3ZRFC

Pvhl54-213-elob-eloc complex_apo
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
142
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Targeting the Von Hippel-Lindau E3 Ubiquitin Ligase Using Small Molecules to Disrupt the Vhl/Hif-1Alpha Interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 32
structure length 142
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3zrfC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3zrfC01
1LM8V 4BKTC 3ZUNC 4W9LC 4BKSC 1LQBC 4B95C 4W9IC 4W9HC 1VCBC 4W9JC 4WQOA 3ZTCC 3ZRCC 4AJYV 4W9KC 4W9CC 4AWJC 5LLIC 3ZTDC 3ZRFC 4B9KC 4W9FC 4W9DC 4W9EC 4W9GC
chains in the Genus database with same CATH superfamily
4PJCE 2VC2H 4WSKA 3ZYOA 4QDGA 4X80L 1A3RH 1KFAH 4J3XA 4XXWC 3VFSB 3FFDA 4CADB 4GUCA 4AMXA 1KN2L 3QDGB 2OCCB 3K71A 5EEUA 1MWAB 2BP0B 4IIZA 1QR1B 1ETZB 2QKSA 3M1OA 4G6JL 2G2PA 5CP7B 1ZMYA 4RAUA 4Q6YA 3NCWA 1M1XB 1C16B 3P11H 3CFEB 4UIMA 5HYJB 3FT0A 3TA3D 2AK1H 3OLDA 4JPVH 2K3HA 3PWUB 4ZRGA 1TQCC 1OVZA 1ND0A 3IN2A 1PZ2A 4LOFA 4J28A 1WEJL 3GS4A 3QEHA 2IAMB 4TSCH 3KLKA 2DJMA 1UJTA 2IWFA 3LY6A 2ZD0A 1YEDA 1AGBA 3CD4A 3KJ4C 4HJGA 3WNNA 1MJ8L 4Y1AA 5B3NA 4DPCX 1BYPA 5JORB 4ZXBA 2A1WL 3HCVA 3WDHA 1HSAB 1KB5L 3EGXA 4OT1H 2ICWB 5GPRA 3BPNB 2QL1A 3FTWA 1EJOH 4IU3A 5TTRA 4NAMA 2XDHA 3VXUB 4EN2A 5K9OA 4U6YA 2H2SC 3CSYA 1T83A 4XP9L 3M17B 5I74B 4TOYL 3NFSL 2YWZA 4NRZB 3BAYA 2C1PB 4AIZA 2YIHA 1QABA 4OFQA 3RZCC 4R2GC 4U3CA 2BRQA 2FIRT 5F7YC 1N4XH 2Y07L 1OGAD 1AE6L 3LMJL 1XXFC 2ZXDA 1BAFL 3ASOB 2R7EA 5EF3A 1MW1A 3C09B 4MAUH 5J1TC 1HS6A 3QQ9C 4WI0B 1U3ZA 5D7EA 3TCLB 2GK0A 5FGRA 4K5LA 5JW3L 3ULVH 2R2BA 5E6SB 4Q9CA 4L9LB 3D85B 1N26A 5GZNA 5JHDB 3T8VA 4X8XA 1FNEB 2X0WA 4GQQA 3IMTA 3WO3B 3MQIA 1IBDA 2JJSA 3ZMRA 5AAPA 3X1EA 2G0LA 4QOKD 1NCDH 3AY4A 1MXGA 1OE1A 2ZUVA 4CGTA 1CL7I 3VGHA 4DGIL 2XWEA 2NNRA 2Z1PA 1TVBB 4L1LA 3TJPA 4JM2A 4PWJA 4ZMZA 5FGCB 2YEQA 5DC4B 4EE2A 4NN6C 1H6TA 2WO4A 4HSQA 1IEHA 1K6QL 1E43A 2AQ2A 4JRXD 3MUGA 1PEZA 2NDGA 2HFGH 2BP8A 3D9AL 4BFBD 4KQ3H 1BFVL 3RX8A 2ATAA 2OL3H 4Y4KD 3VFTB 3DX6A 2OZNA 5E24E 3U4EB 3NBNA 1INQA 4R7XA 1OO2A 4XCCH 1NGZB 3H9SD 4PY8J 5HHMB 1OAQL 3IBEA 4AZUA 4G7YH 1YVLA 3DV4A 4HIXL 4HIHB 3MRIB 5C09A 1PJWA 5HVHB 1L7IH 2IPKB 2XACC 4KDTC 3TZVA 4J3UA 3IGKA 3BEVA 1HN1A 1YEJH 1UB5A 3EO0A 5EIIG 4F92B 2P48B 3MFGB 2EVGA 3ARBD 4PWGA 4XP6L 5E5MA 1USZA 4LARL 4JZJB 1KJMB 2EQDA 1S46A 1YYML 1E90A 1KNOA 1GCYA 3ARYA 3B9DA 5T1KA 3K6SA 2CXGA 2FWUA 4GRWH 4U1GC 1A1NA 1OT4A 2NY5C 5DVLA 3BIKB 2J88H 3TWYA 2EIJB 4L8SA 4MCZA 5GGSA 3OAUL 5B38G 3AWEA 3DOSA 3KLLA 3ECVA 5KAQF 4X99B 1XBDA 3TNMB 4Y1AE 5F7EH 3D2UA 1SF3A 4KTEH 3IVKA 1C08A 3C5JB 2XNAB 2WZAA 3P3RA 4OCRH 5EO1A 5I30H 1AS7A 2BP3A 1E2WA 5FYLL 4Z3JA 2QKIC 1CPUA 1I9IH 4ODTL 1XIWD 3MNWB 3MLYH 2WUBH 3TXAA 2VISB 2YSSA 1FG2A 4MMXA 3ZE0B 3SE9H 1TMQA 5LB1A 4PJEE 3MRDA 1J8SA 4LLVB 2MHAA 4MD4B 4OGXL 3MV7A 4M7ZC 3SDCB 2A9NH 3LRGA 1Z6JT 5B8CA 3SJVA 1T04A 2XQBL 3S36H 4PCSA 4BFEA 3BO8B 1X9LA 4PWKA 4WO4C 1QTSA 1NINA 2GEEA 2IDSA 4G6MH 1JZHA 1MCBA 1I3RA 4ZS6C 4RX4A 4AGLA 4ONFH 1X5MA 1XF2A 3J07A 4PJDA 4B9GA 3ZHDA 1QVOA 1YPZF 3VAEA 2EDYA 3PUUA 1FLRL 3QJXA 3QC6X 4XMXA 3GIZL 3NSJA 5I0DA 1ZA6B 4NNYA 1OOWA 3CBJB 1CJYA 3NK4A 1YJDH 4ZPVB 1CQYA 4N8VB 3T77A 2HTKC 2C7UB 2XWTB 3B8YA 2FYYA 3U48A 5BO1H 2WXOA 3P3TA 4HUKB 2CUHA 4NCDA 3GLDA 2YC1B 1DVYA 4RGND 2AC0A 2DIBA 1G9MC 2ZOKB 1MY7A 3GMQB 2ICWI 3HC4H 1AZZC 1PBYA 2HXAA 3UZEA 5C9KA 4J1UA 1MN4A 4JFTA 4XWGL 1M05B 4KU1A 4YHKL 4DPBX 2X4QB 3QDAA 4NQXA 2AEQL 1UZ8A 1NBYB 1NIDA 2DWTA 1AIZA 4LCCA 4BXVA 2E8YA 3HG3A 1GGBL 4J8RB 2BVPA 5KSBA 2WBWB 4NDMB 2ZPKL 3H53A 5C09E 5ISZB 4TMPA 1OSPH 1BPLB 1CN4A 5BNXD 3MJ9L 3QHFL 3KJ4B 3VXOB 4H26A 4KKNA 1LM8V 4XPHL 4GIOA 3ZRSA 4KK8C 1VCAA 4GYBA 2ODHA 2YXMA 3DX8A 3HJEA 4KVNL 1SVCP 3FCBA 5FYLE 5D2LF 4K8RL 5MEOA 1OAUH 1TYRA 3LV3A 3MGOA 4KHXL 1OCCB 5IJKC 5JYLA 4D9LL 1E9PA 1M2VB 2DMHA 3U6RA 4LCIH 4KJWC 2K1MA 4YDKL 2VSKB 1RU9L 2BXYA 1EIBA 2OK0L 4M7JL 4R9HA 3JVGC 4AWJC 2HA1A 4I0PC 4O4YL 5EZIL 4R4BB 1XR8A 4Z0BH 1ONQB 2R9HC 5EUOF 3RDJA 5CSZA 1T1YB 4R2GB 5FCUH 4AG4L 1P4IL 4BZ1H 1GOFA 4FG6D 4FQIL 2JLPA 1W6WA 2Z93B 2VDNH 1TU2B 3QYNA 1NZRA 4HA1A 3P69A 3PCYA 3VGEA 4AGMA 3DARA 4PRID 1AJ7L 4GJTB 2UVFA 1BAWA 2MOQA 2ZCZA 3V5HB 3MV7E 5MENB 4NQVB 4NUGH 1A47A 2Y2YA 3A6OA 5DJ0B 3OKMA 2GSGB 2C26A 3WO4C 5HYQB 1GMEA 1T5WB 3DSNA 1MAMH 1EAJA 2X70A 1A3QA 4NWTH 4OLVH 3F04A 4UILL 2W92A 4GW5A 3QUMB 4WI4A 3QUGA 1EHXA 2V2TA 3H3PL 5DI8A 2O93L 1WAAA 5D7LD 4J2QA 3LKNB 3HOGA 1HFUA 4PJDE 5JHMA 3D3VD 4PTTB 1H3UA 1CG9B 2YD2A 4FTVA 5D2LE 5JPMA 3MRMB 5ILTH 3X17A 1EFXD 4N2AA 1NC4B 1E4WH 1FZMB 2OMWA 1I8AA 3KH3A 4JFFB 2B08A 1ZLEA 2JB6B 2P5EE 2YLKA 4NN6B 2RA1A 3UTSB 1A7PH 3WUWB 4NQCB 4QXUL 3DXAB 3IDIB 3OPZH 4YUEH 1K4DB 1UXLA 1EMTH 4NN5C 1D9KD 2YD7A 1G7JB 1IARB 3FUHA 5EU6E 3SYCA 1WUZA 1LEIA 1YMHB 4LRIC 3WHXB 2EDXA 1IAIL 3MV9D 4NZJA 3T2NL 3I2CH 4NKQB 2HRGA 3L9EA 4N0UB 4I77L 4R4FL 1NPJA 3W0WB 1JZ5A 4L4JA 4LT7A 5D96C 4WEUD 4Q7DA 3IE4A 4G8GD 4RRPA 3G08B 4Z95H 3ZN6A 4WEBH 4ZMYA 1FZKB 3VXNA 2AI0H 2EJ1A 1R3KA 3DIVA 2NW3B 4U1GB 1YNTF 3JWDC 3TN0C 5DEFB 5I6NA 1UCBH 1DBBH 3EYQC 4KO9A 2QEJA 4LQFL 2FEDC 2IQ9H 2W0FA 3U0TA 4DK3A 3GBEA 4ELKB 2BJML 2X2HA 3B2PA 1AMYA 4MD5A 4U6HA 4X5XB 1LK3H 2QSTA 1WJ3A 4KI5D 3PHQB 4FG4A 2EKSA 1NFIA 2DQDL 2EXYD 3GBDA 4HISA 4EIGB 3U46A 1IU1A 1PG7W 2H8PB 3SD5A 2WINA 5SV4A 4JJ5B 2F1EA 5HYJD 5T5FH 4W81A 4GG6F 4DTGH 2H0JA 3HA0A 1ZLSH 3BAEH 2LR4A 3Q2VA 5KVDE 4ESKA 1DJYA 1EPFA 4R97C 4C56A 4R0LB 4EXPX 4S1QH 1KBGL 4WO4B 1U3HA 2HFTA 1BEXA 3KVPA 1G1YA 4MD0B 3ZYZA 2IAMD 4M8VA 4F57H 1YN7B 3QIWC 5BQ7A 3WNKA 1T2QH 3CTTA 3K81A 1S9YA 4KK5C 3MJ8B 2BNQA 3BCFA 4F1ZA 3HB3D 3SEPA 4K3JL 1YNLH 1QG3A 3O3EA 2GW5A 3QG7L 3TO4A 5J06A 2DLFL 4LPTA 3KVDD 3OMIB 3RY6C 3THMH 3L3HB 4UTBH 3WMQA 1KLUB 1HJCA 1FYTE 4Z7UB 3VXUD 3MN8A 1A7QH 3QG6A 3BH8A 1CFNA 1DVQA 1MCFA 4FTVE 4IEFA 3W82A 5KUKA 3KPSD 3L9RB 3QNYB 4PGBB 3S37H 2EYSA 2E6QA 3GDCA 4NRYA 3KNBA 4UQ2B 1ORQA 3OGCA 4PJ9C 3EYVA 5E2TL 5JHLA 1JG9A 5DHVH 4GG6E 2C3VB 4AEIH 1OY3B 4TQIA 2F53B 3NJFA 3ZUNC 3S35L 5CF3A 5ITBH 2YMXH 4PJGF 5DJ2A 3MRQB 2A6JB 3RPIB 4IOFD 3H0TB 4ZSOA 1E9OA 3HFFA 3VGAC 1CC3A 5HJBA 3STLB 3D85D 2HX8A 5JHDD 5JW5A 4A68A 1L0YA 3O2DL 3VUAA 5A2AA 5F7HA 2HLFC 1OM3H 1H3WM 2QLYA 4IKKA 2DI7A 4JDEB 2WXHA 4B9YA 2EDBA 1T22A 3O2WL 3VFOA 5KYXB 4F7TA 5IZ7A 1YQVL 2UZXA 4U6XA 5GRVL 4A6YH 5D7JA 5EB9A 4RGOL 5BRZE 4UBDD 1XAKA 3VDBA 2AKRA 3BKYL 1M71A 2IJ0C 4BDVA 3F2LA 1FZJA 2VLLB 1BV8A 5J12C 5ID1B 5IVXB 2IPTL 4HHWA 4A2GA 2H0PA 5CEXA 4ZW6A 4HIQA 1AQKL 4GP5B 4I0PB 2CLRA 4JPKL 5IB2A 3D4GA 2VM9A 1OL0A 4XBEH 1GGIL 3SYOA 4NWUL 4KHTH 1I7RA 1BQHB 2VE6A 4F2EA 1KEMH 2OMXA 5KYNA 2OW7A 1KGIA 5TE6H 1J9SA 2VWEC 3WTSA 1CGUA 1IEAB 1RIUH 1RP8A 1P53A 3QWOB 1KJ2B 1AGDA 4KNQA 3LNIA 3QCTL 3V4LA 3U36A 1LO4H 4NP4H 4C56E 3QQ4A 4GW4A 3F7QA 4UQEA 1KXVC 4FFYA 3INUH 4Z77A 1V3LA 3CVDA 5G4OA 4LLDA 2WCGA 3HIZA 1K72A 5DRZB 3I84A 2I7SA 4MNQD 1G5AA 4L18A 5HI3D 4DCQA 1HCVA 4N8CH 4P9ML 1NGXB 4FDWA 4OQTL 1A14H 2X42A 4X0KB 4OFYD 1JZJA 2GJZB 3LOWA 3EJZD 2C9SA 1B9KA 2AAVA 3L3KB 3PGFL 1N2RA 5ACZA 4JRYA 3NFNA 3UJJL 3WJMA 4DN4L 1HSBA 1XV8A 4GQZA 1TZHB 4YX2L 5BV7H 4QRRB 5GRVK 4X83A 1UFGA 3FQTA 1TPXC 3PWNA 4OJCA 1IB5A 3L95B 1XFPA 4NN5B 3B7RL 5FV1L 1OAZH 3QZWG 2OYKA 2HVJB 5IBTH 4WFEE 3K0WA 3K2UL 3CXDH 5GGRA 2CO4A 3G04A 4HDIB 4N2OA 3UPAA 3OWEA 1ZE3H 2R29L 4LHUD 3V6BR 1FNLA 3FU8A 2CM5A 4HUWB 1XSKA 4G59C 2XN9A 5D96B 5H4YA 2IH3A 2BNRA 4L8DB 4ALAC 2EDRA 1LILA 3V0AC 2Z4QA 1ZRUA 2X4PB 3FQUB 3FT4A 3RWFB 1NCUA 1WA0X 1V27A 2CALA 3ISRA 1NLDH 3N0AA 3CDGB 12E8L 1XEUA 4JO4L 5D1ZC 4GFTB 5H37A 1JDDA 3TN0B 3CCHA 4OF3A 5AOKA 3VI3A 1DE4A 4AK2A 1F6LL 1T3FB 4OIFA 4F8OA 3NJGA 2GK2A 4XX1G 3SBPA 1FL3A 2WXLA 3AU1B 1JPFB 2AXJA 4NUJA 5EF0A 1A6AA 2K7PA 1FNGB 4LLQB 4W9EC 3K8KA 2DYSB 2NX5D 1J48A 1NM4A 5DHMC 4H5SA 3BVXA 4X6FA 1HU8A 1H8SA 3WIHA 4GKZB 4H8PA 1NC2B 3ZHLA 1J9TA 3NCEB 4LKCB 2JTYA 2Q3AA 1FF5A 3H2WA 1D5RA 1RVFL 4M4RA 1N5AA 4K7FA 4ERSL 4I48B 1IC4L 4P04A 5HYSA 1MNNA 2WOYA 5EU5B 4DO4A 1CD0A 1ETJA 1G6RB 5E1GA 1MIEH 3S5LB 2NY3C 3UXFA 2WAQA 3ATBA 4R97B 3FYIB 4K9JA 4EN3A 4N0FA 4TTGA 1U9KA 1KB9K 1E42A 1SOQA 2IANB 5BOPA 4KRLB 1U93B 3D0VA 4NZDA 4F7PB 1KEGH 3QIWB 1RHHB 2Y22A 2ZP0T 4P3DB 1BFTA 4JR9H 2CK2A 5AZ2L 1K3ZA 4HOXA 2JB5L 1MI5B 1X5FA 1AO7A 4ZD3L 1KCBA 4PJFA 1UURA 2VC2L 4XP1L 2WLZA 3ISWA 3DRQA 3GBMH 3V5KA 1A3RL 1ZGLA 5ADOH 4AE1A 1KFAL 1WFOA 2PO6C 1OE2A 4XN1A 4J6RH 5LNEA 1XAUA 2AITA 3W5NA 1YEDB 5JXEA 4M1GL 4PJXF 2H2SD 2C9PA 2G75B 3EDDA 4ZUWB 2IEPA 4N68A 3GSUB 3EOTH 1KCKA 4ZXBB 2IOMA 4OB5L 4S0TD 3KLAB 1VFBB 2V2WA 4MRCA 3RZCD 3HE7A 2AK1L 4R2GD 4AEHH 4PJ9B 4NO0A 3FRUB 3HUJF 4JPVL 3SDYL 5LCVL 3TOPA 4DUVA 2VQ1B 1VFAA 3N43B 2MKLC 2R1XA 3DIFB 3GJFA 5I82A 4AY0A 5L7XH 1IAOB 1O7DC 3O45A 4TSCL 3HPJB 1XB8A 4IBZA 5T1DL 3FC8A 3QQ9D 5HJ3A 2RCSH 4AIZB 3VGAB 3HPLA 4FQXC 4JDTL 4LCYA 3BVDB 4PRDB 3LAFA 3HHRB 3L5HA 5CR1A 4OT1L 4MXQC 1OV8A 4JZNB 4KVCH 5TDNA 2XN9E 1EJOL 5GRWA 4LHUG 3QA3A 3VD2A 1X7TA 3R8QA 5EUKA 3NTCH 3SBWA 2B2XL 4PI0A 2FEEI 1MFEH 3U79A 3SE6A 3V0VB 4JFFD 1MPAH 5A1AA 3IJSA 3VI3E 2OSYA 2JJWA 4ZMLA 3G5ZA 2YRPA 3PIQB 4GEJA 1DP0A 3OZ9H 2IWKA 3G5WA 4FS0A 4N1HB 5ALCH 3UTSD 2YRZA 1WFTA 3ESMA 3N2JA 1N4XL 3DXAD 4JFWA 3FCTB 1HX0A 5C6TH 2D4FA 3FB7A 5EH1A 1FQ9C 3VM5A 3ARUA 1NFDF 1V54B 4UM9A 4PJIA 1JHTA 3Q7JA 4G42B 4UB0H 2TAAA 2GIMA 3CPUA 3OX8A 3KZ8A 3MXVH 3BRGC 4V2BA 3W0WD 3ZE2B 3BZ4B 1ET8A 3AXLA 4WSGA 1TVHB 2DH3A 2YAPA 1IC0A 4NC2B 4QKXB 4UOJA 4Y9CA 4FD0A 3ZL4H 4X2UA 4ZQKB 3HBQA 1NCDL 4P5RA 1KIPB 4ETYA 2EUVA 4HCRH 3MRGA 5D5MF 3OV6A 1CDYA 2VIRA 3EFOB 4JHBA 2J7LA 4WCYH 1OAYH 3CSBA 2N0KA 4QHNA 1IC1A 8FABA 4YGVB 4PW9A 5ICUA 1CIDA 4PJFE 4YDNA 2NNAA 3ATDA 1X4YA 1CU4H 2HFGL 4U6VH 5IB1B 4KQ3L 4P3WA 5ELIA 1CIUA 2J57A 1U8JA 4XCCL 4YL4A 4KXZH 3F84A 3HAEA 1B4LA 4G7YL 4QHKJ 5HGBB 3V4VB 1BVOA 1TPXB 1U3JA 2YRLA 2E7CA 3L1OH 1VB9A 1L7IL 2JJUA 4DETA 4HS3B 3E8VA 3EYSH 3R06B 4NC1C 4XN5A 1EXHA 5D6DA 1NFDE 3U9UA 4XNAA 4I9WD 4U1IA 1HVXA 1WGVA 4GAYA 4OTXH 4WO4D 3PL6A 3A67H 1L6XA 1M57B 1UH3A 4WWKA 4ZS6D 4XRCB 3MYJA 4PY7A 3GPEA 2EC8A 2WXFA 1X44A 2V5MA 1MFDH 2HRLA 4FQ2L 1E28B 4OZFB 1P7KA 2CJTA 2H7WA 1LP9F 4FNQA 4LDLB 5L2KB 2J88L 3IBOA 4OCNC 1KXTB 4QXVA 4K0OA 5I8OH 4M6MH 5FA4B 3SJVB 1IE5A 5D1ZB 5F7EL 3DDGA 4KTEL 1C12A 4H8WH 4S1DC 1OW0C 5DQJB 1DUYA 3VXME 5I30L 3S3BB 2HTKD 1I9IL 5CJ8A 5FUOH 1T20B 2CHDA 4AMKH 1QKZH 5E9DA 3UTPD 2TSBA 2ED9A 5I1JH 2YN3A 3PQYA 4GQPH 5KYYA 3RGVA 4Z7QB 2PCPB 2A9DA 1N12A 4PWEA 1BZOA 2OM5A 2X4OA 1PIFA 2WYHA 2QDVA 4M62L 2WBXA 2A9NL 2VMCA 4A37A 2NY1C 5H4ZA 4KBPA 2EVJA 1GXEA 2XWDA 2HRHA 1G7QA 1XCTA 2Q6WA 4AKPA 1BZ9A 4S2SA 3B5TA 4PJBA 5HDRA 4W9IC 1F90H 2ESVA 2UYLA 4G6ML 4M48H 4P59H 2NY3B 4ONFL 4GRWF 5CLYA 1F3RB 3U7WH 3L17A 4O2EB 5GIRB 3K7UA 5T3XD 2F7IA 5FCSH 2VR5A 2MKWA 2VL5A 2ZSVB 3DX3A 4U0QB 3IDJA 3BH9B 5C0CE 4HW6A 3T0EA 4MJ5A 2OQJA 4K5MA 3T4YA 2SEBA 5TK4A 3P0VL 3FN3A 1LP9E 3H1ZA 2WLLB 4N28A 1YJDL 3GRWA 1KPUB 3MUHL 4JFHD 1SBSL 4HLJA 4KK8D 1U42A 5ERWA 4P9HL 3S7GA 3VDAA 2C5DC 4UDTA 5BO1L 4YXLH 5DC9B 2E9WA 3FYEB 4BH8A 1QTYT 3RNQB 5MEQB 1LWHA 1S3KH 2BNUB 2WOBA 4JL2A 3TPUA 2EYTA 1FC2D 3P9WB 3SCMA 3O4OB 2EH7H 5T1JA 3LRSB 2A38A 3C5XA 5DZVA 3HC4L 2BWIA 3FCGA 2AV1B 3FO9B 2BSTB 5HHQA 3RWJA 2P52A 4I0PD 1QFPA 1QBBA 2YUWA 1JNNH 5IW6A 2VLME 5F1NB 4ZO7A 5CJBA 4ABQA 3VD9A 3IJEB 3RFZC 1T21B 4WW1B 1J8HB 1TO5A 1JNHB 4TF4A 1UUNA 4WI6A 3BJ91 4GRWE 4HGKC 2ZCLL 3EYFA 4TNWF 1S7TA 4RQQA 2V2XB 1KF9B 2XYBA 4C83A 1YEGL 4NBYB 2E7LC 2Z31C 1WA1X 3D12B 3WKQA 1INEL 1KXQA 1OAUL 1QLEB 5A2LH 1MVUA 4JQVC 1K5NA 4I4WA 3DUHA 4YE4H 5T8IA 4BSVA 4LCIL 4OJYA 3LS5H 5KS9B 5LKNA 5FO9A 2BSBA 3O11B 2IXQA 4TNWK 3GM8A 4BQ6A 4AEFA 2DW5A 3JYBA 4Z3FA 1ZT7A 1CLOH 3VQ1C 1Z5YD 2NY0C 3ULVF 4Z76B 1XCWA 4IMKC 4AOFA 5FCUL 4KGJA 1RZKC 5AVWB 4QRRD 3BDXA 3QH3B 5E9DE 3BWAA 5EF1A 2VDNL 1RV6X 4B50A 4B9PA 2Y7OA 2WQ8A 2BCKB 1Z9OA 2NY6C 2X53A 3CIAA 6CGTA 1AXTH 3T0XA 3MRPA 4WI9A 3IDGB 4NUGL 1CI5A 1PAMA 2VRKA 2OMWB 1A3LH 3JTTA 2YZ8A 2VCOA 4FLSA 2CHXA 2KS0A 2WTRA 2Y3NA 1MAML 2DM2A 3QXAB 2YLHA 4NNPL 4NWTL 4XNQB 5JR1H 5DJXB 3UC2A 4F9LC 1UKSA 1RJZA 4PJBE 1Z9PA 2ESVE 3GLEA 3H9HB 4JFUA 3V2AR 5C6PB 2ADFH 5JYMA 1ZVSB 5C1MB 2YRBA 3NP4A 1V3JA 2FJSA 3LZPA 5ILTL 1YY8A 1NDMA 2Y2TA 3TN0D 5I28A 1E4WL 1KCSH 3GSRA 4HSCX 2NLJB 3V4PA 1RUQH 3T0EE 4HOZA 5J11C 1E3XA 3EYQD 3U0PA 3AG3B 5E8EA 1GY2A 4WU7B 2FEDD 2E3VA 1YRKA 4WUUA 5T1LB 3Q8BA 1A7PL 3KPLB 3QEQA 1GJWA 5EN2A 2QGDA 5AB1A 4DEUA 1Z5LA 3D6GA 1P4UA 2X6AA 1XGUA 2YSTA 1KCRH 1R3KB 1S7UB 2NY5H 3JV6B 3DBXB 4YUEL 1T6WA 1NC2D 5E8NA 3OJDA 3VFNA 4M93C 2AJXH 3NH7H 1A6TA 3RDTD 3ETBF 1NGWA 1AGCB 3MA7B 3C9NB 2ATPB 3CV5A 5IROC 4PV8B 3ECWA 3JWNG 3I2CL 4XNMB 4ZG1A 3X3FH 4NUMA 4WHDA 2IALB 3ORJA 2VUKA 1V5JA 3CXFA 1G7PA 2ZOTA 3VRIA 2R4RL 4ZZKA 2BRRL 2CJSA 4Z95L 4ANKA 2EDOA 4WEBL 3L5XL 2AI0L 5IQMA 1BJ1H 1BQHG 3DPBA 5H35B 3ASNB 4KK5D 3UTTB 4M43H 1DBBL 1KCWA 3D25B 1BWMA 1A5FH 1IL1B 1KTLA 2I07A 2WK2A 2IQ9L 1GGCH 2N1TE 3Q1SH 1MI5D 3WS6A 3FQNA 1OHZA 4UU9A 1N6QH 1ZHBA 2XQYK 3HMXA 1Y1DA 3U0WH 5I2IB 4DFHA 3VB9A 1KXQE 3IFPB 1LK3L 4A7SA 3DX7A 3MZGB 4IU2B 3LEXA 2H32A 2IPUG 2BHFA 3G3LA 4ACTA 4B5EA 1A2YB 1NOFA 3QFJE 3GMMA 2PW2A 3FT9A 4Q74A 4A2FA 4AQ1C 5EA0H 3O3EB 4AUJA 1J7VR 1NAMB 1OF2A 1U2YA 2BW4A 4RFEA 2L8AA 3DGGA 4DP6X 4UTAL 2GJ6A 4DTGL 1WWAX 2NY1B 1ZLSL 4BFNA 1AS6A 1KGYE 2FZ3B 3BAEL 4PJ9D 1DVFA 5SWQB 4DN3H 5F2FA 2F54E 1XB3A 2VERN 3NG5A 4MX7A 1K4CA 1NANI 3F7PC 4S1QL 1HDMB 2Y4SA 4GO9A 3II3A 3OKYA 3NCFB 4O51B 3OG4B 1G9MH 2KC0A 1MCDA 4F57L 1V10A 1NEZG 1DQTA 2QHLA 4IEFB 5DDHB 3GZQA 1HHIA 1NGQL 1T2QL 1BG9A 2EYSB 4M7KH 4UTCA 4X4YA 3MGAA 3QC5X 4PBDA 1PSKH 3BWUC 1Z9LA 1T0OA 1DFBH 4MMYA 1TQTA 4ZFZB 3THML 1L3WA 4U1NB 2HN7A 2HLFD 2CCLA 3PGCB 4UTBL 1PQZA 4UT6A 2NUTA 5EBMA 1GL4B 4IRZL 4AENA 5LBGA 3QZOA 1A7QL 3ZDZE 4AIXA 1LK2A 1E9OB 1IM9A 5CINH 3L5WB 1WCBB 4P0DA 4ZW5A 4PD4J 5IQ9B 2IDFA 1KLFA 4R6UA 3S37L 1CFMA 1CTNA 3VRJB 1HQ4B 1U8PB 1IGML 2X6UA 1G9HA 4DKEH 2XCMC 2XTJB 3VXSE 2R1WA 5F7NC 1T89A 3KWVA 3QEQE 1G7IA 1LL1A 4XCEB 4ICXA 5GS1C 3UBXB 5ITBL 1JS4A 1KN4H 2YMXL 3DGCR 1PG7H 3GSXA 2JIXD 3MGTB 3RFZB 3JWNH 3IMBA 4YZWA 5SWZA 3PWJB 1GPOH 1PLCA 1BF2A 4AYGA 5I17A 2VW4A 2WN2A 3VA2C 3CHSA 3LQZB 3FQ2A 5FUCE 1YNKH 4RIRB 5JTWA 3LH2H 4FI7A 4G9DA 2FSEB 1IFGA 3RWCB 5HGHA 3VFWA 2ZF9A 1OM3L 3SN6N 5IHZA 3WEMA 5KOMC 2Z31B 3ZIMA 5I0YA 1HYSC 4G8EA 5J6HB 1KPVB 2NY2C 2QQQA 2GTWA 4EDWH 4Q0XH 4URKA 2GTZA 3KPNA 4YHIB 4A6YL 5CEZE 3MBEA 5T3ZD 4IRSC 3CDFA 3CK0H 1F1AA 2EE3A 1CE6B 3SKOB 4ZFOA 7PAZA 1SHSA 1Q8MA 2YAOA 1XH1A 3AZUA 3BVUA 1GC1C 2NY0B 4QJ5B 3RPBA 4HGMA 3STZB 2BSED 4KHTL 4XMVA 2D0HA 1KEML 3MI6A 3POCA 4GQ9L 5E1AA 4IRJA 4OIIH 5TE6L 3GGWA 1KLGB 2DKMA 2NY6B 4NUPA 1RIUL 2UX6A 4HYTB 5KG9A 1UD8A 3ZYIA 1F45A 3BZ5A 4OR1A 3T8MA 4ZOEA 1JERA 2GJ6E 1J9CT 1OSZB 4BA0A 3AXHA 4A2DA 1INDH 5AKTA 5K9QG 4NP4L 1J0KA 1A9BB 4XH2B 1YEIH 2L0DA 1KGJA 3GTTA 3DJTA 5HPOA 4JBSA 3SY6A 3OJMB 5A2JH 5L2KD 4N8CL 3WNOA 1W72B 3F65A 2XTSA 1A14L 1XCQB 5IWLA 2MQCA 2XX1A 5D1ZD 1T7XA 3Q6FB 3HFMH 4PB9H 4PRPB 3LKOB 4ABWA 5J11B 4C4KO 5BJTB 1M9WA 2PR9A 2X4RA 3R18A 2ZUYA 1P69B 4GIAA 2JKJA 1CFSA 5FM8A 3EDJA 5HVWA 3C6LD 3MLSL 3CLFH 5F3HB 5BV7L 3L5IA 1XZ0A 4PJ7F 3RI5F 3JWDH 2ORBH 4RVBA 1A7NL 3S2CA 2PPAA 3MRLA 3PLYA 4JKNA 4M93B 3ARGD 3WY1A 2H6OA 2JNZA 4GXFA 5IBTL 4JKPH 5CSGA 2YPKA 3EO9H 1F86A 5K69A 3CXDL 4ODHH 4X6BB 1MHHA 2VKXA 2D7TH 5DHYA 1MHPH 1PDKA 3WFHA 4UZUA 2NY3D 2JJTC 1X6LA 3Q8CA 3BD3A 3HC3H 1A66A 3NQIA 3F6JA 2KH2B 1TQWA 3RI5K 5KSAA 3Q1EA 1TCRB 1NLDL 4AUYA 1CK0H 2YEZA 2W9LA 5EU4A 2B7DT 3FHQA 32C2A 1H3VA 1UJ3A 4GRMB 4HJJH 2YD1A 4LBEA 1TZGH 1FRGH 1J5CA 4NZUH 2PO6D 3LIZA 4YSTA 2WCPA 2Y5TB 1SNRA 2FD6H 3MRFA 4XCNA 2ZTBA 4LK4A 4AK1A 1SY6A 1NIFA 3N41F 4P3CH 2IOIA 3FXIC 3VW3H 3MACH 4GINA 4FQ1L 5JHBA 2L7EA 2DQIL 4FKHA 4JN2A 4DVRL 4K9EC 4B27A 5K93A 1LO0H 1MIEL 4EMZA 5AAWA 4U1JA 4FULA 3FTVA 4IOSA 2DPKA 5FDWB 2XTLA 5CJQH 1J8HD 1EGJH 4NSKA 1QUPA 5T33H 1SYSA 3QVAA 5B1JC 3RP1A 4X9IA 5E6UB 2PPDA 3SKNB 2VH5H 3LNHA 1KEGL 4L5FH 2GPZA 2JKSA 3MNZA 2YZ1A 4YHNB 4JR9L 3WN5C 1EO5A 3UBXI 3LSOA 4FQXD 5GS0H 1G0DA 3QQDA 3F6IA 3QDMA 5DTFA 5C2UB 2YMTA 2HG5A 3NEXA 2ENQA 4PRAB 4B9IA 3GBML 1YEEH 4MXQD 5ADOL 4CC1A 4KKAD 3TF7C 1ICTA 1DQDH 4J6RL 4RMQA 5DEJA 5AVQB 2M2DA 3D51A 3BP6A 1K85A 1HZHH 5HJ3B 1JHKH 3K72A 3T0AA 3H9YA 4M3HA 2UXGA 1ZHKA 2VRAA 5TH2B 4TUKH 4LEEA 1DQKA 3EOTL 4KAQH 4DH2A 2G3MA 4KI5F 1U8QB 3QNZA 4AEHL 3G9VA 3MLRH 3NJIA 5JOPE 3U4BH 3DO7A 1HCFX 3GMOB 1RK0B 4M5ZH 2F5BL 2VW6A 2AAAA 4U3SB 5AWNH 5ESQB 1SQ2N 5GJSH 5L7XL 3CQFA 2BS9A 4UNUA 3K8LA 4FRWA 5GS1B 3MRNA 3N1FC 2RCSL 2FRGP 5DUMH 3ZZQA 2NW2B 3G5ZB 4PR5B 3B9KC 4A04A 3D87B 4G8FA 3H42H 1EDHA 3KWWB 5CIPA 3C8KB 2Q7YB 3S3JA 3QYMA 1QFWL 4E41E 3W57A 1YPZA 3FHAA 3BHBA 5C8JA 1MCLA 4FADA 1QA9A 3I6KA 3NTCL 3QBTB 4Y9GA 2EUWA 1MCHA 5L8JB 4IRSB 4OZHF 1MFEL 2DB8A 3B2XA 4OLWH 1TMCB 2DM4A 2XFXA 4KKLC 3EOYG 4E9RA 2Z7YA 1FFOA 3OZ9L 5T1LD 5ALCL 2J8HA 3ARDC 4G8AC 1FA4A 2VDKH 3ECUA 3MRBB 5EDSA 4OKVB 5C6TL 3LKPB 4HKJA 1S9WB 3OKEA 1T0NA 5I0ZA 4H8QA 4N0RA 2GFBA 1SJHB 1VIWA 3SE4C 1J18A 4IOIB 3DHMA 4GBXA 4QKTA 4PRHD 3V5DB 4DVBA 4KRNA 1IEBA 5F1OB 2GIYA 3NDZE 4UB0L 4PPTA 4S1SH 3HG5A 4PMFA 3QDJB 4X98A 3F7VA 3UYOD 1A6ZA 1WBYA 4W9HC 2XVBA 4FQQA 2CKBH 2CR3A 3LKSA 3WKNA 1VFOA 3LTVA 1UQSB 3P3YA 4MMZA 5DO8A 1CICC 1U8OB 2G3ZA 3ZL4L 5AG8A 5A43C 2FGZA 1UD3A 1D7FA 3BDBA 3CVBA 4HU2A 4BK4A 1FGVH 1MQKL 3T65B 3B83A 4HCRL 2P8LB 3UTTD 2X09A 1LTXA 3OKLB 3D4CA 3GUTA 3GDBA 1OARH 4WCYL 5IESH 4XOCA 4N9OB 3UYRH 1BFOA 4ZMAT 2FBOJ 2FJGB 3IDNA 4S1DD 3GSNA 4GAYB 3FQRB 3QDME 1WSST 2CZNA 2ZYRA 1XF3A 1SXBA 4GXUM 1KJVB 3O6FA 1CU4L 5FFGA 4MAYD 1G1OA 4LKXB 1VAHA 4RMSA 4U6VL 1BEYH 2FO4A 3S35X 3L4YA 4URTB 5FK9B 1DFXA 2HPTA 4HIJA 3VCLA 3L1OL 4Z5RB 3N42F 5IQOA 5L4MA 1G9NC 5AVZB 5IM7B 5I8CA 2NQ3A 1BXAA 1AXSA 3LNDA 5I1IH 2NY1D 1W0WA 3FO1A 4XNZC 1W80A 1UADC 3LPWA 1EZVX 1HKFA 4XCFL 1H3XA 4QTHB 3FMGH 4B5ZA 2ZT9C 4OTXL 3E6FB 5DEGA 4KKBC 2XN1A 3WUZA 4WHTA 4KX8A 4CMHC 2H47C 3RL2A 3AQXA 1D5ZB 1NOLA 1Q94A 3EYOA 5CUSL 4CVWA 1D5BB 4JCLA 2D4DA 4R84A 4RDQG 3KDMA 2LLGA 4JN1H 4M6ML 3VQ2C 5I8OL 2O6DA 1FO0B 4HFWB 4M3KB 2CNYA 4P2QD 2Q6WB 4H8WL 1E4JA 1F4YH 1XHHA 2K8QA 1RUAL 2CO2A 2WY3B 4YSCA 3OKOA 1G7LA 4RISH 5BS0D 4AMKL 1IQWH 3W9EA 5EZOH 1MVFA 5GGUA 2YKKA 1J5OL 2VLKD 5I1JL 2WWMD 2MJWA 2X12A 1IE4A 3LZRA 4LFHD 4MJIB 1ZXQA 2XIDA 4LNRB 5DURB 5D1XC 5HPMA 5EDXA 5MHSD 2WIIB 4ODVH 5G4MA 4ZMWA 4OI7A 1XGTA 3RIFK 4YDIH 3TBWA 3Q8FA 4B7IA 4M48L 1DJHA 2ITEA 4ZTOH 1E4KA 3D7PA 4HBCH 4KMTH 1DQLH 1VACA 3GMPB 1E0OB 1EQWA 3SCMB 1VA9A 4ZYKA 5JA9A 2E56A 2Y36H 3VB8A 1GTNA 3DX9B 1S7XA 4Q56A 4C58B 3DC0A 4WI2A 3L3GB 4FZEH 3W39B 3WEXA 3KLHC 4P23C 5HHQB 4IBTA 4D9QE 1IBHA 4BELD 5IKCB 2HPOA 2DM7A 1MRFH 3QARA 3ARQA 2BLFA 1KIRA 3WN5B 1UFUA 3PHOB 2EYRB 2B15A 4FFWC 4Z1PA 2DTMH 1BLIA 4X9BA 2Z31D 1I8IB 3O4LE 4YOKA 4OCMC 3MR9B 4J4PC 3ZDXE 3CVHH 4FKKA 1S3KL 4HX1A 1Y0LA 4PGDB 3AUWB 1TVDA 4UAOC 5I5JA 2XN2A 4W4NA 5I1AA 4WKZB 3D39E 2HB0A 1FZOB 4G1EA 5F88A 1MG3C 3U1PA 1KT2A 1S7TB 1J87A 4HPOH 1MCOH 4TVSa 2MNJB 3RIKA 3PNRB 3K6OA 2OXHB 4R7VA 1MLBB 2NY0D 3QULB 3BCDA 5L8KB 1DVTA 4GW1B 5FW6A 1OP9A 2FWLB 4XCYA 5I9QB 3CZSA 1FNHA 5EC1B 4BSVB 1XF4A 3S4SB 3F00A 2J5WA 2NY6D 1LO5A 4DKFH 3K2KA 4C4KT 2V8MA 2W9DH 3EJPA 5D1QE 3WEAA 1PZ5A 1MFCH 2C9QA 4KMQA 1DQJA 5L6YH 3LZFH 3N9GH 3TLRA 2X3CA 3TVMA 2VOTA 2Z35A 3B9KB 5F9OH 2OZ4H 4YDVB 1I7ZB 3AREC 4AGPA 1NGPH 3HC0A 4IGBA 4YE4L 3NESA 1MRDL 1UB6B 2ENJA 4Z7WB 4D3CH 3LS5L 3QFDB 4MCYA 4PYHA 4W9KC 1VGKA 4U7MA 4ANWA 2ZWKA 4PRPD 1JZEA 4P46C 1W0YT 2NYYC 3VXQB 3BUYB 5KANG 1QZ1A 4XZUB 3PWPA 4Y9FA 5DLLA 1D5XA 1WZMA 4JL1A 1HEZA 1QSVA 3LQAH 3GXNA 3LZLA 1TLKA 3LKQB 2ICES 1RUMH 2IBGA 5FKPA 5FM5O 1BECA 3QCUH 1ZS8A 3AG2B 1LE5B 3GXUB 1A3LL 5AD0B 3U0PB 2IVFC 2JKTM 4DQAA 1YMMA 4LFHG 3RUGF 5IROD 4DP9X 5JR1L 1DQIA 1JPGB 3EGDA 2VSMB 2MCAA 1DBML 1ZT1A 2DQUH 2HFFA 1BMZA 3L45A 3I3EA 2VITB 4PJGA 3SOBH 5IG7A 2DJ4A 4O02A 2O5XL 4JFSA 1CICB 1KCUH 2J8UA 3GBNH 5D7IF 2GI0A 4NQEE 4QYOB 3K1KC 3LZOA 3VD3A 1R0AH 4WV1A 4ANUA 1KCSL 1ED3B 3IJ7A 1RUQL 5C07B 3SGKC 3ILPB 4NQQA 4G2AA 4H1LB 4HLZG 2GQHA 2D3LA 3HE6A 5LNGA 5E8PB 5LAXA 5DHXB 1P5VA 4Z23A 1QSFA 2X44D 1VEMA 3MLTB 4Y5VA 1S9VA 3G5VA 1H5BC 3HG4A 3IFLL 4WLCA 3VE0B 5FW8A 4Z7IA 3HR5A 1ACCA 1KCRL 1CT8A 1EJ8A 1UZ6F 2KDGA 5F1SA 2AJXL 3NH7L 1E2VA 2WMPA 3QXUA 2OBGA 4LPCA 1TDQA 3P4MB 3L2NA 5CD3B 1EAOA 4RRPM 2I07B 3HG1B 2DL9A 3FB5A 1ZWIB 2IH1A 5IFJB 2JKXA 1HT6A 2R69L 3D4YA 5E9NA 2Y23A 1BMWA 4F9PC 5IJVA 3RUGE 3VXPB 4UDUB 3HNTH 3WS3A 3P30H 2K9UA 3F12A 1N6VA 4XVJH 1JPEA 2PW2B 1A25A 4YN3A 5FHBH 1A4JB 3F01A 1U91B 3ZUCA 3FB6A 4M43L 5CLXA 1EO8H 1A5FL 2HH0H 2GY7B 4JEGB 1T83C 5D7IE 1GGCL 4HWEH 4IJ3C 1N6QL 2IH8A 3BZEA 3MXWH 3U0WL 2R23A 3OB0H 1YUHA 3QUXC 2XKUA 2PWHA 3MV8B 1HCYA 3F7YA 1CGYA 3JTSA 1E8ZA 4DUWA 2Y24A 5E6ID 1I8LC 4CC4C 2JI3A 1WFNA 3CIQA 4Q52A 4WFGE 3B2MA 5D7KE 3MTRA 4QGYA 4WFFD 3UL4A 3BPOC 3KMDA 5EA0L 2X89D 1XR9B 4N2IA 4F2ME 4Q9QL 5D1XB 4W1TA 2E7HA 3SB3A 5SV3A 1AD9B 3KHOA 4Y5XA 2DH2A 2HN7B 3OR6B 4DN3L 2EZ0C 1ODAA 3GSVB 4JG1H 1DLFH 1E6JH 3AB0C 4JKKA 5FOJA 1J5HA 2XUWA 3Q48A 4AH2A 4X5WB 1G9ML 5LN4A 2JJSC 4PJCB 4NPKA 1OTUC 3FN9A 2FQEA 5BZDA 5F9JA 3LHPH 4XGZB 3WFBH 1ADWA 4M8RA 2FR4B 3L9BA 1PSKL 3HI1B 3NQKA 4HIPA 4P23B 4BUQA 1CURA 1YMME 1DFBL 4C4BA 1QSZA 1PD6A 4ZUVA 5CP3A 4TVPL 1H8NA 3F3HA 4NZRH 3QXTA 4MQ7B 1HYSD 1HWGB 2KZWA 5D6CA 4HIEB 2X6VA 2NY2D 4NKMB 5DK2B 5L2JA 3D34A 4HLZH 2BOCB 2OJ1A 4UAOB 2J8UE 4KZEH 4IRSD 3JZ7A 4RWHA 5LO7A 2NCMA 3TBSB 3WBDA 3X14A 2AJ3A 1JXFA 3MMEA 1XL4A 5E4AA 1AIFB 2P5WB 2RMNA 3WFDH 2EEDA 3UIYA 5HGHB 3IK2A 3P4OB 4Y4HD 2LVCA 1A8JH 4M29A 5IHLB 1Y7VA 3MV01 3WLBB 3L3OA 4Z3HA 4GPVA 3MVSA 2Y6TE 4YR6B 3UOAB 1CL7H 1PG7L 2C34A 2FX7H 4AXWB 1FJ1A 1NCCL 1X7QB 4WU5B 1GPOL 4LLMA 1B2YA 4OCSH 1MCPH 2YPLD 4FHBD 3W11C 2H1PH 5DXWA 1MRCH 1U8LB 2NQCA 3QDJD 4WW2A 3D50A 1YNKL 3BUDA 4F15C 3LH2L 1WZLA 1IGYA 1GSKA 4DGYH 5EN3A 5DJCA 1DQMH 2Y7QA 3D30A 3KGUA 4H88H 3RTQA 4XHJC 4B60A 1RZPA 3K91A 3ERXA 4PRNB 3ZE1F 3AREB 5DA0B 3SO5A 4EDWL 2J21A 1PNCA 1L9OA 2XPZA 3J27A 1AH1A 4IKJA 4FNTA 1QSED 2W5PA 4MMXC 2FGWH 2PYEA 1XGYH 5DRNA 3CK0L 3IKKA 4UT9H 2FWSA 4P46B 3NIGE 1AQDA 2DI9A 4Y7OC 3ABMB 1WIUA 4XAKD 4TQHA 4YSRA 1Z0NA 3MSPA 2W07A 1LWRA 1OZTG 2P24A 2MTPA 4PN6A 2CIKA 5DMJB 5BVPH 1DCEA 1JPTH 1BD2D 3G6JF 3UACA 2R83A 1MFMA 1MW2A 2YPVA 2VLJD 2DMBA 3JV4A 4ELMA 5L88L 4YSEA 2DF3A 3E7JA 3LXBA 4PJ5E 3WIAA 3IWUA 1TQBC 3IE9A 2DYPB 3MRCA 2AEPH 3OQ3B 3JV0A 4MB3A 1AY1H 3O41A 5E4EC 1DBAH 1FV1B 3Q5TA 1AGEA 4PJAF 2C1OA 3BP7B 4G6KH 1INDL 1WPCA 2IMMA 4W6YB 5C0EB 3VFRA 2BS8A 3DTUB 5IB4B 2W91A 3SDAA 1YEIL 4TVPE 1O75A 2QDWA 4F37F 4LIQL 4HWBA 4KMLB 3M86A 1H15A 3VDCA 3IDYC 5IEHA 2ADIA 4HJSA 2HRPH 1O9WA 1RPQA 3KPPB 2IIJA 4QO1A 3HFML 2G5BB 4PB9L 3VVWA 5GSRA 1JRHH 4BKTC 2FAUA 3QB7C 1ZD6A 1KY7A 3MLZH 1F6AB 4G80B 1HI6B 1NEPA 2MQGA 3ES6A 3W9DA 1CD8A 3GZPA 5DK0B 3FU7A 3CLFL 4F37K 3H54A 4HS8H 3WCYA 2IH9A 2NNCA 2WB7A 1IAKB 1H5BB 2WLMA 1BZEA 1JDAA 3UZVB 3UAFA 5AOMA 1AMXA 4MJID 2ORBL 3D33A 4N20A 4MS6A 1TG8A 3JWNE 4K8RC 2CD0A 1BHGA 1KB5B 3A3YB 3H4HA 4IMLB 3U82B 2YD3A 1RZFL 1RY7B 5CBEA 2IPUK 4JKPL 3EO9L 4HUXB 4U1MA 4ODHL 1OQXA 5E2UH 1H6FA 4JPQA 4BDVB 2D7TL 5CMAA 1MHPL 3ULAB 1KIUA 4PJAE 1F3DJ 4EVNA 2DQTL 2EECA 1PU0A 3CFIC 3HC3L 1SUHA 4BA8A 4M9OA 4QRTA 1NCWH 5HDQH 1F1DA 4H2CA 3FT3B 4W9JC 3CFDA 3CZNA 1TTBA 3WIIL 3TP4A 3IDMA 1XEDA 4NGHH 4JN2B 2OKMA 4HZLB 1U8KA 5HHOE 2QR0B 2EO1A 1ZSDB 3MOBH 3TBTB 3NZ8A 4Z0XA 1HHJA 1W6LA 2V7HB 3K6DA 4IJ3B 4P5TA 4H25A 5GRZA 1S7VB 1IKNA 1TZGL 5DWUL 1FRGL 4NZUL 2AK4A 2F74A 3QUXB 2IFFH 5JW4R 5LDSA 2A83B 5H94B 1MHCB 2FD6L 1M9SA 2QV4A 2VUYA 4G8IA 4V2CB 4K71C 3X13B 4JFDD 2K4WA 4P3CL 1H3PL 2DD8H 2HLAB 3VW3L 1REIA 3BPOB 4U1KB 4RZKA 2IGFH 3BP5B 3S97C 3GUFA 3EDEA 2EXSA 5GGVY 1ZTMA 4XNYH 1D6EB 1LO0L 1JYVA 4P5SA 1T0MB 3ZR5A 2AP2A 2M8XA 1II4E 3BGMA 1F97A 3AB0B 5CJQL 1EGJL 3LDBC 5FGBA 2DDQH 4CVXA 1NQBA 4LIQE 3WLWC 4ELME 1HTYA 2VH5L 5I0WA 3MX0A 1IZJA 4BH7B 4EUPB 1MCQA 3FRPB 4L5FL 2BVOB 3DX2A 4LMQI 4POUB 1ZGLM 1CLYL 1NCHA 3CFNA 5A16B 1Z9SA 2HWZH 1OAJA 3QNZB 3DROA 3B9KD 5J9PA 5GS0L 4YIQA 1S7QA 2ZJSH 1JWSA 2GHZA 5F7UA 2BHUA 1B0GA 2APVA 3BMWA 1XGPB 2CUAA 5KW9H 1YEEL 4NJAH 5JDSA 3SDXF 2DQHL 2L4OA 4PG9B 5AYQA 4A7VA 3QIBA 4RDBA 5IK3A 1VADB 1N0LA 2G3XA 1RK1A 3ARZA 3APDA 3VH8B 1HZHL 1SQMA 1JHKL 4MDIB 4TUKL 5BCAA 2ZUTA 3FUIA 3KYOB 3RB7A 4LL4A 2JFCA 2OL3A 1P9MC 1JXDA 3QCVL 1R46A 4XBGB 1UWFA 3ARDD 5CBAA 4M5ZL 1YPZB 1VRSA 2FJUB 3BHBB 2R4SH 3DTXB 5AWNL 4WKXA 4JFEA 5GJSL 1QA9B 5E08H 2OYLA 3HEIB 4HH9A 1E7UA 1GZPA 5MERA 3AC0A 2MIZA 1J05A 3PAVA 4EBQH 3OSVA 5DUML 1IGFL 3RPKA 4W9FC 4E5XA 2JI2A 1KG0A 2AGJH 3QO0B 4WTZA 5I16B 4X5LA 1AANA 1A9EB 3IAGC 1GC1H 3D48R 1BBJA 5C0BE 4N2GA 1FN4B 2VDOH 4BBWA 2ZKHH 2ENYA 2G9HB 3OKEB 3QUKA 1V7MH 1WICA 2EEXA 1CICD 4A7GA 1GYVA 3O8XC 1QBAA 2I60H 2LQRA 2CDEB 4LSQH 3ZDYE 1JVKA 3SDXE 4DVBB 2DAVA 4C47A 2XJLA 3P54A 2PABA 2FX8H 4OLWL 5A2KH 2GUOB 3VFUB 2H0EA 1EZUA 2D3NA 2P1YA 4TL4A 4YDJA 1PZBA 3MOQA 2VDKL 4AEEA 1OCZB 5C3TA 1NCAH 3ECQA 4BRJA 3LZQA 1TTGA 2QVKA 4NCC1 1JTOA 4GAGH 4U1SA 2GSIA 4JHWH 4XOEA 3DO4A 4LDCA 5CCKH 3BEWB 4JE4B 3UERA 3C8HA 3HG1D 1LNUB 1TQBB 3HZMB 3V9FA 4YHZL 5HHXH 4EJ1C 1VHPA 4UUJA 5JLZA 5J1AB 3KXFB 5D2LB 1B2WH 3MOAH 3QI9C 1L7TH 4V1DA 4TL5A 1NCBH 3TO4C 1L9NA 3NFPB 3DK2A 2BY1A 4KKBD 4QRFA 4PS4H 2OI9C 1U8CA 5EWIH 2P5EB 4LEOB 3ULUE 1FGVL 3IDYB 3KS0J 4X6EA 5EUOB 2DWDA 1JAEA 3FO1B 5BZZA 1N0XH 3S37X 5IESL 3DKHA 5HDLA 3B3IB 2Q8AH 3UYRL 3ZKJA 2FWOB 4RESB 4XHQA 5CCHE 4KJPC 3MCYA 3CSGA 4FYQA 1VLXA 2HKFH 2Y3AA 5DEGB 3QNXB 4DNLA 3WG7B 4R7LA 5EU6B 5AOJA 4WI3A 4DUXA 1Z3RA 4DKTA 1KOAA 2P4AB 1BEYL 4GAFB 4GSQA 1VJSA 3JT0A 5F9AC 3AS2A 4GKNB 4XXCA 2R0WH 2ICEB 1ADQA 3PWVA 3N50A 1FIEA 3GXIA 1QWUA 3L6FB 1SVZA 5D1XD 2DQEH 1DZBA 3CZUB 1KYAA 4AQ8C 3BSZA 3LN4A 1QRND 2LAAA 1G7LB 3BUQA 3JQOB 1JGLH 4OW6A 2X1XR 3W9EB 4X4MA 4S0SD 5SX5K 3CZKA 1XH3A 1ZOXA 5GGUB 4FCAA 4JFEE 4WGKA 2JWYA 3Q2WA 1ZT4A 3TA3A 1HH9B 3ZZSA 2KKQA 3BMVA 4LF3B 1E3FA 1G7MA 3CH1A 4G72B 2D2OA 4JN1L 1KB3A 3CHRA 3E6HB 3CC1A 4P23D 2JK5B 1K8DA 2AXFB 4BZ2A 1F4YL 2GSMB 4PBXA 2B5IC 4MHHG 2XPYA 4QRQA 4FFWD 4RISL 1UXSB 2YXFA 5A6LA 1CFBA 3PJSB 4CGUB 1IQWL 3M1BA 2XWZA 4L37A 5EZOL 2APXA 4C59B 4J4PD 3EOAB 1HOCA 4DP2X 1N8ZA 1KIQA 5EU7E 2FBJL 2UWEA 5IW1B 1URLA 1H0DB 4MXVF 3DHPA 1OP5K 3WIFB 4K71B 2DEWX 2P5WD 2C9XA 2OTWB 2R2EA 4BZ1A 2O26U 1HYRC 3I3DA 3G5YA 4LSRL 4NNXB 2I69A 2J6EA 4ODVL 4PRBB 4X4XB 4Y2NA 4MNGA 2EDLA 4KO5A 5DVMA 9CGTA 1B0RA 4YDIL 4FABL 2A6KB 1BQKA 1MJJB 1MZZA 4HBCL 2CRIA 1DQLL 3GKZA 4HX1B 4KMTL 5DZPA 5ICXA 5CGBA 1GGYA 2NDFA 4KH9A 3VXRB 3Q5YA 1YNTB 4ZMNA 4G1EB 2N7AA 2CE6A 4CNIB 4XO9A 2O61B 3QRGH 3A23A 3D18B 3LDBB 2Y36L 2P28B 3PWLB 2BSSB 5ES4B 2R0LL 2V7NB 4G7RB 1FYTB 2VZVA 5EC2B 1Z2KA 4HT1L 5F7MC 4JGJA 5EBLA 1N18A 1F13A 1JPSH 1XF5B 4QRPB 3QS2A 1NUGA 3C2SA 4V1DE 1M3IA 2DTML 4KDVA 5GGRY 4XE0A 3HS8A 2FEJA 3P0GB 3ARED 3VSVA 1RZQA 3CVHL 4KOBA 2V0AA 2FVNA 1OLZA 3BOVA 3UJTH 4MVBC 4YFDB 3BIBX 1TZAA 1ZLDA 2YWYA 4GG6B 3SZ6A 2P80A 5AAMA 3A21A 3IU4H 4TYUA 1O9ZA 5I8EB 4EI5B 2A9CA 4P46D 3IKCA 3FDWA 3LPPA 4KJYA 3ZGHA 4A7QA 1UGKA 4Q2ZA 3VWJC 2HSIA 2XVLA 3HC0B 1P4LA 4G7SB 4IGBB 3V0EA 1M4KA 2KLTA 1JXGA 4UIKH 3EDFA 1ZVNA 1JNLH 3RY5A 4MAZA 5H2BA 1N9PA 3L4CA 3WYRA 5BPPA 4ZAKD 4DKFL 2RIKA 2DYPD 1R5VA 4JRXA 2NZ9C 2W9DL 5G5DB 1E40A 2Z92B 1VEOA 1MFCL 5L6YL 4Y4KA 1HHHB 1NBZA 4KTDH 3LZFL 1K2DA 4IIQA 3H9SA 1Q72H 1OB1A 4K23H 5TDOA 5BRZB 5F9OL 2OZ4L 2E47A 2PW1A 1QEXA 4X4ME 2VZTA 5DUBB 3I75A 4XNBA 5AL8A 1NGPL 4ODWA 5ENWA 4CC0A 3VTMA 5LHDA 2BVUA 2E9JA 3ARBA 4D3CL 5C9JB 3ZQ9A 2NPLX 4HJTA 3O8XB 1UD2A 3SGJA 1XSIA 2K3TA 4D8PB 4OFPA 4HGWA 4JY4B 2YUXA 5IBUB 2QSQA 3EGDB 1VSCA 2B1OA 3FF8A 4L3CA 4PSPA 1SOXA 3GEWB 4PJGB 3SYQA 4Z7VF 1AAJA 2QELA 3LQAL 3VI4A 1Q4NX 1RUML 3EOBA 5T5FA 1I9JH 3QCUL 4EN3C 3RWEA 2UWEE 4HPHA 3RWGA 1XIWA 2B3IA 2X3AA 3KPQB 3NPSB 3BFQG 3C60A 4RDQF 3KBHE 4YHPA 3CFQA 4HFUH 1VCBC 1GW6A 4NUQA 4TUJA 1F11A 3VNYA 4XN7A 4Y1AD 2DQUL 1CDBA 3IS0X 1M42A 3QI9B 3LRLA 1CTOA 4LEBA 3SOBL 4NM4H 5IHUH 4UQIM 4EF3A 1RIVH 2OI9B 2DIAA 4LP5A 4ADGA 4H8HA 2B1HH 1BXXA 4NHUB 1G9NH 3GBNL 5HYFA 2W65A 1R0AL 2ZWYA 4XB7A 5AKRA 4NM8H 2FQDA 4PJHA 3PGDA 2OMVB 5IMLB 2V9RA 4K3DH 1PX8A 1KB9J 1H6EA 1NGYB 4O5LH 4J6IA 3FO0H 1ITCA 1Q1PA 3QUXD 4IS6A 3AQDA 2Y06H 3JYCA 2ALWA 1R3HB 3PHSA 2YD0A 1DO6A 1NL0H 3FF7A 4Q6IA 2NMSA 4G6AD 5DC2A 1GRWA 3OHXB 3IGAA 3RG1C 1KDIA 4WFHE 1Q9OB 2BY0A 2ZNXA 4KKRA 3MBWB 2VGLM 1EEUA 4PMEA 3ROOB 2H6PB 3IFOA 1JGEB 1FL6A 4NQDB 5E99H 2EZ0D 4Y2DA 2I5YH 5KYWB 3RVTC 3V6FA 5GZND 3HNTL 3P30L 2QPSA 1NSNH 4XVJL 3DV6A 3WL9B 4U3XA 1DQQB 4WNQB 2J44A 3LXUX 4JRXE 1OTUD 4N8UA 5E0FA 3KL0A 4NKIH 4HEPA 3TF4A 3UP1A 1EO8L 4DEPC 2ZYHA 5AEAA 3H9SE 1NPUA 4HWEL 3CFBA 3MXWL 4OVVA 2CLVB 1LDSA 1Z66A 2B5IB 5E6ZA 5INDA 5JW4M 2X7LA 1P1ZA 5GZOA 3G5XA 1QPKA 1U2CA 5FIEA 4HJIA 2FJHB 5D7HA 1DUZA 1SEBA 3O3BA 1RH8A 3KR3H 5TJWK 2IWEA 2W1NA 5EO0B 4N26A 1LEGB 2HJKA 3IDUA 5EO9B 5FUZH 2Z65C 3X1NA 4IK6A 4OF7A 4QTIL 1DLFL 1QFUH 5KSVA 2IMNA 5I19L 3QJHA 2ATKA 3HI5H 4PJ7A 4Y5YC 3VFPA 3VI4E 2J1XA 1BLNB 1U8MA 5JQ6H 3WXVH 5IR1A 5FYLD 1RURH 5T1KD 4HWZB 3EFFA 1G5GA 3W11D 1OIOA 1HXMA 3C08L 3TBYA 1BYNA 1X4ZA 1SRDA 1LWJA 1MCSA 3MUUA 3GIVA 3O2VH 2XQ0A 1M7UA 5JMOC 4ONHB 4NENB 4NZRL 3APFA 2ZOLB 1I7UB 3AS3A 2QSVA 4XPBH 5AG9A 3PXJA 1NKOA 5SX4I 43CAA 4N5UA 5ID0A 4XHJD 2V5YA 3BQUC 4ORGB 5B22A 1KPRB 1T5KA 3F83A 4YHYC 5IB5A 2CQVA 1DEEA 2X4TB 2YBRA 2K6WA 4DKDC 4F8QA 4PP1D 1J1PH 4ODSH 5C0AB 3WJLA 3WFDL 4L1BA 4PJHE 5MI0C 2FATH 3V6OE 2YA1A 3MV7D 2Y7QB 3DX0A 4TNFA 1HL9A 3SDDC 2L7JA 1EFXA 5D6DC 3C6SA 4X6DA 5GSVA 4G7QB 3VWJB 3WAKA 3PFQA 1CBVH 5JO5A 1CL7L 1HQRB 2FX7L 2K4AA 3N3EA 4BK5C 2DZEA 2PYEB 5AFAA 1E8WA 4OZIA 5EZLB 1MRCL 1UWGH 5F70A 3W37A 3KXFD 3MO1B 5JUEH 4IHBA 4FA6A 4RGNE 2XXCB 4HOWA 1D9KA 4DGYL 3T6QC 2EDTA 5E1HB 4X6CF 1DQML 2I9LB 2B4CL 1Z9MA 4H88L 2IV8A 2GCYA 3N1GC 4PJXB 2P5ED 4XC3H 1NBVL 3MV9A 4P49A 4XMKH 2J71A 5FM4A 4LCWA 1NUDA 2X88A 2FGWL 1XGYL 4G8GA 4UT9L 1Q90A 2GABA 1FVDA 4M7LT 3HUJB 4TUOA 4YSOA 1AR1C 1NJ9A 4MTMA 5I76B 5FX3A 4J3VA 5A7BA 4TV3A 5EU6D 4G6JH 2C9VA 3VFMA 4L4TB 4ODUA 5E5UB 2CMRL 3BN3B 4JKLA 5BVPL 4AT6A 3M07A 4L1HA 4UMSA 4P9HC 1EX0A 1WZKA 3DA0A 3GS0A 1O6SA 3VFSA 2VC2B 2VTFA 4K8RD 2VJ8A 1DBAL 5F97E 4CADA 1F0LA 2E59A 5C70A 1BZ7B 4HHAB 2FSDA 1MWAA 2YFNA 4G6KL 4JFXB 4Y16C 3WFCH 5I0VA 1QR1A 5EEVA 1ETZA 4KK9C 3RU8H 1OM9A 5CP7A 2WQAA 4JE0A 4QJ3B 3BLBA 3F64A 1M1XA 1C16A 5HYJA 3CFEA 4LDOB 2X0VA 1CF1A 1KB5H 1OT1A 3OKDB 2HRPL 4MDRA 1MH5B 3PWUA 5C71A 2BOBB 3OZLA 3LXCA 4TPRH 3ZKXC 2IAMA 1JRHL 4AYMC 5I18H 4XP9H 1GYCA 4TOYH 3MLZL 4FQPA 1OWWA 4GP8B 1A22B 3IMRA 1DJSA 1ORSB 3GI9H 4PGCB 1NFDB 4HD5A 3FZUC 4JAMB 3F7RA 4NPYB 5JORA 4HS8L 2V37A 4QHUB 4FFVC 1RL1A 3FSAA 4G82A 1HSAA 2WBJC 2ICWA 1I4FB 4BINA 1IKOP 1EAPB 4AKOA 3VGBA 2XWCA 3LMJH 4KKCC 4RMWA 4G3YH 1DSYA 5HI5C 2CJ3A 2HFEB 3VXUA 5E2UL 4ZX5A 4P5TB 3QZWA 1N67A 2MNWA 4P4KC 3M17A 4NRZA 5IMKB 2F8XC 4EPSA 3KPSA 3TCTA 1ASOA 2C1PA 2R2HB 2OSWA 3K2IA 5D5MB 3VXMB 1NCWL 1W0VB 5HDQL 1PFCA 3WLWD 4OAWB 1FYTD 3C5SB 4NGHL 4LGPB 3VX0A 3K4DA 1PCXA 2JH2A 3I6GB 4FX5A 3T3ME 3MOBL 4WI0A 2Z34A 4DGIH 2AJZA 3FFOA 3FOMB 5TQ2H 1A7RH 3CSFA 3TCLA 1KGCE 2WZ6A 4EI0A 5F9DC 2IFFL 4L9LA 3D85A 3CX5K 5JHDA 1GR7A 1LGVA 3CN2A 2BPBA 5J56B 1FNEA 3D9AH 2D2CC 1L9SA 2B39A 2BVYA 3FOLB 4LCWE 4A66A 1UEMA 3UTQB 3TYFB 1RSYA 3NZUA 4EZKA 3U30B 4FE9A 1P4BL 3WFZA 5J9PB 3S8FB 2IGFL 4HIXH 5T1MB 5DD6B 2X1OA 1D5IL 3DVFA 1EEYB 2WYTA 2XWJB 4FXGC 3E9TA 4N22A 3DO3A 4XNYL 3DJZA 4Z7OF 1T66C 5C0CB 1TVBA 4P2CG 2IQAB 4GLRH 5FYKU 1LP9B 1EZSA 1XD1A 2DDQL 4Y5YB 2KPWA 1LO3H 1YYMH 4YXKH 1KWKA 4YQXH 1MWOA 1JWMB 5ECJE 3ZK0A 3VFTA 3C5ZC 3AGWA 2Q76B 3U4EA 4AYFB 4GMTH 3HZ3A 3PU7A 1NGZA 3QDGE 5LVEA 2HWZL 1ZV9A 5BRZD 5IJDC 5CZXC 4HIHA 3OAUH 3MRIA 2ZJSL 4AMWA 1HEHC 1NCJA 2IPKA 1CD1B 3EZJB 4FYSA 5KW9L 4NJAL 3RE0A 5HYJE 4AV0A 1O9VA 3QJRB 1FE8H 3K0YA 5FYLH 2YK1H 2Z8VC 4Y19E 1PKOA 3BQUB 5B39B 4YAQB 3O8XD 3OMZA 1KJMA 4JZJA 5KN5B 2ZIDA 3HI6H 2DQJH 5HDBF 3QYCA 4OD3H 4KKZA 5DQ9B 3ZTNL 4F3FB 1LQSR 1DLHB 1QFWM 3B43A 4KPHL 4HOMA 2EIMB 3BIKA 4GRWB 5MI0B 5MP6H 1FVEB 5FW7A 1OWRM 1ZA3B 3WY2A 4X99A 3SDDB 3TNMA 1NCGA 2ZICA 2JQAA 2R4SL 1RFDH 3C5JA 2XNAA 3UBFA 4PYGA 2XBZA 4C56D 4Z7OE 3BGAA 5E08L 4XODA 1JVLA 2BFVH 1QUNB 1U3HD 3K3QA 2QGCA 3MNWA 4EBQL 2J1KA 2VISA 3NCCB 2YD9A 2AGJL 2V9QA 2V9UA 3J7HA 3VXUE 1N6UA 1NKGA 2APWA 1GC1L 4FG0A 4MD4A 5C0GB 1Y1UA 3QI9D 3SDCA 2VDOL 3TO4D 1HZLA 4I18C 5EBWB 1V7ML 2DIEA 3KPRE 3ZKMD 1KTDB 2I60L 4FLOA 1E5BA 4F7KA 5B3JE 1M56B 4ZUUB 4OY9A 2FX8L 2B59A 3B3BA 2HG0A 1HK6A 4L48A 1VFMA 4QMEA 5C08B 4KJPD 4RAHA 1AR1B 3OPUA 1J8RA 1ZA6A 1NIBA 4WFED 1MCCA 2KLRA 2WNGA 1AZVA 4XWGH 1NCAL 1AZNA 3FN0L 1DVFC 4R7NB 1U6AH 2CGZA 3AACA 1QLFB 1TQUA 2I24N 4ZPVA 4BXSV 3ETBJ 4N8VA 1CGTA 2C7UA 2AEQH 4I1NB 4ZPTB 4RNRB 4JHWL 1CDGA 4UAHA 1UWXK 4GIPD 4M6AA 4FFZL 3V0JA 5CCKL 3P02A 4YSUA 4O2CB 4HCGA 2DTSA 2NX5A 4HKZA 1HXKA 1WFIA 4JM4H 4XXWA 2YC1A 5HHXL 1JF1B 3LN5B 5DEZA 1CD9B 1U33A 5C0DB 2ZOKA 1Q1JH 1R4XA 3IGUA 1ECYA 1L7TL 4XTRC 3GMQA 3CFCH 3FQWB 1NCBL 3QHFH 4FNLH 4Y16B 5G55A 2VDMH 4PS4L 1S5IH 1KACB 5FGCE 1COBA 1M05A 5EWIL 2ARJB 1NEUA 1JYXA 3K2MC 2ZP8A 4JFZL 4KVNH 4Z7AA 1ZTXE 4K8RH 2X4QA 3P77B 2ZKXA 2G0KA 1R3IH 2IGLA 1NBYA 2W80C 3MRRB 2PCFA 1N0XL 4J8RA 2Q8AL 4YDKH 5HHME 4RRPG 5ISZA 4NDMA 2O5NA 5EIIB 3ZKXB 3E3QC 1BYOA 2PCXA 2WQVA 1CVSC 5EZIH 3VXOA 1L0QA 5PCYA 3K6NA 1PG7X 4AG4H 2A7BA 2BY2A 3CGTA 2QBWA 2R0WL 1OSYA 2EEAA 1IIIA 5CSBA 2WBJB 5F7DB 5DVKA 5B38B 1M2VA 3UAEA 5C7ZA 2WKOF 5CHNB 3T3PF 3GSWB 1B90A 2K45A 3UP6A 1JGLL 2ZUQC 4F7CB 2LTQB 3JBG7 3MRKA 3Q2CA 4M03A 5JOFB 2J55A 2DQ6A 4P4KB 4QY8B 5KVDH 4R4BA 1ONQA 1HL5A 1KIQB 2ITDB 1T1YA 3ILDA 4MZIA 4F58L 5CEYB 5BZXA 2X4NB 2Z93A 2DM3A 1TU2A 1HHGB 3ZE0E 3EBHA 2VDNB 3OHMB 4B0MM 4OV5B 3QFJB 1ACXA 3MAWA 3V5HA 2AJSL 5MENA 4NQVA 4DO5A 3O6KH 5DJ0A 2XI9A 3HLAB 2GSGA 5ICXB 5KSUB 5MEPB 5HYQA 1T5WA 3KS0H 1QEWB 4JHZA 3TH2T 3BPCB 4NQUA 2F54B 2CPUA 2YD6A 3QUMA 4KUZH 4MVBD 1I7TB 1GAFH 4LLYB 3WGUB 2E74C 5C0AD 1OGAB 3LKNA 2Q1EA 2D73A 4PTTA 1CG9A 5GGVH 3MRMA 5I1KH 1PVHA 4R90H 3UPCA 1TETH 4UNVA 4MZ2A 1NC4A 4PLKC 4FXGB 2PTTB 3MA9H 1FZMA 2EAEA 3PHAA 3T2NH 3NZSA 3E0GA 5LBSA 4JFFA 1SDAB 1U58B 2JB6A 1EANA 1WBZB 3QRGL 3TCXA 5JPNC 1ILSA 4WAFA 3BWZA 3UTSA 5EG6C 3U2SB 4ZUTB 2NZ9D 4ZO6A 5DT1L 3V0GA 3WUWA 5BV7C 3DXAA 3IDIA 3GO1H 1A4KB 2J12B 4QOKB 5F7FA 1X5YA 1K4DA 3FTXA 1JPSL 3C5ZB 2DKUA 3OR7B 3B7YA 2XSKA 5ICZA 2QV2A 5TK2A 3US0A 1YMHA 3WHXA 1RZIB 4MSWB 1U8IB 1UH4A 3EF7A 5B1BB 2BJMH 4HCFA 4CAGA 4A2HA 4M02A 3UJTL 3VXSB 4MNHB 3W0WA 3L4UA 3TS8A 3FQXB 1I3VA 5TFSH 1CF8H 2LU7A 3IF1B 4XAWH 1F4WH 3IU4L 3G08A 4Y4KB 5C3IA 5FYKE 1N68A 3Q01A 1FZKA 5CLWA 3L4TA 1NMCC 2H6UA 5ISZE 4FOMA 1GVIA 1JZIA 4L4TD 4U7KA 3RNKB 1PYWB 1OOAA 2D9CA 2VXQA 5DEFA 5F8RC 1HILB 4FLQA 1N64H 3NIDF 4UIKL 5LGKA 2XWBB 4HC1A 4ELKA 2CRMA 4OZGF 2ADJB 2ZXQA 1WIPA 4X5XA 4EN3D 1T1WB 2IOOA 3V7AE 3C87A 1SBBA 4EIZC 3A6CH 3PHQA 1MHEB 2YAFA 3QFGA 3CU7A 3HKFA 1Q72L 4K23L 4CSTA 3UBGA 3T09A 3O9WC 2H8PA 5C0NC 1HL4A 2VJ0A 1HWWA 2VKWA 4JJ5A 3CFKB 4Q4EA 3UTZB 4I18B 1WHPA 2BP5M 3O3UN 4QF1B 3U2JA 2B9BA 5D71H 3ALXA 4P2RB 4WO4A 1FC1A 3OXSB 1QYGH 3IPEA 1MFNA 4E9QA 1UWEH 4MD0A 4HLEA 2NNXA 3UGXA 2RFXB 3ZKNC 2WSPA 1YN7A 3ESOA 4HQQH 2OR8A 4TUJB 5EV7A 5AW8B 3JUZA 4JFPB 3MJ8A 4MA3B 3HRZC 3ZTEA 4CU6A 5MENE 3ESNA 1E5CA 3DVNB 1AVAA 3BW9B 3HE7D 1JK9B 2C9RA 1IBBA 2O72A 2IWGA 2JCCF 3A4DA 2B8OT 3SZKC 1I9JL 3F5WB 3L3HA 3P9LB 3PREA 3QWQB 4WQOA 1Y6KR 1KLUA 4FXKC 3OF6A 4AQZA 3NIDE 2W94A 4Z7UA 1I1FB 3RAJH 2J20A 3N5AA 3UMNA 5F9WC 3OAWA 4N25A 3CN0A 1THCA 5FO7B 3HB3C 5K9KB 2D9QB 4FYRA 3L9RA 1OCRB 3QNYA 4PGBA 3TH4T 4JQIL 1I3GL 4UQ2A 4NM4L 1CXLA 3RVTD 3VXMD 3O2DH 4L9DA 5IHUL 5JHLH 3GZKA 1RIVL 4L29B 2B1HL 2DN7A 3T04D 1G9NL 1NA8A 1YC7A 3UTSE 3SPVB 2C3VA 4NQCE 4TNEA 1YQVH 2F53A 4HIIB 2AJYH 2IDTA 5DHVB 1D6VL 2LAGB 3WMSA 4NM8L 3MRQA 2A6JA 5E03A 3RPIA 1R1CA 3H0TA 4GY4A 4K3DL 2AXHA 5AZEH 1OCWH 4O5LL 1JP5A 3VYPA 3FO0L 3EJRA 3STLA 2OYMA 3V0FA 5H37G 4AIEA 4N0UE 2CO3A 1OTTC 4DERA 2P8MB 4ENZA 5ABDE 3W0WE 4DW2H 1GGIH 3Q43A 4NWUH 3FTYA 4JDEA 1UKQA 3D52A 2WZ0A 1ZV2A 4MB5A 3QJTB 1FFQA 2JCCE 1ID2A 2DQCH 5KYXA 2BS71 5IJKA 4UM9D 2PWEA 1EUUA 3BD5A 2EKJA 3CHOA 3QQNA 4HUMB 2IC2A 4A6YB 5E99L 5C0CD 2XX0A 2KZKA 2VLLA 2ZUQB 1ZHNB 5ID1A 5IVXA 1VZIA 1QI3A 3JVGA 3QCTH 4GQRA 3K5SA 3ECBB 4I0PA 3O3BB 5BUAA 3MODL 4UOW1 3B8SA 4NKIL 4TNGA 3RVXC 3BX7C 3L1GA 1BQHA 4YBLC 3RA7H 3TU6A 4P5MB 2V17H 5EMYA 4K07A 1J5IA 3ME0B 3NIFF 1JBJA 3QO1B 1CDUA 1A6UH 5IF0B 4NAJA 3U6XS 4WI5A 3QWOA 1RJCA 3PGFH 2WQUA 1GJUA 1KJ2A 3BQUD 3PP3H 4FFYH 3S9DB 2VLMD 4B41A 4B53A 5FPIA 4IHOB 4YX2H 1AOZA 2KQNA 2WVSA 1XCXA 3KR3L 2XYCA 5DO2C 5FO8B 4WGWB 4WWID 5DRZA 3CMOH 2FO8A 4PRIB 1PZDA 4N1CA 2IADB 4ODXB 5DMGC 2KBGA 5DS2A 1NGXA 5FUZL 1L0XA 2FHFA 4X0KA 3SDDD 5HVFB 2UY7B 4AX3A 1QFUL 3B1TA 4L3EB 2GJZA 1EDQA 1GS7A 3HI5L 3SQBB 3NAAH 2GEQA 3L3KA 1C9SA 3KEDA 5JQ6L 2FEEL 4RGMC 3WXVL 2QVMA 4WTXA 1RURL 4KY2A 4WWKD 5JPNB 3FFCE 1TZHA 2XPGB 4QRRA 5AVXB 5D7LB 4Z7UE 5AYTA 5BV7B 2YGOA 3MROB 2E0PA 2PWDA 4JS7A 3D3VB 2HP4A 3BSHA 2CHZA 12E8H 3EHBC 3EBIA 3SPIA 4R4NC 5IVNA 3L95A 3O2VL 2CCVA 2AF2A 4PJCF 5DJ6B 2HVJA 3H7LA 2X10A 3ARVA 4FKEA 4N9GB 4POZD 1BGXH 5IUSA 4LRIA 3NIFE 5EBGA 3N41B 1QACA 2VZ3A 3NJXA 2CSPA 2Z8SA 4HDIA 2JXMB 5CZRA 2XJKA 5E9DD 4WY7L 2XBTA 1B88A 2XRAL 5AYUH 2EO9A 2A9AA 2X41A 4HUWA 4YS4A 4XPGH 3CQPA 3HNSH 2F53E 4L8DA 1KJ3H 4ODSL 3RGVD 1G0XA 2ZYIA 2X4PA 5H37H 3FQUA 4N1EA 1AR1D 5DJAB 3RWFA 1WVZA 5D1QC 1NMCB 1ZPUA 3WKML 5J6GB 3CDGA 1YUKB 4Y8AA 1ZLWK 1KENH 1ZDSA 3TN0A 1T7ZA 2MH4A 1T3FA 2C7FA 4H8WC 1CBVL 3TBVB 1W8OA 3AU1A 2V9TA 1JPFA 4PVBA 3AMLA 3X11B 2ESVD 4H0GA 1FNGA 4JFHE 4K3GA 4LLQA 2J3SA 1AKJD 1BQSA 4OM0H 1T7VA 1N3NB 4UOW0 2PXYC 3HN3A 3WIHH 4E41B 1L6PA 4MB4A 4GKZA 4A39A 1NC2A 4Y16D 5TDPB 2XIBA 3E80A 4KK9D 3T0ED 5HSFA 3B2UC 3O9WB 4GSDL 5IQLA 4P99A 4E42B 3NSDA 5IVXE 4I48A 2JB5H 5IP4A 4XC3L 5EU5A 1G6RA 1F5WA 1UA3A 4XP1H 3S5LA 2NNFA 1EXGA 1O6SB 4XMKL 4NOBA 2H9GA 1EVUA 4ZNEA 2WN3A 1FAKT 3CNKA 2IANA 2BZ7A 4M1GH 4ZW3A 5F44A 1U93A 5D2NE 3ATEA 1T1ZB 4F7PA 3QIWA 5JIPA 1TSRA 1RHHA 2ARJQ 4OB5H 3KPOB 4P3DA 5DZJA 1RHFA 3N44F 2M1KA 2QHRH 5JZ7C 1B0IA 5CO1A 4ZFFB 3FZUD 3VWKC 3SDYH 4BCZA 3TJHC 4F8PA 4X8JB 1MI5A 5LCVH 4GKSB 4FTDA 4QHMB 4FFVD 5DYOB 3RY6A 2N59A 4J8QA 2WBJD 4K7PY 3IJYB 5B39G 4FXKB 4KKCD 5HI5D 5ETUB 3QDHA 1A1MB 5T1DH 3F85A 5F9WB 3P4NB 4JO3H 2WAHA 3WFCL 1CLVA 5F72S 2B1AH 2G75A 2W60B 2NY7L 4ZUWA 3RU8L 4P4KD 1HJBC 1TQVA 3GSUA 3HAEG 25C8H 3HB3B 4N2DA 5K1VA 5IB3B 3AROA 2YAQA 4JDTH 1BIIB 3L3DB 1AD0A 1SLUA 3KLAA 1VFBA 3LVEA 4JUTA 3LCYA 4ZUSA 2H3NB 4OZHB 4PJ9A 3FRUA 3GJFH 4A63A 2QSCH 3FCSB 5EU3B 3RTLA 2VQ1A 3GXPA 4QRRE 4GS7C 3IB4A 3DIFA 3AS1A 3T1FB 1IAOA 1LHZA 4TPRL 1R5WB 2B2XH 3QFJD 3QZWB 3HPJA 5I18L 1OD9A 1PZAA 3KPSB 2WXGA 1F02I 3S48A 5IIEB 4HP5A 3GI9L 3CBKB 4PRDA 4Q9RH 3EYUH 3ZNGA 2F54D 1S7RB 3GMRB 2Z8WC 2Y7LA 4PHXA 4JZNA 4G3YL 5EEXA 1SM3H 3WTTA 5CGMA 2AJZB 4P2OC 3GXMA 1T5XB 1ZJBA 1T66D 4OSUH 2XFGB 3CX2A 3V0VA 4KFMA 1JFHA 5LGJB 3TVMC 2PR4H 1DJIA 4I3GA 3PIQA 4JDZB 4L4VE 4X7TB 3TBBA 3B9EA 4H4NA 1HAUA 1JGVL 3FCTA 2N0MA 3SHSA 1Z0MA 3C5ZD 4DK5A 4YXHH 2HKAA 3R4DA 2ITCB 4ORZC 3QRBA 4KJQD 4PS8A 5CZXD 5TQ2L 1A7RL 4G42A 1UVQB 3TX4A 3UCQA 4AQAB 2WXKA 3DYPA 3N42B 4LZKA 2XZCH 3B2VH 3VXSD 2A74B 4TVUA 3BZ4A 3GHPA 1TVHA 3QEQD 4PJEF 4PH8A 2ENSA 2OLDA 1U8NB 3CWGA 4ZNEE 1KXVA 5EOCJ 4AJ0A 4ZQKA 2F1BA 3FW6A 2DMKA 2F58H 2IANE 5JXAH 1KIPA 1OXYA 1B4RA 3MZTA 5EOQL 5SWSB 5IBLC 5CKGA 3EFOA 3R7QA 1R5IB 1A9VA 3NYKA 4M6OH 4JY6B 4YGVA 2ZCKH 4OLEA 1LO3L 2BH0A 4GFXA 4YXKL 4Y89A 1EO7A 3ZSTA 3UAJC 4RGMB 3O4LB 4YQXL 5IB1A 2WCSA 5IEKB 3HAEH 4U0RC 2SODB 3OJ2C 4NZTH 4FQ2H 4GMTL 2BSEA 1N10A 1N8OE 4MNQB 1TKWB 3ZW3A 3NN8B 1AGFB 3D39B 3V4VA 5HGBA 1R6VA 4LVHC 4ABUA 4WV1C 2VMFA 5IREA 1AR2A 4HS3A 3R06A 2XVGA 4YC2C 3BUPA 2Z1KA 2Z91B 1FE8L 4P2RD 2YK1L 4QAMB 3FS9A 4F8NA 2LW3A 1ULVA 4PLOB 3T1WA 5E2JA 4MJHA 1AYRA 3HI6L 2DQJL 4XRCA 1W2KT 3UYPB 4OD3L 2M83A 3E1ZA 4JM2F 2L04A 4TQEH 1E28A 4OZFA 1R3JB 5L2KA 3OLEA 4M62H 1KXTA 1P5UC 5C0FB 1NBQA 5D1QB 4CU7A 1U92B 1QX1A 5MP6L 4YL9A 5FA4A 3ZHFA 2GJ6D 5D1ZA 2OMYB 1TENA 3BDYH 1A02N 1DVFD 2J5LC 3LEVH 1RFDL 4LGRB 3ASWA 5DQJA 5HJDA 5IOKA 4FG2A 5B7MA 4ATWA 4LHUB 2HUHA 2ZXEB 3DGDA 2BFVL 3VFVB 1T20A 4N3TA 4ICWA 3QW9A 4TTDC 4APXB 3P73A 1ACYL 3CBRA 1EAQA 2B59B 3QEUB 1BZ8A 3HZKB 4K15A 3EJYC 5I1EL 2PXYB 2QFRA 2F6AA 4MBOA 3EFDH 2VMEA 5KVMC 3E9UA 1DCLA 2PCPA 2XQYG 4PV1C 3T0VA 4XXDB 1ZLVK 4XTRD 1IGCH 4MJ6B 3P0VH 1AHWC 3B1UA 5E9AA 4R5XA 4Z3GA 4LPVA 4A2MA 1BX2B 1SBSH 2MEJB 3OMNB 4P9HH 4JHVA 1MCNA 1NM9A 1T4WA 4Z3IA 4R96B 3UMTA 4LPWA 2P47B 3H8NA 2OXGB 5FV2A 3RFRA 2NX5B 1BVLB 1G1CA 4HKZB 3MJ7B 2ZXGA 4IJTA 5DUPH 5E94B 5F6HI 4O2EA 1F4HA 5GIRA 1A6WH 4A38A 1IM9D 1KWGA 2ZSVA 1AP2B 3I3BA 2EABA 1S8DB 3BH9A 3L16A 3GRWH 5HHVL