3ZRFC

Pvhl54-213-elob-eloc complex_apo
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
142
Chain Sequence
b'LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
molecule tags Transcription
source organism Homo sapiens
publication title Targeting the Von Hippel-Lindau E3 Ubiquitin Ligase Using Small Molecules to Disrupt the Vhl/Hif-1Alpha Interaction
pubmed doi rcsb
total genus 32
structure length 142
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3zrfC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3zrfC01
4B9KC 4WQOA 4AJYV 3ZTDC 4W9KC 3ZRCC 3ZUNC 4W9IC 4AWJC 4W9GC 4W9CC 1LM8V 4B95C 4W9DC 1LQBC 4W9LC 4BKTC 4W9JC 4BKSC 1VCBC 4W9FC 4W9EC 5LLIC 3ZRFC 4W9HC 3ZTCC
chains in the Genus database with same CATH superfamily
1KDIA 5I1DA 2IGLA 4FQXB 5JLZA 4FFZH 5E5LA 1LEIB 2GJZA 4RBPK 5IROC 3SDCC 5ISZD 4RIRB 2AV1A 2I9TA 4XCNB 2XC8A 4PGJA 4H8WH 4P46C 2XWJA 2CA3A 2GTZA 1I3GL 1KELL 2PYFA 5A2IH 2FTAA 1OTSD 2VLKA 3VYOA 2WBJB 2AS5M 3RWEB 4R4FH 2EYTB 5CJQL 3RGVC 2Q8AL 3NZUA 3LIZH 3RIFK 1HILB 4KGLA 5IUCA 2V33A 3T08A 2KDGA 5K69A 2EO7A 2CJUH 4Y9EA 4TSAH 5I1EH 3Q8FA 4KUZH 2FUQA 4OJFH 3A0OA 4JO2H 1AHKA 4ZSOB 4KNSA 2MH4A 4LKXA 5IQ7L 3BPCA 1ORQB 1RIHH 4L4JA 4WI6A 1FYHB 2WAHA 4XBMA 2ITCB 2H1PL 4XBGA 1DBAL 2XZAL 5DF0A 4JAMB 1MWOA 2EVGA 4RFNB 3MKGA 1WDAA 2J6EH 4X9FA 4M7KL 3P9LA 1PD6A 1ZTXL 4BKSC 2O5XL 5D71L 3WEXA 1NCAL 2VUYA 5IF0B 1J1PL 4BSVB 2CGRL 3PIQB 2D7OA 3ZR5A 4U0RB 1GKEA 4R7LA 3RB5A 1IM9D 1IL1B 3M8OH 5JIHA 5J11B 4EI6B 1CVRA 3NZ8A 4YHIA 1KB3A 4O5LL 3CDCA 5F96L 1KC5H 2WCPA 1HI6B 1TZOA 2DQHH 2FGWL 4K9EC 4N2DA 5C70A 4FD0A 3HB3B 1IV8A 2L04A 4BFGA 4ZMYA 3EF7A 4AVJA 4G70B 1N4XL 5FDWB 1O0VA 4YDZA 5C6WH 5DHMC 3L16A 5TDOB 2HP4A 1XR8B 3RYMA 2GK0B 4O4YL 3UZEC 2FJHB 3FT4B 4AJWA 1H3VA 1QTSA 1U8QB 4LFHG 5G5DB 2J56A 4LL1A 1KXHA 4DVBA 2WV3A 4APQB 1GAFL 4M6OH 4PRPE 1NAMH 1Q9WA 3LS5L 1AZZC 4K7FA 4X80L 4B9FA 1IMHC 4JY5L 4XVJH 1DO6A 4DGYL 5C3LD 5D1ZC 3JWNE 2VABA 4XXDA 5EOTB 4I3RH 4WTZG 1TJGL 1F3JB 1ZCRA 2QADD 5IJCC 4LLWB 4U6VL 2FATH 1MRDH 4JPQA 1HSBA 4J3OD 4M7LH 1V7NL 1GSMA 2ZX9A 3GYRA 3TBYB 5J9PA 5FW8A 1JNHA 4Z5RA 1QKZL 2UWEA 3QZBA 1XR9A 3NT0A 4ODVH 4OQTH 3LZOA 5I1HH 5FGBC 1E5UI 2Y5QA 1GVIA 1IEAA 5EHFA 3TWCL 2A83B 3FB6B 5FKPA 3ZU8A 4XOCA 4B3EA 1GPOL 5FCSH 4JJ5B 5IB3B 1X5LA 2Z8SA 5D2LA 1BVNT 5HDBF 3EDDA 1RMFH 3IDXH 4NPYB 1OCCB 4DP0X 2BK8A 3T0WA 4HIXL 2CA4A 1DHKA 2A9ML 1AP2A 2D0GA 3PGCB 5DEGB 4HPOL 4D9RE 4GW1A 4TMPA 3R4DA 1MLCA 2M1KA 3P30L 1BZ8A 5A2FA 3BYTA 2GJJA 1UOLA 1PU0A 2DYPA 3CFDA 1TZIA 3NK3A 4HK0A 4JW3A 4LESA 3SKUD 4OGYH 5I19H 5DI8B 1AYOA 4TSCH 4OCRL 1AKJD 1FHGA 1XCQA 4XCEA 2Z31C 3CMOH 3GBLA 3U1SH 4W81A 5I5IA 1N7ML 1RH8A 1Q4NX 2J4WH 5A7EA 5AUMA 4UTBH 1FNGB 3AT8A 4KVNH 1CFBA 3I3DA 3PP4H 1NLDL 1LP9B 2BSRB 2UXTA 4NQCA 5I1CL 5J6SA 1Z5LA 2Y06H 5GRYA 4NO5B 3HFML 2V2TA 3RBSA 3T0EA 4JVWA 5D1QA 3VQMA 1NMAH 1U8OA 1Q0EA 4P4KC 3WDJA 3CSGA 3BUTA 3DIVA 1IKFL 2FX7L 5DJ0A 3T4AB 1QBLH 5ISZB 4Z23A 2OK0H 3EHBC 5C08E 5L4JA 5IEHA 4XVUC 4MYWB 2Y6SD 3NH7L 1PY0A 2IGTA 2CDGA 3UZQB 4UANA 1MCIA 3MXWH 4IEFA 4PJ7A 5I17B 4ESKA 4GRWF 4ONHA 2AAAA 3KPNB 5HYEA 1A7RH 5GJSL 1E43A 2ZPKL 3M1BB 3O0RH 3QORC 4QOKD 2IG2H 2XHNA 1EZUA 3GDBA 4GUPA 4WHTA 5D6CA 4KKQA 4KPHL 1IQDA 2DKMA 1UKSA 2P7TB 1H15B 1FVEA 1BZQK 4PJGF 2CLVB 4N20A 1G7PA 2OR9H 1JMZA 4JFDB 2IWEA 4UTAA 3FTWA 2O5NA 4EIBA 3UZVA 5AENA 5E9DA 2A7BA 3VCLA 4Q0XH 5D1XE 1R3JA 2AQQA 4L4VD 3NGBC 3SGJA 1AXTL 3L6FB 3MMEA 2K8QA 2P5PA 4Y2NA 3VI4B 4BGLA 3OF6A 3BH4A 1RJYB 3BZFA 1MVUA 5EU6E 4Q9CA 2C8NA 1MW2A 2HFEB 5KUKA 3ULVH 1OE1A 5C0DA 4J3UA 4Y4FA 1BVLB 4H88L 2DQGL 1S7QB 5F21B 3K0YA 4YXHL 4PPTA 3H3PL 4PJDA 1JZ3A 4MD5B 2MOQA 3DRTB 4PYGA 1NAKH 4L05A 1HWWA 3QR2A 3NDYE 2ZX5A 1CF1A 3OMNB 1T3FA 4YGVB 3HG1B 6TAAA 3T8VA 5F8RC 1U3ZA 4M6NL 1YEDA 2FB4L 1Z1WA 2OS7A 35C8H 1NBZA 4X8XA 3WIHH 4LCUA 2Z91A 3L1EA 5ELIA 4JANA 2ZWSA 3N50A 4U2ZA 4L8BA 2BZCA 3DHPA 1XGYH 3VXOA 1SDDA 4WLCA 4Y2DC 3ZDYF 4AQ1B 2IFFH 2XWDA 2W60A 4ZG1A 4RMSA 4UTBL 1LK2B 4MAYB 2F8XC 4JHAL 2ADYA 3V0IA 4LEXH 5T1KA 4L0PB 1MREH 3H9SD 4LEOA 3FONA 4OY9A 1I7TB 3DX7B 1U3HA 3ZQWA 1LE5B 2C4XA 3MV9E 5A2JH 4BQ9A 1JNLH 3MC0A 4QRBA 5D9SB 3FT9A 1X4YA 1ZLDA 3GBEA 4YHKH 3RUGE 3OZ9H 1AFVH 4UQIM 4PLOB 1JPFB 2EXTA 3QA3B 4MNQE 4WO4D 4O2FA 2J72A 4HK3N 2KLRA 3M17A 4JN2A 4LSUL 3RJDA 1MW3A 4XWGH 4QXUL 3V0JA 3BUDA 3VI3A 1AY1L 2W1NA 1MFCL 5E70A 3L5WA 1XQ4A 2R8SL 3NJMA 4P2QB 3UBFA 3F7VB 5DLMH 2DH2A 1RJLB 1S7UB 4CVZB 3WL9A 2R1WB 4X7TB 1IILE 4RMTA 1FZOA 1JF5A 4JG0H 1KJ2H 2ZYRA 1RZFL 3QXDA 4HF5L 4HH9B 4YSEA 1IGTA 2NSMA 2PR4H 2G9HB 3GBML 3OQ3B 2D9CA 5T5FL 3QR1A 4OFYA 5TE7H 4ZUWA 2ZG1A 3KPRD 4E41D 1R5IA 1EVTC 3WV0A 4H13C 4KVCH 5JA8B 4P2OA 4N2BA 1T1ZB 2JJTA 3VFPA 4BD4A 1ZVHA 1TIUA 3IAPA 4LBEB 3MV9A 2DMGA 4XP4L 4K3DL 3HBGA 3BKYH 1NPJA 3LKSA 1HSAA 2OMZA 3EG9A 4U2YA 4F8NA 1KIQB 3NFNA 3A4DA 2X89A 3ZN6A 5LGKA 4QRAA 4G7QB 3CXDL 5CS7A 5IR1B 1IFGA 1DVTA 3BP4A 4GIPD 1KPRA 1PD1A 2ZXBA 4M62L 5AD0B 1JGLH 4ZQKB 3KGRA 3BAYA 3QE5A 3D08A 2V9UA 3ESOA 1NMBL 3H9HB 1KTLB 5DHVB 2NUPB 3W39A 1SBSL 3H2PA 2WXQA 3SZKC 4BCXA 4ANWA 2P28B 2Y07L 4FCAA 2KMWA 2ORBL 3NVQA 2AK1H 3PGDA 2Q5BA 4QTIL 2WXGA 2DS4A 3QCUH 1MW1A 2PUQT 2N4IA 3H1ZA 4HPOH 1O6TA 2MHAB 1Z0NA 3ZZLA 4Z77B 2ZX6A 5HVWA 4GW5B 3GMPA 1BMZA 5BJTB 3MLRL 5KOMC 3CK0H 3QRFM 3FHQA 2AJSH 2PXYA 4EXKA 4JZOA 2NUTA 1LE9A 4NJAH 4NM8L 1K8IA 1RZJC 3ISRA 4UQEA 4B50A 4XCFH 5CGMA 2BP5M 4WI0A 1FC2D 3BW9A 3I2CH 1UJ3B 1C12B 1BVKB 1FQ9C 4NPJA 2EH8L 4PREA 3CPLA 3T3PB 2PTTB 5FDYA 3GSVB 2V3FA 4XO3A 4LLAA 1NLDH 5I1CH 2NXZD 3IGKA 3TEYA 4AQ8C 2ZYHA 1J5CA 2V5MA 1TITA 3Q9QA 3PPEA 1PLCA 3QVAA 1X7QB 4LE8A 4NZJA 5KTEL 4JFUA 2VDQH 4TNVF 3MLWH 1ETA1 4H0GA 5E6IA 2DI8A 5BS0E 1V7ML 3FUHA 4AT6B 1E27B 4E9TA 4NO3B 2VLKE 3V79C 3CLEL 3C09C 2FJGA 4OF6A 4WHCA 2VXSH 2X4OA 3HR6A 2ZCLL 5KZCD 3LKQB 4MJJA 4R2GC 4Z7UB 2YFNA 2PPDA 3HG4A 4JY6A 4WU5B 4DW2L 3S88L 4EPSA 3QUHA 4IOIB 2ZAHA 4LPXA 3WNMA 1T7XA 3QUXB 2VTFA 2CLZA 3QFDB 4GS7C 1MRFH 2DQIL 5CCKH 3RAJL 3BUIA 1IBDA 3FTZA 2AEOA 4NRXB 1Z7JA 1EXHA 1TVHB 1VFBA 3N04A 2R59A 1V3KA 2AJXL 4TYUA 4U1SA 3T0BA 1F56A 4F27A 3D5OF 3SDDD 3ZOAA 1I9IH 1WEJL 2X4SA 4G6AC 4HKBB 3CDZA 3TO2A 1OXYA 2VLMD 2X1OA 4OIAA 3MRMB 3RWHB 1OQXA 5BVPL 2UZIH 2V7HA 3SGDI 3FO9A 5LDUA 1UASA 4DAGL 3KAAA 2R56H 2NZ1A 5DUBA 4ZX4A 1PG7W 2IALA 5AALA 3TWYA 4RA3A 2TRYA 2AVGA 2BS8A 1KIRB 3LPOA 4HZLB 2E9BA 2A73A 4JRWA 4Y16A 4FQ1H 3FBQA 4Y9CA 1TYRA 2PXYD 2ADIB 5EUOA 1PL3A 1I1AD 4MVBC 1D5IL 5JDJA 1QUPA 2GI7A 3L5IA 4GG8B 5E5RB 4L3EE 1DL7H 1SJEB 3H3PH 3I75B 1N5AB 3Q44A 1TU2B 3ZNGA 4JL2A 3QS2A 3RKDC 3IS0X 3BGFC 4MMYA 4S1DD 3QB7C 5IV2A 4XE5B 4LHQB 4DN3H 1EJOH 3HZ3A 1GCFA 1A3RL 1FF5A 5HYJD 1X5JA 3GZQA 5L2JA 3PDOB 2EJ1A 4GRLB 5C6TL 4DTGL 1ZGLP 3GGWA 4R84A 1QWHA 1DBKH 1KOAA 3F6JA 1M2VA 3VNYA 4PJ8D 4PJGB 1A47A 3OKDA 2YD7A 1SMOA 3EW3B 5MERB 3TBCA 3GHPA 4FG6D 4NKQB 3LS4L 2F53E 4DOHB 3EOYG 1KEGH 1I1AC 2R2CA 3MOQA 2ZKMX 1ZHNA 4U0QB 4UNTA 5CKAA 2HTKC 1QX1A 3MTRA 4N9GA 5DWUH 3Q48A 4OLWL 5KS9B 3QJRB 2PR9A 1RJZA 3WUWG 4PY8I 1GIGH 3VRLF 4CU8A 1YZZA 4M1DL 3KPLB 4XCCL 5DVPA 3V0VB 4IMKA 3HS8A 4AQOA 1ETZB 3OC8A 1JZ4A 2UWEE 2WSKA 4ENED 3WFCL 3UTZA 4I13B 2VKWA 4P23A 5CEZH 1BBJA 5BO0D 1OAKL 1SEBA 2C7FA 1EUTA 4C55A 1WT5C 5IFHL 2GEEA 2VW6A 4Q6IB 5FYJE 3QDAA 4D9QD 1U8CA 3GSXB 2NRDA 3GSQA 1S7XA 3QIBD 4MMZB 1AGFA 1A6AB 5J6HB 1MSPA 1P84K 4QHMB 2HFGL 3E2HB 4K8RH 5F3FA 5HBBA 2RIKA 3TX4A 3VE0A 4G7RB 2VMEA 4P9HH 3V5DA 1JD7A 1ZA6A 2B3IA 5E6RB 2LGNA 1CE6A 1RK0B 3NJFA 1YEFH 1EHKB 1MHCA 2QDWA 4YR6A 3V6BR 1U8HA 1H9DA 1WFMA 4AGNA 2QKIC 4G6KH 2XZCH 3VA2C 4M8UA 1XGPA 4J3SA 4AG4H 3PWJA 1DANT 2ZNWA 3E6HB 3CFEB 2AABL 4TQIA 3V6OC 2BH0A 4XI5C 2GUOA 5DJXA 3UTSE 3B8SA 3NRPA 1E9QB 1O6SA 4HLJA 4U1KA 3T9WA 4FXTA 2Y36H 3TH4T 4L29A 2OSLA 2EYTA 1FV1B 1KB9J 1N2RB 4ZOAA 5E23A 1BFOB 2UZYB 5C07E 4J39A 4FNRA 2EABA 1T1YB 3APDA 5F7HA 2Y2YA 5DZAA 5B8CC 2RQ8A 4RCAA 4WDIA 4LNRB 3WKMH 2A77L 3QSKB 1N8ZB 1NMBH 1JTOA 2FT8A 4B9KC 3PS6A 2APWA 2YPLA 1RIVH 4G8AC 1ORQA 2XXFA 3II3A 3HUJA 1F90L 4NCC2 3B37A 3KPPA 2FD6L 3QJTB 4W9ZA 3QEQD 4HDIB 3ASOB 5IMMA 3H9SB 2EXWD 2J43A 3OMAB 2RHEA 3FUDA 1X44A 3QRLA 4ZFOA 1FL3B 1NBYB 4V1DA 2EICA 1QLRB 2TSAA 2X38A 3EUDA 3ZGHA 3L8QA 3KPTA 4OZHF 4TVUA 2BHYA 3NIGB 2VR9A 3TN0B 3WXWL 3ALXA 3OJ2C 4MLIA 4Q2ZA 1H6UA 5HYQB 4MZRA 5GRXG 5AKVA 5CGBA 1GAFH 4M6OL 1NAML 1U91B 4X80H 5I6PA 1BD2D 1HI6A 1Z6JT 1I53A 4UOQA 2E7DA 4QRSA 3EBHA 2VDQB 1FVDA 1TJGH 2E59A 2VDLB 3AQXA 1WCQA 3IFLH 3LX9A 5FCUL 3DI3B 3FYEB 3RGBA 5TDOA 1HH9B 3T4AC 1E2VA 1B4LA 2ZXCA 3O4LA 4EDWL 1ZSDB 4JPKL 3ZZSA 1LLAA 4BINA 5IIEA 1M6OB 4K9JA 2E9GA 1NEPA 2VRKA 4KRPD 5I0XA 4N2LA 4F58H 5GGSY 3CZUB 1BAFL 4R97B 3TJPA 5JIIA 3ELQA 4N8CL 3TEWA 3MV7B 2OQJA 5TH2A 5GPRA 4HJ0D 2JELH 2R0ZH 4HGMA 1OT1A 3LNGA 5F7KC 1RK7A 2L7JA 3QDGE 4HIXH 3T6ZA 1L9OA 4KK6D 4WFEE 3QORA 4TSAL 1YQVL 2JJWA 4RGNB 3RVUC 2XVLA 5D7SL 3IXAB 3ZT5A 4RETB 3HR5B 5K9JL 1FCCA 1FVCA 2FLRT 5IW1A 4FHJA 5TGBB 5A43C 3O2VH 4KKCD 4NC0B 1T6BX 1G7IB 3LH9A 1TQCC 4MYPA 4FCHA 4GAJH 4JQVA 3ZR6A 2WK2A 3NGBB 5AOIA 4K94C 5H37H 4Z0XA 3H85A 4AJYV 5KYYB 1N6QH 1LO4H 2Z9TA 1Z9SA 4PJEA 4XN8A 3Q5OA 3CFNA 1CICC 3DHMA 2ZONA 3QULB 4G5ZH 5J6GB 1G6RB 3P0VH 1J0JA 1A6WH 3O8XD 5DEGA 4Z0BH 3U36A 3WFEH 2QPDB 3MRJA 4GBXC 3S3PA 3LJ3A 4WSJA 3OF6D 3CZJA 4DP6X 4W9JC 4MD0B 3FU3A 4TNFA 1A4BA 4XRCB 5F96H 3QHFL 1CL7H 3BN3B 5FW6A 4IIZA 5BUAA 1R3IL 4KK6C 4O2EB 1DDHA 2WCGA 4NC2B 2HKHH 1GMIA 5BQ7A 2XACC 3GXTA 4Q9QL 4LLDB 4W6WB 4FFZL 1BHGA 1Z0MA 2WLLA 3GPSA 5F9DC 3OJDB 4BUHA 2E7LC 1PLGH 1AZUA 2OK0L 1H9VA 3IFNL 5I28A 1FNGA 1JVLA 4WI3A 3P4OA 1OE2A 5JW5A 2BWDA 4HIHA 3VB8A 3SCMA 5LJYH 4NQCB 3L9RA 5F7FA 2VZOA 1V55B 2OMTA 4IBYA 3VXRA 3SDXE 4ZX6A 1WITA 2V2TB 5CWSA 3TA3A 3H42H 3BHBA 1OCRB 1AC0A 2QVIA 1FFOA 4QGTA 3CU7A 5I0ZA 3Q2VA 4Y5VB 3D18A 4XC3H 1MJJB 2WXMA 8PAZA 4TTDC 1T5WA 3WHE0 3W0WE 1H19A 3CZNA 4R0LC 2FR4A 1FN4B 3G6JE 1JF1B 2V17L 4JFQB 1LO2H 1JXGA 2EDMA 5JUEH 5EU6A 3MBXL 5CILL 3O2WH 4DP1X 2CDGB 5HHOB 4GSDH 2NCMA 4N68A 3CSTA 3VSTA 1JAEA 2QGDA 5K9QI 3KPNA 1UZGA 1M56B 4RX4D 4N8VG 4H0HB 3LH2H 2WIIA 2NY0D 2EKJA 3FSVA 1B3JA 4P2RD 4ZXBA 3ZDYE 2QQNH 2R2BA 1IQDB 3RP1A 4O5LH 1OAKH 3SDXA 2QPSA 2NNCA 2FE0A 5J3HC 5CP3H 1FE8L 5LAPA 4HJGA 2WSDA 4L8SC 4B5ZA 2X9ZA 2EYRB 4LSPH 2WNXA 4I18B 5DC0A 4P04A 5J1TC 2P24B 1RULH 4L37B 2HA1A 4UQDA 2YD2A 5DD6A 1HOCA 4UBDC 4N2FA 1DQJA 4PJ5D 4MA8H 4HAGA 1M7DB 5E08H 1VZGA 2QQLH 2ODHA 4NQTA 5BV7H 4MB1A 2X4PA 3N85H 1I1FA 1SPDA 1BVLA 4GQRA 1A22B 1NFIB 1UD3A 3IAQA 4A7UA 1BJMA 5DMKA 3LOWA 3D0AA 1NFKA 3UP6A 1L7TL 4BELD 4IK6A 5DS8A 1H3WM 1XTMA 2ESVB 2JKWA 2ZJSH 3BUYA 2DQEL 3I9GL 3K4AA 3VI4F 4YO0B 8CGTA 2DLFH 3HUJF 1BIIA 4KZDH 1TEYA 2XZQL 4MBRA 4XGZB 5EA0L 1LEKB 1UVQA 4MD4B 2ICEB 1P5UC 3D25A 4IMLA 1R24A 4HIIB 3ZO0A 1RIHL 5I0YA 1LNUA 1RHHA 4GSQA 5FV2A 1VIWA 3I6SA 2V6HA 1IAIM 2DV6A 4OUUA 3D09A 4F3FA 3GIZH 1F13A 4GB9A 5EOCH 3DMMC 3ARBD 1WC7B 2WQ8A 5CJ5A 3AITA 1PZUB 3OAUL 3BIKB 3QNXB 4YSCA 3JT0A 1J5OH 3MJ9A 2F54E 4NQXB 3PRZA 1U3NA 2Z93B 4JHWH 4RFEA 3TVMC 4G2AA 5AAMA 4CMHB 1J5DA 3U25A 3GUFA 1DANU 2DLHA 4ODSH 5IK3A 2MPAL 3KGTA 3EBIA 4Z3GA 4LOFA 5ITBH 3S36X 4QHUB 6PAZA 1QI4A 5EU4A 1X6LA 4TSCL 1QBAA 4BM7A 4IGBB 5JZ7D 4ZDHA 1U3YA 1H8LA 4XVUD 2XA3A 4G6ML 3ZXAC 2BIMA 1OGSA 4ALAL 4XBPB 5ESQB 1GGCH 1S7VA 1V8HA 1X9LA 3QR0A 2NY3B 1EBAA 3I74A 3T2QA 4RZKA 1IBGH 4P2QA 5EEWA 1OP4A 3B56A 3MLTA 4UTCA 4PJAB 5CAYB 1MFBL 1TXKA 1RP9A 1OGAE 4E41E 4YOKA 1M9WA 4IQHA 2BIQA 3IF1B 3JWDC 1ZV5A 4HFUH 3EGXA 4HBCL 2FGZA 3TA4D 1N19A 2VR4A 1P7QD 5ANHA 4E9VA 1XH0A 4Z95L 2BXYA 3EFFA 1SXCA 4R2GB 4ODXB 3QUKA 3AABA 4TUUA 1AQKL 1KB5A 1Q1PA 4U1LB 3HAEB 3QUXC 2WIMA 4JLRB 4ZFZB 5LNGA 1CT8B 4BFJA 4QXTA 3VD9A 3H0TB 2XV6B 2VJXA 5SV4A 3HI5H 3L3OC 3LKSB 4EO5A 3EG9B 1I1YA 3GNML 1F4XL 1FNHA 3TNMA 3T2OA 5AB0A 3MA9H 3MRKA 3D2UA 3GEWB 2IPKB 5D7SH 2AQNA 1IFHH 3CZLA 2IOOA 2VXTH 1OAUH 4BHUA 2P5WB 3OLGA 4UM8A 1SZNA 3PYCA 4YDJB 5GISH 2EDEA 4AUUA 4BH7A 4LKCA 2H3XC 4TN9A 5DUPL 1QVOB 3BH9A 2JKRM 3VFGH 4FTVA 4V1DE 2HX8A 4GH7B 5F7DB 5K9QG 3KLDA 3FQXA 1DEEA 4OGYL 4TUKL 5I19L 3BRDA 3DX6A 3KPMA 3ZDXE 4J27A 5DVLA 1BGXH 2QBWA 4Z8FH 3E1F1 4GW5A 3D39A 5BJTA 2FX8L 2VC2H 1SOXA 1PEZA 4PWGA 5H35B 5DEJA 2J4WL 4C4KT 5GHWL 4Z78A 4DERA 3D07A 5IJBC 3OVUB 3B2DC 3OD3A 4L48A 4X4KA 4ZOCA 3EYUL 2BNQB 1NMCC 4EVNB 1E2ZA 1TO4A 3L3KA 3EDJA 3FB8B 1L6PA 1KV7A 4YXKL 5KBMA 3Q06A 3QISA 1TMQA 3PWLA 3ULUE 1DJGA 3KPOA 2OZ4A 4TLKA 4FFVD 5DEFA 3EZ8A 5H94A 4LSSH 2H1XA 2WO2B 1YEIL 4HUCA 4Z7OF 3ZMRA 1PX4A 1I1AB 3FF8A 2CQVA 5A16A 4WU7A 5M95B 2F58L 4FRWA 3E8UL 2E56A 4JDVA 2Z7WA 2JV6A 1WIUA 1SXSA 3A5VA 5LG6A 1IL1A 5CR8A 3PNWB 5DZOA 4C59B 1B0WA 1JRHL 3MCLH 1RKRA 3ULSB 1Q9OB 3AQDA 1BOGA 5EZJA 4IBLT 5BRZE 4GEIA 3BMWA 2X4OB 3K80A 4WO4B 4QMEA 4LRIA 4PY7B 1HNFA 2R56L 3HFFA 4JFDD 1V5JA 2OXHA 4QT5B 1THCA 3WJLC 2BCKB 3FZUD 3SO5A 3U7WH 4HKXB 5GZOD 2YLKA 4AM0Q 5SWQB 4YHKL 2QPFA 1D5IH 4NZ8A 1X5MA 3IAGC 2VLRD 1A3ZA 3CX5J 5G4MA 5LGHL 2BOCA 5D5MF 1HHHB 1KXVA 4PGEB 4EN3B 5GSVA 1XCWA 3PHQA 4WFGD 2OFQA 3MO1B 5JIKA 1KNOA 3C08L 3U82B 2Z64C 3MACL 2NDGA 1DVFC 2DAVA 4KBPA 5I8OH 2ITEA 3VYNA 4LLWA 5INDA 3BP5B 4PIRF 3KPRE 1PZBA 3PAYA 4PJIE 4XPGL 5I15L 1K5WA 4FKEA 4FYQA 4MGXA 3JWNC 4WJG3 4BCYA 1JJUA 4AM0B 4PJFE 2G60L 3MJ8A 1FNAA 2CIKB 3VXQA 1BFVH 1OARH 3SKOB 4IBUA 3MV11 5E4EC 2CK2A 4IW4C 4FQLH 4KK8D 2E3VA 3KPSA 3B7TA 4MX7A 4EBQH 1IE4A 3SO3C 2ENYA 1RK1A 3V0FA 4DETA 4K7PX 3O2DH 3CHRA 1EEQA 3BIBX 1E7VA 2E86A 4X7CC 4CMMA 3HJ0A 3RWDA 3VFMB 3UAAA 5D4JA 4I77L 2ZWYA 5TE6H 2OJEA 4IDJH 5IB1A 5DWUL 1E40A 3F01A 3TCTA 5DS2A 1V7MH 4AZ8A 5DZ9A 2B9BA 4Y1AD 1WBZA 5CBEB 3NTCL 1BDYA 2ENPA 5LBSH 3PJSB 4YHPA 1NBVH 1JN6A 5D2NB 1AHWC 3VSVA 2NY5H 4JM0A 3L3HA 1S3KH 1HHKA 2WUCL 4W4OC 5CZKA 3I3EA 2CU9A 1U41A 2FK9A 1BJ1H 2WQRA 2WXIA 2Y3AA 5FA4A 1L9TA 1PZ5B 1WPCA 4X2UA 5L2KA 2MSPA 2R2HA 3EYVB 4XMLH 4GQZA 1MRFL 2H0EA 4L5FL 5AW3B 2IAMB 4XPHH 3RU8L 3ZMNA 1EAPB 2XBTA 3FQ4A 4HLZG 4L1TA 5CUSH 1Y1DA 2XIDA 4KO5A 4BDVA 1LQBC 2DD8L 3H6JA 1MQKL 4D7PA 5KJ7E 1ZT4A 1E67A 1WE5A 5EO1B 5BOZG 2OXGB 2L8AA 4KQ4H 3ZZQA 1AJ7H 3FBKA 3IGFA 4OCSL 3IGAB 3CVIH 1KENL 1M05B 2BNRE 3RTQB 5I26A 1PYWA 4GINA 4LLYB 4R2GD 3NEXA 1AGBB 2A0LC 2VDPL 3SSGA 1XEUA 5MENE 3T3PF 2EO9A 5FM5O 4CADA 1GOFA 4YL9A 1IBGL 3Q43A 2R4SH 1HU8A 4QO1A 3WEOA 2JSFA 3VG0L 1B9KA 2QT6A 3AW5A 4EOWH 2P42B 5I17A 1DL7L 5DC2A 2X6MA 1GXEA 2X4QB 3VXUD 2CRMA 3R0MA 4QRRA 3BWUC 2C9XA 3QO0A 4D0DB 4D94A 3CUPA 1ZA6B 5ALCL 4BIKA 2J6EL 3T3MB 4GG6A 5LO7A 2CXKA 1RIVL 1U4FA 3VFNA 3H7BA 3ZK0A 2RR3A 5CF3A 3WE6B 2Y2TA 3EJRA 1ZLSL 3SE9H 1FH5H 1AXIB 2A3TA 2B8OT 5ENWB 1MNUH 4ELMB 3NACL 4N90D 3ZMEA 3D2TA 1ZXQA 5F7EH 4Z7NE 1VERA 2Y7LA 3D4ZA 4UMSA 3W2DH 5CCJA 2X6UA 2AF2A 4HSQA 3FFDA 1LDSA 2J20A 3K0WA 2EUXA 2MTAA 2X4NA 1KXTB 2HRPL 3LY6A 5K9OB 4NZRL 2VR3A 4O4YH 4O00A 2BDNH 1QUNA 2XU9A 4D0BA 5CJXC 2X0UA 5G2NA 5IJKA 1MCWW 3VD3A 4HDIA 3JWNG 4JRXB 3ZE1E 3ARDA 1RZGB 4JM2F 4H40A 5AFAA 2Y9RT 3CJJA 1TQTA 3CHSA 3RWJA 1S46A 2EDNA 3RQ3A 3GMOA 1QACA 5IROA 3SDCA 2AC0A 2P1YA 4TSBH 4ZT1A 3TN0A 4JZJC 1BJ1J 5HGHB 4GFTB 2G3MA 2FATL 1PY4A 3OMZA 3HZKB 2VL4A 4MMZC 1U30A 2CO3A 4KX8A 3L95A 4AMWA 4YFLF 1E2WA 1I9EA 1LK2A 1XSIA 4MAYA 1GGTA 4QR7A 5I1JL 4KDWA 3MLWL 2ENJA 4JHVA 5IJVA 1WA2X 3MREA 3BESR 1KELH 2D2OA 4Y19E 4DP7X 3GIVB 2ZD0A 5FYKU 3FTXA 3BVUA 4OJEH 3ZKND 4TUJA 1A3LH 3NAAL 2VMDA 1CFMA 5IHLB 1BWWA 4BFKA 1PMYA 1SNRA 4ZMAT 2NXYC 4UCFA 4PJCE 5FS5A 3V4VH 1CG9A 3SPVA 4BZ2H 1NSNH 3Q0HA 3DVGB 3ZSSA 2OQJB 4KZCA 3BVXA 5TH2B 2WXJA 3VI3B 5EZLB 2OMYA 4M7ZC 5DRZA 2WAQA 4NQEE 5BO1L 4GO8A 4OZGB 5CO1A 2YK1H 2G75B 2J8UB 4LDLB 2XG4B 2CCWA 5DRWB 5IW1B 1QSEA 2G5BA 3U0PB 1G6VK 1XIWA 1E90A 2ZKYA 3EJCA 5ITFB 4GNKB 2IOMA 3D51A 1PF3A 3JWNH 1LD9A 1T1XB 2W59A 3S5LA 4R3SA 3RGHA 1A2YB 1P1VA 4FZEH 1DP0A 3N9GH 5DJ2A 3NMEA 4ZPTB 3C6LD 3ZHLA 3DPDA 4EZJA 1D9KA 5T5NG 2XWTB 3ILPB 5I1AB 5TE4L 5FV1L 1MJUL 4L1HA 2QV2A 5I30L 3L7EB 3FO2B 1U21A 4ADIA 4Y5YC 4MXQC 3ZYOA 5D1XC 5DSCA 4R26H 3DIFA 3MUGB 1FNSH 1SYVA 3TVMD 4XB3A 1KGUA 4YDLC 1VAHA 1S8DA 2HLAB 4LLDA 3BP7A 2BNQD 4WGWB 3RHWF 3V6ZB 3QXUA 4N28A 3VFTA 3TYGL 2Z4QB 4JFEB 4TVPD 4Y8DC 3IJ9A 3VDCA 2WN3A 2HVJA 1GS7A 3QEUA 1A4AA 4Z1PA 1JTPA 2V9TA 5KVEH 1QRKA 1B88A 1SLXA 1SN2A 3RIKA 3IJEA 1FYTA 2XTJD 3NOIA 3OKKB 3ETBJ 4JDZA 1SY6A 2OMTB 3A6BH 4HXBL 2VDRH 3GJEB 2WBJA 1T89C 1F4AA 3RWEA 5HYSG 5FM5M 3TA3B 2Q6WA 1GKOA 1A21A 3B2UC 3D3VA 1EX0A 3EH2A 3HVNA 5LXGH 2P26A 3P4NB 1OP5K 5EPMB 1KLFB 2GIMA 3C60A 4ZK8A 5B3NA 5DZVA 3VQ1C 3OB8A 4QHKI 1FG2B 1KCRH 2GFBA 4TLUA 4PVBA 4NAQA 3ME0A 1DO5A 5AOZA 2YD1A 3NIGE 2QVMA 4MCNA 3CPLB 3G5WA 1CBVL 2W0KA 3LEXA 3JXAA 4AEIL 1R0AL 3NRQA 1N6VA 5HHOA 1T6VN 4ZOBA 4OM1L 4JFYA 3HE7D 4X6EB 2X4RA 4QD2E 1RUPH 4D3CH 1CF8L 3PIQA 1I3UA 1BAGA 1JZ8A 1CICB 3B7SA 2Z35B 4OLUH 2UYLA 1BBDL 1JFQH 2OBGA 4GRLD 3ZKXC 4X7FC 1WAAE 5ECGA 1T83A 3I6LD 1Z9NA 1ZTXE 3KHOA 5ESVA 3VM5A 2BMKA 4NQUA 2MWCA 2HLEB 4XMWA 4A7GF 5BV7B 1AGDB 2MCG1 2Q76A 2C3VA 1HOCB 3AWGA 4MA7L 4TLSA 2G5RA 3L08A 1D5ZB 3N6YA 4PLJC 2N0MA 2GK0A 3QUXA 3WLWD 4OW6A 5AAPA 5F7UA 3IFPB 4CN1A 1GW0A 1OSPH 1N12A 1I1FB 3HI1A 1VEMA 3BVDB 1PLGL 1AC6A 4DVBB 5IGXH 3HJEA 3HOGA 4UF7C 4L1BA 5D7HA 3LKNB 3ASWA 1Q9WB 4K7FB 2C3GA 3DV6A 4Y4KA 4BKLA 1KCVH 2GYSA 4H5SA 2EVIA 2F8IA 2IH3A 4G9FA 1EWHA 4D7BA 3STLA 4HW6A 1XF2B 3MNWA 4O2CA 1GCYA 1SYSB 5DD0H 1HZHH 4A38A 4P8QA 2CRYA 3HZMB 4HIIA 4OD2B 3KDMB 4N2KA 4UOJA 5I6LA 1K2DB 1JP5A 3B4NA 1HEJC 1ICTA 3F62A 5ITBL 4I5BA 2R51A 4PGCA 2CHDA 3TL5A 3KL3A 5KVFL 3DSFL 3ECUA 4PWFA 4OCWL 5D7IB 5IW6B 4AYID 1KEMH 1MCBA 4PLKC 3ZTNH 2DBJA 3O2WL 1NCBH 4JN1H 3FK3A 2G9KA 1E0OB 1WHOA 3MNVA 1WAAA 3EO0B 3BSHA 4CC0A 3SJVB 2WLZA 4X5WB 5T5FH 4K5MA 4WJ5A 2E27L 5BW7C 4XN2A 1GGIL 1A0QL 1SF3A 4FFTA 1M7IB 4QOKE 5ICXB 4OD1L 2DWDB 5B38A 3II2A 2BFVH 3FRPB 1I7UB 2W07B 2PYEE 3LAFA 4JM2C 2HT2C 5GS1A 1U92B 1PX8A 4I18C 4S10A 5D4IA 1ZKAA 4GKNA 5LCVA 1RFDH 2ZX8A 4H88H 1GYAA 5D2LF 5L6YH 1GSKA 3NCEB 3SYCA 1FIEA 4QRPA 2NYKA 2AI0L 1OANA 1RUQH 3HI5L 4HEPG 4PJFA 3CFJA 3NCCB 3G9AB 3V4VB 3GTVA 2D7NA 1BXXA 3EGXB 5C0BE 1FFNB 4N8CH 4HEPA 4HX1A 5EF0A 3BFQG 5KS9A 2X05A 4BZ1A 2B1OA 2NQ3A 4WNSA 5MHSD 1LMKA 1BFSA 4X4YA 3QUKB 1AKJA 5GS0D 3AS2A 3HIZA 2QR0A 4WI8A 5DUMH 5HHOE 3BVNA 4KZDL 4U6XA 3RPKA 1NSNL 5J8OA 1QQDA 3F7QA 4HULB 1VESA 1U3HC 3O6FC 4Y4HD 3RDTA 5K9JH 3BZ4B 3RI5F 1KULA 3ILEA 4D8PA 1R5VA 1H3GA 1T20B 5D7JD 1MELA 2KHAA 5KVFE 4F33A 3K2UL 1EBPA 4KTYA 3O0RL 4GRLC 1MCQA 3MLZH 4Z8FL 2ZF9A 2Z34A 5DJYA 2K3HA 1K4DA 3DMMB 3FQ2A 3ATEA 3KL5A 2AK4B 3KMDA 3T0ED 4LKCB 4WI2A 1QVOA 1TSHA 4Z0BL 1IIIA 1R4XA 4TL4A 4GUPB 1GMEA 3WLWC 2DWSA 3UYRH 4ELKB 2DLIA 1H15A 3D4GA 4HFWA 5HDBE 4X5XA 3PGFL 1LO5B 4QCIA 3VXSE 5DJXB 3SEPA 3WI9A 2BY1A 3LNIA 5E9DB 1QFWM 2ZCHL 5BZXA 3MGAA 3S37H 4Z76B 5C0FA 3VWKD 5EIIB 4NT6A 5CEXA 4ZO8A 1VZIA 5IREA 5DLML 4PJBE 1LJMA 2X6CA 1BFOA 3Q6GH 1NGXA 2VSKB 3HHMA 4MXVE 3P9MA 3NIDB 3WFBH 2AQ1A 2X6AA 3MLVH 4DP9X 1A9BB 1SN5A 3KYKL 4Z7AA 4JRYB 2OX5B 4UWQB 3L5HA 4ODWA 3LKRA 4KMQA 3WS6A 2WHVA 4KJPC 1BM3H 1KFAL 3S5LG 3WLBB 1DUZA 3AAZA 3L2LA 1QNIA 4QRPD 5SWSA 2DI7A 3KPPB 5D2NC 1KG0A 3ZRCC 2EXYD 3G5ZA 4NDMB 3VRJB 5CCKL 3B9DA 3DX8B 3TEZA 1TMCB 5H94B 1U8PB 3WKQA 2GTWB 4JE0A 3RZCC 3NCJH 3BKYL 4N6RA 2A38A 5DVKA 3IDGB 1FL3A 1NBYA 4E9WA 3C2AH 4IU3A 1H5BB 2DL2A 4JDTH 4KGJA 4ZS7H 3LD8B 3TBBA 1UC6A 4X7DC 4PJEE 4JDVB 2QKIB 2I27N 2HPOA 3A24A 5HI3C 4NN7B 3RIFF 2D31B 3OAWA 3WFDH 4YWGL 1CZ8L 5KYXA 5HJDA 1C16A 2HG5B 3IDNA 3FFCD 4NO0A 1JNLL 2Y7NA 4E9YA 3HBPA 4ZNEE 2P80A 4KMTH 1SDYA 3QWRD 2HTLD 4MJIB 3RFRA 3BZEB 4IKIA 1W72H 2CMRH 4POUB 4QY8A 4BWUA 4ZQTA 5CBAA 1H8NA 3SYQA 1I9RH 3L81A 3TYFA 4D3CL 4DK3A 1AIZA 1EQWA 3N44F 3WDHA 1MN4A 4C4BA 1HNGA 4LK4A 5F9OH 3MOBL 4P46A 3MZTA 3SODB 3H54A 4K3JL 1HHHA 2EE6A 3CN2A 1GYWA 3X1NA 4A2EA 5J0BA 5KANI 4PS3A 3MO1A 3FCUB 4FABH 3IMSA 5AZEH 2WMPA 3BEWB 3AREC 3NBNA 3QK0A 2IV8A 4D0CA 5J5EA 2B2XH 3QHTC 4NUMA 1E9OB 3P4MB 3QEHB 1LK3L 5C8JA 5I75C 1RJLA 1S7UA 3X1EA 4CVZA 1TTCA 2YJQA 5E6IC 4F7CA 4M1GH 2BC4B 2YJLA 4RISL 2C9WA 3SKOA 1NGPL 1XAUA 1KF9B 5ICUA 2CHNA 3KPSB 4BFFA 2DQTH 1OGTA 2G4GA 3T6WA 1Z3GH 3E0GA 3AMLA 3AU0A 3PABB 5EF1A 5T3ZL 1YEIH 3ESNA 4Z7VB 3VFPB 2E8YA 5IMLB 4PD4K 2HJFB 4OZIF 3L9EA 1JDCA 3KXFD 3PQYB 4XMLL 6CGTA 2WXLA 1LMIA 2C3WA 3IETA 1W0WB 2HXAA 3PF2A 2OMWA 5EFIA 1E8WA 1YVLA 5E2TL 4AZ8B 5FYLL 1IT9L 5M7QA 5IR1A 5I73C 4XRCA 3BAEL 2J5WA 2F7IA 4J12A 4UAOB 5IFHH 2NNRA 4WVRA 5EIIG 4O2EA 5TQ0L 5J12B 2UUDK 3K71A 1BSIA 3VWKC 1ODAA 4KJWD 3H9HA 5C08D 1PZ5A 2QHRH 4P3CL 4HOWA 2GJZB 4PTTB 3IE9A 2AV1B 3K8LA 3QUMH 4NHUA 2I9TB 5DHVH 2PP9A 1DSWA 3ARZA 3K6DA 5G4NA 5A3IC 2CNYA 1KBGH 1MFVA 1P4UA 3VB9A 4OZ4A 2PYFB 2WNWA 4MKMA 5IG7B 1OK0A 3VXRB 1LO0H 3G08A 3O3AA 3K5RA 1F1AA 1X4XA 4GW4A 3R18A 5BVJA 2VLJB 3CE1A 5AVXB 3CFKA 3N40P 1JV2B 4RFOH 2WN2A 1UOWA 3KG5A 4LCWE 4KWUA 4B60A 2NLJA 2OJ1A 2OMUB 4IBZA 3FRUA 3D18B 5CR1A 1JK8A 2GBUA 3HHSA 3BRGC 1RERA 1UWYA 1S78D 5AYTA 5EU7C 2H3KA 3BD5A 2D3NA 3BW9B 4FHKA 2EIJB 5C08A 4LCCA 1PG7H 2AXFA 5C97A 1A6PA 2OL3H 4M61B 2QSVA 2Y24A 4V2BA 2L4OA 4JPWH 5IBUB 3LZFH 4J6RH 3T0VA 1WISA 3BKCL 2VE6B 3I6GA 1XSOA 4S0SD 3G5YB 1EJOL 2BS71 3CSBA 3POCA 2VW7A 4GAGL 4XXWC 4UQCA 3EGDA 5T1MB 3UBXA 5DUJA 2R2BB 4MXQD 2HRPH 2HYMA 1AD9A 1CYXA 1F45A 4RNRB 4RQQB 5E1AA 4HOXA 4P06A 2BDNL 1CC3A 5D7LE 1UACL 4CAGA 4XR8C 5ENWA 3B7UX 3VGAB 3NTCH 2KQNA 4JPVH 3T2NL 4RMWA 5JW4R 2B39A 2HN7A 3UG4A 2Y69B 3BAIA 2CLZB 1QLEH 3POHA 2IWFA 3QFDA 4YDKH 1Y18B 2X4PB 1JBJA 5G5DA 1PZSA 3UP1A 4MCYB 5H37A 2ZUSA 1AXSB 5HPMB 4NO0D 2APBA 1GZPA 5DS8B 1ED3B 1QUNB 3TLRA 3LEYL 3X11A 1SFHA 4KJQD 4NUQA 2XY2A 4JO3L 4ODHL 1H0DB 2R29H 3L2MA 4LOUC 5T3ZE 3MV9D 4ACTA 5I1JH 2NW2B 3HLAA 3CZGA 4U6TA 1KXQA 3GUTA 2IALB 2CR6A 2ZCHH 3A6CH 3L1FA 4GQPH 5IMKB 4WNQA 4AH2A 3CVIL 3MNZA 4KAQH 3L13A 4FQJH 4YXKH 1NUDA 1MWAA 1SJXA 3DDFA 3C5SA 1WZ1L 4M03A 2ADIA 5EUOB 4KX7A 1B0RA 3NYKA 1VACB 4P5TD 5JHLL 3QEGL 4EZLA 4YNYB 3QWOA 1GZQB 1CD8A 2R4SL 1CVSC 4L8SB 4DN3L 1QEXA 4JGNA 2DI9A 1D5BA 1UT9A 2J57A 2AAVA 3US9A 1ZHBA 5C7ZA 3L7FB 3TESA 5IJVB 4PRPA 2WBKA 4Y5XB 4AV4A 2V3DA 4ZUSA 2BJMH 3AROA 4LSTH 4P3DA 4WW2C 3RURA 3MLYH 3QUZC 4NERA 1JGDB 1KJ3L 4F1SA 3ZKJA 1NQBA 1L0PA 2E7BA 3K46A 5EOQL 2DKUA 3B1UA 4PJGA 4ZDHB 1DJZA 2WUCH 4RFNC 4GRWB 3V4PB 1ECYA 3AXIA 3DWTA 1IC0A 4HXAL 4XPAL 3L48A 3RNKB 5B1CA 3S4SB 2YR3A 3IKKA 4KMTL 4RSVA 1CFNB 2UY6B 3MOAL 4URKA 2XUWA 1J10A 4XN7A 3SDDA 3TJEL 1AO7A 5JPMB 2VLRE 1USQA 1JS4A 5I30H 2VQ1B 3O9WC 2CMRL 3TT3H 2VXUH 5FAAA 3NFSH 1JGIA 1QSEB 1B0GB 4L3AA 4YHOL 2NT0A 3IFNH 1J8HD 2GIYA 1OAZL 3QPQD 4WV1C 2LT9A 4AI7A 2RACA 4YC2B 4GQ9L 2JCCF 3JBG7 3MBWB 5HVHC 1CT8A 2D2CC 3AWFA 3MV01 3J2PA 4BH8B 1K6QL 3HG3A 2EVFA 2R7EB 2HX9A 4PRNB 2YWZA 1EO7A 1ZLEA 2XN9A 3DOIA 1TZGH 1LK3H 4UQ2A 1MG2C 1X7TA 2VWEC 3PU7A 4JZJB 4M6MH 2YRZA 5DD3H 4C56D 4E42A 2FWOB 2GIXA 4FA7B 4J5VA 1UM4H 2DEXX 2CO6A 4FEIA 2FWSA 4ES9A 5GIRB 1JXDA 4OSUH 4YDJA 4JPKH 3DYMA 4PJ5A 4KY1H 3L4VA 2EDHA 1CE6B 3BP6A 4YR6B 4A6YA 3K81A 1GGYA 2WQAA 1PNCA 4I77H 1XMEB 4GKOA 4LARH 4YPJA 3VFTB 1MVFA 4X8CA 3U2SB 4NLAA 4IM8A 3OC5A 3E6HA 3F58L 2F5AH 1SM3L 3DX6B 3KPMB 4P99A 4LHUA 1M1XB 3B2VH 3QIBA 5C86A 4KK9D 5FYLH 1DQLH 3NFPB 3BWAA 1KY7A 4KTGA 5FO8A 2HUEA 3K6IA 4H25A 4JO5A 5TQ0H 4YSOA 4OLUL 3O11B 4M3HA 3KYNA 4MZ3A 3D12B 3QFJA 4OFYD 3HZYB 4CJ1A 3ZQXA 3AGWA 1HN1A 4XO8A 1J8KA 2EE0A 3MUHL 5DFVD 1KBPA 3WHXA 1I9JH 1TJXA 4JFYB 4X6EA 5D7KE 2MQGA 5JIPA 4JRLA 1XCXA 1HEHC 2AJZA 2I9LA 2R1XB 4KITB 1KIPB 1ZWIA 4I85A 1TETH 3SBWC 2Z6FA 3V55A 2Z91B 1ACXA 2W8CA 3IRCA 3V4PH 3OL2A 3ZZ1A 2JTYA 1IRAY 3U79A 2YPLD 1WP6A 2NY7L 4JFOA 5ESVB 3N42B 5MP6H 1X4ZA 4OZFB 2BMKB 1N5YH 3U7YH 4GBXD 2HUHA 3RGVA 3S2CA 4XCYB 1J1OH 4GG6E 3V4UL 4P2QD 4CW1B 1WS8A 1RUAH 3VI3E 1NMCB 3CPUA 4FJZA 4LPCA 5HSFA 1BMWA 1HEZB 3SY0A 5HTSA 2WANA 4KHTL 3QDJD 2F68X 3QIUD 4Z9KB 3W9EA 4K3EH 3FH7A 5KVEL 3ILQD 1MCSA 5B22A 1RZ8B 2J8UE 2DMHA 2RFXA 3OKOB 1CK0L 4O2FB 3KLSA 3UPRA 1S7SB 2AQSA 2GT9A 3B2MA 3W2DL 2ITFA 2OSXA 3VGFA 3SQBA 1OW0A 3O2VL 5IHZB 2KZKA 1KYUA 3ZHNA 4U6HB 4E36A 4JPVL 1DTUA 2B9AA 1EFQA 1OLLA 2R23B 4GAJL 3FL7A 4NZRH 1P0SE 4M56A 2PCPB 3QZOA 1WTGT 4ZD3H 4A04A 1E28B 4GMTH 4WHYH 1IGTB 4AIZB 2J21A 4N2CA 1A6ZB 5CZVL 1MFBH 4QHLA 4WFFD 1HKLH 4OF8A 2G2NA 4HBCH 2Y7QB 2KLSA 1QTPA 4TVPL 4K3GA 5F7YC 5GZNC 2QPUA 3MNVB 1FIGH 5IHWA 4L18A 3ARBC 3BH8A 3RG1C 3BISA 2V5YA 1JZ7A 4KAQL 1DZBA 3ALWA 1RULL 4JY4B 3WS6C 2JQZA 2HTLC 4DO6A 2WXFA 1EVUA 4A7TA 1KWGA 3MGOA 1ROWA 1B9ZA 2V9QA 3DVFA 5EU3B 5AD0A 4ZQKA 1DN0B 1DDHB 5J3HD 4F7KA 1YDPA 1PIFA 5K39B 2IDSA 3LD8C 5MI0B 5CP7A 5ECJE 4AEHL 4OGXH 4DQOL 3BKJL 3WJMB 5IQ7H 2BVEA 3ABKB 4PJHA 3Q1EA 3LSOA 4JFFB 3WEMA 4DP4X 5IM7B 3LPFA 3V4VA 2D4FA 2VITA 5GJTH 2X4UB 5BMFL 3CHQA 4HX1B 3E6FA 2IXQB 2CK0L 2OL3B 3P73A 3VFWB 1NM9A 1IAKA 2EDFA 3FUJA 1FFOB 3F04A 3VD5A 5EOQH 4ORGB 4FQXD 5LBVA 1U95B 4Y5VA 2XZZA 4JZOB 2YKLH 4HXAH 1PSKL 2YRLA 3QRBA 1QQDB 3I50L 4X6FA 1JNJA 2VDLH 4WW2F 3NP3A 2QLYA 1J0HA 3CFQA 1T20A 1UJ3A 4BUGA 2MNJB 1DUYA 4XN5A 4YLCA 1IBYA 1MCWM 1OTTD 3BUPA 4NI3A 1XGRB 2FGWH 4M4RA 1G0XA 3M45A 2G3XA 1MIMH 3DSFH 4OM1H 1AHWB 3BN9C 3CVHB 4PV1C 2BX5A 3ULVC 3TBSB 5I8KL 1TPXC 4D0DA 1NC4B 2YN5A 2MPAH 5TDPA 1XVSA 3AQYA 5DMIL 2HZHA 4UQ3B 1ND0A 2HT3D 2LHAA 4NSKB 3ZRFC 2YC1B 4FQCL 5E6IB 3HW7A 4GFXA 3NCWA 3VXMD 4N0UB 4DFIA 3UTTA 1W72B 4B9JA 1EO5A 2OM5A 4QCIB 4YVNA 3G6AA 3GHEH 4WWOA 2Q3AA 4XVJL 3SOBL 4X6DB 5JW4N 4FFYL 1K85A 1THAA 1BW8A 2OMVA 2YD5A 3MX0A 5TDNA 4H2CA 4PJXA 1S5IL 3GXIA 4KNTA 4NQCD 4N2NA 5FHAH 1WFOA 3IU3A 3D0VA 3GZPA 4TVPE 5EORH 5E6YA 3S3JA 1ACYH 1RFDL 5HDQH 5DT1L 4RX4A 4K2UL 2FEEI 1Y07A 3LZQA 4PCKA 2WCSA 4DP8X 5JIDA 3LKRB 1N68A 4GLRI 3D39E 5HHXL 2LR4A 3QDGA 3GRWH 2GB2A 1AO7E 2JXMA 3GRWA 4W4NA 3CDZB 4R4BB 1T7ZA 2X70A 1OP3K 4FXKB 4G8IB 5C1MB 1XFPA 1DE4A 4YO0A 4X99B 2OYPA 1CCZA 4AYGA 5F9WC 3CFCH 3ULVE 4NRZB 1OD7A 2QSCH 4CDGC 1JZGA 2CO2A 3DTXA 4A2FA 2DDQL 3DJSA 3VXPA 2MFNA 4HJIA 5DU7A 5C0RH 4TRPL 3WOVA 3IMBA 4NYLB 4M5TA 1I8LA 4FG6C 4EQ3A 1L6ZA 1XB8A 5D7LD 5EV7A 3ULUH 3WFHB 4IKKA 3IWUA 43C9B 5KVFH 4MB3A 4S1QH 4ZMNA 1JI2A 4GG8A 1KYOK 4XPGH 3IVKA 1KEML 3SDAD 3ZTNL 4JZNA 3B7RL 2E7HA 2N1TE 3I75A 1EMTL 5JXED 2GHWB 4U1MA 5E00A 4PBDA 4X4XB 2UZXA 4LCWD 1TJHH 3GK8L 2PYED 5I71B 1RZJL 4Z3HA 5GS0L 3GMNA 4UZUA 4AWJC 5IV2B 4RFEB 4RGND 1UA6H 4NP4L 1FL5B 4G8FA 4Y4FC 3RKDD 4RISH 3MRCA 2V2XA 3FOMB 3SDYL 3WHE1 5C9JB 1A9EA 4YBLC 2CIIB 2IANA 3L1OH 3QI9A 3BPNB 3PGFH 3APNA 4OBRA 1WBXB 2BVYA 5BNXD 1H3PH 5F89A 3OKDB 3EYUH 2VAAB 4BQ6A 5D7KD 2VNCA 3PWNA 1H6EA 3KLLA 4QJ5B 1VSCA 4XMPH 3ZKMC 4BXSV 4JBSA 2HH0L 3OPZH 4QHNB 3V4UH 2R69L 2BC4A 2VC2B 2QZ5A 1F6AA 5F3HA 3JZ7A 3BAEH 1XIWB 2BIPA 4HK3J 3S8FB 3IPFA 3GSRB 1RJZB 2Z8WC 3C09B 1MI5D 5IW3A 3SBRA 1I1RA 1OGTB 1INDL 1E4XL 4IRJD 5GGSA 3KPLA 3V0VA 3BN9D 1M53A 4ZPTA 1GGBH 4UT6A 4NP9A 2RCSH 4FFVC 4P2QE 3WFZA 2DQDH 4EMZA 4F7MB 3S8WA 2NY1D 1ZPLA 4QF1A 3UBHA 3C87A 3B2PA 3HRZA 3MODH 4I4WB 2ATAA 5DRNB 4AENA 1A6UL 3V9CA 2O5XH 2ZUQB 1MLBB 1RZQA 3QZWB 4F15B 3VG0H 5CZVH 5E2VL 1S8DB 4MDIA 4NRYB 1BGXL 2LLNA 3RVWD 1HKLL 1JVKA 2BRRL 5D7JB 2FX8H 5GGRY 3RZCD 2FJFA 4X5LA 1L9PA 1ZGLA 2R29A 4X5PA 5H2BA 4WEBH 4ODTH 1LDPH 2MCPL 3O4OB 1MCEA 4KFMA 1ZSHA 3UGUA 2ITCA 4K3JH 2KZWA 2XPYA 5DGRA 5F0LB 1DBJL 2F61A 5CCHE 3KLQA 4DP2X 1XL6A 3Q6GL 3TC9A 3CFKB 1NIDA 1P2CB 3X1FA 4Z78B 3D05A 3FO1B 3AREB 2G60H 4G80B 4P2OC 4QDGA 1V3JA 4QRUA 1ZLSH 2XQBL 2JJTC 1CB4A 3HZVB 3IDMA 5HGDA 4EE2A 4HUKB 3A23A 3B5TA 5D93B 4EBQL 4XWOD 5SWZD 3O45A 3PUUA 3Q6FA 2Y7SA 3IB4A 3TP4A 4AMXA 4XPFL 1ETJA 1JWUB 4K5OA 1X5KA 1AYRA 3VH8B 2EDLA 4JFHE 3NEEA 4WHDA 1ZK9A 2W92A 4AQEB 5IMMB 2O5ZH 4UM9D 4YDLB 2NOYA 2R9HC 4S1SL 3QCTL 4WU7B 3EJPA 1GW6A 2FHBA 3ZRSA 3F7YA 3MAWA 4BQ8A 4BZ1L 1IO4C 1CICA 1C1EL 1AZVA 4OB5H 5HPOA 5J1SC 4OBSA 4Q97A 3QDHA 3MDJA 1KPUA 3J8F7 4J3BA 8FABA 1FSKB 2UVEA 2YEZA 3B43A 1UUSA 2VW4A 4NXKA 3PWUA 2GJ6B 1BX2B 3VWKB 1A64A 2BCKA 2VERN 5E5MA 3RU8H 3IDUA 4HLEA 4PGBA 2WLMA 2RA1A 2KT6A 3W38A 3HI1B 1NC4D 1F0LA 1UYWH 3KD4A 2Q87A 2BINA 3SDAA 4O02B 1QLFB 1XMWA 1HXYA 4PG2C 4F9LC 3S37L 4OZFH 2UX7A 4OAWB 4MQXD 4EN3A 1KCUH 3PHQB 1NOLA 2WLJA 3DV6B 2NX5E 4Y4KB 3KPSD 1E4JA 2A83A 1MFEL 3FB6A 4UQ9A 2PTUA 5DJAB 1R3KA 3STLB 1M4KA 3AC0A 4I3SH 2FH8A 4XPTH 1T03H 3RIAF 4JJ5A 1SYSA 1BQ5A 5FYJH 4NIYE 1OKEA 4ACPA 3HHRB 3D2UD 5D72H 3GSNL 5CD3A 4NB7A 3GXMA 4Y7MA 5GSRA 3ATFA 3VXME 3HCVA 2Y06L 4QLWA 2P5ED 3GQFA 3OSVA 4GSRA 1WAAF 3R19A 5IFJA 1JPSH 4CC1A 5KYUA 3EYOA 2QVKA 1WVZA 5IY5B 2YBRB 1XBDA 3KWWA 3U46A 2GJPA 1JUFA 2BLFA 5HHPA 1RK1B 1KGCE 2YK1L 3BKCH 2WBXA 5IBTH 2G4EA 3MVSA 1O7SA 3X12B 4CA4A 1IJ9A 3L3GA 3FB7A 4KXBA 1G6RA 1XF3B 3KBHE 3W5MA 3WO4C 4QTIH 1FGVH 3VO0A 4GAGH 1KGWA 1AR1C 3IKCB 4JHUA 4ZXBC 2NY2C 2RJMA 4X6CE 1Y6NR 5FYLE 5IB1B 5B38B 1NTDA 2DQCH 2GC7C 4P3DB 1EXGA 4GXVH 5CBEA 3CBRA 3RB7A 2RQEA 4ABQA 3MBED 5CJXA 5JHDB 1P7QB 2XKNA 2EXSA 5IT2L 1KYOJ 1U92A 1PDKA 2YXMA 5GJSH 3NIFE 4YIQA 3ESVF 3IN2A 3RNKA 4I0PB 2LU4A 3L4UA 2DJSA 5J7CC 3S9DB 2DD8H 3QFJD 2WQVA 1T5XB 1K6QH 2HVBA 4OFQA 4UOZA 2JB6B 3RVUD 1FNSL 3ABZA 2NY3D 2VM9A 4Y16C 1NCDL 2NXYD 3D48R 5JW5B 3K7UA 5LHDA 2IAMA 2DH3A 3FKUS 3GJFB 3VSQA 2LAAA 4TF4A 1WJ3A 5FX3A 3TYGH 3QZWG 3EDEA 1I3RA 3JV5A 4WUUE 4OSUL 4ODHH 1HT6A 2AANA 1NGQH 2VDMB 5D5ME 3RE0A 4DOHE 5JW3L 1VPOH 3MBWA 3W3BA 1G7LB 4BK5A 2WQSA 1QFOA 2EE2A 1P6AB 4DUWA 4YBQD 1BQLH 3DARA 4Z7QB 3WMQA 4FJYA 4H44C 5D6CB 4IOFC 4WHTB 3BDXA 1OWWA 1P53A 2ZKHH 5E8OA 3ZTEA 3MV8D 4PCSA 2AJVL 4N22A 1JI1A 4CKVX 4MDJB 3OM3B 4HIEB 2F19H 1UB6A 3OPZL 5LBGA 3DETD 3DMMA 4PJFF 2F7QA 1E9PB 3UL4A 3GEFA 1CBVH 4HOMA 5TQ2H 2RMNA 1ZLWH 3P3TA 3TVMA 5E2TH 3UACA 1XHHA 3NESA 5BRQA 3T04D 5F7EL 3U1QA 1XGYL 1OPGH 1ACZA 3LHAA 1E30A 3EOAB 3P0YL 4LP8A 4QHPA 4ZAKA 2QSTA 5GGUB 4LSTL 4LSDA 3RL2A 3QUZB 4M3JA 2J3SA 4XNQA 1YPZA 3DRTA 4YHLH 5EIIA 1OHQA 1WIOA 5E7FA 3WTVA 2WZPD 3VG9C 4V1DD 1NGXB 1YNKL 1HL8A 5BO1H 4TXVB 4DPBX 3HG1A 4JMXA 3EDKA 2DKSA 2WBJD 1XBRA 4XZUB 3MOAH 4EXPX 3NJXA 3U9UB 3ARBA 5DHDA 4LCUB 4ZX3A 2B7DT 3AAZB 3HLKA 1NFDF 4CN4A 1ADQH 2MTPA 1GC1L 2ESVA 4L8BB 2X1XR 4Y5YA 3GXPA 3V0AC 2G5UA 4QRRE 5A2CA 4FP8L 1GHFL 5ICZA 1IVLA 3UGXA 2YPLE 4OT1H 4P9MH 3DNKA 3UMTA 2VXQH 5C0JB 2JE8A 2ICEA 2H26B 3RWJB 4PVMA 1KIPA 1ZWIB 2LLLA 2XYBA 4W1TA 2VISB 1EAJA 3QDMA 1JCKA 1PKQB 3AG1B 4OUUB 5D9SA 4YFDB 4FYRA 5I5JA 4OCXH 3WTUA 2H0FA 2CJUL 1WC7A 3L95B 4R5TA 1UKTA 2PCFB 4AITA 4XP1H 1JPFA 3QNXA 1U8IA 4AJ0A 4NQXA 5DFAA 3WIIL 2AITA 5GGRB 3C6LC 1JD9A 2ZYIA 1KV3A 2PMZA 1MJ8L 4FDWA 2ICWB 1QFWI 1UCBL 4NQSA 5AL0A 4CVXA 2CO4A 4YX2L 5BRZD 1HVXA 1Z66A 1XB3A 1ZTXH 4BZ1H 4JVUA 2CO7A 1C1EH 1NAMB 3N0PB 4PRDB 4LPYA 5HGAB 1LL1A 1PD0A 3MRNA 5L88L 1INQA 2R0WH 1DJHA 2EDYA 2WWKO 2XTJC 1F58L 1CE1H 1DQLL 4KTEL 4NWUL 1NCCH 1R5IB 3P4MA 1FDLL 2W65B 5KBKA 5FPIA 3AUVA 1NCIA 4PJAA 5DRZB 3O6LH 1EZLA 3QEQB 3QJHB 3FU0A 5JYMA 2G75A 1P84J 1Q94A 2W95A 1E28A 2D8KA 4AC4A 4F2ME 3UJIL 2HFGH 1KIQA 3NFNB 1A6ZA 2OA9A 5FEBA 4PRAB 5EEUA 4QHLB 3F83A 3OPUA 2Y7MA 4CVWA 1KCUL 3TZVD 1HYRC 1I8IB 3GSNA 3OX8B 3D1MC 2ITDA 3MJ7B 4HVBA 1CFQB 4I3SL 3DXAA 4U1HA 4Q9RL 2GSGB 5EBWA 5IOPA 5AWNH 2MKLC 5HHNB 3VW3L 4YGAB 3NIGF 1UURA 1XGQB 1BQSA 2GABA 4BWTA 4LLMB 1SYVB 4MCZA 1DCEA 3MRPA 5GZND 4G1EA 5GZOA 4Q8BA 5E1QA 2F6AA 4KO7A 5KVDH 2NZ9C 1IKNC 4IRSD 5CP7B 4FTVB 4XP5H 5SX4H 4M43H 3LNHA 4PRBB 5AKTA 3TTSA 1KCLA 2KBGA 3EFOB 1J86A 3ZL4L 5J4MA 2V8LA 4OFPA 3MV7D 2P5EE 2XFXB 2JKNA 2YBGA 3IDXL 3IJEB 2Q8BH 1C12A 1U8MB 5ID0B 4ZUVA 1NGYB 3RILA 2NYZA 3PJLA 4DW2H 3G6DL 2DW5A 5EU5A 2F7PA 4P59L 4LXFA 4UYPA 1WD9A 3DOHA 5HHVL 3ATAA 3K8MA 1IAKB 3P30H 4ADGA 1SLVA 5FA3B 5C0CA 3F8UB 4X6CF 5I66B 5E8PB 3CN3A 2BZ7A 4XZ4A 1IUZA 2J71A 2VKXA 3FSOA 2DZEA 4CMHC 1NPNA 1NLBL 2ZOKB 5DJ6B 4AL8H 5BW7A 1YEHL 5T1LD 3WFBL 2B08A 3PDGA 5JYLA 1FL6B 4HV8B 4DIXA 2JKTM 3OKNB 3D0LA 3NCYS 4K94L 4CU7A 4IRSC 3IFLL 4ELMF 1I8KB 2HFTA 1K72A 4KVNL 3LZPA 3DURB 4Q4EA 3LKQA 4Z7UA 3DECA 1KCKA 5ISZE 1OAXL 5GRWA 4IOIA 4N4YB 1C08A 3EGDB 4YAQB 5EBLA 2BFVL 4UQ3A 5FK9B 5CSBA 4FFWC 5CSGA 5HHXH 3D9AL 1OGAD 4Q6IC 1AD9B 1A6TA 2IF7A 4N0UA 5JPNB 2EC8A 1Q9OA 1QFHA 2AK4D 4ZS7L 3L9BA 4HWBA 1IM9B 1IGCH 5MP6L 3U0WH 1W8NA 3LB6C 2FYVA 3Q3GA 1ANUA 1QFWL 1IBBA 5LNEA 4PLKD 4UUJB 3WFDL 2WLKA 4TKWA 1J1OL 4LFHD 5I9QB 1RSYA 4W4OA 2LU5A 3M6DA 3R0NA 3O6MH 1KCVL 3ENEA 4HKXA 3ARGC 3MCKA 1W8EA 2EYSB 1SJMA 1U93B 4HZLA 1O7VA 4PQXA 4MCYA 5LQBL 1BECA 1KJVB 2EKSA 3NA9L 5J9PB 1JNHB 1BPVA 1H8SA 2ZPKH 2YD8A 2VZUA 4WHYG 5DUML 5GSVB 2G3ZA 5I8CA 2KPWA 1RZ7L 2OMBA 3GMMA 4JB9H 2ATPB 1N6QL 1E4KA 2JF1A 3OWRA 2K7QA 2NW2A 3HLAB 1M2OA 2D3JA 2HCZX 1AG6A 2ZSWA 3UC0L 4KNQA 4AH2B 1BXUA 4TUOA 1MCNA 4OKDA 4FABL 3ZE0B 4H0IA 3ZE2E 2M8XA 5J1AA 1OT2A 2OP4H 2H6PA 4FNTA 1AXTH 4BFIB 3TEXA 2GCYB 4HKZB 1GIGL 4UT6L 1WRFA 2NQDA 5E4IA 3VGAC 3GRBA 1WD8A 2C9QA 1ADQL 1EZVX 4E2OA 1FIGL 2OYLA 3T4YA 1U8LA 3HFMH 1AZRA 4AQ8A 5EDSA 1K3IA 3BE1L 2B5IC 1RLWA 2CALA 4JR9H 4MJHA 3X17A 5I8KH 1CN4A 2ZTBA 5F1IA 2HJLA 2J55A 2X2IA 3VFVA 1FAKT 4MSWA 2E46A 5AUMB 4WIQA 3S98A 1M7IA 3C75A 4J1UA 4MNQD 5JXEC 4N9GB 1WAPA 2VLJD 4P4RB 3AGVA 1J8HB 3DGDA 4K71C 4KJYB 3MSPA 4N2HA 1NGZB 1GZHC 1W6LA 4JFZL 3S4SA 2PNDA 1ERNA 1CFNA 3DXAD 4Y2LA 5I6XB 1G94A 2R2HB 4OCYL 4MJ2A 4PV8A 3DUSB 3HPLA 4MQXC 1CGTA 1JZHA 1O9WA 1YMMA 4BFEA 5BMFH 4LT7A 1C5BH 3ZHKA 4BK8A 4UT9A 3WS3A 2K0RA 3HNVL 4WO4C 1S7RB 4X9YA 3EH4B 3ARDC 4JFHD 4R90H 3GSUA 2WLYA 2GUYA 1NKOA 1QA9B 1WGOA 4U6XB 3V5DB 2QQNL 1RK0A 4IOSA 2J88H 1F58H 5MEPB 3ZQ9A 5KW9L 4W6YB 3V52H 3NSXA 5D71H 4A1RA 4F33B 1FUNA 1XGPB 1XT5A 4E42B 4F91B 4JZJA 3S34H 1AY1H 1FVEB 2EIDA 5C2BL 3CFEA 5AW9B 5CKGA 3OBAA 3KLAB 3N1GC 1CI3M 1W72L 3I6LE 1RURL 2A5UA 2DEWX 2P8LA 3QQ4A 4KC3B 5IHHA 4I2XB 4G6AD 3OKMB 4HG4K 4NXSA 4Z18A 3F7PC 3KYMA 4FQCH 3T77A 1YY9D 2Z7UA 4Y4KD 5AW7B 4Y4HA 4PRHB 3JWOC 2NR6D 4OLYL 1S7QA 5ES4B 4PJDB 1OE3A 1M1XA 2XZQH 1NL0L 4NT6B 5EA0H 5CEXB 2F8OA 1ZS8A 2BP8B 2FT6A 3QCTH 1AOZA 3V5HB 3VXTA 2HKFH 4OCMC 4V1DB 5FKAB 2FO4B 4QXVA 1EEYA 4F7PA 1NBZB 5EN3A 4LLUA 5FYLD 3ULUF 3AM8A 3L3OA 3O45B 3MXVH 3Q6FB 1HTYA 3QUGA 4HPYL 5GRVL 4MMXC 1EUUA 4ZW6A 4Z3FA 3VH8G 1W0VA 1SOSA 3UX9B 1K5NA 2FECI 1OZUA 5K33A 3G5XB 1CPUA 1TEFA 2WXPA 3HS0B 4I0PC 4M29A 3MRGB 1WS7A 4M3KB 2C7UA 1UXSB 1U8KB 3I50H 2B20A 2C1OA 5FWRA 1T4KA 3Q1SH 2YD6A 5AZ2H 1GPOH 1L5GB 4P0DA 5FM8A 4PJ8C 4BUQA 4DKDC 3MROA 2AFNA 5E9NA 5CXPA 4GP4B 4HKJA 2NXZB 3QIWC 4R7NA 4AW7A 4UINH 3WGVB 3N43F 1SY6L 3IDNB 4ORZC 1AGEA 4KUCF 1KMGA 5K59E 1IGFL 4K5PA 1CI5A 1JPEA 5GGTH 4M8QA 2C9VA 5EWIL 2H1LM 2BCMA 1HOEA 1OTSC 3SGJC 1V27A 3FU9A 4NN6B 1T22B 1JNNH 3NDZE 3DJTA 2YGNA 3IWVA 5D1QE 4JKPL 4LVNB 4NKDB 1OALA 4OF5A 1PIGA 4P46B 3NJNA 5HYJB 4RFOL 1DQMH 1FVCB 1JXFA 4NQCE 1VKXB 2VO8A 1AI1H 4N0FA 3HPJB 4NUJA 1IGCL 3U0WL 5DJAA 2WBJC 1ZLVH 1NGPH 1PAMA 5DJZA 1JGVH 2OMYB 3FTVA 1MPAL 4M62H 4NZTL 5EC1A 4FL4B 2J2ZB 1RPQA 3H53A 4ODBD 2J8UA 2XG4A 4OCLC 2QHLA 2YA2A 5E24E 3QUYC 3P1VA 4I89A 3TJEH 1A9VA 3QPXL 4IJTA 4PW3A 1D6EB 4OTXH 4XNZC 2IIJA 3VG9B 4G7SB 5DJ2B 3B6SB 3BZ5A 5DUPH 2Y7QA 1KN2L 4RRPA 4Z3IA 4MTMA 5H37G 1WZKA 1P5UB 1CLYL 2VDKL 3R06A 2APFA 3BT0A 3HVDA 3L3GB 2NUPA 4IHOB 4P5TC 1MXDA 5H4YA 3RL1B 4PS4H 4XBEL 3WTXA 4WTQA 3MYJA 3INUH 2V17H 5C07D 4YDVA 4L9LB 3TCLB 1S78C 4L3EB 4PVLA 4ENEC 2WOBA 2IG2L 4UNIA 4PHZA 3K6SA 4NM8H 3V6FB 3APFA 1MHHA 2C9SA 3JV0A 4NQDB 1NOAA 3GZKA 1PVHA 3KVQA 5JOPE 2OR9L 2NW3A 2VN5A 5E2VH 3ZY7A 1RUML 3N91A 2KH2B 3CLFL 3HB3C 3QS3A 5BS0A 3K71B 3PFUA 5HI4C 2O61A 3BP7B 5HHMB 5KEZA 5F7MC 4K7PL 5AVUB 2O4EA 2XWZA 4JFEA 1I8UA 2BHFA 3OGOE 5FYKL 2HVJB 3QEUB 5IESL 2FWLB 2W38A 4JO3H 2FAUA 9PCYA 1N3NB 4OV6F 4W70A 3BPCB 2CUAA 2Y1AA 4JFPA 3GTNA 2DEYX 1MCJA 2IXQA 4G43B 5IWLA 1L3NA 1I3RB 4PCYA 1HESA 2B77A 3CU1A 1QO3B 5BVJB 5I82A 3TFBA 3EADA 2OL3L 4EQ2A 5FO9B 4OF3A 2H7WA 2FBRA 2X10A 5KBNC 1AGCA 4MAUL 5T3ZD 4E9QA 2NY3C 2BVQA 5DDHA 4ZJ9A 2B3RA 2D7TH 3QEGH 2YGPA 3FTGA 4KI5E 4ECNA 3C6LA 3K2KA 2WIIB 3U0TA 1OPGL 5D72L 3I9IA 4OLXH 3DOSA 4U1IA 4U6YB 1DUYB 3VFGL 3ME0B 5KS9E 4K7PY 4M61A 4FADA 1C5DA 1TCRB 4ZO6A 1INDH 1E4XH 3NZ8B 4YHIB 4ZO7A 4D9LH 3V2AR 3WEAA 1F6LL 2FJGB 4MDRA 4NC1C 4N1CA 2K6YA 3JV4B 3BYYA 3UH8A 3MFFA 1R47A 3U7WL 2FEJA 1Z9LA 3B5GA 2F53D 4CC4C 3LXUX 1XGTB 1G0DA 3HNVH 4G1MB 5KJ4A 1K9TA 4DT2A 1KJ3H 3ARYA 3T2NH 3CX5K 3BFWA 4HAKA 4NSKA 3QJZA 4F8OA 4OJYA 2UYLB 4XCCH 1W72A 2Q86B 1KTBA 2XV2A 2D0HA 3GHBL 2J88L 5KW9H 4R8WL 4X8JA 4NRXA 3UJTH 3G6AB 3L3DB 1PPIA 4RWHA 1WWCA 4JUSA 4KTDH 1TTFA 3GDCA 3MX0B 2WD0A 1UENA 2WYZA 3IYLW 4WV1A 1F1DA 4JM2A 4NM4H 3T71A 1FFPA 3MRMA 3RWHA 3KR3L 1UEYA 2VM4A 4LMQI 4YSPA 3FQNB 3IRZA 1BREA 2C4FU 2X0VA 1KPVA 1TTBA 1DBMH 4IS6B 5ID1B 4MB5A 2F53A 4B7LA 4D8OA 1MFCH 4PJIF 3BUQA 5HP5A 4Z5RB 1OSYA 1ED3A 3X11B 4GQ9H 4HMEA 5EBGA 1ORSA 2H47C 2OTUB 4GMSH 4R4BA 1LXMA 4Y5YB 5IQMA 1PG7X 5FUCE 4AG4L 2P8MA 1JGUL 4WWKB 4AYEC 5ICZB 2WWKT 3GUTB 3REVA 4ZMPA 5FUOH 5D2LB 2PLTA 1G43A 1W91A 2XETA 2QKSA 1JZDC 1QSFA 3FAWA 4XNUL 3WG7B 4YHZL 1IEHA 4I1NB 5HDLA 5DO2D 3PE9A 3ZE2B 5C0GA 2EACA 2XWCA 4FI7A 2PABA 4KJQC 4JFTA 4PR5B 5KVDE 1XZWA 4GRLA 4MJ5B 4WFED 4H2AA 4HUNB 1I7ZB 3FFCB 2ICWJ 1VJSA 3WN5C 3M46A 5I6MA 1FDLH 4JQIL 2JWYA 1ZDSA 2F5AL 2PCYA 2C3HA 2EH7H 2F5BL 3GNMH 4XPAH 1FZJA 3B2VL 4AVHA 3AB0C 3MLTB 4XXCC 2FEDC 2V2XB 3FOMA 1J88A 4GXVL 1ZHNB 4UILL 2QVFB 3VX0A 1HCZA 5JR1L 3B9EA 1LP9A 1U3HD 2BSRA 2WZ0A 5D70L 1MFAL 3R8QA 1U42A 3GS4A 4G5AA 1PZAA 1YPZF 3DGCR 3PWNB 2EECA 3ET9F 5K9KB 3Q2NA 1IAMA 1YY8A 2XWEA 3OKEB 5T3XE 4P07A 1DCLA 2IADB 3FU6A 1JWMB 4J4PA 4ZMTA 2XRAL 1RU9H 2WVTA 3S5ZA 2XZCL 2JH2A 3K3QA 4KQ3L 1JF6A 3STZB 1G9NL 3WSQH 2GSIA 3FTSA 4IKNA 4QHMA 1NGQL 3MUY1 1SHWA 3U9PH 4F2FA 2P5WA 1U8JA 2CKBB 4FP8H 3RBGA 1LYQA 1HAUA 4U6VH 2Z0UA 3CN0A 4LDOB 1U4EA 4KHXH 1MHCB 5F0MB 3M1BA 5H8DA 1U8HB 4D8PB 2VO5A 2XN9B 3V9FA 5E4OA 1FH5L 2EDOA 2H32H 1FYTD 4GRMB 2JELL 1GYUA 2R0ZL 4OQTL 1T0OA 4KRNA 4AC2A 4UB0H 2CO6B 3UO8B 5B3JE 3FUEA 4MJID 2QGCA 1CD1A 1SM3H 3LVTA 3VRLE 1FORL 4R4ND 4A6YB 4NRYA 2UZYA 3QNYB 1MY7A 5I2IB 3PDDA 5BXFA 4C54A 5INCB 4IRZH 4UU9B 4Y1SA 4KK5C 1NEZB 5IQ9A 1IGIH 2W9DH 4MD5A 5FUCC 1XIWC 3HUJB 4BE5A 3PWLB 4HS6B 1S6NA 2E6PA 2YPKA 3FW6A 4IMKC 4L4TD 2HT2D 4YGVA 3P9MB 3H9SA 4WENB 4QRUB 5F7AA 1SLWA 3KLKA 4F9PC 1SVCP 5E7BA 4XODA 2EZ0D 1QYGL 1C5CL 3N44B 5FYKH 4YQXH 2V37A 1TLMA 4RRPG 4MASA 1IQWL 1XF5A 3KNBA 5CIPA 3T6XA 3ZVVA 1QRND 5ABAA 5JW3H 1BWMA 4PRIA 2YPVH 3PL6B 2B1AL 5HDOA 3SE8L 4WKXA 4F15C 2QGBA 2MCAA 4A7VA 4AMKH 4CJ0A 1NJ9B 2GSMB 4KKBC 2LLGA 1CDBA 4B0MB 4QYOB 2FSDA 1F41A 4YFLI 4PJCA 1BIHA 1MW0A 2JI1A 3BIAX 2MPVA 1EHAA 5IIEB 4AGPA 1BZ7A 2NY4C 1C8PA 5IBUG 3BT2L 5AW5B 1MFDH 4NO0B 4UV7L 1RUAL 2H0JA 7FABH 2YEZB 4EI5C 4TRPH 1YECH 3ZYIA 3FF7A 4OZFA 4P5MA 3WU1A 1T89A 3KJ4B 2Q7NA 1OSEA 5DFTA 3X3FH 2D03H 2OJZH 4M7LT 3JWDH 1KNOB 1ET8A 4U49A 2DYRB 2MIZA 4Y9GA 3VWKA 3TGXA 1G5AA 2D9QB 3E1ZA 3MBXH 5CILH 2ZOLB 3TF4A 1PQZA 2X4TA 3FQRA 4KPHH 2GJ6D 3OHXA 1UZ6E 3TYFB 1J11A 5D93C 3I02B 1N8OE 1TJHL 2AXGA 3GK8H 3LRKA 4DJMA 4FERA 3U4BH 3QEQE 5TPWL 2VUOA 4YHLL 1BLIA 3T0DA 1BF2A 1J18A 2G9HA 4XAWL 2XSKA 2A9CA 3WTSA 4KZEH 1R3KB 1YYML 4WQOA 2VDLL 2QV4A 5AKRA 4MHHI 4OLWH 1P5VB 4NHCL 1JTTA 4KKAD 3N41F 4E9XA 3P77A 3ZO9A 3V7MA 5CD3B 3VTAA 4JK0D 3RWDB 1DBML 5F7LB 4QIRA 3U36B 4E68A 3QJXA 3UCQA 1JV5A 2PO6D 1G1OA 2WTPA 3AZUA 1G84A 4XX5A 3WELA 4CGUB 3QUMA 3N43B 3BP4B 2W0FB 4ZBJA 1ZVSB 3ZTCC 1MDTA 1XWVA 4WK4B 4X8GA 2F9BT 2E47A 3T4YB 2XJKA 5MEQA 4KXCA 5D1QD 4AYSA 1N67A 2ETWA 4Q9RH 3WIHL 1MCHA 4F8QA 3RKPA 2IANE 4PMEA 3ES6B 4H20L 1W0WA 2ARJQ 4MMXB 4ZRGA 3CVHH 1TZHB 4P2AA 4C47A 2NQCA 5D7IE 4Q6YA 2WXOA 4CNIA 4G83A 3FMGH 3ATBA 1YA5A 1EXUB 1YNTA 4TV3A 2V0AA 3N2JA 3SY6A 3MBEB 5JHDD 1MF2L 1GRWA 2CJSA 5D1ZB 4Z77A 1LO2L 3GMPB 5AW4B 4R90L 4W9FC 5JUEL 3DVNB 1WFIA 2OXGA 4Y4FD 5K39A 3VGGA 4A63A 5ACZA 1MAML 1HILA 4L3CB 4NEHB 5I0VA 1M05A 2JB6A 4TULH 4OM0L 2NUTB 4POZD 4WEMB 1MJJA 4AKQA 4B9GA 1LE9B 1TTGA 1QSVA 2XQYK 3LSOB 3ISWA 4JFFA 4ZOEA 4NN7C 3T8MA 5TFSH 4CADB 4YHMH 4NNPH 1BQHB 1OIOA 1QOKA 2JCWA 3GINA 2PWEA 4KTEH 3WS3B 1FE8H 1G1CA 1A7QL 2VIRA 4ODTL 3WKPA 1UKQA 2XTSA 3C8DA 5D55A 2OMUA 2H41A 4ZUUA 2WXRA 3HHSB 4X98A 5HDWA 4JFED 4X6CA 5FECB 4LCIH 1EZVY 2BSTA 2WNKA 1WWWX 1X5ZA 3MR9A 3CFTA 3NQIA 4IRJB 4KI5F 4LCCB 5CGYD 2MNUA 1MRDL 4F80A 2QQLL 4KDTA 4PJ7E 3SPIA 4BV1A 5DMIH 4MDJA 4BZ2A 1P9MC 1RZJH 1F11B 3F2LA 2NCEA 4M48H 1SHXA 4I18A 4PY8J 4ELMA 2HFFA 3FH8A 4JY6B 4WU5A 1OAXH 5DD6B 2H9GB 5AWNL 2E7LA 1XR8A 3KYMB 1M7DA 4XP4H 3LN4A 2YC1A 1VDGA 1EAOA 2NYYD 1U8QA 5EUOF 4HZ1A 3AY4A 1OTTC 4RQQA 5LCVH 5DC4B 2DPKA 1M6UA 1MG3C 2YFOA 3CMGA 3KEDA 4KHXL 4OH2A 5DT1H 1TVHA 5SX5H 5I0WA 5DMKB 4K2UH 4KI1A 1RCYA 1YPZB 4PJBF 5LG1A 2HWZH 1OSZA 3V7AG 4MNHB 2VABB 2X41A 2DQFA 4AGQA 2R69H 1YY9C 2XKUA 4P4KB 4R7XA 2DB8A 1YN7A 3D4CA 3OAUH 1R9FA 3RDTC 2FO4A 1JK9B 3GMRB 3UGEA 3NA9H 2EIZB 1BQKA 1XR9B 4WFHD 3BC9A 5DO8A 1QR1A 3WNIA 2WM0A 3ZKMD 1MHPH 1IEAB 2DN7A 3SE4C 4F8LA 4MS6A 2LTQB 1CXLA 1YMHA 2BSDA 5E99H 2C7UB 1N5AA 3EKCA 3ARXA 4Y1AE 4AX3A 5BRPA 3BIKA 1AS7A 3WTYA 4LSVH 1L4IA 4YLBA 5E1IA 1ES0B 1XGZA 4WWID 1AIFA 2G3NA 1USZA 2E7CA 3IMWA 1T03L 4P46D 3HE6C 3MRRA 3V52L 2DMKA 2IWGA 3NZHL 2H6UA 4K94H 1U0QA 3MLXL 3N1PC 4JKWA 5HYFA 4QRFA 2DJUA