3ZRRA

Crystal structure and substrate specificity of a thermophilic archaeal serine : pyruvate aminotransferase from sulfolobus solfataricus
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
379
structure length
379
Chain Sequence
b'LLHVGPTTIKEDVLVAGLENNVGFTSKEFVEALAYSLKGLRYVMGASKNYQPLIIPGGGTSAMESVTSLLKPNDKILVVSNGVFGDRWEQIFKRYPVNVKVLRPSPGDYVKPGEVEEEVRKSEYKLVALTHVETSTGVREPVKDVINKIRKYVELIVVDGVSSVGAEEVKAEEWNVDVYLTASQKALGSAAGLGLLLLSPKALSILDSQNSIAGYYLDLRNWLPVMRGAEEGKAAYFATPPVHVILQLAEAFRLIEKEGIENRIKRHTMVASAIRAGLEALGLEIVARRPESYSNTVTGVILKVADPQKVLAGTVNEGVEFAPGVHPAFKYFRIGHMGWVTPNDAIIAISVIERTLRKLGEPIRFGEGVKAVEEVLFSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE-PYRUVATE AMINOTRANSFERASE (AGXT)
publication title Crystal Structure and Substrate Specificity of the Thermophilic Serine:Pyruvate Aminotransferase from Sulfolobus Solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 138
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 2.6.1.51: Serine--pyruvate transaminase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3zrrA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3zrrA02
1OHVA 4M2KA 2VMUA 3JZLA 4GE7A 1M0PA 4W5KA 2C7TA 4WYDA 2YCTA 3VAXA 3B8XA 2Z9XA 3WGCA 1MAQA 1S06A 2CSTA 4ITGA 2Z1ZA 4JEWA 2D7YA 1B4XA 2YCPA 2AY1A 4PVFA 4AO9A 1TOEA 5EUEA 4ATQA 1BT4A 3MEBA 5FT5A 2YKVA 1IVRA 3ELPA 1LC8A 2BYJA 2CB1A 3KKIA 3L8AA 4WP0A 3UE8A 1C7OA 3EI7A 3MADA 1E5FA 3FRKA 1G7XA 1IJIA 3VK3A 2BWPA 1WYTA 3A9ZA 1IAXA 4MQRA 1GC3A 2Q7WA 2AY9A 3CAIA 3WGBA 1IX7A 2ZSLA 3MC6A 3PAAA 4IXSA 1AMSA 1QZ9A 2CFBA 2VGUA 2XBNA 3NYTA 3QBOA 3RCHA 1SZSA 3DR4A 4XAUA 4ADEA 3TFTA 2DGKA 1W7MA 1ASNA 1N31A 1VP4A 3LWSA 2VLHA 4F5KA 3W1JA 3FZ7A 1LW5A 1MDXA 1XEYA 1AJRA 4K2BA 2ZUKA 4R5ZA 4WLJA 3PDBA 4A0FA 1JS3A 2OQXA 1QITA 2AY3A 1B9HA 2DOUA 2R0TA 3HT4A 4WXFA 1GC0A 4B98A 2W7MA 5EAVA 3JW9A 3LVKA 1FC4A 1IX8A 1QJ5A 2FNUA 4MQQA 3E77A 1EQBA 3LVMA 1DJ9A 3NTJA 4RM1A 1S09A 1ELUA 4W1XA 5M4BA 1I48A 4GEBA 1CL2A 3F9TA 4BHDA 2QB3A 2PO3A 5HXXA 1AIBA 1AHYA 5HHYA 3NRAA 2EH6A 4TN4A 1UU1A 1YNUA 1V2FA 4PIWA 4A72A 2AY6A 1TARA 4U1TA 5J8QA 2ZY2A 3ZZKA 2NMPA 2WK7A 2VMTA 1MGVA 2HOYA 4NOGA 5DX5A 2X3LA 5F9SA 3CQ5A 1X2AA 1IBJA 1OXOA 5JAYA 2O1BA 2JJHA 3B1EA 3BCAA 2AATA 1KL1A 2QBTA 3NX3A 2BI5A 4JE5A 3FVSA 4MKJA 2GMSA 2C0RA 5FT4A 5G4JA 3VK2A 4IYOB 1ASAA 4XJMA 1AY4A 3LVLB 4O6ZA 2W7LA 2D66A 1M7YA 2D7ZA 1AHEA 3H7FA 3A8UX 2VGWA 3R9AA 3FDDA 1ASDA 3VK4A 1BKGA 1ASFA 1QISA 1AAWA 2O7CA 1AKBA 4R5FA 4RJ0A 1BQAA 1ARTA 4A0HA 3PJ0A 4M2JA 4ZM4A 4DBCA 1B9IA 1UKJA 2Z9UA 4FL0A 5LHAA 2VMYA 2FQ6A 4WYFA 3DR7A 3WCNA 3EI8A 2O0RA 1D2FA 2HP1A 2W7FA 1EG5A 4LW4A 1V2EA 4UHNA 5M49A 2YHKA 1VEFA 3BC8A 4WLHA 1GEWA 2W7DA 4OYTA 3WLXA 2AEUA 5EAAA 5M4DA 3F0HA 4ADCA 1RV3A 2GSAA 3II0A 1M0QA 4K2IA 1JG8A 3G7QA 1GEYA 2VMNA 1ZOBA 3I4JA 4WB0B 4F5IA 3TQXA 4ZDOA 3B1DA 3UWCA 3IF2A 1GBNA 1D7UA 2WKAA 4MQPA 3GJUA 2JJGA 3MKJA 4F5JA 2CH2A 3I5TA 2QMAA 3DXVA 2ZY3A 3N0LA 2D5YA 2E7UA 1ARIA 4OBUA 5AX8A 3AEMC 4WYEA 5EQCA 4B9BA 4ZM3A 1AHXA 3E2ZB 2ZY5A 4KAMA 2C44A 3E2FA 4F4EA 1QIRA 2W8UA 1YJZA 3DRDA 3GWPA 3WX9A 3RBLA 2ZP7A 3BWNA 4IYOA 2X8UA 4F5LA 5E5IA 1CS1A 2RFVA 4WXGA 4XK1A 4W1VA 1W3UA 1W7LA 2D61A 1PG8A 4CBSA 8AATA 4EB5A 3ECDA 4GE4A 3VP6A 4JF1A 1BJ4A 3VOMA 2QLRA 2QA3A 1KMJA 2D65A 2DKBA 4A6TA 3G0TA 1AKAA 2WK9A 4CVQA 2OGEA 1ZC9A 1TASA 1C7NA 1TATA 2CANA 2W8WA 5LH9A 3WCOA 4CXQA 4Q75A 2BIEA 3NU7A 2YRRA 2AY7A 3MC6C 3AOWA 1G4VA 4ZWVA 3EIAA 2HUFA 1KMKA 1TOGA 2BHXA 2CTZA 4OC9A 3R4TA 2VIAA 4BQ0A 3KE3A 1LC5A 1S07A 2OATA 1UU0A 2BI2A 5F8VA 2W8VA 3AEPA 4XJPA 4DQ6A 2BI1A 2R5CA 1B8GA 4WB0A 1QJ3A 4E1OA 1O4SA 3HMUA 5D5SA 1J04A 4JF0A 1OHWA 3AEOA 2EO5A 1DJEA 1AKCA 3AATA 1M32A 1AIAA 2BKWA 1WSTA 2VMOA 4GSAA 2W7GA 2VGVA 1O61A 4ADBA 1QGNA 3TATA 4P3MA 3RUYA 3K40A 1V2DA 3FVUA 3NU8A 4K2MA 5K8BA 4XJLA 3FTBA 1DKAA 2AY2A 1Z3ZA 4OCAA 3WKRA 3E2ZA 4A0GA 2EGYA 5BJ3A 1MLZA 1FG3A 1YJYA 2VGSA 4MKKA 3WY7A 1ORDA 3Q8NA 1IAYA 1ASBA 2YKUA 4J5UA 3JWBA 3BCXA 3PGYA 4WYGA 3ISLA 1ECXA 3AENB 3LV2A 1T3IA 1D7VA 2CH1A 3GZCA 1CZCA 1YAAA 1Z7DA 2ZJGA 1ARGA 2Z67A 1DTYA 2YOBA 1AX4A 3HDOA 2VMQA 2VMXA 3T32A 3A2BA 1PMOA 5DJ1A 4Y0IA 5EFSA 2DR1A 4Q31A 3FQ7A 2Z20A 4OTLA 1BS0A 1IX6A 2VI9A 4A6RA 5IWQA 2W7JA 5E4ZA 3GSBA 2BI9A 3PA9A 1CL1A 1O62A 1N2TA 3B46A 4MSOA 3HL2A 2CJDA 2GQNA 2W7KA 4RKCA 3B1CA 4XEWA 1XI9A 2X5FA 3HVYA 3TCMA 2CINA 4HVKA 3FVXA 5G09A 1GEXA 1IUGA 1ARHA 1SF2A 2G6WA 3HLMA 3FQ8A 2FN6A 1AY8A 4MGRA 4UOYA 2Z1YA 2E7JA 2HOXA 4IW7A 3MAUA 4E77A 1AY5A 2ZY4A 1I43A 4PFNA 4N0BA 3AEJA 2HOZA 1I29A 2OKKA 3IHJA 4IXOA 4LW2A 4GDYA 4LNMA 1N8PA 4ZAHA 2R5CB 4MY5A 3NYSA 4FFCA 5D95A 3WKSA 2HZPA 3AELA 4AO4A 2QB2A 1LW4A 4LC3A 4BMKA 5EIGA 1BW0A 2JG2A 3GETA 1BJWA 1SVVA 1KKPA 2VMWA 3GZDA 3NDNA 2BWOA 3P6KA 2W7EA 4ATPA 1AMQA 3ELEA 2W7IA 1BJNA 1GD9A 1BQDA 2BI3A 4RAEA 4I8AA 4ADDA 3H14A 1ASGA 1AAMA 1JF9A 1TPLA 4QGRA 1JS6A 5EUNA 3RQ1A 3AENA 1LC7A 1WYVB 2YCNA 4KYOA 2EZ2A 4N0WA 4M2MA 3LVJA 3E2YA 2CY8A 1B5OA 3MAFB 3MBBA 1DGEA 2YRIA 3L44A 1H1CA 4XJOA 3FFHA 1FG7A 3UAKA 1E5EA 3DC1A 5G2QA 2ZSMA 1D7RA 3BWNC 4HF8A 3TFUA 1C7GA 1AICA 3ATHA 3ZRRA 1UU2A 1KKJA 2BIAA 4IY7A 3AOVA 4ZSYA 1AHFA 1LS3A 1W7NA 2TPLA 3FZ6A 4ZWMA 5EUDA 2JJFA 2PB0A 1EJIA 1D7SA 2VI8A 3HBXA 4GE9A 4WYCA 3ZRQA 1ASEA 4GRXA 1MLYA 1LK9A 1RVUA 3RI6A 3W1IA 3EI5A 4UHOA 3D6KA 2R2NA 3G8MA 1MDZA 1CQ8A 3DODA 3PDXA 3ACZA 1WYUB 4RIZA 4ITXA 3AV7A 1ASMA 4BA5A 3GBXA 2DKJA 1S08A 5G4IA 1DFOA 4U2HA 3EI9A 3OKSA 2VIBA 1H0CA 4WYAA 4UHMA 2ZC0A 2E7IA 5E3KA 3N5MA 3N75A 1S0AA 4IX8A 4JE5D 3OP7A 2ZYJA 4ZASA 2W8TA 1MAPA 1BJOB 3LG0A 4A0RA 1C0NA 3BCBA 1GCKA 2OGAA 4XQ2A 4CBRA 1DJUA 1ZODA 1OATA 3EI6A 3DYDA 3E6GA 4OBVA 5I92A 4JEXA 2EPJA 2Z61A 5FT8A 1AMAA 3DZZA 2GMUA 2BWNA 1V72A 2HUUA 3FZ8A 2AEVA 1LKCA 2AY8A 1AJSA 4JEZA 5EIGB 1G4XA 3QGUA 1WYVA 2E54A 2VGZA 3FD0A 3I16A 2HORA 1GC2A 1RVYA 1X28A 2BIGA 3MAFA 4JEYA 3EZ1A 4WD2A 1W23A 4DGTA 4F5MA 3BWOA 5C6UA 2FYFA 3ASBA 3F6TA 4JEVA 1YJSA 1AHGA 1MDOA 3ZZJA 2ORDA 4RITA 4EMYA 2WK8A 2Z9WA 5G0AA 4F5FA 3FSLA 4RKDA 3PIUA 3WZFA 3EZSA 4A6UA 3EUCA 9AATA 4R2NA 1SPAA 1B5PA 3QHXA 5FT6A 3KGWA 5HDMA 4TMRA 3W1HA 4E3RA 2D64A 4WBTA 4AZJA 4ZSWA 4PFFA 1C9CA 4A00A 4AH3A 5BJ4A 4KXKA 1YIYA 1ASLA 4ZDPA 2F8JA 2GB3A 2YKYA 3CQ6A 2AY5A 4ZDLA 2OKJA 4OT8A 2VMZA 1WYUA 1X0MA 2W8JA 1OXPA 3A9YA 3BV0A 3PD6B 3FQAA 1Y4IA 2AY4A 2FM1A 1AMRA 2X5DA 4LNLA 1O69A 3HQTA 4Q6RA 2JJEA 3DU4A 3LY1A 5TF5A 3P1TA 4AZKA 1CJ0A 4LNJA 1YIZA 2V0YA 3A9XA 3BN1A 4RLGA 2D63A 4EB7A 3QI6A 2DGLA 3EIBA 3ZRPA 1BJOA 1M0OA 1ARSA 1PFFA 1WKHA 3K7YA 3KGXA 4R8DA 5G2PA 3JU7A 1TOKA 4OMAA 1DGDA 4EFFA 1KL2A 3M5UA 3FDBA 4F5HA 2HUIA 1C4KA 5DB5A 3AEJC 2YKXA 3ASAA 3PPLA 1M6SA 2VMPA 3FFRA 2R5EA 2JGTA 1WYTB 2HP2A 4IXZA 3NYUA 2CJHA 1CQ6A 1PMMA 3FCRA 1YOOA 4ISYA 2FNIA 3CQ4A 3FKDA 4F5GA 1SZUA 1I41A 1U08A 2BYLA 3BB8A 4Q76A 2VLFA 3COGA 3DXWA 4RJYA 3RCHB 1TOJA 2DGMA 3NUIA 4ZLVA 3GZDC 4CXRA 3USFA 2W7HA 2V1PA 1X29A 1AJSB 4H51A 4WXBA 1M4NA 1GC4A 4P7YA 1J32A 4W1WA 4BA4A 3JTXA 1WKGA 3PDBB 3JWAA 3CBFA 1CZEA 1G7WA 2VGTA 4TV7A 4W8IA 3RBFA 1ASCA 2VYCA 1SZKA 2XH1A 4Y0DA 4UQVA 4W91A 3QM2A 4E3QA 2EZ1A 3QPGA 1TOIA 2C81A 5DJ9A 1RV4A 3K28A 1P3WA 1VJOA 3NUBA 3QN6A 4AOAA 5M46A 2JISA 3GR9A 1CQ7A 1SFFA 2VMRA 2CJGA 1M0NA 2VMVA 4EU1A 3AEMA 2VMSA 4Y0HA 1OHYA 2Z9VA 1ELQA 4L0OA 7AATA 3NNKA 1GDEA 3BS8A 3PD6A 3E9KA 4J8LA 2PB2A
chains in the Genus database with same CATH superfamily
1OHVA 4M2KA 2VMUA 3JZLA 4GE7A 1M0PA 4W5KA 2C7TA 4WYDA 2YCTA 3VAXA 3B8XA 2Z9XA 3WGCA 1MAQA 1S06A 2CSTA 4ITGA 2Z1ZA 4JEWA 2D7YA 1B4XA 2YCPA 2AY1A 4PVFA 4AO9A 1TOEA 5EUEA 4ATQA 1BT4A 3MEBA 5FT5A 2YKVA 1IVRA 3ELPA 1LC8A 2BYJA 2CB1A 3KKIA 3L8AA 4WP0A 3UE8A 1C7OA 3EI7A 3MADA 1E5FA 3FRKA 1G7XA 1IJIA 3VK3A 2BWPA 1WYTA 3A9ZA 1IAXA 4MQRA 1GC3A 2Q7WA 2AY9A 3CAIA 3WGBA 1IX7A 2ZSLA 3MC6A 3PAAA 4IXSA 1AMSA 1QZ9A 2CFBA 2VGUA 2XBNA 3NYTA 3QBOA 3RCHA 1SZSA 3DR4A 4XAUA 4ADEA 3TFTA 2DGKA 1W7MA 1ASNA 1N31A 1VP4A 3LWSA 2VLHA 4F5KA 3W1JA 3FZ7A 1LW5A 1MDXA 1XEYA 1AJRA 4K2BA 2ZUKA 4R5ZA 4WLJA 3PDBA 4A0FA 1JS3A 2OQXA 1QITA 2AY3A 1B9HA 2DOUA 2R0TA 3HT4A 4WXFA 1GC0A 4B98A 2W7MA 5EAVA 3JW9A 3LVKA 1FC4A 1IX8A 1QJ5A 2FNUA 4MQQA 3E77A 1EQBA 3LVMA 1DJ9A 3NTJA 4RM1A 1S09A 1ELUA 4W1XA 5M4BA 1I48A 4GEBA 1CL2A 3F9TA 4BHDA 2QB3A 2PO3A 5HXXA 1AIBA 1AHYA 5HHYA 3NRAA 2EH6A 4TN4A 1UU1A 1YNUA 1V2FA 4PIWA 4A72A 2AY6A 1TARA 4U1TA 5J8QA 2ZY2A 3ZZKA 2NMPA 2WK7A 2VMTA 1MGVA 2HOYA 4NOGA 5DX5A 2X3LA 5F9SA 4H63Q 3CQ5A 1X2AA 1IBJA 1OXOA 5JAYA 2O1BA 2JJHA 3B1EA 3BCAA 2AATA 1KL1A 2QBTA 3NX3A 2BI5A 4JE5A 3FVSA 4MKJA 2GMSA 2C0RA 5FT4A 5G4JA 3VK2A 4IYOB 1ASAA 4XJMA 1AY4A 3LVLB 4O6ZA 2W7LA 2D66A 1M7YA 2D7ZA 1AHEA 3H7FA 3A8UX 2VGWA 3R9AA 3FDDA 1ASDA 3VK4A 1BKGA 1ASFA 1QISA 1AAWA 2O7CA 1AKBA 4R5FA 4RJ0A 1BQAA 1ARTA 4A0HA 3PJ0A 4M2JA 4ZM4A 4DBCA 1B9IA 1UKJA 2Z9UA 4FL0A 5LHAA 2VMYA 2FQ6A 4WYFA 3DR7A 3WCNA 3EI8A 2O0RA 1D2FA 2HP1A 2W7FA 1EG5A 4LW4A 1V2EA 4UHNA 5M49A 2YHKA 1VEFA 3BC8A 4WLHA 1GEWA 2W7DA 4OYTA 3WLXA 2AEUA 5EAAA 5M4DA 3F0HA 4ADCA 1RV3A 2GSAA 3II0A 1M0QA 4K2IA 1JG8A 3G7QA 1GEYA 2VMNA 1ZOBA 3I4JA 4WB0B 4F5IA 3TQXA 4ZDOA 3B1DA 3UWCA 3IF2A 1GBNA 1D7UA 2WKAA 4MQPA 3GJUA 2JJGA 3MKJA 4F5JA 2CH2A 3I5TA 2QMAA 3DXVA 2ZY3A 3N0LA 2D5YA 2E7UA 1ARIA 4OBUA 5AX8A 3AEMC 4WYEA 5EQCA 4B9BA 4ZM3A 1AHXA 3E2ZB 2ZY5A 4KAMA 2C44A 3E2FA 4F4EA 1QIRA 2W8UA 1YJZA 3DRDA 3GWPA 3WX9A 3RBLA 2ZP7A 3BWNA 4IYOA 2X8UA 4F5LA 5E5IA 1CS1A 2RFVA 4WXGA 4XK1A 3N7NA 4W1VA 1W3UA 1W7LA 2D61A 1PG8A 4CBSA 8AATA 4EB5A 3ECDA 4GE4A 3VP6A 4JF1A 1BJ4A 3VOMA 2QLRA 2QA3A 1KMJA 2D65A 2DKBA 4A6TA 2WB6A 3G0TA 1AKAA 2WK9A 4CVQA 2OGEA 1ZC9A 1TASA 1C7NA 1TATA 2CANA 2W8WA 5LH9A 3WCOA 4CXQA 4Q75A 2BIEA 3NU7A 2YRRA 2AY7A 3MC6C 3AOWA 1G4VA 4ZWVA 3EIAA 2HUFA 1KMKA 1TOGA 2BHXA 2CTZA 4OC9A 3R4TA 2VIAA 4BQ0A 3KE3A 1LC5A 1S07A 2OATA 1UU0A 2BI2A 5F8VA 2W8VA 3AEPA 4XJPA 4DQ6A 2BI1A 2R5CA 1B8GA 4WB0A 1QJ3A 4E1OA 1O4SA 2KFPA 3HMUA 5D5SA 1J04A 4JF0A 1OHWA 3AEOA 2EO5A 1DJEA 1AKCA 3AATA 1M32A 1AIAA 2BKWA 1WSTA 2VMOA 4GSAA 2W7GA 2VGVA 1O61A 4ADBA 1QGNA 3TATA 4P3MA 3RUYA 3K40A 2G7JA 1V2DA 3FVUA 3NU8A 4K2MA 5K8BA 4XJLA 3FTBA 1DKAA 2AY2A 1Z3ZA 4OCAA 3WKRA 3E2ZA 4A0GA 2EGYA 5BJ3A 1MLZA 1FG3A 1YJYA 2VGSA 4MKKA 3WY7A 1ORDA 3Q8NA 1IAYA 1ASBA 2YKUA 4J5UA 3JWBA 3BCXA 3PGYA 4WYGA 3N4RA 5KTBA 3ISLA 1ECXA 3AENB 3LV2A 1T3IA 1D7VA 2CH1A 3GZCA 1CZCA 1YAAA 1Z7DA 2ZJGA 1ARGA 2A1VA 2Z67A 1DTYA 2YOBA 1AX4A 3HDOA 2VMQA 2VMXA 3T32A 3A2BA 1PMOA 5DJ1A 4Y0IA 5EFSA 2DR1A 4Q31A 3FQ7A 2Z20A 4OTLA 1BS0A 1IX6A 2VI9A 4A6RA 5IWQA 2W7JA 5E4ZA 3GSBA 2BI9A 3PA9A 1CL1A 1O62A 1N2TA 3B46A 4MSOA 3HL2A 2CJDA 2GQNA 2W7KA 4RKCA 3B1CA 4XEWA 1XI9A 2X5FA 3HVYA 3TCMA 2CINA 4HVKA 3FVXA 5G09A 1GEXA 1IUGA 1ARHA 1SF2A 2G6WA 3HLMA 3FQ8A 2FN6A 1AY8A 4MGRA 4UOYA 2Z1YA 2E7JA 2HOXA 4IW7A 3MAUA 4E77A 1AY5A 2ZY4A 1I43A 4PFNA 4N0BA 3AEJA 2HOZA 1I29A 2OKKA 3IHJA 4IXOA 4LW2A 4GDYA 4LNMA 1N8PA 4ZAHA 2R5CB 4MY5A 3NYSA 4FFCA 5D95A 3WKSA 2HZPA 3AELA 4AO4A 2QB2A 1LW4A 4LC3A 4BMKA 5EIGA 1BW0A 2JG2A 3GETA 1BJWA 1SVVA 1KKPA 2VMWA 3GZDA 3NDNA 2BWOA 3P6KA 2W7EA 4ATPA 4K05A 1AMQA 3ELEA 2W7IA 1BJNA 1GD9A 1BQDA 2BI3A 4RAEA 4I8AA 4ADDA 3H14A 1ASGA 1AAMA 1JF9A 1TPLA 4QGRA 1JS6A 5EUNA 3RQ1A 3AENA 1LC7A 1WYVB 2YCNA 4KYOA 2EZ2A 4N0WA 4M2MA 3LVJA 3E2YA 2CY8A 1B5OA 3MAFB 3MBBA 1DGEA 2YRIA 3L44A 1H1CA 4XJOA 3FFHA 1FG7A 3UAKA 1E5EA 3DC1A 5G2QA 2ZSMA 1D7RA 3BWNC 4HF8A 3TFUA 1C7GA 1AICA 3ATHA 3ZRRA 1UU2A 1KKJA 2BIAA 4IY7A 3AOVA 4ZSYA 3N4XA 1AHFA 1LS3A 1W7NA 2TPLA 3FZ6A 4ZWMA 5EUDA 2JJFA 2PB0A 1EJIA 1D7SA 2VI8A 3HBXA 4GE9A 4WYCA 3ZRQA 1ASEA 3N4SA 4GRXA 1MLYA 1LK9A 1RVUA 3RI6A 3W1IA 3EI5A 4UHOA 3D6KA 2R2NA 3G8MA 1MDZA 1CQ8A 3DODA 3PDXA 3ACZA 1WYUB 4RIZA 4ITXA 3AV7A 1ASMA 4BA5A 3GBXA 2DKJA 1S08A 5G4IA 1DFOA 4U2HA 3EI9A 3OKSA 2VIBA 1H0CA 4WYAA 4UHMA 2ZC0A 2E7IA 5E3KA 3N5MA 3N75A 1S0AA 4IX8A 4JE5D 3OP7A 2ZYJA 4ZASA 2W8TA 1MAPA 1BJOB 3LG0A 4A0RA 1C0NA 3BCBA 1GCKA 2OGAA 4XQ2A 4CBRA 1DJUA 1ZODA 1OATA 3EI6A 3DYDA 3E6GA 4OBVA 5I92A 4JEXA 1KAFA 2EPJA 2Z61A 5FT8A 1AMAA 3DZZA 2GMUA 2BWNA 1V72A 2HUUA 3FZ8A 2AEVA 1LKCA 2AY8A 1AJSA 4JEZA 5EIGB 1G4XA 3QGUA 1WYVA 2E54A 2VGZA 3FD0A 3I16A 2HORA 1GC2A 1RVYA 1X28A 2BIGA 3MAFA 4JEYA 3EZ1A 4WD2A 1W23A 4DGTA 2EYQA 4F5MA 3BWOA 5C6UA 2FYFA 3ASBA 3F6TA 4JEVA 1YJSA 1AHGA 1MDOA 3ZZJA 2ORDA 4RITA 4EMYA 2WK8A 2Z9WA 5G0AA 4F5FA 3FSLA 4RKDA 3PIUA 3WZFA 3EZSA 4A6UA 3EUCA 9AATA 4R2NA 1SPAA 1B5PA 3QHXA 5FT6A 3KGWA 5HDMA 4TMRA 3W1HA 4E3RA 2D64A 4WBTA 4AZJA 4ZSWA 4PFFA 1C9CA 4A00A 4AH3A 5BJ4A 4KXKA 1YIYA 1ASLA 4ZDPA 2F8JA 2GB3A 2YKYA 3CQ6A 2AY5A 4ZDLA 2OKJA 4OT8A 2VMZA 1WYUA 1X0MA 2W8JA 1OXPA 3A9YA 3BV0A 3PD6B 3FQAA 1Y4IA 2AY4A 2FM1A 1AMRA 2X5DA 4LNLA 1O69A 2FKIA 3HQTA 4Q6RA 2JJEA 3DU4A 3LY1A 5TF5A 3P1TA 4AZKA 1CJ0A 4LNJA 1YIZA 2V0YA 3A9XA 3BN1A 4RLGA 2D63A 4EB7A 3QI6A 2DGLA 3EIBA 3ZRPA 1BJOA 1M0OA 1ARSA 1PFFA 1WKHA 3K7YA 3KGXA 4R8DA 5G2PA 2QSRA 3JU7A 1TOKA 4OMAA 1DGDA 4EFFA 1KL2A 3M5UA 3FDBA 4F5HA 2HUIA 1C4KA 5DB5A 3AEJC 2YKXA 3ASAA 3PPLA 1M6SA 2VMPA 3FFRA 2R5EA 2JGTA 1WYTB 2HP2A 4IXZA 3NYUA 2CJHA 1CQ6A 1PMMA 3FCRA 1YOOA 4ISYA 2FNIA 3CQ4A 3FKDA 4F5GA 1SZUA 1I41A 1U08A 2BYLA 3BB8A 4Q76A 2VLFA 3COGA 3DXWA 4RJYA 3RCHB 1TOJA 2DGMA 3NUIA 4ZLVA 3GZDC 4CXRA 3USFA 2W7HA 2V1PA 1X29A 1AJSB 4H51A 4WXBA 1M4NA 1GC4A 4P7YA 1J32A 4W1WA 4BA4A 3JTXA 1WKGA 3PDBB 3JWAA 3CBFA 1CZEA 1G7WA 2VGTA 4TV7A 4W8IA 3RBFA 1ASCA 2VYCA 1SZKA 2XH1A 4Y0DA 4UQVA 4W91A 3QM2A 4E3QA 2EZ1A 3QPGA 1TOIA 2C81A 5DJ9A 1RV4A 3K28A 1P3WA 1VJOA 3NUBA 3QN6A 4AOAA 5M46A 2JISA 3GR9A 1CQ7A 1SFFA 2VMRA 3H9XA 2CJGA 1M0NA 2VMVA 4EU1A 3AEMA 2VMSA 4Y0HA 1OHYA 2Z9VA 1ELQA 4L0OA 7AATA 3NNKA 1GDEA 3BS8A 3PD6A 3E9KA 4J8LA 2PB2A
chains in the Genus database with same CATH topology
1OHVA 4M2KA 2VMUA 3JZLA 4GE7A 1M0PA 4W5KA 2C7TA 4WYDA 2YCTA 3VAXA 3B8XA 2Z9XA 3WGCA 1MAQA 1S06A 2CSTA 4ITGA 2Z1ZA 4JEWA 2D7YA 1B4XA 2YCPA 2AY1A 4PVFA 4AO9A 1TOEA 5EUEA 4ATQA 1BT4A 3MEBA 5FT5A 2YKVA 1IVRA 3ELPA 1LC8A 2BYJA 2CB1A 3KKIA 3L8AA 4WP0A 3UE8A 1C7OA 3EI7A 3MADA 1E5FA 3FRKA 1G7XA 1IJIA 3VK3A 2BWPA 1WYTA 3A9ZA 1IAXA 4MQRA 1GC3A 2Q7WA 2AY9A 3CAIA 3WGBA 1IX7A 2ZSLA 3MC6A 3PAAA 4IXSA 1AMSA 1QZ9A 2CFBA 2VGUA 2XBNA 3NYTA 3QBOA 3RCHA 1SZSA 3DR4A 4XAUA 4ADEA 3TFTA 2DGKA 1W7MA 1ASNA 1N31A 1VP4A 3LWSA 2VLHA 4F5KA 3W1JA 3FZ7A 1LW5A 1MDXA 1XEYA 1AJRA 4K2BA 2ZUKA 4R5ZA 4WLJA 3PDBA 4A0FA 1JS3A 2OQXA 1QITA 2AY3A 1B9HA 2DOUA 2R0TA 3HT4A 4WXFA 1GC0A 4B98A 2W7MA 5EAVA 3JW9A 3LVKA 1FC4A 1IX8A 1QJ5A 2FNUA 4MQQA 3E77A 1EQBA 3LVMA 1DJ9A 3NTJA 4RM1A 1S09A 1ELUA 4W1XA 5M4BA 1I48A 4GEBA 1CL2A 3F9TA 4BHDA 2QB3A 2PO3A 5HXXA 1AIBA 1AHYA 5HHYA 3NRAA 2EH6A 4TN4A 1UU1A 1YNUA 1V2FA 4PIWA 4A72A 2AY6A 1TARA 4U1TA 5J8QA 2ZY2A 3ZZKA 2NMPA 2WK7A 2VMTA 1MGVA 2HOYA 4NOGA 5DX5A 2X3LA 5F9SA 4H63Q 3CQ5A 1X2AA 1IBJA 1OXOA 5JAYA 2O1BA 2JJHA 3B1EA 3BCAA 2AATA 1KL1A 2QBTA 3NX3A 2BI5A 4JE5A 3FVSA 4MKJA 2GMSA 2C0RA 5FT4A 5G4JA 3VK2A 4IYOB 1ASAA 4XJMA 1AY4A 3LVLB 4O6ZA 2W7LA 2D66A 1M7YA 2D7ZA 1AHEA 3H7FA 3A8UX 2VGWA 3R9AA 3FDDA 1ASDA 3VK4A 1BKGA 1ASFA 1QISA 1AAWA 2O7CA 1AKBA 4R5FA 4RJ0A 1BQAA 1ARTA 4A0HA 3PJ0A 4M2JA 4ZM4A 4DBCA 1B9IA 1UKJA 2Z9UA 4FL0A 5LHAA 2VMYA 2FQ6A 4WYFA 3DR7A 3WCNA 3EI8A 2O0RA 1D2FA 2HP1A 2W7FA 1EG5A 4LW4A 1V2EA 4UHNA 5M49A 2YHKA 1VEFA 3BC8A 4WLHA 1GEWA 2W7DA 4OYTA 3WLXA 2AEUA 5EAAA 5M4DA 3F0HA 4ADCA 1RV3A 2GSAA 3II0A 1M0QA 4K2IA 1JG8A 3G7QA 1GEYA 2VMNA 1ZOBA 3I4JA 4WB0B 4F5IA 3TQXA 4ZDOA 3B1DA 3UWCA 3IF2A 1GBNA 1D7UA 2WKAA 4MQPA 3GJUA 2JJGA 3MKJA 4F5JA 2CH2A 3I5TA 2QMAA 3DXVA 2ZY3A 3N0LA 2D5YA 2E7UA 1ARIA 4OBUA 5AX8A 3AEMC 4WYEA 5EQCA 4B9BA 4ZM3A 1AHXA 3E2ZB 2ZY5A 4KAMA 2C44A 3E2FA 4F4EA 1QIRA 2W8UA 1YJZA 3DRDA 3GWPA 3WX9A 3RBLA 2ZP7A 3BWNA 4IYOA 2X8UA 4F5LA 5E5IA 1CS1A 2RFVA 4WXGA 4XK1A 3N7NA 4W1VA 1W3UA 1W7LA 2D61A 1PG8A 4CBSA 8AATA 4EB5A 3ECDA 4GE4A 3VP6A 4JF1A 1BJ4A 3VOMA 2QLRA 2QA3A 1KMJA 2D65A 2DKBA 4A6TA 2WB6A 3G0TA 1AKAA 2WK9A 4CVQA 2OGEA 1ZC9A 1TASA 1C7NA 1TATA 2CANA 2W8WA 5LH9A 3WCOA 4CXQA 4Q75A 2BIEA 3NU7A 2YRRA 2AY7A 3MC6C 3AOWA 1G4VA 4ZWVA 3EIAA 2HUFA 1KMKA 1TOGA 2BHXA 2CTZA 4OC9A 3R4TA 2VIAA 4BQ0A 3KE3A 1LC5A 1S07A 2OATA 1UU0A 2BI2A 5F8VA 2W8VA 3AEPA 4XJPA 4DQ6A 2BI1A 2R5CA 1B8GA 4WB0A 1QJ3A 4E1OA 1O4SA 2KFPA 3HMUA 5D5SA 1J04A 4JF0A 1OHWA 3AEOA 2EO5A 1DJEA 1AKCA 3AATA 1M32A 1AIAA 2BKWA 1WSTA 2VMOA 4GSAA 2W7GA 2VGVA 1O61A 4ADBA 1QGNA 3TATA 4P3MA 3RUYA 3K40A 2G7JA 1V2DA 3FVUA 3NU8A 4K2MA 5K8BA 4XJLA 3FTBA 1DKAA 2AY2A 1Z3ZA 4OCAA 3WKRA 3E2ZA 4A0GA 2EGYA 5BJ3A 1MLZA 1FG3A 1YJYA 2VGSA 4MKKA 3WY7A 1ORDA 3Q8NA 1IAYA 1ASBA 2YKUA 4J5UA 3JWBA 3BCXA 3PGYA 4WYGA 3N4RA 5KTBA 3ISLA 1ECXA 3AENB 3LV2A 1T3IA 1D7VA 2CH1A 3GZCA 1CZCA 1YAAA 1Z7DA 2ZJGA 1ARGA 2A1VA 2Z67A 1DTYA 2YOBA 1AX4A 3HDOA 2VMQA 2VMXA 3T32A 3A2BA 1PMOA 5DJ1A 4Y0IA 5EFSA 2DR1A 4Q31A 3FQ7A 2Z20A 4OTLA 1BS0A 1IX6A 2VI9A 4A6RA 5IWQA 2W7JA 5E4ZA 3GSBA 2BI9A 3PA9A 1CL1A 1O62A 1N2TA 3B46A 4MSOA 3HL2A 2CJDA 2GQNA 2W7KA 4RKCA 3B1CA 4XEWA 1XI9A 2X5FA 3HVYA 3TCMA 2CINA 4HVKA 3FVXA 5G09A 1GEXA 1IUGA 1ARHA 1SF2A 2G6WA 3HLMA 3FQ8A 2FN6A 1AY8A 4MGRA 4UOYA 2Z1YA 2E7JA 2HOXA 4IW7A 3MAUA 4E77A 1AY5A 2ZY4A 1I43A 4PFNA 4N0BA 3AEJA 2HOZA 1I29A 2OKKA 3IHJA 4IXOA 4LW2A 4GDYA 4LNMA 1N8PA 4ZAHA 2R5CB 4MY5A 3NYSA 4FFCA 5D95A 3WKSA 2HZPA 3AELA 4AO4A 2QB2A 1LW4A 4LC3A 4BMKA 5EIGA 1BW0A 2JG2A 3GETA 1BJWA 1SVVA 1KKPA 2VMWA 3GZDA 3NDNA 2BWOA 3P6KA 2W7EA 4ATPA 4K05A 1AMQA 3ELEA 2W7IA 1BJNA 1GD9A 1BQDA 2BI3A 4RAEA 4I8AA 4ADDA 3H14A 1ASGA 1AAMA 1JF9A 1TPLA 4QGRA 1JS6A 5EUNA 3RQ1A 3AENA 1LC7A 1WYVB 2YCNA 4KYOA 2EZ2A 4N0WA 4M2MA 3LVJA 3E2YA 2CY8A 1B5OA 3MAFB 3MBBA 1DGEA 2YRIA 3L44A 1H1CA 4XJOA 3FFHA 1FG7A 3UAKA 1E5EA 3DC1A 5G2QA 2ZSMA 1D7RA 3BWNC 4HF8A 3TFUA 1C7GA 1AICA 3ATHA 3ZRRA 1UU2A 1KKJA 2BIAA 4IY7A 3AOVA 4ZSYA 3N4XA 1AHFA 1LS3A 1W7NA 2TPLA 3FZ6A 4ZWMA 5EUDA 2JJFA 2PB0A 1EJIA 1D7SA 2VI8A 3HBXA 4GE9A 4WYCA 3ZRQA 1ASEA 3N4SA 4GRXA 1MLYA 1LK9A 1RVUA 3RI6A 3W1IA 3EI5A 4UHOA 3D6KA 2R2NA 3G8MA 1MDZA 1CQ8A 3DODA 3PDXA 3ACZA 1WYUB 4RIZA 4ITXA 3AV7A 1ASMA 4BA5A 3GBXA 2DKJA 1S08A 5G4IA 1DFOA 4U2HA 3EI9A 3OKSA 2VIBA 1H0CA 4WYAA 4UHMA 2ZC0A 2E7IA 5E3KA 3N5MA 3N75A 1S0AA 4IX8A 4JE5D 3OP7A 2ZYJA 4ZASA 2W8TA 1MAPA 1BJOB 3LG0A 4A0RA 1C0NA 3BCBA 1GCKA 2OGAA 4XQ2A 4CBRA 1DJUA 1ZODA 1OATA 3EI6A 3DYDA 3E6GA 4OBVA 5I92A 4JEXA 2EPJA 2Z61A 5FT8A 1AMAA 3DZZA 2GMUA 2BWNA 1V72A 2HUUA 3FZ8A 2AEVA 1LKCA 2AY8A 1AJSA 4JEZA 5EIGB 1G4XA 3QGUA 1WYVA 2E54A 2VGZA 3FD0A 3I16A 2HORA 1GC2A 1RVYA 1X28A 2BIGA 3MAFA 4JEYA 3EZ1A 4WD2A 1W23A 4DGTA 2EYQA 4F5MA 3BWOA 5C6UA 2FYFA 3ASBA 3F6TA 4JEVA 1YJSA 1AHGA 1MDOA 3ZZJA 2ORDA 4RITA 4EMYA 2WK8A 2Z9WA 5G0AA 4F5FA 3FSLA 4RKDA 3PIUA 3WZFA 3EZSA 4A6UA 3EUCA 9AATA 4R2NA 1SPAA 1B5PA 3QHXA 5FT6A 3KGWA 5HDMA 4TMRA 3W1HA 4E3RA 2D64A 4WBTA 4AZJA 4ZSWA 4PFFA 1C9CA 4A00A 4AH3A 5BJ4A 4KXKA 1YIYA 1ASLA 4ZDPA 2F8JA 2GB3A 2YKYA 3CQ6A 2AY5A 4ZDLA 2OKJA 4OT8A 2VMZA 1WYUA 1X0MA 2W8JA 1OXPA 3A9YA 3BV0A 3PD6B 3FQAA 1Y4IA 2AY4A 2FM1A 1AMRA 2X5DA 4LNLA 1O69A 2FKIA 3HQTA 4Q6RA 2JJEA 3DU4A 3LY1A 5TF5A 3P1TA 4AZKA 1CJ0A 4LNJA 1YIZA 2V0YA 3A9XA 3BN1A 4RLGA 2D63A 4EB7A 3QI6A 2DGLA 3EIBA 3ZRPA 1BJOA 1M0OA 1ARSA 1PFFA 1WKHA 3K7YA 3KGXA 4R8DA 5G2PA 2QSRA 3JU7A 1TOKA 4OMAA 1DGDA 4EFFA 1KL2A 3M5UA 3FDBA 4F5HA 2HUIA 1C4KA 5DB5A 3AEJC 2YKXA 3ASAA 3PPLA 1M6SA 2VMPA 3FFRA 2R5EA 2JGTA 1WYTB 2HP2A 4IXZA 3NYUA 2CJHA 1CQ6A 1PMMA 3FCRA 1YOOA 4ISYA 2FNIA 3CQ4A 3FKDA 4F5GA 1SZUA 1I41A 1U08A 2BYLA 3BB8A 4Q76A 2VLFA 3COGA 3DXWA 4RJYA 3RCHB 1TOJA 2DGMA 3NUIA 4ZLVA 3GZDC 4CXRA 3USFA 2W7HA 2V1PA 1X29A 1AJSB 4H51A 4WXBA 1M4NA 1GC4A 4P7YA 1J32A 4W1WA 4BA4A 3JTXA 1WKGA 3PDBB 3JWAA 3CBFA 1CZEA 1G7WA 2VGTA 4TV7A 4W8IA 3RBFA 1ASCA 2VYCA 1SZKA 2XH1A 4Y0DA 4UQVA 4W91A 3QM2A 4E3QA 2EZ1A 3QPGA 1TOIA 2C81A 5DJ9A 1RV4A 3K28A 1P3WA 1VJOA 3NUBA 3QN6A 4AOAA 5M46A 2JISA 3GR9A 1CQ7A 1SFFA 2VMRA 3H9XA 2CJGA 1M0NA 2VMVA 4EU1A 3AEMA 2VMSA 4Y0HA 1OHYA 2Z9VA 1ELQA 4L0OA 7AATA 3NNKA 1GDEA 3BS8A 3PD6A 3E9KA 4J8LA 2PB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHV A;  4M2K A;  2VMU A;  3JZL A;  4GE7 A;  1M0P A;  4W5K A;  2C7T A;  4WYD A;  2YCT A;  3VAX A;  3B8X A;  2Z9X A;  3WGC A;  1MAQ A;  1S06 A;  2CST A;  4ITG A;  2Z1Z A;  4JEW A;  2D7Y A;  1B4X A;  2YCP A;  2AY1 A;  4PVF A;  4AO9 A;  1TOE A;  5EUE A;  4ATQ A;  1BT4 A;  3MEB A;  5FT5 A;  2YKV A;  1IVR A;  3ELP A;  1LC8 A;  2BYJ A;  2CB1 A;  3KKI A;  3L8A A;  4WP0 A;  3UE8 A;  1C7O A;  3EI7 A;  3MAD A;  1E5F A;  3FRK A;  1G7X A;  1IJI A;  3VK3 A;  2BWP A;  1WYT A;  3A9Z A;  1IAX A;  4MQR A;  1GC3 A;  2Q7W A;  2AY9 A;  3CAI A;  3WGB A;  1IX7 A;  2ZSL A;  3MC6 A;  3PAA A;  4IXS A;  1AMS A;  1QZ9 A;  2CFB A;  2VGU A;  2XBN A;  3NYT A;  3QBO A;  3RCH A;  1SZS A;  3DR4 A;  4XAU A;  4ADE A;  3TFT A;  2DGK A;  1W7M A;  1ASN A;  1N31 A;  1VP4 A;  3LWS A;  2VLH A;  4F5K A;  3W1J A;  3FZ7 A;  1LW5 A;  1MDX A;  1XEY A;  1AJR A;  4K2B A;  2ZUK A;  4R5Z A;  4WLJ A;  3PDB A;  4A0F A;  1JS3 A;  2OQX A;  1QIT A;  2AY3 A;  1B9H A;  2DOU A;  2R0T A;  3HT4 A;  4WXF A;  1GC0 A;  4B98 A;  2W7M A;  5EAV A;  3JW9 A;  3LVK A;  1FC4 A;  1IX8 A;  1QJ5 A;  2FNU A;  4MQQ A;  3E77 A;  1EQB A;  3LVM A;  1DJ9 A;  3NTJ A;  4RM1 A;  1S09 A;  1ELU A;  4W1X A;  5M4B A;  1I48 A;  4GEB A;  1CL2 A;  3F9T A;  4BHD A;  2QB3 A;  2PO3 A;  5HXX A;  1AIB A;  1AHY A;  5HHY A;  3NRA A;  2EH6 A;  4TN4 A;  1UU1 A;  1YNU A;  1V2F A;  4PIW A;  4A72 A;  2AY6 A;  1TAR A;  4U1T A;  5J8Q A;  2ZY2 A;  3ZZK A;  2NMP A;  2WK7 A;  2VMT A;  1MGV A;  2HOY A;  4NOG A;  5DX5 A;  2X3L A;  5F9S A;  3CQ5 A;  1X2A A;  1IBJ A;  1OXO A;  5JAY A;  2O1B A;  2JJH A;  3B1E A;  3BCA A;  2AAT A;  1KL1 A;  2QBT A;  3NX3 A;  2BI5 A;  4JE5 A;  3FVS A;  4MKJ A;  2GMS A;  2C0R A;  5FT4 A;  5G4J A;  3VK2 A;  4IYO B;  1ASA A;  4XJM A;  1AY4 A;  3LVL B;  4O6Z A;  2W7L A;  2D66 A;  1M7Y A;  2D7Z A;  1AHE A;  3H7F A;  3A8U X;  2VGW A;  3R9A A;  3FDD A;  1ASD A;  3VK4 A;  1BKG A;  1ASF A;  1QIS A;  1AAW A;  2O7C A;  1AKB A;  4R5F A;  4RJ0 A;  1BQA A;  1ART A;  4A0H A;  3PJ0 A;  4M2J A;  4ZM4 A;  4DBC A;  1B9I A;  1UKJ A;  2Z9U A;  4FL0 A;  5LHA A;  2VMY A;  2FQ6 A;  4WYF A;  3DR7 A;  3WCN A;  3EI8 A;  2O0R A;  1D2F A;  2HP1 A;  2W7F A;  1EG5 A;  4LW4 A;  1V2E A;  4UHN A;  5M49 A;  2YHK A;  1VEF A;  3BC8 A;  4WLH A;  1GEW A;  2W7D A;  4OYT A;  3WLX A;  2AEU A;  5EAA A;  5M4D A;  3F0H A;  4ADC A;  1RV3 A;  2GSA A;  3II0 A;  1M0Q A;  4K2I A;  1JG8 A;  3G7Q A;  1GEY A;  2VMN A;  1ZOB A;  3I4J A;  4WB0 B;  4F5I A;  3TQX A;  4ZDO A;  3B1D A;  3UWC A;  3IF2 A;  1GBN A;  1D7U A;  2WKA A;  4MQP A;  3GJU A;  2JJG A;  3MKJ A;  4F5J A;  2CH2 A;  3I5T A;  2QMA A;  3DXV A;  2ZY3 A;  3N0L A;  2D5Y A;  2E7U A;  1ARI A;  4OBU A;  5AX8 A;  3AEM C;  4WYE A;  5EQC A;  4B9B A;  4ZM3 A;  1AHX A;  3E2Z B;  2ZY5 A;  4KAM A;  2C44 A;  3E2F A;  4F4E A;  1QIR A;  2W8U A;  1YJZ A;  3DRD A;  3GWP A;  3WX9 A;  3RBL A;  2ZP7 A;  3BWN A;  4IYO A;  2X8U A;  4F5L A;  5E5I A;  1CS1 A;  2RFV A;  4WXG A;  4XK1 A;  4W1V A;  1W3U A;  1W7L A;  2D61 A;  1PG8 A;  4CBS A;  8AAT A;  4EB5 A;  3ECD A;  4GE4 A;  3VP6 A;  4JF1 A;  1BJ4 A;  3VOM A;  2QLR A;  2QA3 A;  1KMJ A;  2D65 A;  2DKB A;  4A6T A;  3G0T A;  1AKA A;  2WK9 A;  4CVQ A;  2OGE A;  1ZC9 A;  1TAS A;  1C7N A;  1TAT A;  2CAN A;  2W8W A;  5LH9 A;  3WCO A;  4CXQ A;  4Q75 A;  2BIE A;  3NU7 A;  2YRR A;  2AY7 A;  3MC6 C;  3AOW A;  1G4V A;  4ZWV A;  3EIA A;  2HUF A;  1KMK A;  1TOG A;  2BHX A;  2CTZ A;  4OC9 A;  3R4T A;  2VIA A;  4BQ0 A;  3KE3 A;  1LC5 A;  1S07 A;  2OAT A;  1UU0 A;  2BI2 A;  5F8V A;  2W8V A;  3AEP A;  4XJP A;  4DQ6 A;  2BI1 A;  2R5C A;  1B8G A;  4WB0 A;  1QJ3 A;  4E1O A;  1O4S A;  3HMU A;  5D5S A;  1J04 A;  4JF0 A;  1OHW A;  3AEO A;  2EO5 A;  1DJE A;  1AKC A;  3AAT A;  1M32 A;  1AIA A;  2BKW A;  1WST A;  2VMO A;  4GSA A;  2W7G A;  2VGV A;  1O61 A;  4ADB A;  1QGN A;  3TAT A;  4P3M A;  3RUY A;  3K40 A;  1V2D A;  3FVU A;  3NU8 A;  4K2M A;  5K8B A;  4XJL A;  3FTB A;  1DKA A;  2AY2 A;  1Z3Z A;  4OCA A;  3WKR A;  3E2Z A;  4A0G A;  2EGY A;  5BJ3 A;  1MLZ A;  1FG3 A;  1YJY A;  2VGS A;  4MKK A;  3WY7 A;  1ORD A;  3Q8N A;  1IAY A;  1ASB A;  2YKU A;  4J5U A;  3JWB A;  3BCX A;  3PGY A;  4WYG A;  3ISL A;  1ECX A;  3AEN B;  3LV2 A;  1T3I A;  1D7V A;  2CH1 A;  3GZC A;  1CZC A;  1YAA A;  1Z7D A;  2ZJG A;  1ARG A;  2Z67 A;  1DTY A;  2YOB A;  1AX4 A;  3HDO A;  2VMQ A;  2VMX A;  3T32 A;  3A2B A;  1PMO A;  5DJ1 A;  4Y0I A;  5EFS A;  2DR1 A;  4Q31 A;  3FQ7 A;  2Z20 A;  4OTL A;  1BS0 A;  1IX6 A;  2VI9 A;  4A6R A;  5IWQ A;  2W7J A;  5E4Z A;  3GSB A;  2BI9 A;  3PA9 A;  1CL1 A;  1O62 A;  1N2T A;  3B46 A;  4MSO A;  3HL2 A;  2CJD A;  2GQN A;  2W7K A;  4RKC A;  3B1C A;  4XEW A;  1XI9 A;  2X5F A;  3HVY A;  3TCM A;  2CIN A;  4HVK A;  3FVX A;  5G09 A;  1GEX A;  1IUG A;  1ARH A;  1SF2 A;  2G6W A;  3HLM A;  3FQ8 A;  2FN6 A;  1AY8 A;  4MGR A;  4UOY A;  2Z1Y A;  2E7J A;  2HOX A;  4IW7 A;  3MAU A;  4E77 A;  1AY5 A;  2ZY4 A;  1I43 A;  4PFN A;  4N0B A;  3AEJ A;  2HOZ A;  1I29 A;  2OKK A;  3IHJ A;  4IXO A;  4LW2 A;  4GDY A;  4LNM A;  1N8P A;  4ZAH A;  2R5C B;  4MY5 A;  3NYS A;  4FFC A;  5D95 A;  3WKS A;  2HZP A;  3AEL A;  4AO4 A;  2QB2 A;  1LW4 A;  4LC3 A;  4BMK A;  5EIG A;  1BW0 A;  2JG2 A;  3GET A;  1BJW A;  1SVV A;  1KKP A;  2VMW A;  3GZD A;  3NDN A;  2BWO A;  3P6K A;  2W7E A;  4ATP A;  1AMQ A;  3ELE A;  2W7I A;  1BJN A;  1GD9 A;  1BQD A;  2BI3 A;  4RAE A;  4I8A A;  4ADD A;  3H14 A;  1ASG A;  1AAM A;  1JF9 A;  1TPL A;  4QGR A;  1JS6 A;  5EUN A;  3RQ1 A;  3AEN A;  1LC7 A;  1WYV B;  2YCN A;  4KYO A;  2EZ2 A;  4N0W A;  4M2M A;  3LVJ A;  3E2Y A;  2CY8 A;  1B5O A;  3MAF B;  3MBB A;  1DGE A;  2YRI A;  3L44 A;  1H1C A;  4XJO A;  3FFH A;  1FG7 A;  3UAK A;  1E5E A;  3DC1 A;  5G2Q A;  2ZSM A;  1D7R A;  3BWN C;  4HF8 A;  3TFU A;  1C7G A;  1AIC A;  3ATH A;  3ZRR A;  1UU2 A;  1KKJ A;  2BIA A;  4IY7 A;  3AOV A;  4ZSY A;  1AHF A;  1LS3 A;  1W7N A;  2TPL A;  3FZ6 A;  4ZWM A;  5EUD A;  2JJF A;  2PB0 A;  1EJI A;  1D7S A;  2VI8 A;  3HBX A;  4GE9 A;  4WYC A;  3ZRQ A;  1ASE A;  4GRX A;  1MLY A;  1LK9 A;  1RVU A;  3RI6 A;  3W1I A;  3EI5 A;  4UHO A;  3D6K A;  2R2N A;  3G8M A;  1MDZ A;  1CQ8 A;  3DOD A;  3PDX A;  3ACZ A;  1WYU B;  4RIZ A;  4ITX A;  3AV7 A;  1ASM A;  4BA5 A;  3GBX A;  2DKJ A;  1S08 A;  5G4I A;  1DFO A;  4U2H A;  3EI9 A;  3OKS A;  2VIB A;  1H0C A;  4WYA A;  4UHM A;  2ZC0 A;  2E7I A;  5E3K A;  3N5M A;  3N75 A;  1S0A A;  4IX8 A;  4JE5 D;  3OP7 A;  2ZYJ A;  4ZAS A;  2W8T A;  1MAP A;  1BJO B;  3LG0 A;  4A0R A;  1C0N A;  3BCB A;  1GCK A;  2OGA A;  4XQ2 A;  4CBR A;  1DJU A;  1ZOD A;  1OAT A;  3EI6 A;  3DYD A;  3E6G A;  4OBV A;  5I92 A;  4JEX A;  2EPJ A;  2Z61 A;  5FT8 A;  1AMA A;  3DZZ A;  2GMU A;  2BWN A;  1V72 A;  2HUU A;  3FZ8 A;  2AEV A;  1LKC A;  2AY8 A;  1AJS A;  4JEZ A;  5EIG B;  1G4X A;  3QGU A;  1WYV A;  2E54 A;  2VGZ A;  3FD0 A;  3I16 A;  2HOR A;  1GC2 A;  1RVY A;  1X28 A;  2BIG A;  3MAF A;  4JEY A;  3EZ1 A;  4WD2 A;  1W23 A;  4DGT A;  4F5M A;  3BWO A;  5C6U A;  2FYF A;  3ASB A;  3F6T A;  4JEV A;  1YJS A;  1AHG A;  1MDO A;  3ZZJ A;  2ORD A;  4RIT A;  4EMY A;  2WK8 A;  2Z9W A;  5G0A A;  4F5F A;  3FSL A;  4RKD A;  3PIU A;  3WZF A;  3EZS A;  4A6U A;  3EUC A;  9AAT A;  4R2N A;  1SPA A;  1B5P A;  3QHX A;  5FT6 A;  3KGW A;  5HDM A;  4TMR A;  3W1H A;  4E3R A;  2D64 A;  4WBT A;  4AZJ A;  4ZSW A;  4PFF A;  1C9C A;  4A00 A;  4AH3 A;  5BJ4 A;  4KXK A;  1YIY A;  1ASL A;  4ZDP A;  2F8J A;  2GB3 A;  2YKY A;  3CQ6 A;  2AY5 A;  4ZDL A;  2OKJ A;  4OT8 A;  2VMZ A;  1WYU A;  1X0M A;  2W8J A;  1OXP A;  3A9Y A;  3BV0 A;  3PD6 B;  3FQA A;  1Y4I A;  2AY4 A;  2FM1 A;  1AMR A;  2X5D A;  4LNL A;  1O69 A;  3HQT A;  4Q6R A;  2JJE A;  3DU4 A;  3LY1 A;  5TF5 A;  3P1T A;  4AZK A;  1CJ0 A;  4LNJ A;  1YIZ A;  2V0Y A;  3A9X A;  3BN1 A;  4RLG A;  2D63 A;  4EB7 A;  3QI6 A;  2DGL A;  3EIB A;  3ZRP A;  1BJO A;  1M0O A;  1ARS A;  1PFF A;  1WKH A;  3K7Y A;  3KGX A;  4R8D A;  5G2P A;  3JU7 A;  1TOK A;  4OMA A;  1DGD A;  4EFF A;  1KL2 A;  3M5U A;  3FDB A;  4F5H A;  2HUI A;  1C4K A;  5DB5 A;  3AEJ C;  2YKX A;  3ASA A;  3PPL A;  1M6S A;  2VMP A;  3FFR A;  2R5E A;  2JGT A;  1WYT B;  2HP2 A;  4IXZ A;  3NYU A;  2CJH A;  1CQ6 A;  1PMM A;  3FCR A;  1YOO A;  4ISY A;  2FNI A;  3CQ4 A;  3FKD A;  4F5G A;  1SZU A;  1I41 A;  1U08 A;  2BYL A;  3BB8 A;  4Q76 A;  2VLF A;  3COG A;  3DXW A;  4RJY A;  3RCH B;  1TOJ A;  2DGM A;  3NUI A;  4ZLV A;  3GZD C;  4CXR A;  3USF A;  2W7H A;  2V1P A;  1X29 A;  1AJS B;  4H51 A;  4WXB A;  1M4N A;  1GC4 A;  4P7Y A;  1J32 A;  4W1W A;  4BA4 A;  3JTX A;  1WKG A;  3PDB B;  3JWA A;  3CBF A;  1CZE A;  1G7W A;  2VGT A;  4TV7 A;  4W8I A;  3RBF A;  1ASC A;  2VYC A;  1SZK A;  2XH1 A;  4Y0D A;  4UQV A;  4W91 A;  3QM2 A;  4E3Q A;  2EZ1 A;  3QPG A;  1TOI A;  2C81 A;  5DJ9 A;  1RV4 A;  3K28 A;  1P3W A;  1VJO A;  3NUB A;  3QN6 A;  4AOA A;  5M46 A;  2JIS A;  3GR9 A;  1CQ7 A;  1SFF A;  2VMR A;  2CJG A;  1M0N A;  2VMV A;  4EU1 A;  3AEM A;  2VMS A;  4Y0H A;  1OHY A;  2Z9V A;  1ELQ A;  4L0O A;  7AAT A;  3NNK A;  1GDE A;  3BS8 A;  3PD6 A;  3E9K A;  4J8L A;  2PB2 A; 
#chains in the Genus database with same CATH topology
 1OHV A;  4M2K A;  2VMU A;  3JZL A;  4GE7 A;  1M0P A;  4W5K A;  2C7T A;  4WYD A;  2YCT A;  3VAX A;  3B8X A;  2Z9X A;  3WGC A;  1MAQ A;  1S06 A;  2CST A;  4ITG A;  2Z1Z A;  4JEW A;  2D7Y A;  1B4X A;  2YCP A;  2AY1 A;  4PVF A;  4AO9 A;  1TOE A;  5EUE A;  4ATQ A;  1BT4 A;  3MEB A;  5FT5 A;  2YKV A;  1IVR A;  3ELP A;  1LC8 A;  2BYJ A;  2CB1 A;  3KKI A;  3L8A A;  4WP0 A;  3UE8 A;  1C7O A;  3EI7 A;  3MAD A;  1E5F A;  3FRK A;  1G7X A;  1IJI A;  3VK3 A;  2BWP A;  1WYT A;  3A9Z A;  1IAX A;  4MQR A;  1GC3 A;  2Q7W A;  2AY9 A;  3CAI A;  3WGB A;  1IX7 A;  2ZSL A;  3MC6 A;  3PAA A;  4IXS A;  1AMS A;  1QZ9 A;  2CFB A;  2VGU A;  2XBN A;  3NYT A;  3QBO A;  3RCH A;  1SZS A;  3DR4 A;  4XAU A;  4ADE A;  3TFT A;  2DGK A;  1W7M A;  1ASN A;  1N31 A;  1VP4 A;  3LWS A;  2VLH A;  4F5K A;  3W1J A;  3FZ7 A;  1LW5 A;  1MDX A;  1XEY A;  1AJR A;  4K2B A;  2ZUK A;  4R5Z A;  4WLJ A;  3PDB A;  4A0F A;  1JS3 A;  2OQX A;  1QIT A;  2AY3 A;  1B9H A;  2DOU A;  2R0T A;  3HT4 A;  4WXF A;  1GC0 A;  4B98 A;  2W7M A;  5EAV A;  3JW9 A;  3LVK A;  1FC4 A;  1IX8 A;  1QJ5 A;  2FNU A;  4MQQ A;  3E77 A;  1EQB A;  3LVM A;  1DJ9 A;  3NTJ A;  4RM1 A;  1S09 A;  1ELU A;  4W1X A;  5M4B A;  1I48 A;  4GEB A;  1CL2 A;  3F9T A;  4BHD A;  2QB3 A;  2PO3 A;  5HXX A;  1AIB A;  1AHY A;  5HHY A;  3NRA A;  2EH6 A;  4TN4 A;  1UU1 A;  1YNU A;  1V2F A;  4PIW A;  4A72 A;  2AY6 A;  1TAR A;  4U1T A;  5J8Q A;  2ZY2 A;  3ZZK A;  2NMP A;  2WK7 A;  2VMT A;  1MGV A;  2HOY A;  4NOG A;  5DX5 A;  2X3L A;  5F9S A;  4H63 Q;  3CQ5 A;  1X2A A;  1IBJ A;  1OXO A;  5JAY A;  2O1B A;  2JJH A;  3B1E A;  3BCA A;  2AAT A;  1KL1 A;  2QBT A;  3NX3 A;  2BI5 A;  4JE5 A;  3FVS A;  4MKJ A;  2GMS A;  2C0R A;  5FT4 A;  5G4J A;  3VK2 A;  4IYO B;  1ASA A;  4XJM A;  1AY4 A;  3LVL B;  4O6Z A;  2W7L A;  2D66 A;  1M7Y A;  2D7Z A;  1AHE A;  3H7F A;  3A8U X;  2VGW A;  3R9A A;  3FDD A;  1ASD A;  3VK4 A;  1BKG A;  1ASF A;  1QIS A;  1AAW A;  2O7C A;  1AKB A;  4R5F A;  4RJ0 A;  1BQA A;  1ART A;  4A0H A;  3PJ0 A;  4M2J A;  4ZM4 A;  4DBC A;  1B9I A;  1UKJ A;  2Z9U A;  4FL0 A;  5LHA A;  2VMY A;  2FQ6 A;  4WYF A;  3DR7 A;  3WCN A;  3EI8 A;  2O0R A;  1D2F A;  2HP1 A;  2W7F A;  1EG5 A;  4LW4 A;  1V2E A;  4UHN A;  5M49 A;  2YHK A;  1VEF A;  3BC8 A;  4WLH A;  1GEW A;  2W7D A;  4OYT A;  3WLX A;  2AEU A;  5EAA A;  5M4D A;  3F0H A;  4ADC A;  1RV3 A;  2GSA A;  3II0 A;  1M0Q A;  4K2I A;  1JG8 A;  3G7Q A;  1GEY A;  2VMN A;  1ZOB A;  3I4J A;  4WB0 B;  4F5I A;  3TQX A;  4ZDO A;  3B1D A;  3UWC A;  3IF2 A;  1GBN A;  1D7U A;  2WKA A;  4MQP A;  3GJU A;  2JJG A;  3MKJ A;  4F5J A;  2CH2 A;  3I5T A;  2QMA A;  3DXV A;  2ZY3 A;  3N0L A;  2D5Y A;  2E7U A;  1ARI A;  4OBU A;  5AX8 A;  3AEM C;  4WYE A;  5EQC A;  4B9B A;  4ZM3 A;  1AHX A;  3E2Z B;  2ZY5 A;  4KAM A;  2C44 A;  3E2F A;  4F4E A;  1QIR A;  2W8U A;  1YJZ A;  3DRD A;  3GWP A;  3WX9 A;  3RBL A;  2ZP7 A;  3BWN A;  4IYO A;  2X8U A;  4F5L A;  5E5I A;  1CS1 A;  2RFV A;  4WXG A;  4XK1 A;  3N7N A;  4W1V A;  1W3U A;  1W7L A;  2D61 A;  1PG8 A;  4CBS A;  8AAT A;  4EB5 A;  3ECD A;  4GE4 A;  3VP6 A;  4JF1 A;  1BJ4 A;  3VOM A;  2QLR A;  2QA3 A;  1KMJ A;  2D65 A;  2DKB A;  4A6T A;  2WB6 A;  3G0T A;  1AKA A;  2WK9 A;  4CVQ A;  2OGE A;  1ZC9 A;  1TAS A;  1C7N A;  1TAT A;  2CAN A;  2W8W A;  5LH9 A;  3WCO A;  4CXQ A;  4Q75 A;  2BIE A;  3NU7 A;  2YRR A;  2AY7 A;  3MC6 C;  3AOW A;  1G4V A;  4ZWV A;  3EIA A;  2HUF A;  1KMK A;  1TOG A;  2BHX A;  2CTZ A;  4OC9 A;  3R4T A;  2VIA A;  4BQ0 A;  3KE3 A;  1LC5 A;  1S07 A;  2OAT A;  1UU0 A;  2BI2 A;  5F8V A;  2W8V A;  3AEP A;  4XJP A;  4DQ6 A;  2BI1 A;  2R5C A;  1B8G A;  4WB0 A;  1QJ3 A;  4E1O A;  1O4S A;  2KFP A;  3HMU A;  5D5S A;  1J04 A;  4JF0 A;  1OHW A;  3AEO A;  2EO5 A;  1DJE A;  1AKC A;  3AAT A;  1M32 A;  1AIA A;  2BKW A;  1WST A;  2VMO A;  4GSA A;  2W7G A;  2VGV A;  1O61 A;  4ADB A;  1QGN A;  3TAT A;  4P3M A;  3RUY A;  3K40 A;  2G7J A;  1V2D A;  3FVU A;  3NU8 A;  4K2M A;  5K8B A;  4XJL A;  3FTB A;  1DKA A;  2AY2 A;  1Z3Z A;  4OCA A;  3WKR A;  3E2Z A;  4A0G A;  2EGY A;  5BJ3 A;  1MLZ A;  1FG3 A;  1YJY A;  2VGS A;  4MKK A;  3WY7 A;  1ORD A;  3Q8N A;  1IAY A;  1ASB A;  2YKU A;  4J5U A;  3JWB A;  3BCX A;  3PGY A;  4WYG A;  3N4R A;  5KTB A;  3ISL A;  1ECX A;  3AEN B;  3LV2 A;  1T3I A;  1D7V A;  2CH1 A;  3GZC A;  1CZC A;  1YAA A;  1Z7D A;  2ZJG A;  1ARG A;  2A1V A;  2Z67 A;  1DTY A;  2YOB A;  1AX4 A;  3HDO A;  2VMQ A;  2VMX A;  3T32 A;  3A2B A;  1PMO A;  5DJ1 A;  4Y0I A;  5EFS A;  2DR1 A;  4Q31 A;  3FQ7 A;  2Z20 A;  4OTL A;  1BS0 A;  1IX6 A;  2VI9 A;  4A6R A;  5IWQ A;  2W7J A;  5E4Z A;  3GSB A;  2BI9 A;  3PA9 A;  1CL1 A;  1O62 A;  1N2T A;  3B46 A;  4MSO A;  3HL2 A;  2CJD A;  2GQN A;  2W7K A;  4RKC A;  3B1C A;  4XEW A;  1XI9 A;  2X5F A;  3HVY A;  3TCM A;  2CIN A;  4HVK A;  3FVX A;  5G09 A;  1GEX A;  1IUG A;  1ARH A;  1SF2 A;  2G6W A;  3HLM A;  3FQ8 A;  2FN6 A;  1AY8 A;  4MGR A;  4UOY A;  2Z1Y A;  2E7J A;  2HOX A;  4IW7 A;  3MAU A;  4E77 A;  1AY5 A;  2ZY4 A;  1I43 A;  4PFN A;  4N0B A;  3AEJ A;  2HOZ A;  1I29 A;  2OKK A;  3IHJ A;  4IXO A;  4LW2 A;  4GDY A;  4LNM A;  1N8P A;  4ZAH A;  2R5C B;  4MY5 A;  3NYS A;  4FFC A;  5D95 A;  3WKS A;  2HZP A;  3AEL A;  4AO4 A;  2QB2 A;  1LW4 A;  4LC3 A;  4BMK A;  5EIG A;  1BW0 A;  2JG2 A;  3GET A;  1BJW A;  1SVV A;  1KKP A;  2VMW A;  3GZD A;  3NDN A;  2BWO A;  3P6K A;  2W7E A;  4ATP A;  4K05 A;  1AMQ A;  3ELE A;  2W7I A;  1BJN A;  1GD9 A;  1BQD A;  2BI3 A;  4RAE A;  4I8A A;  4ADD A;  3H14 A;  1ASG A;  1AAM A;  1JF9 A;  1TPL A;  4QGR A;  1JS6 A;  5EUN A;  3RQ1 A;  3AEN A;  1LC7 A;  1WYV B;  2YCN A;  4KYO A;  2EZ2 A;  4N0W A;  4M2M A;  3LVJ A;  3E2Y A;  2CY8 A;  1B5O A;  3MAF B;  3MBB A;  1DGE A;  2YRI A;  3L44 A;  1H1C A;  4XJO A;  3FFH A;  1FG7 A;  3UAK A;  1E5E A;  3DC1 A;  5G2Q A;  2ZSM A;  1D7R A;  3BWN C;  4HF8 A;  3TFU A;  1C7G A;  1AIC A;  3ATH A;  3ZRR A;  1UU2 A;  1KKJ A;  2BIA A;  4IY7 A;  3AOV A;  4ZSY A;  3N4X A;  1AHF A;  1LS3 A;  1W7N A;  2TPL A;  3FZ6 A;  4ZWM A;  5EUD A;  2JJF A;  2PB0 A;  1EJI A;  1D7S A;  2VI8 A;  3HBX A;  4GE9 A;  4WYC A;  3ZRQ A;  1ASE A;  3N4S A;  4GRX A;  1MLY A;  1LK9 A;  1RVU A;  3RI6 A;  3W1I A;  3EI5 A;  4UHO A;  3D6K A;  2R2N A;  3G8M A;  1MDZ A;  1CQ8 A;  3DOD A;  3PDX A;  3ACZ A;  1WYU B;  4RIZ A;  4ITX A;  3AV7 A;  1ASM A;  4BA5 A;  3GBX A;  2DKJ A;  1S08 A;  5G4I A;  1DFO A;  4U2H A;  3EI9 A;  3OKS A;  2VIB A;  1H0C A;  4WYA A;  4UHM A;  2ZC0 A;  2E7I A;  5E3K A;  3N5M A;  3N75 A;  1S0A A;  4IX8 A;  4JE5 D;  3OP7 A;  2ZYJ A;  4ZAS A;  2W8T A;  1MAP A;  1BJO B;  3LG0 A;  4A0R A;  1C0N A;  3BCB A;  1GCK A;  2OGA A;  4XQ2 A;  4CBR A;  1DJU A;  1ZOD A;  1OAT A;  3EI6 A;  3DYD A;  3E6G A;  4OBV A;  5I92 A;  4JEX A;  1KAF A;  2EPJ A;  2Z61 A;  5FT8 A;  1AMA A;  3DZZ A;  2GMU A;  2BWN A;  1V72 A;  2HUU A;  3FZ8 A;  2AEV A;  1LKC A;  2AY8 A;  1AJS A;  4JEZ A;  5EIG B;  1G4X A;  3QGU A;  1WYV A;  2E54 A;  2VGZ A;  3FD0 A;  3I16 A;  2HOR A;  1GC2 A;  1RVY A;  1X28 A;  2BIG A;  3MAF A;  4JEY A;  3EZ1 A;  4WD2 A;  1W23 A;  4DGT A;  2EYQ A;  4F5M A;  3BWO A;  5C6U A;  2FYF A;  3ASB A;  3F6T A;  4JEV A;  1YJS A;  1AHG A;  1MDO A;  3ZZJ A;  2ORD A;  4RIT A;  4EMY A;  2WK8 A;  2Z9W A;  5G0A A;  4F5F A;  3FSL A;  4RKD A;  3PIU A;  3WZF A;  3EZS A;  4A6U A;  3EUC A;  9AAT A;  4R2N A;  1SPA A;  1B5P A;  3QHX A;  5FT6 A;  3KGW A;  5HDM A;  4TMR A;  3W1H A;  4E3R A;  2D64 A;  4WBT A;  4AZJ A;  4ZSW A;  4PFF A;  1C9C A;  4A00 A;  4AH3 A;  5BJ4 A;  4KXK A;  1YIY A;  1ASL A;  4ZDP A;  2F8J A;  2GB3 A;  2YKY A;  3CQ6 A;  2AY5 A;  4ZDL A;  2OKJ A;  4OT8 A;  2VMZ A;  1WYU A;  1X0M A;  2W8J A;  1OXP A;  3A9Y A;  3BV0 A;  3PD6 B;  3FQA A;  1Y4I A;  2AY4 A;  2FM1 A;  1AMR A;  2X5D A;  4LNL A;  1O69 A;  2FKI A;  3HQT A;  4Q6R A;  2JJE A;  3DU4 A;  3LY1 A;  5TF5 A;  3P1T A;  4AZK A;  1CJ0 A;  4LNJ A;  1YIZ A;  2V0Y A;  3A9X A;  3BN1 A;  4RLG A;  2D63 A;  4EB7 A;  3QI6 A;  2DGL A;  3EIB A;  3ZRP A;  1BJO A;  1M0O A;  1ARS A;  1PFF A;  1WKH A;  3K7Y A;  3KGX A;  4R8D A;  5G2P A;  2QSR A;  3JU7 A;  1TOK A;  4OMA A;  1DGD A;  4EFF A;  1KL2 A;  3M5U A;  3FDB A;  4F5H A;  2HUI A;  1C4K A;  5DB5 A;  3AEJ C;  2YKX A;  3ASA A;  3PPL A;  1M6S A;  2VMP A;  3FFR A;  2R5E A;  2JGT A;  1WYT B;  2HP2 A;  4IXZ A;  3NYU A;  2CJH A;  1CQ6 A;  1PMM A;  3FCR A;  1YOO A;  4ISY A;  2FNI A;  3CQ4 A;  3FKD A;  4F5G A;  1SZU A;  1I41 A;  1U08 A;  2BYL A;  3BB8 A;  4Q76 A;  2VLF A;  3COG A;  3DXW A;  4RJY A;  3RCH B;  1TOJ A;  2DGM A;  3NUI A;  4ZLV A;  3GZD C;  4CXR A;  3USF A;  2W7H A;  2V1P A;  1X29 A;  1AJS B;  4H51 A;  4WXB A;  1M4N A;  1GC4 A;  4P7Y A;  1J32 A;  4W1W A;  4BA4 A;  3JTX A;  1WKG A;  3PDB B;  3JWA A;  3CBF A;  1CZE A;  1G7W A;  2VGT A;  4TV7 A;  4W8I A;  3RBF A;  1ASC A;  2VYC A;  1SZK A;  2XH1 A;  4Y0D A;  4UQV A;  4W91 A;  3QM2 A;  4E3Q A;  2EZ1 A;  3QPG A;  1TOI A;  2C81 A;  5DJ9 A;  1RV4 A;  3K28 A;  1P3W A;  1VJO A;  3NUB A;  3QN6 A;  4AOA A;  5M46 A;  2JIS A;  3GR9 A;  1CQ7 A;  1SFF A;  2VMR A;  3H9X A;  2CJG A;  1M0N A;  2VMV A;  4EU1 A;  3AEM A;  2VMS A;  4Y0H A;  1OHY A;  2Z9V A;  1ELQ A;  4L0O A;  7AAT A;  3NNK A;  1GDE A;  3BS8 A;  3PD6 A;  3E9K A;  4J8L A;  2PB2 A; 
#chains in the Genus database with same CATH homology
 1OHV A;  4M2K A;  2VMU A;  3JZL A;  4GE7 A;  1M0P A;  4W5K A;  2C7T A;  4WYD A;  2YCT A;  3VAX A;  3B8X A;  2Z9X A;  3WGC A;  1MAQ A;  1S06 A;  2CST A;  4ITG A;  2Z1Z A;  4JEW A;  2D7Y A;  1B4X A;  2YCP A;  2AY1 A;  4PVF A;  4AO9 A;  1TOE A;  5EUE A;  4ATQ A;  1BT4 A;  3MEB A;  5FT5 A;  2YKV A;  1IVR A;  3ELP A;  1LC8 A;  2BYJ A;  2CB1 A;  3KKI A;  3L8A A;  4WP0 A;  3UE8 A;  1C7O A;  3EI7 A;  3MAD A;  1E5F A;  3FRK A;  1G7X A;  1IJI A;  3VK3 A;  2BWP A;  1WYT A;  3A9Z A;  1IAX A;  4MQR A;  1GC3 A;  2Q7W A;  2AY9 A;  3CAI A;  3WGB A;  1IX7 A;  2ZSL A;  3MC6 A;  3PAA A;  4IXS A;  1AMS A;  1QZ9 A;  2CFB A;  2VGU A;  2XBN A;  3NYT A;  3QBO A;  3RCH A;  1SZS A;  3DR4 A;  4XAU A;  4ADE A;  3TFT A;  2DGK A;  1W7M A;  1ASN A;  1N31 A;  1VP4 A;  3LWS A;  2VLH A;  4F5K A;  3W1J A;  3FZ7 A;  1LW5 A;  1MDX A;  1XEY A;  1AJR A;  4K2B A;  2ZUK A;  4R5Z A;  4WLJ A;  3PDB A;  4A0F A;  1JS3 A;  2OQX A;  1QIT A;  2AY3 A;  1B9H A;  2DOU A;  2R0T A;  3HT4 A;  4WXF A;  1GC0 A;  4B98 A;  2W7M A;  5EAV A;  3JW9 A;  3LVK A;  1FC4 A;  1IX8 A;  1QJ5 A;  2FNU A;  4MQQ A;  3E77 A;  1EQB A;  3LVM A;  1DJ9 A;  3NTJ A;  4RM1 A;  1S09 A;  1ELU A;  4W1X A;  5M4B A;  1I48 A;  4GEB A;  1CL2 A;  3F9T A;  4BHD A;  2QB3 A;  2PO3 A;  5HXX A;  1AIB A;  1AHY A;  5HHY A;  3NRA A;  2EH6 A;  4TN4 A;  1UU1 A;  1YNU A;  1V2F A;  4PIW A;  4A72 A;  2AY6 A;  1TAR A;  4U1T A;  5J8Q A;  2ZY2 A;  3ZZK A;  2NMP A;  2WK7 A;  2VMT A;  1MGV A;  2HOY A;  4NOG A;  5DX5 A;  2X3L A;  5F9S A;  4H63 Q;  3CQ5 A;  1X2A A;  1IBJ A;  1OXO A;  5JAY A;  2O1B A;  2JJH A;  3B1E A;  3BCA A;  2AAT A;  1KL1 A;  2QBT A;  3NX3 A;  2BI5 A;  4JE5 A;  3FVS A;  4MKJ A;  2GMS A;  2C0R A;  5FT4 A;  5G4J A;  3VK2 A;  4IYO B;  1ASA A;  4XJM A;  1AY4 A;  3LVL B;  4O6Z A;  2W7L A;  2D66 A;  1M7Y A;  2D7Z A;  1AHE A;  3H7F A;  3A8U X;  2VGW A;  3R9A A;  3FDD A;  1ASD A;  3VK4 A;  1BKG A;  1ASF A;  1QIS A;  1AAW A;  2O7C A;  1AKB A;  4R5F A;  4RJ0 A;  1BQA A;  1ART A;  4A0H A;  3PJ0 A;  4M2J A;  4ZM4 A;  4DBC A;  1B9I A;  1UKJ A;  2Z9U A;  4FL0 A;  5LHA A;  2VMY A;  2FQ6 A;  4WYF A;  3DR7 A;  3WCN A;  3EI8 A;  2O0R A;  1D2F A;  2HP1 A;  2W7F A;  1EG5 A;  4LW4 A;  1V2E A;  4UHN A;  5M49 A;  2YHK A;  1VEF A;  3BC8 A;  4WLH A;  1GEW A;  2W7D A;  4OYT A;  3WLX A;  2AEU A;  5EAA A;  5M4D A;  3F0H A;  4ADC A;  1RV3 A;  2GSA A;  3II0 A;  1M0Q A;  4K2I A;  1JG8 A;  3G7Q A;  1GEY A;  2VMN A;  1ZOB A;  3I4J A;  4WB0 B;  4F5I A;  3TQX A;  4ZDO A;  3B1D A;  3UWC A;  3IF2 A;  1GBN A;  1D7U A;  2WKA A;  4MQP A;  3GJU A;  2JJG A;  3MKJ A;  4F5J A;  2CH2 A;  3I5T A;  2QMA A;  3DXV A;  2ZY3 A;  3N0L A;  2D5Y A;  2E7U A;  1ARI A;  4OBU A;  5AX8 A;  3AEM C;  4WYE A;  5EQC A;  4B9B A;  4ZM3 A;  1AHX A;  3E2Z B;  2ZY5 A;  4KAM A;  2C44 A;  3E2F A;  4F4E A;  1QIR A;  2W8U A;  1YJZ A;  3DRD A;  3GWP A;  3WX9 A;  3RBL A;  2ZP7 A;  3BWN A;  4IYO A;  2X8U A;  4F5L A;  5E5I A;  1CS1 A;  2RFV A;  4WXG A;  4XK1 A;  3N7N A;  4W1V A;  1W3U A;  1W7L A;  2D61 A;  1PG8 A;  4CBS A;  8AAT A;  4EB5 A;  3ECD A;  4GE4 A;  3VP6 A;  4JF1 A;  1BJ4 A;  3VOM A;  2QLR A;  2QA3 A;  1KMJ A;  2D65 A;  2DKB A;  4A6T A;  2WB6 A;  3G0T A;  1AKA A;  2WK9 A;  4CVQ A;  2OGE A;  1ZC9 A;  1TAS A;  1C7N A;  1TAT A;  2CAN A;  2W8W A;  5LH9 A;  3WCO A;  4CXQ A;  4Q75 A;  2BIE A;  3NU7 A;  2YRR A;  2AY7 A;  3MC6 C;  3AOW A;  1G4V A;  4ZWV A;  3EIA A;  2HUF A;  1KMK A;  1TOG A;  2BHX A;  2CTZ A;  4OC9 A;  3R4T A;  2VIA A;  4BQ0 A;  3KE3 A;  1LC5 A;  1S07 A;  2OAT A;  1UU0 A;  2BI2 A;  5F8V A;  2W8V A;  3AEP A;  4XJP A;  4DQ6 A;  2BI1 A;  2R5C A;  1B8G A;  4WB0 A;  1QJ3 A;  4E1O A;  1O4S A;  2KFP A;  3HMU A;  5D5S A;  1J04 A;  4JF0 A;  1OHW A;  3AEO A;  2EO5 A;  1DJE A;  1AKC A;  3AAT A;  1M32 A;  1AIA A;  2BKW A;  1WST A;  2VMO A;  4GSA A;  2W7G A;  2VGV A;  1O61 A;  4ADB A;  1QGN A;  3TAT A;  4P3M A;  3RUY A;  3K40 A;  2G7J A;  1V2D A;  3FVU A;  3NU8 A;  4K2M A;  5K8B A;  4XJL A;  3FTB A;  1DKA A;  2AY2 A;  1Z3Z A;  4OCA A;  3WKR A;  3E2Z A;  4A0G A;  2EGY A;  5BJ3 A;  1MLZ A;  1FG3 A;  1YJY A;  2VGS A;  4MKK A;  3WY7 A;  1ORD A;  3Q8N A;  1IAY A;  1ASB A;  2YKU A;  4J5U A;  3JWB A;  3BCX A;  3PGY A;  4WYG A;  3N4R A;  5KTB A;  3ISL A;  1ECX A;  3AEN B;  3LV2 A;  1T3I A;  1D7V A;  2CH1 A;  3GZC A;  1CZC A;  1YAA A;  1Z7D A;  2ZJG A;  1ARG A;  2A1V A;  2Z67 A;  1DTY A;  2YOB A;  1AX4 A;  3HDO A;  2VMQ A;  2VMX A;  3T32 A;  3A2B A;  1PMO A;  5DJ1 A;  4Y0I A;  5EFS A;  2DR1 A;  4Q31 A;  3FQ7 A;  2Z20 A;  4OTL A;  1BS0 A;  1IX6 A;  2VI9 A;  4A6R A;  5IWQ A;  2W7J A;  5E4Z A;  3GSB A;  2BI9 A;  3PA9 A;  1CL1 A;  1O62 A;  1N2T A;  3B46 A;  4MSO A;  3HL2 A;  2CJD A;  2GQN A;  2W7K A;  4RKC A;  3B1C A;  4XEW A;  1XI9 A;  2X5F A;  3HVY A;  3TCM A;  2CIN A;  4HVK A;  3FVX A;  5G09 A;  1GEX A;  1IUG A;  1ARH A;  1SF2 A;  2G6W A;  3HLM A;  3FQ8 A;  2FN6 A;  1AY8 A;  4MGR A;  4UOY A;  2Z1Y A;  2E7J A;  2HOX A;  4IW7 A;  3MAU A;  4E77 A;  1AY5 A;  2ZY4 A;  1I43 A;  4PFN A;  4N0B A;  3AEJ A;  2HOZ A;  1I29 A;  2OKK A;  3IHJ A;  4IXO A;  4LW2 A;  4GDY A;  4LNM A;  1N8P A;  4ZAH A;  2R5C B;  4MY5 A;  3NYS A;  4FFC A;  5D95 A;  3WKS A;  2HZP A;  3AEL A;  4AO4 A;  2QB2 A;  1LW4 A;  4LC3 A;  4BMK A;  5EIG A;  1BW0 A;  2JG2 A;  3GET A;  1BJW A;  1SVV A;  1KKP A;  2VMW A;  3GZD A;  3NDN A;  2BWO A;  3P6K A;  2W7E A;  4ATP A;  4K05 A;  1AMQ A;  3ELE A;  2W7I A;  1BJN A;  1GD9 A;  1BQD A;  2BI3 A;  4RAE A;  4I8A A;  4ADD A;  3H14 A;  1ASG A;  1AAM A;  1JF9 A;  1TPL A;  4QGR A;  1JS6 A;  5EUN A;  3RQ1 A;  3AEN A;  1LC7 A;  1WYV B;  2YCN A;  4KYO A;  2EZ2 A;  4N0W A;  4M2M A;  3LVJ A;  3E2Y A;  2CY8 A;  1B5O A;  3MAF B;  3MBB A;  1DGE A;  2YRI A;  3L44 A;  1H1C A;  4XJO A;  3FFH A;  1FG7 A;  3UAK A;  1E5E A;  3DC1 A;  5G2Q A;  2ZSM A;  1D7R A;  3BWN C;  4HF8 A;  3TFU A;  1C7G A;  1AIC A;  3ATH A;  3ZRR A;  1UU2 A;  1KKJ A;  2BIA A;  4IY7 A;  3AOV A;  4ZSY A;  3N4X A;  1AHF A;  1LS3 A;  1W7N A;  2TPL A;  3FZ6 A;  4ZWM A;  5EUD A;  2JJF A;  2PB0 A;  1EJI A;  1D7S A;  2VI8 A;  3HBX A;  4GE9 A;  4WYC A;  3ZRQ A;  1ASE A;  3N4S A;  4GRX A;  1MLY A;  1LK9 A;  1RVU A;  3RI6 A;  3W1I A;  3EI5 A;  4UHO A;  3D6K A;  2R2N A;  3G8M A;  1MDZ A;  1CQ8 A;  3DOD A;  3PDX A;  3ACZ A;  1WYU B;  4RIZ A;  4ITX A;  3AV7 A;  1ASM A;  4BA5 A;  3GBX A;  2DKJ A;  1S08 A;  5G4I A;  1DFO A;  4U2H A;  3EI9 A;  3OKS A;  2VIB A;  1H0C A;  4WYA A;  4UHM A;  2ZC0 A;  2E7I A;  5E3K A;  3N5M A;  3N75 A;  1S0A A;  4IX8 A;  4JE5 D;  3OP7 A;  2ZYJ A;  4ZAS A;  2W8T A;  1MAP A;  1BJO B;  3LG0 A;  4A0R A;  1C0N A;  3BCB A;  1GCK A;  2OGA A;  4XQ2 A;  4CBR A;  1DJU A;  1ZOD A;  1OAT A;  3EI6 A;  3DYD A;  3E6G A;  4OBV A;  5I92 A;  4JEX A;  2EPJ A;  2Z61 A;  5FT8 A;  1AMA A;  3DZZ A;  2GMU A;  2BWN A;  1V72 A;  2HUU A;  3FZ8 A;  2AEV A;  1LKC A;  2AY8 A;  1AJS A;  4JEZ A;  5EIG B;  1G4X A;  3QGU A;  1WYV A;  2E54 A;  2VGZ A;  3FD0 A;  3I16 A;  2HOR A;  1GC2 A;  1RVY A;  1X28 A;  2BIG A;  3MAF A;  4JEY A;  3EZ1 A;  4WD2 A;  1W23 A;  4DGT A;  2EYQ A;  4F5M A;  3BWO A;  5C6U A;  2FYF A;  3ASB A;  3F6T A;  4JEV A;  1YJS A;  1AHG A;  1MDO A;  3ZZJ A;  2ORD A;  4RIT A;  4EMY A;  2WK8 A;  2Z9W A;  5G0A A;  4F5F A;  3FSL A;  4RKD A;  3PIU A;  3WZF A;  3EZS A;  4A6U A;  3EUC A;  9AAT A;  4R2N A;  1SPA A;  1B5P A;  3QHX A;  5FT6 A;  3KGW A;  5HDM A;  4TMR A;  3W1H A;  4E3R A;  2D64 A;  4WBT A;  4AZJ A;  4ZSW A;  4PFF A;  1C9C A;  4A00 A;  4AH3 A;  5BJ4 A;  4KXK A;  1YIY A;  1ASL A;  4ZDP A;  2F8J A;  2GB3 A;  2YKY A;  3CQ6 A;  2AY5 A;  4ZDL A;  2OKJ A;  4OT8 A;  2VMZ A;  1WYU A;  1X0M A;  2W8J A;  1OXP A;  3A9Y A;  3BV0 A;  3PD6 B;  3FQA A;  1Y4I A;  2AY4 A;  2FM1 A;  1AMR A;  2X5D A;  4LNL A;  1O69 A;  2FKI A;  3HQT A;  4Q6R A;  2JJE A;  3DU4 A;  3LY1 A;  5TF5 A;  3P1T A;  4AZK A;  1CJ0 A;  4LNJ A;  1YIZ A;  2V0Y A;  3A9X A;  3BN1 A;  4RLG A;  2D63 A;  4EB7 A;  3QI6 A;  2DGL A;  3EIB A;  3ZRP A;  1BJO A;  1M0O A;  1ARS A;  1PFF A;  1WKH A;  3K7Y A;  3KGX A;  4R8D A;  5G2P A;  2QSR A;  3JU7 A;  1TOK A;  4OMA A;  1DGD A;  4EFF A;  1KL2 A;  3M5U A;  3FDB A;  4F5H A;  2HUI A;  1C4K A;  5DB5 A;  3AEJ C;  2YKX A;  3ASA A;  3PPL A;  1M6S A;  2VMP A;  3FFR A;  2R5E A;  2JGT A;  1WYT B;  2HP2 A;  4IXZ A;  3NYU A;  2CJH A;  1CQ6 A;  1PMM A;  3FCR A;  1YOO A;  4ISY A;  2FNI A;  3CQ4 A;  3FKD A;  4F5G A;  1SZU A;  1I41 A;  1U08 A;  2BYL A;  3BB8 A;  4Q76 A;  2VLF A;  3COG A;  3DXW A;  4RJY A;  3RCH B;  1TOJ A;  2DGM A;  3NUI A;  4ZLV A;  3GZD C;  4CXR A;  3USF A;  2W7H A;  2V1P A;  1X29 A;  1AJS B;  4H51 A;  4WXB A;  1M4N A;  1GC4 A;  4P7Y A;  1J32 A;  4W1W A;  4BA4 A;  3JTX A;  1WKG A;  3PDB B;  3JWA A;  3CBF A;  1CZE A;  1G7W A;  2VGT A;  4TV7 A;  4W8I A;  3RBF A;  1ASC A;  2VYC A;  1SZK A;  2XH1 A;  4Y0D A;  4UQV A;  4W91 A;  3QM2 A;  4E3Q A;  2EZ1 A;  3QPG A;  1TOI A;  2C81 A;  5DJ9 A;  1RV4 A;  3K28 A;  1P3W A;  1VJO A;  3NUB A;  3QN6 A;  4AOA A;  5M46 A;  2JIS A;  3GR9 A;  1CQ7 A;  1SFF A;  2VMR A;  3H9X A;  2CJG A;  1M0N A;  2VMV A;  4EU1 A;  3AEM A;  2VMS A;  4Y0H A;  1OHY A;  2Z9V A;  1ELQ A;  4L0O A;  7AAT A;  3NNK A;  1GDE A;  3BS8 A;  3PD6 A;  3E9K A;  4J8L A;  2PB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...