT0A 3EFDH 3AG3B 2JB6B 4U05A 2EE3A 1F97A 2GK2A 2NY3D 3L9RA 4M3HA 5C0FA 2XZAL 2N7AA 3PWLA 4MDIB 5F1SA 3NSCA 4ZDHA 5IJDC 1MJJB 1C16B 4Q9RL 5MERB 1QI4A 2K3HA 4P2RD 1E8XA 1FLTX 4XVSH 1CD1B 4OKVB 1E5CA 4JHWL 2RGSA 4Y16D 5ILTH 2APVA 4YSQA 1OAYH 2XWRA 3JV6B 4HT1L 3QXAB 3VXMA 3W0WA 4EIUA 3AY2A 4OLVL 3TM6A 4OV5A 4P2QE 1JZEA 2VN6A 1X7SA 4OF5A 5AVTB 2FX8L 2FQFA 3RVUC 2WWKT 3DUHA 4F15B 5D6DC 5GS0L 1BOGA 1NDMA 2WLLB 2QMJA 2IH1A 3QUZC 3WJJC 3WTUA 4Z3TA 3OC8A 1YQVL 2EXTA 1CYXA 2IDQA 1ORQB 3QPKA 3M07A 1OP9A 1Y07A 1VA9A 2OM5A 3MHZA 3N40P 4GO8A 3ARGD 2X2YA 12E8L 2J56A 2EUXA 4HSCX 1S9YA 2HT3D 3CVHH 3UAJA 1V8HA 4L3FA 4NB7A 1HKFA 1ORSB 1CE1H 4PCYA 4P3DB 3GUTA 5E70A 1II4E 3WLWD 2MTPA 3CZKA 4C4UA 2I60L 1A6ZA 2WVVA 3A4EA 5IHUH 3UTPD 1FO0H 3VX0A 2QHRL 3RWDA 5DHMC 5LDSA 3LKNB 4P23C 5F7WC 2N3JA 5L2KA 4P2OA 2G75B 4Y5YC 1TVHA 4CGUB 4LSUH 4ODTH 5E7FA 9CGTA 4P46C 5KSAB 3OAUL 2CPUA 4R4BB 4R7NB 2YZ1A 4EVNB 3SQRA 4XNYH 1KGCE 1AGEB 1MXGA 4X7SH 3QSKB 1C8PA 1P2CA 5CBEA 5BS0A 1WZKA 3DO3A 3JYBA 3P9MB 5B4MD 4M4RA 2CA4A 3MLYH 2VW6A 4NFDA 4P5KA 5TQ2L 4XC3L 1EJOL 1GC1H 1T21A 1TTRA 3PDGA 2W0KA 3KCWA 1PLAA 5JR1H 4OQTA 3LH2H 5JXAH 1DL7L 1VFAA 3GSQA 1UJ3C 1MFBL 3MA7B 3OHMB 3BDBA 1NKGA 2VR4A 1OAKH 1RIUH 3VE0A 1AI1L 2EKSB 2NOYA 2GAZB 3C8KB 1Q8MA 2Z64C 4MKTA 1BFTA 2Z7UA 3U0TB 4NCDA 4PJEF 1QATA 2Q7AA 4DKEH 3ARXA 3BZFB 4FAAB 5GS2D 3ZKQD 3CFQA 2DWYA 3N41B 4ABVA 5A3IC 5IT2H 1NBZA 2B16A 4GQRA 4M61A 4XAWH 5SWSE 2MCG1 1YAZA 1H3TA 4ZK8A 5TF0A 5JORA 1L9OA 1R5IB 3I6LD 1JZ2A 1ZANL 4LHUB 2NW3A 5AYQA 3NJMA 4LGSB 4B0MB 3WFZA 5KAQF 3S88L 3BUTA 3DA0A 5HYJE 5GRZA 2QGDA 4P4KA 1DCLA 1MG3C 3JT0A 1BX2A 4FFZH 4S1SL 4ODWA 3FT1A 4LKCB 4S1DD 4PJDF 4TMPA 5H35B 1TZIA 2EDWA 1BWMA 3ZE2B 1A4JB 1G1OA 1VFBB 3L7EA 2IGTA 4FQPA 2JJSA 1CR9H 1TTUA 1XZ0B 2CGRL 2V4LA 3WN6A 3APFA 3FONB 3IETB 3F3HA 5DRNB 4YO0B 5FECA 5JA8B 2EDXA 4NAMA 4YR6B 3C6EA 1LK2A 3HBQA 1DQML 2CLVB 2IAMA 2K8QA 1JI2A 3B7RL 1OARH 4DN3L 4V33A 4D0CB 2X6BA 2ZOWA 5BRZD 4K7PL 5DS1A 1V7NH 5DHYB 3ZQXA 4KDTC 1NCAL 2H2PC 3CSGA 4WIQA 2ZXCA 4I5BA 1NCBH 2FO4B 5ICXB 2C1PB 4JO4H 3DOSA 3AM8C 3IMWA 4BCZA 4DEPB 3RTQB 1N5YL 2BERA 1QLEL 3W9EB 2KPNA 1U9KA 4HEMA 3O9WB 4XPHH 2Y7NA 3BP6B 5DJDA 2FQEA 3V7MA 4DPBX 1MNUL 3L3OA 3T65B 1GJIA 4XCNB 1J0HA 4PGEA 3RZCB 3RY4A 4JB9L 1BDYA 2XN9D 2ZUWA 1ASQA 4GI9A 4LLVA 4OD2A 3BUQA 4N68A 3RIFK 3P4OA 5JPMB 2GI0A 3EJJX 5KSAD 1BVKB 3VYOA 5GIRA 1ZLUH 5DGRA 2ARJA 1I1RA 3EO0B 3KXFB 2XWTA 3AU1A 2J21A 1RD6A 3MBWB 2BWDA 1XGYL 3OBAA 1U3HD 3L4VA 5CLZA 1AHKA 3QUXA 4IRSC 4L1HA 4OIBA 1UJTA 4YNYB 1P9MA 1MHHB 4JJOA 5ES4B 3HI5L 4XPBH 2F8IA 5DQDH 4LCCC 1AS7A 3NEXA 2ROXA 4WVRA 1U8IB 1TTGA 3OJDB 5JHDB 4FFTA 3APMA 3OKNB 4ZNCD 2YK1L 1E5AA 2P1YA 4TUJB 4Y5XB 2QQNL 4TLSA 3EDFA 4V1DA 3HNVH 1DZ0A 1NFDA 2WXPA 4B9GA 1S5HA 5D1ZB 5TJWK 5MEOA 4X6FB 5C9JB 2Y1VA 2NNRA 1N0LB 3I75B 4X0KA 3P69A 3RVWC 1FLRL 3HHRB 4AW4A 4MSWB 2X9XA 3AB0C 1MVYA 3FTWA 1ZV9A 2IGFH 4KI5D 2B3RA 3IDUA 4RH4A 3DYPA 1WAAE 3A24A 1JGLL 2E9BA 2YXWA 2ICEB 2Z4QA 2QPDB 2ADJB 3GSXA 1OT2A 3NESA 4HIIB 1G7MA 5J1TC 1T89A 1SBSH 1PS3A 3V2AR 1BFVL 2H32B 4PJFB 5LGJA 5CGTA 2AK4E 4X6CF 1T1XB 1TCRA 1NMAH 3Q1SL 3L9RB 1RZFL 2NY2C 2YO3A 5CF3A 4ZDHB 1WC7A 2ZOLA 2PYFB 4M43L 3BEVA 3VD5A 2XLLA 2MNUA 4FQHA 4EBQL 5I5MA 2MWCA 4WV1A 3SYAA 2WNWA 2D4FA 4X4YB 3PJSB 5B3JF 1FFNB 1J1XH 3E0GA 3VXMB 5HGDA 5FUOH 3OG4B 3LX9A 4LK4A 1URIA 3VJ6B 1IMHC 3KPSE 4DGUA 1RPUA 3QHFH 2WJ7A 1JG9A 1UM5H 3FKUS 3RTQD 3CFKA 5SX5K 5J7CC 3TN0A 3DX0A 4NPKA 3O9WD 1T5XA 3POCA 3T2LA 3UTTB 3ULVL 2E46A 3ZVVA 5GGQH 4G6FD 5HDRA 3U6XA 4CUCA 5F7LB 1EVTC 1IJNA 2MQGA 3C6SB 1P5UB 2QSCH 4HX1A 3RVXD 3SDDC 3ZLQC 4F91B 1KBGH 5C08A 4OF8A 2IFGA 3M7FB 3REWA 5DURD 5EPMA 1QWHA 4PB0L 3RU8L 5C0JA 3Q01A 4JE0A 3WV0A 4KO9A 4OBSA 1LDPL 4GRMA 3R4DA 3CH1A 5DUML 3QJTB 3C5SA 2DY2A 1UOKA 3QFJB 3SQOH 4IHBA 4PRBA 2CBMA 4JANA 1RJLA 2CRMA 3QIBA 2P9RA 5IQ9A 1S4IA 4K9EC 3HE6A 1ZTMA 2H3XC 3QNXA 4UM8B 5DI8A 3QORC 1F5WA 5IEHA 2K6WA 2YXFA 1ZLSH 5GGRY 1JL8A 3JVGC 3QXUA 4UB0H 1JWSA 1K6QH 3RZWA 5MEQA 1XGPA 1TVHB 1CBVH 2XIBA 2VNCA 5D7LE 4PRHB 4MQSB 4R2GB 5D71L 3MXVH 4XXDB 1X4YA 4H26A 15C8H 1AP2A 3FUDA 5EU6B 4XBMA 1WA0X 4KTEH 4PRPE 1M3JA 3QEHA 4YXKL 3RX5A 2OTWA 2OW7A 1H3UA 4KOBA 4P9MH 4M4RB 4MA7L 1YJDL 2PMZA 3WIHH 5HY9B 5A2IH 2AXWA 4ZMPA 3DUUB 5EHFA 1KB3A 1AZUA 1DFBL 2CRYA 3B7TA 4JDTL 1V55B 3IJSA 1VFAB 5CD5C 5H2BB 5C0DB 1RMFL 2F5AH 3HMWH 1QR4A 4DTGL 1MWAA 3TVMD 4HETA 5GRYA 3HB3B 5ENWB 3US1A 2HMID 1K4DB 3QHZL 1R33A 2E59A 1XGQB 4PJBF 1CLZL 1NBZB 4M61B 5HDOA 1T7XA 4ZPVA 3ESVF 3QDAA 4LASH 1IQWH 3PCYA 4UV4H 1L6ZA 1I3RB 2JB5L 3TWCH 2IH9A 2DV6A 5DJCB 4UQ9A 2YD8A 2I69A 5C7XH 4NX0A 1BX2B 1QMUA 1MCJA 3IJ7A 5EIQA 1O7DC 3CU1A 5ICZB 3W39A 4Z7VE 4KXAA 5E6IA 5IF0A 1MCRA 3QP3A 2P80A 2VMJA 3F05A 2BWIA 2YPLB 2HG5A 3NDYE 4NQED 5I8OH 1QBML 1J87A 4JZOA 3UTTD 5FYKE 2EE9A 4X6EB 3I9PA 5G4MA 2XWZA 4WDIA 1M42A 1NC4A 1SDAB 4WU7A 1LK2B 1PQZA 2PCXA 3HUJF 2VR7A 2H8PB 5D2NC 3O4LA 4L4TE 2FZ3A 1NUFA 4K94H 1TJXA 3MLRL 4QRTA 5IESL 4KKCC 1WS7A 2PCPA 4I5BB 2YGNA 1AZBA 3RGVA 5LAXA 3BZEA 1JPGB 3RX9A 1J48A 1CC3A 3QFJD 1SLVA 3KVPA 2DM2A 2E7MA 1OY3B 2OI9C 4Y89A 4KQ4H 5B1JA 4IU2A 2NSMA 5KOVC 1KENL 4OM1H 1YYMH 1EV2E 3L3OB 3OQ3B 4PGEB 3B9KC 4HFWB 2XTJC 4IBVA 1VFUA 2JKJA 5FGCE 3F7PC 1FNSH 1MF2L 4PRHD 1IAKA 4JFDA 5GGRA 5K9OB 3QW9A 2PPFA 4L4VE 2ARJB 3C5ZA 5EU6D 2XWTB 3AU1B 2KLTA 4P3WA 3LZRA 1RL1A 4JFFD 3OXSA 5FHBH 3S3PA 4UQDA 4DVRL 3KLSA 4B7IA 1Q1PA 5EB9A 3BN9D 2G9HB 3QCUH 4F27A 3BPNC 2VRKA 3H9SA 1FDLL 2X3CA 4I7ZC 3FTGA 2F53A 4JVUA 1PZ3A 3CZLA 4MD4A 1TSRA 1KGYE 4MCMA 1IM9D 3GIZL 3F58L 4XTRD 4Y4KA 3ZUCA 3OXRA 4ZJ9A 1FAIH 3KLQA 4M5ZL 3ARZA 4LB8A 3O4OC 5I2IB 1F11A 4YXLH 1ET5A 1NCCH 4YWGH 1NFDB 4PMFA 1U8NB 3C08H 4FYQA 4KTDH 5ERWA 3VW3L 3LXUX 3IAQA 4AJVA 3BPLB 2O30A 3QFDA 3TEZA 1E9OB 2QPEB 1LILA 4OIAA 4AG4H 2WNKA 1TVBA 1Z9PA 2O61A 1CGSH 1PZAA 4R5TA 1DQTA 2HLEB 2XYCA 5LWYH 4WTQA 2OYKA 3D09A 2JIXB 1DVUA 4NZJA 4GNKB 1L7IH 3JWOC 1FFOA 3BP5B 1YY8A 2VO5A 2P5WA 3BC9A 3X1GA 5DRWB 2WQUA 2YPLD 4LOUD 3JWNE 5EA0H 2L7JA 4IRJC 3VD0A 1WC7B 4BFGA 2GJJA 3BEVB 4WO4B 2FLRT 4FQHB 3QXWA 4AGLA 5BO4A 3VXRB 4IDJH 4HPOL 3OTTA 2IQAA 4WV1B 3NGBC 2AP2A 4KGLA 2R29A 5HI4C 1QLEB 4WI9A 1QBLH 4ODSL 4U0RB 2ORBL 4MJ2A 2A6JA 4I77H 4FFYH 5ECGA 3IDNB 4PUBL 5IBTH 4DKDC 5AENA 4FA8A 4N1CA 4X6DE 5GS1B 2ZKHL 3EGXB 5E8OA 3CFKB 4NQXA 3GBML 3ZSSA 3O8XA 3TN0B 2MIZA 1W15A 1EEUA 4HS8L 3U30B 5IIEA 1Z7JA 5GSRA 2EYRA 3VXPB 3MUGB 2K4WA 2M83A 3LPGA 4KJQC 1I8IA 4UMGA 1CL7H 1D7DA 2OXHA 4HISA 5T1LA 4Z78B 1VLXA 3G6AA 4NKDB 3GD1C 2EDKA 1S9KC 4HGWB 1EO7A 1OAUH 2FD6L 1XMWA 2EDEA 3REWB 1JAEA 3T5WA 3SD2A 4E5XB 4GRMB 5B1BB 3T2NL 4HK0A 3WNNA 1J9SA 2DTMH 4RAVA 3X11A 4JANB 1RJLB 5DUJA 5TDOB 2E27H 5FPIA 5IQ9B 2YAQA 1B4LA 3GIVA 4OF3A 1PG7L 2JLLA 3D39D 4JS7A 3ZZLA 4HGKC 2VSKB 4JRYA 1MXDA 2FB4L 4HAKA 3BDXA 2DQIH 3OLGA 4KTGA 5ANHA 3FU8A 3L4XA 2XG4A 1ADWA 1KCRH 2CHWA 3Q8AA 1AP2B 1H15B 3T3PF 1JSYA 4AKPA 1JTOA 4AENB 2OTWB 3O3BA 2ZUTA 2VUKA 4MRCA 1EZVX 3EHBC 4PY8J 3VYPA 4N8CH 4RQQA 5F0LB 2EXWC 1RZKL 1PZSA 2V2XA 3ZSTA 2FRGP 3MA9H 4RMUA 4LAQH 5AB0A 2R8SL 3TESA 3DVNB 3IJSB 2JIXD 5D5MF 2VR9A 1PVHA 4K7PX 1X5AA 2MMXA 5L7XH 3BKML 3B2DC 1K4CB 3PS6A 5EBWA 5E8PB 2NY6B 5J5EA 4LL4A 1HSAA 2ZWYA 4BQ9A 4GY4A 1AJ7L 2P28B 1KGJA 3QR0A 1BQ5A 2APFA 2C4FU 3SDXB 2DDQH 5IHWA 3TYGL 1WITA 1JPFB 1RULL 3VXRD 3PGCB 4K23H 2XVKA 4ZFFA 5GISL 1X3DA 4KZDL 3VFSA 4AMXA 2F7IA 1XB3A 2WMPA 4YDVA 5I5IA 3OAYH 5J4MA 2D9QB 4M5SA 3WIIL 3W39B 3D4YA 4XP4H 1D5MA 2BSSA 2IAAC 2NXZB 3L16A 4O58H 5E6IB 5SV4A 2F74A 4JO1L 4LSQL 1CG9A 3Q3GB 1RSFA 2V17H 3MN8A 3PXLA 4P5MA 5E2UH 1T4KA 4Z3GA 2Y7QA 2MH4A 2W60A 2YRPA 3X3GL 1U92B 3N1GC 5D1QD 2KS0A 2FO1A 1PYWB 4WDIB 4XX5A 3V6OA 1NC4B 2WP3O 1CE6A 4WU7B 1R3IH 4ORGB 3JYCA 1TQCC 4NDMA 3HRZC 4HULB 2ODIA 1WZLA 3OL2A 4YSSA 3RFZA 3T3ME 3WNJA 2VDPL 1IBYA 5KSBE 2G2RA 3FTYA 2X1QA 3BZEB 1GR7A 5DR5L 5I1HH 3FQWB 1UCTA 4NZUL 1RAMA 3HZMA 1SN2A 2VKWA 5FGSA 1X5LA 4Z7QE 5I1IH 1VSCA 4AC4A 3JV5A 1CXLA 3O2DA 1ZPUA 2XKSA 3NZHH 4FI6A 3UYPA 3WNPA 1D5BB 3KR3L 1FYTE 1UXSA 4XO3A 5JQIB 3EYUH 4POZC 5C09E 2A83A 4D8PB 5D93B 1KXTA 2IMMA 1EJFA 3B2VL 1DQIA 4J12A 5GZNC 3X3FH 2WUBH 3C6LA 4TQ8A 2F9BT 2F8VA 2JKTM 3C5ZB 3D87B 4HCRL 4HA1A 1UXWA 2V2TB 4M3JA 3B8SA 1A6VH 2X4OB 4FZEH 3VXSA 3AJ7A 4R7DA 2O5XL 5IOKA 3TBWA 3HI6L 2F08A 4D7PA 3DX8A 1FZMB 2NNCA 3AG2B 5HDBB 4KOCA 1QEXA 1F4WH 2F53B 1D5XA 4UQIM 3CFTA 1CFMA 4FL4C 1KXVC 4PJHB 3MRQB 2ZPKL 4YVUA 1HZHH 5SX4H 3REVA 4A37A 4AGNA 5EF1A 2MKLC 2NY6D 3QG6A 3B7YA 4OM0H 1SUJA 4PJ5A 4ZMAT 3BISA 1X7QA 1PD1A 2ADGB 3ZE1F 1SDDB 3OR7A 2ICWJ 3EO9H 4CVXA 3EH2A 4L1LA 4HMDA 2O61B 4UTAL 1DVXA 3INOA 5T8IA 4JPWH 3CLEL 4ONGH 5F7DA 4HH9A 4H5SA 3G6DL 4KUZL 1NCWL 1RHHA 5DFVD 1OAQL 2ZSVA 3MRHA 4X4KA 4NQVA 4PGJA 2AJVH 3RRQA 2WM0A 5EC1B 1Z5LA 2P5WB 4PW3A 4PJ7F 2P26A 2F54B 1J1OH 1DLFH 3PAZA 5I1AA 5AG9A 1IM3A 1BQRA 1YEGL 4S1RL 8PAZA 2SODB 1EEYA 2D2CC 3OLIA 4KK9D 1E9QA 4G7YL 1XF5A 4N2OA 2QKSA 2KBGA 2OS7A 4HVBA 3SGKA 3O3UN 4E9LA 3WDHA 3AWGA 5AAWC 2P5EB 1K2DA 2JF1A 2FJFB 2WXJA 4CMHB 1GW0A 5ACZA 2H3NA 4IKLA 3GJEB 5IBLC 1D9KA 1AGDA 4UT9A 1MFMA 1GS6X 2KHAA 2QQLH 1BVLB 4LPTA 3L3DB 1XV8A 4ZTPH 2G5BB 4NQXB 4A7QA 2Y4SA 3A4DA 5AVSB 3OGOE 5E9DA 1RP9A 3ATAA 1Q1JH 2B0SH 1OPGL 2VIRA 5GSRB 4AYFB 1CYGA 3EYOB 2WZAA 4ZX3A 2C9WA 1GXEA 2NW2A 3JWDH 4OQ1A 1JV2B 1R24A 4NUPA 1XIWA 3U4EA 1I82A 1XCXA 5KVDH 2BOLA 2K6ZA 1X7TA 5GS2H 3HNSH 4KJWC 5F21B 3MV01 3BMVA 4LSVH 4P8QA 5EFIA 4AT6A 3GLEA 3GWJA 4B9CA 1HXKA 5L4FA 1NWPA 1G1CA 2PPAA 1J5HA 4TNVK 3MRKA 3A23A 4YAQB 2FIRT 1F3JB 4RAVB 5TE6L 1WG3A 5DVOA 1QVOA 2UYLB 3E8UH 2BNQA 3GMMA 3L4UA 4ANKA 4GYBA 3WTVA 3OAZK 4JHVA 3HG1E 2NY7L 2VMDA 4JRYB 4KHTH 4JFTA 1CDYA 2K4AA 3I2CL 4U0QB 2ZCKL 3V5DB 3OC5A 3RPIB 1M1SA 2F1EA 1KACB 3SQBA 4G8AC 3Q13A 1WPCA 2FK9A 3IWUA 4GQ9H 4OKDA 5GS3A 2DYSB 4NQCD 4GO9A 3ALPA 5IOPA 1NIFA 2DI9A 3O3BB 3CFEA 3V10A 1DEEA 4P5TC 2R1XA 3OB0K 1OP3K 1KIUA 3QI9B 1WUZA 2V2XB 1RFDL 1YMMB 2JV6A 4BFEA 3KPMB 5IJVB 3LS4L 2WLZA 5J12B 1YNKL 3BAYA 3GSWA 1SEBB 5E2TL 2G60H 3ZPDA 5LCVL 4IBWA 5A7BA 4GQQA 3PU7A 2DWDB 3AQYA 1OPOA 3FJTA 2C3VA 1HVXA 1AO7E 3LYRA 1HU8A 2F54D 1T1WA 3C5JA 3D0LA 3T0EE 1UZ6E 4WW2B 2BVQB 2AZAA 1WBYA 1YECH 4R96B 3D51A 3IJYA 5HYIA 2E4TA 2X3AA 5CEYB 1NGXA 3S4SG 3GMRA 2Z7WA 3QWQB 4G9FB 2C9UA 4RLDA 4ZFFB 1KYUA 4Y1AB 3FUMA 3VFSB 2IG2L 3U0WH 1VGKB 2ICWB 3FFDA 1VF5C 4K5NA 4L2YA 1ZA3A 5TE7L 3ATEA 1S7RA 4HV8A 2IOOA 4LPCA 2EEAA 3TO4B 1BLNA 1D5MB 3GSNL 5IR1A 2F74B 2WGXA 4KQ3H 3O2VH 4O2CB 1QI3A 3A6CH 4KKZA 4P5MB 3U79A 4I18A 1T4KB 3S5ZA 5L6YL 1CD9B 1FNLA 1KELH 2Q7YA 2W60B 4UBDD 1FGVL 1IZKA 1VENA 4TVSa 3VD9A 4ONOA 3PWVA 5B1CA 1CE6B 2XYBA 4AKOA 5CR1A 1X9RA 4JFEA 4XNDA 4TUKL 1Q0XL 3TA3D 1BG9A 4MJJA 1INQA 1BHGA 3R0NA 5EBMA 3TH3T 2VDLL 2CWRA 3GBNH 3UFIA 4F5CA 2GCYB 3VX1A 3RFZB 4BGLA 5HGHB 4ZXBD 1HIML 5HHMB 5BQDA 4W4OC 2G2RB 5DLLA 4MMXB 3GHBL 2NXYC 3P4MB 2O6PA 1J8RA 2VRQA 3MV11 5CIPB 5F9WB 3SPCA 5KVEH 3Q2NA 4DF9A 3ATBA 3VI3E 3ATDA 1PG7W 4GAJL 2X9WA 1UACL 3E2HC 2KYIA 3OJMB 2Z31C 1JGEA 1JPEA 2GEQA 3U1SL 3KYMB 2W65B 1T6BX 4J27A 4OLYH 2H1PL 2PPEA 4PP1C 5DJAB 4DKAA 1OTUC 1XHHA 1HL9A 2A83B 1HHHB 3GRWH 4X7TA 4D7BA 4NENA 4YDIH 1KGUA 1BIIB 2BC4A 3CQFA 4QRRE 2YMTA 3C6LB 4YHOH 5I1KH 2DIJA 2F5BL 4JHUA 4A63A 3MXWH 3DX7A 3NCCB 3VFWA 1UXWB 2YC1A 2Q20A 4OCWL 3KGUA 1KDIA 3NAAL 3O11A 4OT1H 2GEEA 4XMVA 4R7DB 3QI9D 5DD5H 1YMMD 1HHIA 2PXYA 3ETBF 4YBHA 5T5NF 4YSPA 2IWFA 3VA6A 4BK5C 2OP4L 4K8RL 1BBJA 4DUXA 3W9DB 1MELA 2OJZL 3N41F 3HLKA 3WKQA 1BAWA 2JKIS 3I74A 5LGHL 4LT7A 1SXZA 3O45A 4AIZB 3O3EB 3CBRA 4MAZA 1KJ2A 4MDJA 3V8CA 1ZTXE 5GGTH 4GS7B 1U8HB 5GRJH 2B4CH 4W9LC 4P5SA 1C12B 1MHEB 2IDTA 2E76C 2E75C 2HVJB 4PJ5B 2GC4C 5HD8C 1WBZA 1NBYB 1X7QB 2XA8H 3DJTA 5IG7A 2BVOB 3VWJC 4OFPA 1SRDA 3OZLA 2VUOA 4YDJA 1AC6A 1BAFL 3MYZA 1ADQL 1OSPH 4G70B 1U8LB 4Y1AD 1Y1UA 5CZXC 3ZE2F 3NACH 1EO8L 4NZ8A 2X89A 2NLJA 4GXVH 4QOKE 5AKVA 5FWQA 3V52L 3N85L 4YSAA 4KZEH 2WV3A 2VXQH 32C2A 3G5VA 4KNTA 5A16A 1UFGA 4NQVB 2PYEE 4JUTA 3QIWD 2HT4D 1HSBB 1J8HB 3BSGA 2VL5A 5EUOE 4TKWA 1AGFA 4GG6E 5EO9A 1Q9KA 2VMEA 1XD1A 2OSWA 2ZKWA 4ERSH 1IGFH 5F8QC 1DQLL 1ZS8A 1VFOA 5CWSA 4J4PC 5BRZA 4IOSD 5IVZB 5GGVH 1NGWA 4X5QA 5ESQB 1C5BH 5TFSH 2BS9A 4NM8H 5D70H 3PAVA 5DHXB 1HX0A 4D0DA 1XCTA 2GJZA 3FFCB 5ACZB 1F90L 5J1SC 4E41D 3NCYP 3HMXH 4YPGB 1D6VL 4OZIA 3VNYA 4P9HC 1KOAA 2C9RA 3ARYA 3CXDL 4M9OA 2Q87A 1I4FB 4Z5RB 3WENA 1GYAA 3GMOB 5E9DB 3IAGC 2J72A 2XN9A 1GHFL 4FMFA 4J1UA 5DVPA 5E8EB 1SEQH 2Q5BA 5T5FL 2H32H 2IALB 3B2MA 4KJYB 2YAEA 3QAQA 4WUUB 4X9GA 4Q52A 4ZSOE 3BQUD 3OKEA 1W72L 3BSHA 1LL1A 4U6HA 4AT6B 4YBLC 5EFIB 3LDBC 3WBDA 4JDVA 1FCGA 1JHKL 4K5LA 3ESOA 2XICA 1IJ9A 4HC1H 1BQLH 2DL9A 4PRIA 3B56A 5KYXA 3RBGA 5GGVY 2DB8A 1WT5C 3OR6B 3DX2A 2VITB 3CSPA 3LRSB 1RXLA 4MHHI 2DW5A 5J6SA 5C0GB 1G7HA 1QVOB 2D7MA 2ODHA 1HKLL 4E9YA 2BNQB 5JPNA 4BD4A 1KN2H 3GMMB 4IU3B 1KCSH 4IK6A 1KYOJ 4LOVA 1CICD 2R9HC 2X0WA 3HZKA 1BFSA 1FUNA 3WOVA 1NBCA 5ADOH 3BI9X 4A7TA 2DM4A 4QIRA 3TT1H 5AYTA 4W9KC 3GUFA 2OMZB 5C0BE 3WTTA 3EJZC 3HFMH 2ZXEB 2BY0A 3R0MA 4KJPC 4BJLA 3ME0A 4LEXL 3DVGA 4JL2A 1M6OB 4M6MH 2F7OA 4WEBL 5IOPB 5IP4A 4PCTA 3UIZA 1YEHL 3CFEB 2APXA 5IVXE 5MEND 4U3XA 4MLIA 1H19A 2WIIA 5FYJD 3KYKH 1MOEA 4Z7OE 7PCYA 4F33B 3BAIA 1PX8A 1RUMH 3VVWA 1R3HA 3AS1A 2H7WA 3WTYA 3H56A 1OSEA 3M8OL 3T04D 2X7LA 1WZMA 3FU9A 2WSKA 3TBYA 1P84J 4RISL 1J8HD 1U2CA 3MROA 4RGMC 3FAXA 3TBCA 3QYCA 4FQXC 5AVVB 5BJTB 2Y2YA 1MAKA 1X5YA 3O2WH 4YHMH 5DD1L 4MNGE 4CKVX 1RUKH 3UTZA 1A1NA 3V7AE 4WHTA 3JTSA 2HFTA 4ALAC 1FH5H 4NO3A 4WWKC 4ZMZA 3L4CA 1ZA3B 4LL9A 2EJ1A 1IBHA 4YSDA 3CZUB 3WS3B 4E42B 5T5FA 2A6IA 1PW3A 4CSSA 1CD0A 2JKLA 1G7LA 4JHAH 5GGTA 1R3LB 1QTPA 3GZPA 4U31A 1ZT1A 4L0PB 5IMKA 5T3XL 3V4PL 3CFCL 4F9PA 3FUIA 4BKLA 3M1BA 1HE7A 2AQ2A 2WLKA 2XZAH 4D9QE 4EKJA 3ULUF 2ZTBA 3LKPA 4AL8C 1B3JA 1GGBH 4Q9RH 3CXHK 3HS0C 1UQSA 4LEEA 4HK3N 2VDOB 2D0FA 4WUUD 3CHRA 1L9SA 3ISYA 3VRJA 2CUIA 1PX4A 4F1SA 3EUUA 4JHWH 2DQEL 3CVBA 1INQB 5EBMB 4J3XA 4FABL 2YAPA 2O6FA 4HT1H 5C9KA 5F1IA 2AVFA 2J43A 1MFDL 4OLVH 5AG8A 3MRRB 5JHLL 2FX8H 2G3MA 5JTWA 4OI7A 1GMIA 1P4BL 5GZOC 3L6FA 4MAYD 3DXAE 4RFOL 4BE6A 4F7MA 4EZKA 3KPRD 4FNQA 5PCYA 4BA0A 3ZQ9A 1MDAA 3B7UX 1TIUA 5LGKA 2AJ3A 1CF1A 1J5IA 2C9QA 1SQ2N 1FVEB 2GBVA 5L9DL 12E8H 5DD6B 1GS7A 2NTFA 2VWEC 4NENB 4EUPG 1OTSD 2MCPL 3QQ3A 3FMGL 3VGGA 2ZT9C 1QUNB 4BQ8A 1X5ZA 1BEYL 3CE1A 1BM7A 3DX7B 3QJHA 1AZRA 1LWRA 4ZMTA 1T3FA 4UDUA 5DK0A 2BOBA 2NX5B 4AV0A 1WSST 4NPYB 4NC2B 4HKBB 5I9QB 1CVSC 2I60H 1IV8A 2D9CA 2PXYB 2R2HB 3NJLA 4H8HA 4P2QD 1U30A 2QHRH 4R0LC 2HT2D 3DOIA 5DJ6A 3TNMA 4RIRB 1PZBA 1TQVA 1G84A 1AR1D 1HH6A 3ARDA 4A2MA 2A6KB 5IW6B 3KZ8A 1XO8A 2XOTA 4IRZA 3DJ9A 5E03A 1KJ2B 3OAUH 3GEWB 1E8ZA 1MVFA 4GRWB 2QPUA 3A4FA 5LXVA 2VC2L 3VFMA 2W9DL 4XBEL 1A1OA 3QB7C 4U1GB 2PPCA 2YRBA 1WBZB 5TQ2H 1ODAA 3KBPA 2A99A 2J8UA 3I85A 4XC3H 3UJJL 2IANE 1EJOH 3GSNB 2ITFA 4MBRA 4U1HA 1QPXA 3MRJA 5B8CB 2NLJB 4NQEA 4QGYA 4Y5VB 1JGDA 4AQ1A 1DL7H 4YDKL 1MFBH 5JW4M 4IW4C 1CF8L 4HDIA 1AI1H 1B88A 5DYOB 3SGEI 4W70A 4W9DC 2ZWLT 1OL0A 4BDVA 2VL5B 3MKKA 4LSTL 5CP7B 2VLRA 3FB8A 4FG2A 4IMKC 1O7SA 2VDLB 1ZS8B 3ARFA 1OAJA 1R3JA 3PDDA 4PJCA 1YVLA 1NGWB 3D12B 4H40A 1MRDL 3NJNA 4QCIA 1ZANH 3S88H 4LVEA 1XCTB 3NCFB 4TL5A 3UEZA 4F3FA 1MFCL 3MJWA 4PJEE 3NQKA 3C75A 2CBOA 2GIXA 4S1SH 2E7HA 1L5GA 3L5WA 1P4LA 4R97B 1JV5B 3QVAA 1I7TB 4LPYA 3ZDYB 4DN4L 1HYSC 3K1KC 4ZTOL 3KLHC 1ZIAA 1BM3L 1CCZA 1BMGA 2CGRH 2WZ6A 4LP5A 1M7UA 4GKNB 1E4XI 2BSEA 2A2QT 3RWHB 3HOGA 2XX0A 2NY4C 1G9NC 1DQMH 4M56A 4DGYL 4JGNA 4DN3H 4K7PH 1HQRA 4U6HB 1I1AC 1NCAH 2ZYIA 1A7PL 2Q7NA 5D6CA 3V6ZB 1S3KL 4UM9D 1XAKA 4FQJL 2AFNA 2XIDA 2NX5D 4PRIB 1N5YH 1U6AL 3RNKB 1FIEA 1HCVA 5HYJD 1QLEH 4HLZG 3SGDH 1B0GA 3US0A 1FSKC 5JPNB 3S8WA 3SDCA 1MNUH 1DDTA 2RACA 4LCUA 1IM9A 2CHZA 2UWEA 1NFDF 2X2IA 4JB9H 3O3AB 2H26A 3VXOA 2RB8A 4MKMA 1DN2A 1NGYB 4WFHE 4WU5B 4EZMA 3KPOA 1EZVY 4HSQA 3B5HA 4YZFF 8FABA 2NUPA 3GB7B 4JRLA 3TEWA 2JELL 4AUJA 4LLAA 2P42B 1XGYH 2V3DA 1NMCB 1MUJA 4KXZI 3QC5X 4Z0BL 1OB1A 3L4ZA 2W0PA 4PWJA 2OZ4L 4PRAA 1KT2A 4RA3A 5KS9A 1I9JH 2A4EA 1OP3H 3MRFB 4W9JC 5HDWA 4NUJB 2W07A 2X7LB 5DA4A 1NCHA 1Q9OB 1U8CA 2YK1H 3TBYB 4HJGA 2QQNH 5FAAA 3GS7A 5I75B 4Z95L 1PKQA 1IARB 3FQ1A 2X1WL 4PWFA 4L29B 3ILPA 2BWQA 4X4MA 3IDJB 4JGHA 5J13B 3HN3A 4TNVF 1FLRH 4B27A 4BIKA 4M48L 5AZ2L 4B95C 2ATAA 1A1NB 4G6AC 2QADC 5BZDA 1N7ML 3QJOA 4WENB 1JGLH 3R06A 4F7EA 3UPRA 4ZS7L 3C60D 4GSQA 3UTQA 2A6IB 4K5PA 1BFVH 3S8GB 4GRLD 4UTCA 1UT2A 1F58L 3QRFM 1JD9A 1W72B 3Q1SH 4LMQI 1DZBA 2OJEA 3AUWB 5IMKB 1MPAL 1RZFH 4RGND 5B38A 1G9MC 4M43H 2WAHA 1QLRB 1UQSB 3G6JB 4PHZA 4EBQH 2P47B 3U0PA 2KL6A 4RFNB 1TQWA 4KFMA 1CIUA 5HVGB 2NR6C 1A3LL 4X6CE 2QGCA 3GZKA 3SKMB 3C2SA 3FT2A 3EH4B 3P2BA 3MO1B 5DK3A 4U7KA 3MRIB 3PXHA 1JYNA 2AJSH 4K8RD 4Y4HD 1BZ9A 1J1PL 1NTDA 4IYKA 4B3VA 3CX2A 3EOTL 1N12A 4F7MB 4A7VA 1R19A 4YHYC 4IHOB 3ULVH 1X5IA 5B3JE 3ZNGA 5CSGA 1ZGLB 4K3JH 2OQJB 4G1EB 1P6FA 3KGTA 1OF2B 3TONA 3QWRD 3J07A 1LHZA 4LSDA 4LHQB 1ETJA 1KNOA 2FYVA 2NTFB 1JE6A 2D3LA 3NSXA 3GMQB 3SYOA 5KJRL 5B1AB 4MXQC 1FWXA 2EDNA 4HIJB 1A3RL 3RU8H 3ZTJG 2M2DA 1LDPH 3QS3A 1TETL 3QJHB 1JWUB 1M7DA 4X7DC 1XL6A 1U8MB 3TJHD 3VFTA 2X4NA 3H0TA 1ROCA 3T2QA 5A1AA 4N0CD 1ZJBA 3HPLA 4XRCA 5LG1A 4I9WD 3KPSD 1PL3A 3UPAA 1RY7B 1WCBB 3QWOA 1VGEL 2DEWX 3K3QA 3SCMB 1CFNA 3DGGA 2YIHA 3QJQB 2GG1A 2FUTA 1OAZL 4K3DL 3SDXF 1GYWA 3MOQA 1NEZG 1IAOA 5D71H 4PJXA 4W9HC 5IW1B 3F7RA 3VXNB 3IDMA 3DLQR 4RAUB 4YXKH 1A21A 3ULVF 1QHPA 5F7KC 1QSFB 3Q2LA 4MA7H 1YJDH 3B2UC 4Y2DD 5GGSA 4JGUA 2QV2A 2P43B 3L9EA 1W0VB 5EU5B 1J86A 3MRJB 1DFBH 4JDTH 3G3LA 2AITA 3V4PB 2AJXL 3JWNG 2J1ZA 4MZ2A 2K7PA 4N86A 4KKAC 3QUKB 3T71A 1RMFH 3PV6B 1EFQA 5DZ9A 3ZYIA 1KYOK 4DTGH 1OGAB 1I3VA 4UDTA 5D1QA 2VE6A 1XEDA 1UTDA 3NJIA 4BDVB 3T0VA 2B15A 3ROLA 3IGAA 1P1VA 2BW4A 3QHZH 4GMTL 1XWVA 3LRGA 3CC5A 3SO5A 3ARFB 1CLZH 1R3JB 4JY4A 5I6XB 5D7LD 1KB9K 5I15L 4QCIB 2CBTA 3N42B 1MREL 1OTTD 1T80A 3GTVA 3FU0A 3IM1A 3QIUC 4QY8A 5DQJA 4DJMA 3GLDA 2JB5H 1M71B 4PRPD 1QEWA 1HEZB 2VZVA 5K59F 1IGCL 4PJBE 2BRRL 2I26N 4JPIB 4X9IA 1M9WA 4AE0A 3MZTA 1JP5A 2WN2A 1QBMH 4JCMA 3PIQA 2HZHA 4CW1A 1K85A 1JK9B 4TQEL 1XGRB 3B83A 4GO6B 4ZMNA 3RX7A 3MVSA 3QUML 4C56E 4XI5C 1ACZA 2GW5A 5B21A 2XRAL 3QE5A 3DJRA 4Y2OA 3LKSA 4TVUA 4B5ZA 3E80A 2HJLB 2A6DA 3DRTA 1QSEB 2LU3A 4NUMA 3RWFB 3MLRH 3SOTA 5IESH 2JJTC 1EIBA 3LJ3A 3KS0J 3PDOA 5HDBF 3QNZB 5F7BA 3EJYD 3JXAA 5T1KB 1OKEA 4TLTA 5L2JA 1DFXA 4PJ9C 2BX5A 2VERA 3HUJE 1CXIA 1KENH 3QZWG 4FQCL 3L3JA 4PJHF 4R90L 4G8EA 4LCUB 2I9TA 2LLNA 2UWEB 4RMSA 2VC2B 5ALCH 2RA1A 4JO2L 2VLJB 3BH8B 3ZGHA 4RMWA 4FLHA 1TZGH 4BQCA 1GZPA 1MF2H 3KPLA 2FYYB 3MRBB 3GMNB 3KPOB 1FFPA 3Q8EA 4UOQA 4AGQA 8FABB 2NUPB 3HE7C 1XAUA 5E1AB 4H8VA 5I66A 5DHVA 4ZUVA 1AOZA 3DIFA 5AVZB 3SDAA 3RHWK 1OLZA 1A4CA 1OHQA 4DVRH 1CFBA 1YMHB 5HHNA 2BSRA 1V3MA 4ODVL 3MRNA 4YUEL 2YXVA 4PLJD 1TU2B 3UZVA 4UMSA 2QPFA 3MUUA 2VLME 4PRAB 5BNXD 3NZ8A 4H7VA 1FDLH 4HUXB 3H3KA 5T3XD 2FSEA 1MFEL 1HWHB 4I4WA 2AI0L 4GW5A 5FF6B 4URKA 1ZHNB 4MQ7A 5I0DA 2ENSA 1CT8A 4RBPK 1OGAD 1BW8A 1LMIA 3GSOB 2IDFA 3F58H 3GIZH 5AVQB 1CFQB 1WHPA 5TQ0L 4HJGB 4M7KL 4DO5A 4M5ZH 3RB5A 2BM3A 2HLFD 4MJHA 1G0DA 1GMEA 5I6MA 4LNRA 2XWEA 2YPVA 4OLEA 1G5AA 3MV9B 1I8LC 3S3SA 4FNSA 2XBZA 3NCWA 2J5WA 4L2LA 3AFLA 3K2UL 4XNUL 4K9EL 2COQA 2VN3A 4DK3A 2Q76B 3VW3H 4O51B 4L4VD 2CJUL 3ARED 2E6PA 1NDGB 3VWKA 3MLSL 5TDPB 3GSVB 1ONQB 2GB2A 1UXLA 1DN0A 1NCNA 4Q6IB 1B4JH 1LP9A 4KK8D 3BE1L 4F7EB 4MFHA 1X44A 2PO6D 2CDEB 2IPKA 3DNKA 3OMNB 2L0DA 4HF5L 3IDXL 3LQAC 5I6NA 5K1JA 3IFLL 2P44B 4MMZC 4I85A 2B8OT 4KK5C 2VSMB 5I18L 5JXEC 3MOBL 2V7NB 4O2EA 2Y25A 1CB4A 3IXAB 1ACCA 1FZKA 2YUXA 4OU3A 4A55A 4I89A 2G0KA 2PABA 5B38B 1HL8A 2J8HA 1IBBA 4Q56A 4JRFA 4JDEB 3U0PB 3S97C 3DKHA 1YDPA 3L1FA 1N67A 2YD3A 3QAZB 2CO7A 3DPBB 2A9NL 4FX5A 3CN4A 2FEDD 3LH8A 2CHNA 2AABL 1CO1A 4RDBA 1KTCA 5JNYA 2ORBH 1AMXA 1QSED 3W82A 5CEZL 2DMBA 4PUBH 3MBEA 2WTRB 4L8SA 1BYOA 1MVUB 2Z91B 1BZ9B 5C07E 2ZKHH 4JFOB 3OKKB 5ID0B 5IB1B 1EPFA 3GBMH 1D7BA 3UABA 5BO0D 3UZEA 1E4WL 3UCRA 4HS8H 2P4AB 5SX4I 4A1RA 2DQMA 5E94B 1B0RA 4N0UB 3EH1A 2DQTH 1SXAA 2CRIA 1AXTH 5FGBA 2VLJD 3CZNA 2XUWA 3L3KA 5KW9L 2MJWA 3PHOB 3RBSA 1O6TA 3VM5A 2XT1B 4BFNA 5HDLA 2BSCA 4PWKA 5K1NA 3QUZB 3F64A 4MVBD 2QDVA 1ZTXL 3LXAA 1WFNA 1CQKA 4XBGA 3BIAX 1KY7A 3T2NH 2CK0L 2FJHA 3AXLA 3MGTA 1JPSL 3TYFB 1QRNE 3VFTB 4G5ZL 4A67A 1XTLA 1Q72L 1HN1A 3DARA 1ASOA 1I7ZB 4AYID 2VDRL 4QHUA 1G7QB 2GJ6E 2IPUG 3ZE0B 4IBZA 3QWOB 2H41A 4WW2F 5CIPH 5DS8A 2EUZA 4LLDA 4XN5A 2FB4H 2W8CA 4AXWA 1A7QL 3FRUA 4PVNA 3UAJC 3FOMB 4ODHL 4PJXB 4C83B 1WAEA 3H53A 1ETZB 4M1GL 5FOBA 5C0CA 2EEBA 3T4AA 2J6EL 4P23B 4MNQE 3MV9D 4ZFOA 1E90A 4X7EC 4Y5YB 1MFUA 1NGZA 2ZG3A 2YQ3A 1RZKH 3QDJA 2LAGB 4P46B 2OLDA 2R56L 4NBXB 4L48A 2VISB 1W6WA 1YNLH 3L4WA 5LO7A 2R8SH 2P8PB 2JQAA 4P2OC 3T3PE 4Y8DC 1BLIA 4JN2A 3NTCL 2NYYC 3UO1L 1QLFB 2E7LC 3BKMH 1T2XA 3TF7C 2JTDA 3ET9F 4ZUUB 2BCKB 4LQFL 3VFGH 3VSTA 1SF3A 4LLQB 3RFRA 3X14B 3P3YA 3IGAB 4KRMB 3AY4A 2QEJA 1AJ7H 1DLHA 4NQDA 4TPRL 4O5LL 1UJ3B 4L4JA 3TYGH 2WC7A 1RULH 5F96H 4PGCB 5D5ME 1FZOA 3HZVA 4ZXBA 2GSIA 3CAFA 5GISH 2DYPA 4KZDH 1UD4A 2WQRA 1XGTA 3TA4D 1KTLA 4DZ8A 2A9BA 5C7ZA 1UM6L 2WLHA 3IVKB 5C70A 5H4YA 4LBAA 3I6KA 2R27A 5F72S 4ZW6A 3TBTB 1L0QA 4HMEA 5D1XC 5FYJH 3WIIH 3BFWA 2PP7A 1IFRA 4J3BA 1JF1B 2VKXA 2GTZA 4JO1H 4LSQH 5DUPL 2GVYA 4NJ9L 1L3NA 1XGUB 3L95B 5EZIL 3A6BL 2BSTA 3QDMB 1F56A 3KDPB 4JKNA 3FB5A 5E4EC 5CR8A 3X3GH 1H6EA 4GUCA 1Z5YD 1VHPA 4PD4K 2ESVE 5LQBH 3VH8A 4EQ3A 1AQDB 1N2RA 4DIXA 3FSAA 3RVUD 3QBTB 1FN4A 3O41A 3QEQE 4Q8BA 1NFIB 2J55A 4DK5A 2NUTA 3JV0A 3LKSB 4P4KC 3ZHFA 4BZ2L 2HCZX 4GINA 5DHDA 2QLVB 1KFGA 1NUGA 2UY6B 2VDPH 1JCKA 2I7SA 3JWOL 3ABGA 5BVJB 4QEGA 2L7EA 5DR5H 3E1F1 4HHGA 3GSRB 4QTFA 2JJSC 3G7TA 1BPLB 3JZYA 3L3JB 2WKOA 5LN8A 3CFJA 2FH8A 3FBKA 3MV8B 5DZPA 2ZZUT 3Q9QA 2YN3A 5F6HI 3KR3H 2HVBA 4GB9A 1LXMA 3OAWA 4KRLB 1SOQA 2IAMC 4ELKA 3B2VH 4KAQL 3IBOA 1GZPB 1OALA 2NCEA 2J3SA 3KPLB 1NCGA 4MXWL 1XTMA 2ZJSL 4YN3A 4HCRH 4JFPA 4NN6B 4P23D 1NQBA 4F9LA 1QHQA 3DURB 4HIHA 1VERA 4WTZA 3CSFA 5L8LB 2O5XH 5CINL 5HHNB 3SOBH 3II1A 3HI6H 5J06A 5AW6B 3V0VA 3MRNB 1UUSA 3L3OC 4Z7UA 3UZVB 5HPMB 3BJ91 3DMMD 2KI6A 4I2XE 5HGAA 2VH5H 3TPKA 4GW5B 5I1DA 4XP5L 1SJHA 4MQ7B 1HH9B 4NNXB 4IRSB 2X40A 4DVBB 4IOSA 2ZPKH 4HS3B 5AOZA 3APNA 1FYTD 2PP9A 3GJFH 5GXBB 2PP8A 3UPCA 1B9ZA 4LCCB 4AEIH 3JTTB 3GPSA 2YEQA 1XF4A 3QUXC 3NA9L 5C92A 1P9MC 4XB3A 1X5HA 5EDXA 2RHEA 4EF3A 5BMFL 5CO1A 4UTAH 1DN0B 2Q2EB 1HHGB 3CLEH 3HS9A 1BD2E 1EJ8A 2WQ8A 3G6DH 1NCWH 4KUZH 4ABWA 1I9RL 3VDCA 3MV7E 4APXB 4ZMLA 5A3ID 3ZRSA 3KBEA 2FL5B 3IGFA 3EYQC 3NIFB 2H6PB 3DVIA 4XPTL 3ZE1E 3QUMB 1MHPL 3AB0B 2ZNXA 3B3IA 4N8VB 4JKPL 4YDZA 1FZKB 1YEGH 2XFXA 3QDMD 2YGPA 4S1RH 5ISZD 4X7CC 4G7YH 1E4KA 1P7BA 4P06A 1W8OA 4G6ML 3PFUA 3ASNB 1YDPB 2N7SA 3IGKA 1ERNA 4P2RE 1KEGL 4NHUA 2VXVL 1FYHB 4ANXA 5ESVA 1YY9D 2CD0A 4FQQB 5AD0B 2FWOA 3CFMA 3F7KA 4I9XA 2NY2B 5G55A 3EBHA 1OAXL 5ETUA 4HUUB 4N0YL 3PQYA 3S4SA 5JLZA 1T89C 2R1WA 4ORZC 3F5WB 3P4LA 2W80C 4JQIL 3PWUA 3F85A 4TOYL 1CZ8L 2XPYA 3E3QE 4IKIA 4XAKD 1CICA 1TZHA 1BYNA 1AHWA 5FYLL 3BAEL 1OPGH 4U6YB 2H2PD 3TF4A 3MV8D 5DJ8B 3L3HA 4N6RA 4F2MB 4R4FL 5DSCA 4F20A 4WV1C 2OTUA 3S5LB 1RVFL 4U0RC 4MX7A 3RDTA 4Z8FL 3B9DA 4XCEA 5FFGA 1FA4A 1XXFC 4NO5A 3M1CA 3WMSA 2GUYA 1M7IA 4R84A 3VI4A 2FJHB 3AXLB 4R5XA 3VD4A 5TE6H 3SDDB 4WFFD 2CMRL 3TN0C 5E2JA 1J0IA 3GNML 3MNVA 4N2BA 5D2LA 2XKUA 4GW1A 3MLVL 3UTPE 1DE4A 1HI6B 2UZXA 2R0ZL 2FT7A 2NY7H 2GC7C 3H7BA 5ICYA 2Y1YA 3I2CH 2ZCKH 1MH5A 3QZMA 4IRSD 4NO2B 5A43C 3B4NA 3KHOA 3QORB 3HPJA 1OSZB 2Y72A 5C0CB 1JWMA 1QR1A 4CN6A 4PS4L 1A4KA 3L7FB 3K6SA 3FSWA 3WELA 1KLFA 3LIZA 3QIBC 4QD2E 1NGZB 4FI7A 4XVJL 1UASA 3HE6C 4ZMOA 1RFDH 3VXUB 5FC9A 5EO1B 3QDJB 1RZ7L 1YNKH 5E2TH 5LCVH 1CI3M 4Y2LA 2XXCB 1J9CT 2X6AA 2MOQA 2CIKB 1RJYB 4WWID 3RVWD 2AHIA 5CXPA 1KIRA 3EJSA 1NM9A 3HG1D 5LLIC 3QO1A 2DLHA 5EU3B 3VAEA 4ETQB 3TNNB 4JFWA 4L3EA 5KVDE 3PREA 3AG4B 1DLHB 4UOJA 1KPVB 3H42L 4NQDB 3NIDB 5FLVA 1KBKA 3PJLA 4GRWH 2GSIB 3DRQB 2PPDA 2DYPB 2ZCLL 3F12A 4HKJB 4Z7WA 5TH2A 4HWBL 2IG2H 3CZSA 2EIBA 1E3FA 1OVZA 2EZ0C 1T20A 2BO0A 4XMPL 5TE7H 2NY2D 4MAYA 4G7VH 4UQCA 3I6KB 4X8JA 3KPRA 3MLUL 4HBCL 2BFVL 2R1YA 1AXSA 3GSNH 5CLXA 4JREC 5FB8B 2VDNL 3T4YA 3FPXA 5CNHA 1ZV2A 3CN0A 4I3GA 2YUVA 2BSTB 2I9LB 4LIQL 4QO1A 1WEJL 1X5GA 1FGVH 1BJMA 1AVAA 4BEIA 1XZWA 2YS4A 1IEBA 2VZ1A 1ICTA 4XXWA 1AE6L 3BP7A 4G3YL 3VH8B 1UWXH 4PWHA 4A6YA 2WZPA 4QRQB 4TUKH 2K0RA 3T0ED 5CJOL 1GGIL 2VDLH 5GRXG 1UD8A 1IBDA 1UOLA 4RNRA 4M7LL 3UYRL 1JYVA 5HXMA 1UKTA 5HJ3A 1Z3GL 1HIMH 3D85A 1GPOL 5FA4B 3QH3A 5DJZA 1NICA 2VDRB 1QFWI 3GHBH 4WI0A 2LHAA 5J0BA 4ZS6C 3POHA 3KPNA 5HJGA 2D0HA 4X99A 4YMPA 1ECZA 2CJSA 5FKPA 5D2NB 4GAJH 5DEFA 1UACH 3ZKJA 2JJUA 2X4PA 4YSOA 3CWGA 3U1SH 1AKJB 2H1PH 2HN7A 1XH0A 4PG2A 4YGVA 3D1MC 4J3OF 4Q58C 2DL2A 4X4XA 4N1EA 5E0QA 2XQYG 2OI9B 5EZLB 1UC6A 3DBXB 3A5VA 1FQ9C 2F5BH 1S6NA 2YEZA 4LSRL 3QORD 4JFPB 4MJ6A 4OCWH 3RGVC 1SJMA 2AVGA 2MHAB 3B9KB 3BD5A 3NAAH 2BIOA 2XTJB 3IF1A 1ZAGA 3NSJA 4N90E 3WFBL 2CO4A 5CHNA 4JKMA 2XY2A 3SJVB 3VXUD 3KPQA 5I1JL 3B5GA 5F8RC 5LAPA 2OP4H 1I1FA 3QDHA 4K8RH 5F1NB 4PI0A 2PW2A 4HZLB 1T0NB 5K69A 3I9AA 1N18<