3ZRRA

Crystal structure and substrate specificity of a thermophilic archaeal serine : pyruvate aminotransferase from sulfolobus solfataricus
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
379
structure length
379
Chain Sequence
LLHVGPTTIKEDVLVAGLENNVGFTSKEFVEALAYSLKGLRYVMGASKNYQPLIIPGGGTSAMESVTSLLKPNDKILVVSNGVFGDRWEQIFKRYPVNVKVLRPSPGDYVKPGEVEEEVRKSEYKLVALTHVETSTGVREPVKDVINKIRKYVELIVVDGVSSVGAEEVKAEEWNVDVYLTASQKALGSAAGLGLLLLSPKALSILDSQNSIAGYYLDLRNWLPVMRGAEEGKAAYFATPPVHVILQLAEAFRLIEKEGIENRIKRHTMVASAIRAGLEALGLEIVARRPESYSNTVTGVILKVADPQKVLAGTVNEGVEFAPGVHPAFKYFRIGHMGWVTPNDAIIAISVIERTLRKLGEPIRFGEGVKAVEEVLFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Substrate Specificity of the Thermophilic Serine:Pyruvate Aminotransferase from Sulfolobus Solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords SERINE-PYRUVATE AMINOTRANSFERASE (AGXT)
total genus 138
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 2.6.1.51: Serine--pyruvate transaminase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3zrrA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3zrrA02
1UU0A 3HMUA 4M2MA 3E2ZA 3AEPA 2DGKA 3CQ6A 4XQ2A 2C0RA 3A9ZA 1AJSB 1BW0A 3G8MA 4HVKA 1AHYA 3QI6A 3BN1A 1EJIA 1BJWA 2VGWA 1QZ9A 2YCTA 2YKYA 1ORDA 2WK8A 3JTXA 2C7TA 4WYCA 1P3WA 2VMOA 1OHWA 3KGXA 3PD6B 4WB0A 3T32A 4F5GA 3A9YA 1BJ4A 1TASA 2Z1ZA 2ZUKA 1WYUA 1XI9A 4WXFA 1ARIA 4RJ0A 3PDBA 3F0HA 2W7JA 4A72A 1EG5A 4A0RA 1MLYA 1AMRA 4NOGA 3G0TA 2ZY5A 4IYOB 1O4SA 1ARHA 2AY8A 2CJDA 3FTBA 4W91A 4IX8A 1W7LA 3R4TA 4GRXA 1IX8A 5DX5A 2XH1A 1AAMA 2AY7A 4ZM3A 1D7SA 3COGA 4RM1A 3ZZJA 1G7WA 1G7XA 4XAUA 4JF0A 2ZY2A 1ELUA 3TCMA 1C0NA 4EMYA 1DKAA 3NYTA 1QJ5A 4WBTA 3FZ8A 4JEVA 3ECDA 2F8JA 2OATA 2ZSMA 3B1CA 1ASEA 1V2EA 1G4VA 2D5YA 2D63A 3D6KA 4A6UA 4IXOA 1VJOA 1CL1A 2CH1A 1T3IA 4QGRA 3WGCA 1MDXA 2JJFA 4CXRA 3RI6A 4CVQA 2VMRA 2E54A 2AEVA 1S08A 2VMXA 1Y4IA 4JE5D 3WLXA 4MY5A 2FNUA 4M2KA 4U1TA 2V1PA 4JEYA 2JJHA 3FZ6A 2X5FA 3EI6A 5FT8A 1B9HA 4BA5A 3NRAA 4XK1A 5G2QA 1KKJA 3HT4A 1MDOA 2JJEA 4ZSYA 1OXPA 4AO9A 4R2NA 1M0NA 4W5KA 3GZDA 3QBOA 4E3QA 5TF5A 3LV2A 4M2JA 3RBLA 3VP6A 3FVUA 5BJ4A 2BIAA 4W1XA 4WLHA 4ATPA 2D7ZA 3VOMA 3AATA 1MAPA 4UHMA 7AATA 2HUUA 1N31A 1V2FA 1M32A 3K7YA 3ZRQA 3JWBA 5F8VA 4K2MA 2DGMA 2HUFA 3GBXA 4UOYA 4WXGA 1BT4A 4WYGA 3MBBA 2EO5A 3PAAA 2D61A 4TMRA 3NNKA 3DR7A 3II0A 4MKJA 2FYFA 1AY5A 5JAYA 5EIGA 1M0QA 2Z67A 3VK2A 1PMOA 2Z1YA 4LNMA 2R5CB 1CQ8A 3JW9A 4FL0A 4LW4A 4OBUA 4BQ0A 1ECXA 1S06A 3H7FA 1WKHA 3BWOA 3KKIA 1M0PA 2Z20A 3EI9A 3EZSA 4XJPA 2JJGA 4ISYA 4BHDA 1GEWA 5HHYA 3BS8A 3P1TA 2YCNA 1TOKA 2W7EA 1ASLA 2W7LA 2AY3A 4ITGA 2OQXA 3QPGA 4F5HA 1QIRA 3BC8A 4R8DA 3LY1A 2VI8A 3UE8A 4PVFA 3FSLA 3IHJA 1C7OA 1DTYA 1IAYA 1SZSA 2ZJGA 3A2BA 2FNIA 3ZRRA 3OKSA 2DGLA 3BB8A 4A0FA 3H14A 3DXVA 3CQ4A 2V0YA 4JEWA 3B1DA 2OKJA 3MADA 4LC3A 3TQXA 1Z7DA 4ZWVA 1DJUA 2YOBA 4RKDA 1YJYA 2W8WA 2CANA 1DFOA 4EU1A 5BJ3A 1BJOA 1DGEA 4ZDPA 1O62A 2W8VA 9AATA 5D95A 3PIUA 3DU4A 2ZSLA 3HVYA 3MC6A 2D66A 5EUEA 2W7DA 3DYDA 4R5ZA 1TARA 1X28A 2PB2A 3L8AA 3TATA 1AKAA 3AEJA 4ZDLA 1IVRA 3ZZKA 4EB7A 3FD0A 1M7YA 3N75A 4XJLA 3ASAA 1V2DA 1SPAA 2JISA 3EI7A 1TPLA 3PDXA 4LNLA 2QB3A 1J04A 1JS3A 2Z9XA 4JEZA 4Q6RA 4WYAA 1I43A 5I92A 2BHXA 3P6KA 3BV0A 2Z61A 1YOOA 1M0OA 3NYSA 2VMYA 3MAFB 2YKVA 1MLZA 4E77A 4ZASA 1X29A 2C44A 2VMNA 3WX9A 3WZFA 4GSAA 3GSBA 1XEYA 5G4IA 2YHKA 3GR9A 4K2BA 2YCPA 1ARGA 3LWSA 4F5JA 4GEBA 3RCHB 1AAWA 4W1WA 1IX6A 4IY7A 1AMAA 1J32A 4HF8A 4BA4A 3EZ1A 1RV4A 2W7GA 1AKBA 4A0GA 3GZDC 1DJ9A 5DJ1A 4PFFA 2JG2A 1I41A 2Q7WA 4OC9A 2TPLA 3NU8A 1ASNA 4Y0HA 3LVKA 3QGUA 1JF9A 3GJUA 3CQ5A 4A00A 3F6TA 2QB2A 2W8TA 2BYJA 1OHVA 1GC4A 2WKAA 3QM2A 5EQCA 3DZZA 2XBNA 1AX4A 4PIWA 3ACZA 1CL2A 1D7RA 1S0AA 2HP1A 4B98A 4DBCA 3E9KA 3VK4A 3WGBA 4Q76A 2AY2A 3AEMC 2GMSA 2QA3A 4PFNA 3AOVA 3VK3A 1ELQA 3A8UX 3MKJA 2Z9WA 4LW2A 3FVXA 1GD9A 4Q31A 1I29A 4MQQA 3WY7A 1TOJA 5K8BA 3PA9A 3HDOA 1D7VA 1E5EA 2WK7A 3E2YA 4E3RA 2VMQA 1FC4A 2HOYA 1PFFA 1QJ3A 1SF2A 2ZYJA 1ARTA 2VYCA 4EB5A 2BIGA 4TN4A 2HOZA 2OGEA 4WLJA 3AEMA 2JGTA 2BI3A 4E1OA 1D7UA 5HXXA 4Y0IA 3FRKA 1QISA 3PD6A 5M4DA 2W8JA 4U2HA 4EFFA 1QITA 1ARSA 1ZODA 3G7QA 1IJIA 1FG3A 2WK9A 2VIAA 3FQAA 3W1JA 2BYLA 1M6SA 3LVMA 2BI1A 3RUYA 2VMWA 4AO4A 5LHAA 1YAAA 1B5PA 5C6UA 1SZKA 2CY8A 2R2NA 2YRRA 2D7YA 2NMPA 4UHOA 5F9SA 3E77A 3FFHA 1LKCA 2VMVA 2G6WA 1WSTA 1CZEA 2YRIA 3BCAA 4N0BA 3RCHA 2OKKA 1AY8A 4GE7A 3TFTA 1AIAA 1IUGA 3HL2A 1VEFA 4ZWMA 1S09A 4P7YA 2O1BA 4O6ZA 1KMJA 2GMUA 3KE3A 2BIEA 5G09A 2GSAA 2FQ6A 3FFRA 4ADCA 1WYVA 4Q75A 4F4EA 4W1VA 4AOAA 2VMTA 4ATQA 3F9TA 4WD2A 4JE5A 2YKUA 5IWQA 1W23A 1JS6A 1EQBA 4R5FA 3ELPA 4ZSWA 1YIYA 4CBSA 4TV7A 4AZKA 2AY5A 3EIAA 5G4JA 1O61A 2R5EA 1ASCA 1UKJA 4P3MA 1FG7A 1YJSA 1ASFA 4ADEA 5FT6A 1LK9A 2VGSA 4AH3A 2PO3A 2VGZA 1RV3A 2W8UA 3FZ7A 3DRDA 1DGDA 5FT4A 3MC6C 1G4XA 3QHXA 1O69A 2BWNA 1ZC9A 1CJ0A 3JU7A 3AEJC 4LNJA 4JEXA 5EAVA 3N5MA 2D64A 4XJMA 1TATA 1W7MA 4MKKA 4OBVA 1LC8A 3KGWA 2PB0A 1KL2A 3FVSA 1TOIA 5EUNA 3L44A 1CZCA 1W7NA 1BJOB 2C81A 3EI8A 1BJNA 3E6GA 1AJSA 1BS0A 1OATA 2AY6A 5EFSA 1RVUA 2CFBA 4J8LA 3FDDA 4MGRA 4GE9A 1ASGA 4F5LA 2VMZA 5J8QA 3B46A 2X5DA 1AHEA 1B8GA 1MGVA 3A9XA 3HBXA 4DQ6A 2DOUA 1N2TA 2D65A 2ZY3A 1WYTA 1IBJA 5EUDA 2CJHA 4RJYA 1SZUA 1W3UA 2DKJA 2VGUA 3EI5A 3FCRA 3NUIA 4WXBA 5LH9A 2VLHA 2W7FA 2QLRA 1ZOBA 2EGYA 3AENB 3NU7A 1ASAA 5EAAA 4AZJA 3ATHA 3JZLA 1AHGA 3LVJA 4IXZA 2AEUA 4KAMA 1GDEA 3BWNC 1PMMA 1I48A 1GEYA 2DKBA 4ADDA 2EPJA 1AHFA 3N0LA 4ITXA 4ZM4A 2W7MA 2HUIA 3NYUA 4MSOA 2O7CA 2E7UA 3NDNA 2VGTA 1WYVB 4ZAHA 3AV7A 3FQ8A 5M49A 4RKCA 2FM1A 3E2ZB 3VAXA 4WP0A 1V72A 2O0RA 1RVYA 2VMPA 2ZC0A 2E7IA 3ELEA 2BWPA 2YKXA 5EIGB 3JWAA 3BWNA 5D5SA 2VI9A 4JF1A 3I4JA 3WCOA 4RIZA 2W7HA 3I5TA 1TOEA 4BMKA 2ORDA 1S07A 1LW5A 2R0TA 1AJRA 1GC0A 5HDMA 3BCBA 2ZP7A 3CBFA 1SVVA 4GE4A 4WB0B 4DGTA 2X8UA 3AOWA 1C7GA 3DODA 1AKCA 4XJOA 4F5IA 1YIZA 3ASBA 5DJ9A 4ZLVA 1MDZA 2GQNA 4RITA 4UQVA 2Z9UA 3BCXA 3USFA 3MAFA 4IYOA 1H1CA 2AY1A 1UU2A 3ZRPA 1B4XA 1C9CA 2HOXA 3HQTA 2OGAA 3WCNA 1H0CA 1QGNA 2VGVA 1AMQA 1AMSA 3AEOA 3K28A 2CTZA 1IX7A 3W1IA 3M5UA 4GDYA 2BKWA 4ADBA 3AELA 1CQ7A 2CJGA 3LVLB 1ASBA 1GCKA 4I8AA 1ASDA 4XEWA 1BKGA 3E2FA 3NUBA 1BQAA 3PJ0A 1C4KA 2BI5A 4RLGA 2W7IA 3CAIA 3EUCA 3PGYA 4OCAA 2HP2A 1E5FA 5G0AA 5G2PA 1C7NA 1WYTB 2EH6A 2R5CA 3TFUA 4KXKA 2VMUA 1B5OA 4B9BA 3UWCA 1AICA 4CBRA 2AY4A 1ASMA 3OP7A 1Z3ZA 1D2FA 4OT8A 3GZCA 1UU1A 2BI2A 1M4NA 1YJZA 3AENA 4F5FA 1WYUB 3NTJA 4Y0DA 3WKSA 1YNUA 1AHXA 3PDBB 4OYTA 1KL1A 2AY9A 1GC3A 1X2AA 2EZ1A 2DR1A 3B8XA 4MQRA 4OTLA 4A6TA 3EIBA 1DJEA 2CH2A 8AATA 1LC7A 3NX3A 4F5MA 3FQ7A 3W1HA 4J5UA 3DR4A 1OXOA 4F5KA 3UAKA 1GBNA 2QMAA 3FKDA 2EZ2A 1AIBA 4A6RA 3I16A 1KKPA 1BQDA 3K40A 3B1EA 1B9IA 3PPLA 4A0HA 4KYOA 2VIBA 2AATA 1PG8A 1IAXA 2BI9A 1WKGA 2Z9VA 4IXSA 3MEBA 1U08A 5AX8A 1LW4A 5DB5A 2HORA 2E7JA 4K2IA 1JG8A 2FN6A 1LC5A 3HLMA 3ISLA 2BWOA 1X0MA 4FFCA 4IW7A 4MQPA 3MAUA 3GWPA 2GB3A 1TOGA 2RFVA 1CQ6A 2HZPA 3DXWA 2VLFA 1LS3A 3R9AA 1GEXA 3FDBA 3LG0A 3DC1A 1CS1A 4OMAA 5E3KA 1KMKA 4ZDOA 4L0OA 3RQ1A 5M46A 2QBTA 4UHNA 1OHYA 5E4ZA 1AY4A 4W8IA 4WYEA 3RBFA 4CXQA 2CSTA 3QN6A 3IF2A 2ZY4A 1MAQA 3GETA 2VMSA 4N0WA 5E5IA 2X3LA 3Q8NA 3WKRA 4H51A 2CINA 4RAEA 1VP4A 2CB1A 1GC2A 5FT5A 5M4BA 4WYFA 1SFFA 1N8PA 2W7KA 4WYDA
chains in the Genus database with same CATH superfamily
1UU0A 3HMUA 4M2MA 3E2ZA 3AEPA 2DGKA 3CQ6A 4XQ2A 2C0RA 3A9ZA 1AJSB 1BW0A 3G8MA 4HVKA 1AHYA 3QI6A 3BN1A 1EJIA 1BJWA 2VGWA 1QZ9A 2YCTA 2YKYA 1ORDA 2WK8A 3JTXA 2C7TA 4WYCA 1P3WA 2VMOA 1OHWA 3KGXA 3PD6B 4WB0A 3T32A 4F5GA 3A9YA 1BJ4A 1TASA 2Z1ZA 2ZUKA 1WYUA 1XI9A 4WXFA 1ARIA 4RJ0A 3PDBA 3F0HA 2W7JA 4A72A 1EG5A 4A0RA 1MLYA 1AMRA 4NOGA 3G0TA 2ZY5A 4IYOB 1O4SA 1ARHA 2AY8A 2CJDA 3FTBA 4W91A 4IX8A 1W7LA 3R4TA 4GRXA 1IX8A 5DX5A 2XH1A 1AAMA 2AY7A 4ZM3A 1D7SA 3COGA 2G7JA 4RM1A 3ZZJA 1G7WA 1G7XA 2WB6A 4XAUA 4JF0A 2ZY2A 1ELUA 3TCMA 1C0NA 4EMYA 1DKAA 3NYTA 1QJ5A 4WBTA 3FZ8A 4JEVA 3ECDA 3N4RA 2F8JA 2OATA 2ZSMA 3B1CA 1ASEA 1V2EA 1G4VA 2D5YA 2D63A 3D6KA 4A6UA 4IXOA 1VJOA 1CL1A 2CH1A 1T3IA 4QGRA 3WGCA 1MDXA 2JJFA 4CXRA 3RI6A 4CVQA 2VMRA 2E54A 2AEVA 1S08A 2VMXA 1Y4IA 4JE5D 3WLXA 4MY5A 2FNUA 4M2KA 4U1TA 2V1PA 4JEYA 2JJHA 3FZ6A 2X5FA 3EI6A 5FT8A 1B9HA 4BA5A 3NRAA 4XK1A 5G2QA 1KKJA 3HT4A 1MDOA 2JJEA 4ZSYA 1OXPA 4AO9A 4R2NA 1M0NA 4W5KA 3GZDA 3QBOA 4E3QA 5TF5A 3LV2A 4M2JA 3RBLA 3VP6A 3FVUA 5BJ4A 2BIAA 4W1XA 4WLHA 4ATPA 2D7ZA 3VOMA 3AATA 1MAPA 4UHMA 7AATA 2HUUA 1N31A 1V2FA 1M32A 3K7YA 3ZRQA 3JWBA 5F8VA 5KTBA 4K2MA 2DGMA 2HUFA 3GBXA 4UOYA 2FKIA 4WXGA 1BT4A 4WYGA 2EYQA 3MBBA 2EO5A 3PAAA 2D61A 4TMRA 3NNKA 3DR7A 3II0A 4MKJA 2KFPA 2FYFA 1AY5A 5JAYA 5EIGA 1M0QA 2Z67A 3VK2A 1PMOA 2Z1YA 4LNMA 2R5CB 1CQ8A 3JW9A 4FL0A 4LW4A 4OBUA 4BQ0A 1ECXA 1S06A 3H7FA 1WKHA 3BWOA 3KKIA 1M0PA 2Z20A 3EI9A 3EZSA 4XJPA 2JJGA 4ISYA 4BHDA 1GEWA 5HHYA 3BS8A 3P1TA 2YCNA 1TOKA 2W7EA 1ASLA 2W7LA 2AY3A 4ITGA 2OQXA 3QPGA 4F5HA 1QIRA 3BC8A 4R8DA 3LY1A 2VI8A 3UE8A 4PVFA 3FSLA 3IHJA 1C7OA 1DTYA 1IAYA 1SZSA 2ZJGA 3A2BA 2FNIA 3ZRRA 3OKSA 2DGLA 3BB8A 4A0FA 2A1VA 3H14A 3DXVA 3CQ4A 2V0YA 4JEWA 3B1DA 2OKJA 3MADA 4LC3A 3TQXA 1Z7DA 4ZWVA 1DJUA 2YOBA 4RKDA 1YJYA 2W8WA 2CANA 1DFOA 4EU1A 5BJ3A 1BJOA 1DGEA 4ZDPA 1O62A 2W8VA 9AATA 5D95A 3PIUA 3DU4A 2ZSLA 3HVYA 3MC6A 2D66A 5EUEA 2W7DA 3DYDA 4R5ZA 1TARA 1X28A 2PB2A 3L8AA 3TATA 1AKAA 3AEJA 4ZDLA 1IVRA 3ZZKA 4EB7A 3FD0A 1M7YA 3N75A 4XJLA 3N4SA 3ASAA 1V2DA 1SPAA 2JISA 3EI7A 1TPLA 3PDXA 4LNLA 2QB3A 1J04A 1JS3A 2Z9XA 4JEZA 4Q6RA 4WYAA 1I43A 5I92A 2BHXA 3P6KA 3BV0A 2Z61A 1YOOA 1M0OA 3NYSA 2VMYA 3MAFB 2YKVA 1MLZA 4E77A 4ZASA 1X29A 2C44A 2VMNA 3WX9A 3WZFA 4GSAA 3GSBA 1XEYA 5G4IA 2YHKA 3GR9A 4K2BA 2YCPA 1ARGA 3LWSA 4F5JA 4GEBA 3RCHB 1AAWA 4W1WA 1IX6A 4IY7A 1AMAA 1J32A 4HF8A 4BA4A 3EZ1A 1RV4A 2W7GA 1AKBA 4A0GA 3GZDC 1DJ9A 5DJ1A 4PFFA 2JG2A 1I41A 2Q7WA 4OC9A 2TPLA 3NU8A 1ASNA 4Y0HA 3LVKA 3QGUA 1JF9A 3GJUA 3CQ5A 4A00A 3F6TA 2QB2A 2W8TA 2BYJA 1OHVA 1GC4A 2WKAA 3QM2A 5EQCA 3DZZA 2XBNA 1AX4A 4PIWA 3ACZA 1CL2A 1D7RA 1S0AA 2HP1A 4B98A 4DBCA 3E9KA 3VK4A 3WGBA 4Q76A 2AY2A 3AEMC 2GMSA 2QA3A 4PFNA 3AOVA 3VK3A 1ELQA 3A8UX 3MKJA 2Z9WA 4LW2A 3FVXA 1GD9A 4Q31A 1I29A 4MQQA 3WY7A 1TOJA 5K8BA 3PA9A 3HDOA 1D7VA 1E5EA 2WK7A 3E2YA 4E3RA 2VMQA 1FC4A 2HOYA 1PFFA 1QJ3A 1SF2A 2ZYJA 1ARTA 2VYCA 4EB5A 2BIGA 4TN4A 2HOZA 2OGEA 4WLJA 3AEMA 1KAFA 2JGTA 2BI3A 4E1OA 1D7UA 5HXXA 4Y0IA 3FRKA 1QISA 3PD6A 5M4DA 2W8JA 4U2HA 4EFFA 1QITA 1ARSA 1ZODA 3G7QA 1IJIA 1FG3A 2WK9A 2VIAA 3FQAA 3W1JA 2BYLA 1M6SA 3LVMA 2BI1A 3RUYA 2VMWA 2QSRA 4AO4A 5LHAA 1YAAA 1B5PA 5C6UA 1SZKA 2CY8A 2R2NA 2YRRA 2D7YA 2NMPA 4UHOA 5F9SA 3E77A 3FFHA 1LKCA 2VMVA 2G6WA 1WSTA 1CZEA 2YRIA 3BCAA 4N0BA 3RCHA 2OKKA 1AY8A 4GE7A 3TFTA 1AIAA 1IUGA 3HL2A 1VEFA 4ZWMA 1S09A 4P7YA 2O1BA 4O6ZA 1KMJA 2GMUA 3KE3A 2BIEA 5G09A 2GSAA 2FQ6A 3FFRA 4ADCA 1WYVA 4Q75A 4F4EA 4W1VA 4AOAA 2VMTA 4ATQA 3F9TA 4WD2A 4JE5A 2YKUA 5IWQA 1W23A 1JS6A 1EQBA 4R5FA 3ELPA 4ZSWA 1YIYA 4CBSA 4TV7A 4AZKA 2AY5A 3EIAA 5G4JA 1O61A 2R5EA 1ASCA 1UKJA 4P3MA 1FG7A 1YJSA 1ASFA 4ADEA 5FT6A 1LK9A 2VGSA 4AH3A 2PO3A 2VGZA 1RV3A 2W8UA 3FZ7A 3DRDA 1DGDA 5FT4A 3MC6C 1G4XA 3QHXA 1O69A 2BWNA 1ZC9A 1CJ0A 3JU7A 3AEJC 4LNJA 4JEXA 5EAVA 3N5MA 2D64A 3H9XA 4XJMA 1TATA 1W7MA 4MKKA 4OBVA 1LC8A 3KGWA 2PB0A 1KL2A 3FVSA 1TOIA 5EUNA 3L44A 1CZCA 1W7NA 1BJOB 2C81A 3EI8A 1BJNA 3E6GA 1AJSA 1BS0A 1OATA 2AY6A 5EFSA 1RVUA 4K05A 2CFBA 4H63Q 4J8LA 3FDDA 4MGRA 4GE9A 1ASGA 4F5LA 2VMZA 5J8QA 3B46A 2X5DA 1AHEA 1B8GA 1MGVA 3A9XA 3HBXA 4DQ6A 2DOUA 1N2TA 2D65A 2ZY3A 1WYTA 1IBJA 5EUDA 2CJHA 4RJYA 1SZUA 1W3UA 2DKJA 2VGUA 3EI5A 3FCRA 3NUIA 4WXBA 5LH9A 2VLHA 2W7FA 2QLRA 1ZOBA 2EGYA 3AENB 3NU7A 1ASAA 5EAAA 4AZJA 3ATHA 3JZLA 1AHGA 3LVJA 4IXZA 2AEUA 4KAMA 1GDEA 3BWNC 1PMMA 1I48A 1GEYA 2DKBA 4ADDA 2EPJA 1AHFA 3N0LA 4ITXA 4ZM4A 2W7MA 2HUIA 3NYUA 4MSOA 2O7CA 2E7UA 3NDNA 2VGTA 1WYVB 4ZAHA 3AV7A 3FQ8A 5M49A 4RKCA 2FM1A 3E2ZB 3VAXA 4WP0A 1V72A 2O0RA 1RVYA 2VMPA 2ZC0A 2E7IA 3ELEA 2BWPA 2YKXA 5EIGB 3JWAA 3BWNA 5D5SA 2VI9A 4JF1A 3I4JA 3WCOA 4RIZA 2W7HA 3I5TA 1TOEA 4BMKA 2ORDA 1S07A 1LW5A 2R0TA 1AJRA 1GC0A 5HDMA 3BCBA 2ZP7A 3CBFA 1SVVA 4GE4A 4WB0B 4DGTA 2X8UA 3AOWA 1C7GA 3DODA 1AKCA 4XJOA 4F5IA 1YIZA 3ASBA 5DJ9A 4ZLVA 1MDZA 2GQNA 4RITA 4UQVA 2Z9UA 3BCXA 3USFA 3MAFA 4IYOA 1H1CA 2AY1A 1UU2A 3ZRPA 1B4XA 1C9CA 2HOXA 3HQTA 2OGAA 3WCNA 1H0CA 1QGNA 2VGVA 1AMQA 1AMSA 3AEOA 3K28A 2CTZA 1IX7A 3W1IA 3M5UA 4GDYA 2BKWA 4ADBA 3AELA 1CQ7A 2CJGA 3LVLB 1ASBA 1GCKA 4I8AA 1ASDA 4XEWA 1BKGA 3E2FA 3NUBA 1BQAA 3PJ0A 1C4KA 2BI5A 4RLGA 2W7IA 3CAIA 3EUCA 3PGYA 4OCAA 2HP2A 1E5FA 5G0AA 5G2PA 1C7NA 1WYTB 2EH6A 2R5CA 3TFUA 4KXKA 2VMUA 1B5OA 4B9BA 3UWCA 1AICA 4CBRA 2AY4A 1ASMA 3OP7A 1Z3ZA 1D2FA 4OT8A 3GZCA 1UU1A 2BI2A 1M4NA 1YJZA 3AENA 4F5FA 1WYUB 3NTJA 4Y0DA 3WKSA 3N4XA 1YNUA 1AHXA 3PDBB 4OYTA 1KL1A 2AY9A 1GC3A 1X2AA 2EZ1A 2DR1A 3B8XA 4MQRA 4OTLA 4A6TA 3EIBA 1DJEA 2CH2A 8AATA 1LC7A 3NX3A 4F5MA 3FQ7A 3W1HA 4J5UA 3DR4A 1OXOA 4F5KA 3UAKA 1GBNA 2QMAA 3FKDA 2EZ2A 1AIBA 4A6RA 3I16A 1KKPA 1BQDA 3K40A 3B1EA 1B9IA 3PPLA 4A0HA 4KYOA 2VIBA 3N7NA 2AATA 1PG8A 1IAXA 2BI9A 1WKGA 2Z9VA 4IXSA 3MEBA 1U08A 5AX8A 1LW4A 5DB5A 2HORA 2E7JA 4K2IA 1JG8A 2FN6A 1LC5A 3HLMA 3ISLA 2BWOA 1X0MA 4FFCA 4IW7A 4MQPA 3MAUA 3GWPA 2GB3A 1TOGA 2RFVA 1CQ6A 2HZPA 3DXWA 2VLFA 1LS3A 3R9AA 1GEXA 3FDBA 3LG0A 3DC1A 1CS1A 4OMAA 5E3KA 1KMKA 4ZDOA 4L0OA 3RQ1A 5M46A 2QBTA 4UHNA 1OHYA 5E4ZA 1AY4A 4W8IA 4WYEA 3RBFA 4CXQA 2CSTA 3QN6A 3IF2A 2ZY4A 1MAQA 3GETA 2VMSA 4N0WA 5E5IA 2X3LA 3Q8NA 3WKRA 4H51A 2CINA 4RAEA 1VP4A 2CB1A 1GC2A 5FT5A 5M4BA 4WYFA 1SFFA 1N8PA 2W7KA 4WYDA
chains in the Genus database with same CATH topology
1UU0A 3HMUA 4M2MA 3E2ZA 3AEPA 2DGKA 3CQ6A 4XQ2A 2C0RA 3A9ZA 1AJSB 1BW0A 3G8MA 4HVKA 1AHYA 3QI6A 3BN1A 1EJIA 1BJWA 2VGWA 1QZ9A 2YCTA 2YKYA 1ORDA 2WK8A 3JTXA 2C7TA 4WYCA 1P3WA 2VMOA 1OHWA 3KGXA 3PD6B 4WB0A 3T32A 4F5GA 3A9YA 1BJ4A 1TASA 2Z1ZA 2ZUKA 1WYUA 1XI9A 4WXFA 1ARIA 4RJ0A 3PDBA 3F0HA 2W7JA 4A72A 1EG5A 4A0RA 1MLYA 1AMRA 4NOGA 3G0TA 2ZY5A 4IYOB 1O4SA 1ARHA 2AY8A 2CJDA 3FTBA 4W91A 4IX8A 1W7LA 3R4TA 4GRXA 1IX8A 5DX5A 2XH1A 1AAMA 2AY7A 4ZM3A 1D7SA 3COGA 2G7JA 4RM1A 3ZZJA 1G7WA 1G7XA 2WB6A 4XAUA 4JF0A 2ZY2A 1ELUA 3TCMA 1C0NA 4EMYA 1DKAA 3NYTA 1QJ5A 4WBTA 3FZ8A 4JEVA 3ECDA 3N4RA 2F8JA 2OATA 2ZSMA 3B1CA 1ASEA 1V2EA 1G4VA 2D5YA 2D63A 3D6KA 4A6UA 4IXOA 1VJOA 1CL1A 2CH1A 1T3IA 4QGRA 3WGCA 1MDXA 2JJFA 4CXRA 3RI6A 4CVQA 2VMRA 2E54A 2AEVA 1S08A 2VMXA 1Y4IA 4JE5D 3WLXA 4MY5A 2FNUA 4M2KA 4U1TA 2V1PA 4JEYA 2JJHA 3FZ6A 2X5FA 3EI6A 5FT8A 1B9HA 4BA5A 3NRAA 4XK1A 5G2QA 1KKJA 3HT4A 1MDOA 2JJEA 4ZSYA 1OXPA 4AO9A 4R2NA 1M0NA 4W5KA 3GZDA 3QBOA 4E3QA 5TF5A 3LV2A 4M2JA 3RBLA 3VP6A 3FVUA 5BJ4A 2BIAA 4W1XA 4WLHA 4ATPA 2D7ZA 3VOMA 3AATA 1MAPA 4UHMA 7AATA 2HUUA 1N31A 1V2FA 1M32A 3K7YA 3ZRQA 3JWBA 5F8VA 5KTBA 4K2MA 2DGMA 2HUFA 3GBXA 4UOYA 2FKIA 4WXGA 1BT4A 4WYGA 2EYQA 3MBBA 2EO5A 3PAAA 2D61A 4TMRA 3NNKA 3DR7A 3II0A 4MKJA 2KFPA 2FYFA 1AY5A 5JAYA 5EIGA 1M0QA 2Z67A 3VK2A 1PMOA 2Z1YA 4LNMA 2R5CB 1CQ8A 3JW9A 4FL0A 4LW4A 4OBUA 4BQ0A 1ECXA 1S06A 3H7FA 1WKHA 3BWOA 3KKIA 1M0PA 2Z20A 3EI9A 3EZSA 4XJPA 2JJGA 4ISYA 4BHDA 1GEWA 5HHYA 3BS8A 3P1TA 2YCNA 1TOKA 2W7EA 1ASLA 2W7LA 2AY3A 4ITGA 2OQXA 3QPGA 4F5HA 1QIRA 3BC8A 4R8DA 3LY1A 2VI8A 3UE8A 4PVFA 3FSLA 3IHJA 1C7OA 1DTYA 1IAYA 1SZSA 2ZJGA 3A2BA 2FNIA 3ZRRA 3OKSA 2DGLA 3BB8A 4A0FA 2A1VA 3H14A 3DXVA 3CQ4A 2V0YA 4JEWA 3B1DA 2OKJA 3MADA 4LC3A 3TQXA 1Z7DA 4ZWVA 1DJUA 2YOBA 4RKDA 1YJYA 2W8WA 2CANA 1DFOA 4EU1A 5BJ3A 1BJOA 1DGEA 4ZDPA 1O62A 2W8VA 9AATA 5D95A 3PIUA 3DU4A 2ZSLA 3HVYA 3MC6A 2D66A 5EUEA 2W7DA 3DYDA 4R5ZA 1TARA 1X28A 2PB2A 3L8AA 3TATA 1AKAA 3AEJA 4ZDLA 1IVRA 3ZZKA 4EB7A 3FD0A 1M7YA 3N75A 4XJLA 3N4SA 3ASAA 1V2DA 1SPAA 2JISA 3EI7A 1TPLA 3PDXA 4LNLA 2QB3A 1J04A 1JS3A 2Z9XA 4JEZA 4Q6RA 4WYAA 1I43A 5I92A 2BHXA 3P6KA 3BV0A 2Z61A 1YOOA 1M0OA 3NYSA 2VMYA 3MAFB 2YKVA 1MLZA 4E77A 4ZASA 1X29A 2C44A 2VMNA 3WX9A 3WZFA 4GSAA 3GSBA 1XEYA 5G4IA 2YHKA 3GR9A 4K2BA 2YCPA 1ARGA 3LWSA 4F5JA 4GEBA 3RCHB 1AAWA 4W1WA 1IX6A 4IY7A 1AMAA 1J32A 4HF8A 4BA4A 3EZ1A 1RV4A 2W7GA 1AKBA 4A0GA 3GZDC 1DJ9A 5DJ1A 4PFFA 2JG2A 1I41A 2Q7WA 4OC9A 2TPLA 3NU8A 1ASNA 4Y0HA 3LVKA 3QGUA 1JF9A 3GJUA 3CQ5A 4A00A 3F6TA 2QB2A 2W8TA 2BYJA 1OHVA 1GC4A 2WKAA 3QM2A 5EQCA 3DZZA 2XBNA 1AX4A 4PIWA 3ACZA 1CL2A 1D7RA 1S0AA 2HP1A 4B98A 4DBCA 3E9KA 3VK4A 3WGBA 4Q76A 2AY2A 3AEMC 2GMSA 2QA3A 4PFNA 3AOVA 3VK3A 1ELQA 3A8UX 3MKJA 2Z9WA 4LW2A 3FVXA 1GD9A 4Q31A 1I29A 4MQQA 3WY7A 1TOJA 5K8BA 3PA9A 3HDOA 1D7VA 1E5EA 2WK7A 3E2YA 4E3RA 2VMQA 1FC4A 2HOYA 1PFFA 1QJ3A 1SF2A 2ZYJA 1ARTA 2VYCA 4EB5A 2BIGA 4TN4A 2HOZA 2OGEA 4WLJA 3AEMA 2JGTA 2BI3A 4E1OA 1D7UA 5HXXA 4Y0IA 3FRKA 1QISA 3PD6A 5M4DA 2W8JA 4U2HA 4EFFA 1QITA 1ARSA 1ZODA 3G7QA 1IJIA 1FG3A 2WK9A 2VIAA 3FQAA 3W1JA 2BYLA 1M6SA 3LVMA 2BI1A 3RUYA 2VMWA 2QSRA 4AO4A 5LHAA 1YAAA 1B5PA 5C6UA 1SZKA 2CY8A 2R2NA 2YRRA 2D7YA 2NMPA 4UHOA 5F9SA 3E77A 3FFHA 1LKCA 2VMVA 2G6WA 1WSTA 1CZEA 2YRIA 3BCAA 4N0BA 3RCHA 2OKKA 1AY8A 4GE7A 3TFTA 1AIAA 1IUGA 3HL2A 1VEFA 4ZWMA 1S09A 4P7YA 2O1BA 4O6ZA 1KMJA 2GMUA 3KE3A 2BIEA 5G09A 2GSAA 2FQ6A 3FFRA 4ADCA 1WYVA 4Q75A 4F4EA 4W1VA 4AOAA 2VMTA 4ATQA 3F9TA 4WD2A 4JE5A 2YKUA 5IWQA 1W23A 1JS6A 1EQBA 4R5FA 3ELPA 4ZSWA 1YIYA 4CBSA 4TV7A 4AZKA 2AY5A 3EIAA 5G4JA 1O61A 2R5EA 1ASCA 1UKJA 4P3MA 1FG7A 1YJSA 1ASFA 4ADEA 5FT6A 1LK9A 2VGSA 4AH3A 2PO3A 2VGZA 1RV3A 2W8UA 3FZ7A 3DRDA 1DGDA 5FT4A 3MC6C 1G4XA 3QHXA 1O69A 2BWNA 1ZC9A 1CJ0A 3JU7A 3AEJC 4LNJA 4JEXA 5EAVA 3N5MA 2D64A 3H9XA 4XJMA 1TATA 1W7MA 4MKKA 4OBVA 1LC8A 3KGWA 2PB0A 1KL2A 3FVSA 1TOIA 5EUNA 3L44A 1CZCA 1W7NA 1BJOB 2C81A 3EI8A 1BJNA 3E6GA 1AJSA 1BS0A 1OATA 2AY6A 5EFSA 1RVUA 4K05A 2CFBA 4H63Q 4J8LA 3FDDA 4MGRA 4GE9A 1ASGA 4F5LA 2VMZA 5J8QA 3B46A 2X5DA 1AHEA 1B8GA 1MGVA 3A9XA 3HBXA 4DQ6A 2DOUA 1N2TA 2D65A 2ZY3A 1WYTA 1IBJA 5EUDA 2CJHA 4RJYA 1SZUA 1W3UA 2DKJA 2VGUA 3EI5A 3FCRA 3NUIA 4WXBA 5LH9A 2VLHA 2W7FA 2QLRA 1ZOBA 2EGYA 3AENB 3NU7A 1ASAA 5EAAA 4AZJA 3ATHA 3JZLA 1AHGA 3LVJA 4IXZA 2AEUA 4KAMA 1GDEA 3BWNC 1PMMA 1I48A 1GEYA 2DKBA 4ADDA 2EPJA 1AHFA 3N0LA 4ITXA 4ZM4A 2W7MA 2HUIA 3NYUA 4MSOA 2O7CA 2E7UA 3NDNA 2VGTA 1WYVB 4ZAHA 3AV7A 3FQ8A 5M49A 4RKCA 2FM1A 3E2ZB 3VAXA 4WP0A 1V72A 2O0RA 1RVYA 2VMPA 2ZC0A 2E7IA 3ELEA 2BWPA 2YKXA 5EIGB 3JWAA 3BWNA 5D5SA 2VI9A 4JF1A 3I4JA 3WCOA 4RIZA 2W7HA 3I5TA 1TOEA 4BMKA 2ORDA 1S07A 1LW5A 2R0TA 1AJRA 1GC0A 5HDMA 3BCBA 2ZP7A 3CBFA 1SVVA 4GE4A 4WB0B 4DGTA 2X8UA 3AOWA 1C7GA 3DODA 1AKCA 4XJOA 4F5IA 1YIZA 3ASBA 5DJ9A 4ZLVA 1MDZA 2GQNA 4RITA 4UQVA 2Z9UA 3BCXA 3USFA 3MAFA 4IYOA 1H1CA 2AY1A 1UU2A 3ZRPA 1B4XA 1C9CA 2HOXA 3HQTA 2OGAA 3WCNA 1H0CA 1QGNA 2VGVA 1AMQA 1AMSA 3AEOA 3K28A 2CTZA 1IX7A 3W1IA 3M5UA 4GDYA 2BKWA 4ADBA 3AELA 1CQ7A 2CJGA 3LVLB 1ASBA 1GCKA 4I8AA 1ASDA 4XEWA 1BKGA 3E2FA 3NUBA 1BQAA 3PJ0A 1C4KA 2BI5A 4RLGA 2W7IA 3CAIA 3EUCA 3PGYA 4OCAA 2HP2A 1E5FA 5G0AA 5G2PA 1C7NA 1WYTB 2EH6A 2R5CA 3TFUA 4KXKA 2VMUA 1B5OA 4B9BA 3UWCA 1AICA 4CBRA 2AY4A 1ASMA 3OP7A 1Z3ZA 1D2FA 4OT8A 3GZCA 1UU1A 2BI2A 1M4NA 1YJZA 3AENA 4F5FA 1WYUB 3NTJA 4Y0DA 3WKSA 3N4XA 1YNUA 1AHXA 3PDBB 4OYTA 1KL1A 2AY9A 1GC3A 1X2AA 2EZ1A 2DR1A 3B8XA 4MQRA 4OTLA 4A6TA 3EIBA 1DJEA 2CH2A 8AATA 1LC7A 3NX3A 4F5MA 3FQ7A 3W1HA 4J5UA 3DR4A 1OXOA 4F5KA 3UAKA 1GBNA 2QMAA 3FKDA 2EZ2A 1AIBA 4A6RA 3I16A 1KKPA 1BQDA 3K40A 3B1EA 1B9IA 3PPLA 4A0HA 4KYOA 2VIBA 3N7NA 2AATA 1PG8A 1IAXA 2BI9A 1WKGA 2Z9VA 4IXSA 3MEBA 1U08A 5AX8A 1LW4A 5DB5A 2HORA 2E7JA 4K2IA 1JG8A 2FN6A 1LC5A 3HLMA 3ISLA 2BWOA 1X0MA 4FFCA 4IW7A 4MQPA 3MAUA 3GWPA 2GB3A 1TOGA 2RFVA 1CQ6A 2HZPA 3DXWA 2VLFA 1LS3A 3R9AA 1GEXA 3FDBA 3LG0A 3DC1A 1CS1A 4OMAA 5E3KA 1KMKA 4ZDOA 4L0OA 3RQ1A 5M46A 2QBTA 4UHNA 1OHYA 5E4ZA 1AY4A 4W8IA 4WYEA 3RBFA 4CXQA 2CSTA 3QN6A 3IF2A 2ZY4A 1MAQA 3GETA 2VMSA 4N0WA 5E5IA 2X3LA 3Q8NA 3WKRA 4H51A 2CINA 4RAEA 1VP4A 2CB1A 1GC2A 5FT5A 5M4BA 4WYFA 1SFFA 1N8PA 2W7KA 4WYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UU0 A;  3HMU A;  4M2M A;  3E2Z A;  3AEP A;  2DGK A;  3CQ6 A;  4XQ2 A;  2C0R A;  3A9Z A;  1AJS B;  1BW0 A;  3G8M A;  4HVK A;  1AHY A;  3QI6 A;  3BN1 A;  1EJI A;  1BJW A;  2VGW A;  1QZ9 A;  2YCT A;  2YKY A;  1ORD A;  2WK8 A;  3JTX A;  2C7T A;  4WYC A;  1P3W A;  2VMO A;  1OHW A;  3KGX A;  3PD6 B;  4WB0 A;  3T32 A;  4F5G A;  3A9Y A;  1BJ4 A;  1TAS A;  2Z1Z A;  2ZUK A;  1WYU A;  1XI9 A;  4WXF A;  1ARI A;  4RJ0 A;  3PDB A;  3F0H A;  2W7J A;  4A72 A;  1EG5 A;  4A0R A;  1MLY A;  1AMR A;  4NOG A;  3G0T A;  2ZY5 A;  4IYO B;  1O4S A;  1ARH A;  2AY8 A;  2CJD A;  3FTB A;  4W91 A;  4IX8 A;  1W7L A;  3R4T A;  4GRX A;  1IX8 A;  5DX5 A;  2XH1 A;  1AAM A;  2AY7 A;  4ZM3 A;  1D7S A;  3COG A;  4RM1 A;  3ZZJ A;  1G7W A;  1G7X A;  4XAU A;  4JF0 A;  2ZY2 A;  1ELU A;  3TCM A;  1C0N A;  4EMY A;  1DKA A;  3NYT A;  1QJ5 A;  4WBT A;  3FZ8 A;  4JEV A;  3ECD A;  2F8J A;  2OAT A;  2ZSM A;  3B1C A;  1ASE A;  1V2E A;  1G4V A;  2D5Y A;  2D63 A;  3D6K A;  4A6U A;  4IXO A;  1VJO A;  1CL1 A;  2CH1 A;  1T3I A;  4QGR A;  3WGC A;  1MDX A;  2JJF A;  4CXR A;  3RI6 A;  4CVQ A;  2VMR A;  2E54 A;  2AEV A;  1S08 A;  2VMX A;  1Y4I A;  4JE5 D;  3WLX A;  4MY5 A;  2FNU A;  4M2K A;  4U1T A;  2V1P A;  4JEY A;  2JJH A;  3FZ6 A;  2X5F A;  3EI6 A;  5FT8 A;  1B9H A;  4BA5 A;  3NRA A;  4XK1 A;  5G2Q A;  1KKJ A;  3HT4 A;  1MDO A;  2JJE A;  4ZSY A;  1OXP A;  4AO9 A;  4R2N A;  1M0N A;  4W5K A;  3GZD A;  3QBO A;  4E3Q A;  5TF5 A;  3LV2 A;  4M2J A;  3RBL A;  3VP6 A;  3FVU A;  5BJ4 A;  2BIA A;  4W1X A;  4WLH A;  4ATP A;  2D7Z A;  3VOM A;  3AAT A;  1MAP A;  4UHM A;  7AAT A;  2HUU A;  1N31 A;  1V2F A;  1M32 A;  3K7Y A;  3ZRQ A;  3JWB A;  5F8V A;  4K2M A;  2DGM A;  2HUF A;  3GBX A;  4UOY A;  4WXG A;  1BT4 A;  4WYG A;  3MBB A;  2EO5 A;  3PAA A;  2D61 A;  4TMR A;  3NNK A;  3DR7 A;  3II0 A;  4MKJ A;  2FYF A;  1AY5 A;  5JAY A;  5EIG A;  1M0Q A;  2Z67 A;  3VK2 A;  1PMO A;  2Z1Y A;  4LNM A;  2R5C B;  1CQ8 A;  3JW9 A;  4FL0 A;  4LW4 A;  4OBU A;  4BQ0 A;  1ECX A;  1S06 A;  3H7F A;  1WKH A;  3BWO A;  3KKI A;  1M0P A;  2Z20 A;  3EI9 A;  3EZS A;  4XJP A;  2JJG A;  4ISY A;  4BHD A;  1GEW A;  5HHY A;  3BS8 A;  3P1T A;  2YCN A;  1TOK A;  2W7E A;  1ASL A;  2W7L A;  2AY3 A;  4ITG A;  2OQX A;  3QPG A;  4F5H A;  1QIR A;  3BC8 A;  4R8D A;  3LY1 A;  2VI8 A;  3UE8 A;  4PVF A;  3FSL A;  3IHJ A;  1C7O A;  1DTY A;  1IAY A;  1SZS A;  2ZJG A;  3A2B A;  2FNI A;  3ZRR A;  3OKS A;  2DGL A;  3BB8 A;  4A0F A;  3H14 A;  3DXV A;  3CQ4 A;  2V0Y A;  4JEW A;  3B1D A;  2OKJ A;  3MAD A;  4LC3 A;  3TQX A;  1Z7D A;  4ZWV A;  1DJU A;  2YOB A;  4RKD A;  1YJY A;  2W8W A;  2CAN A;  1DFO A;  4EU1 A;  5BJ3 A;  1BJO A;  1DGE A;  4ZDP A;  1O62 A;  2W8V A;  9AAT A;  5D95 A;  3PIU A;  3DU4 A;  2ZSL A;  3HVY A;  3MC6 A;  2D66 A;  5EUE A;  2W7D A;  3DYD A;  4R5Z A;  1TAR A;  1X28 A;  2PB2 A;  3L8A A;  3TAT A;  1AKA A;  3AEJ A;  4ZDL A;  1IVR A;  3ZZK A;  4EB7 A;  3FD0 A;  1M7Y A;  3N75 A;  4XJL A;  3ASA A;  1V2D A;  1SPA A;  2JIS A;  3EI7 A;  1TPL A;  3PDX A;  4LNL A;  2QB3 A;  1J04 A;  1JS3 A;  2Z9X A;  4JEZ A;  4Q6R A;  4WYA A;  1I43 A;  5I92 A;  2BHX A;  3P6K A;  3BV0 A;  2Z61 A;  1YOO A;  1M0O A;  3NYS A;  2VMY A;  3MAF B;  2YKV A;  1MLZ A;  4E77 A;  4ZAS A;  1X29 A;  2C44 A;  2VMN A;  3WX9 A;  3WZF A;  4GSA A;  3GSB A;  1XEY A;  5G4I A;  2YHK A;  3GR9 A;  4K2B A;  2YCP A;  1ARG A;  3LWS A;  4F5J A;  4GEB A;  3RCH B;  1AAW A;  4W1W A;  1IX6 A;  4IY7 A;  1AMA A;  1J32 A;  4HF8 A;  4BA4 A;  3EZ1 A;  1RV4 A;  2W7G A;  1AKB A;  4A0G A;  3GZD C;  1DJ9 A;  5DJ1 A;  4PFF A;  2JG2 A;  1I41 A;  2Q7W A;  4OC9 A;  2TPL A;  3NU8 A;  1ASN A;  4Y0H A;  3LVK A;  3QGU A;  1JF9 A;  3GJU A;  3CQ5 A;  4A00 A;  3F6T A;  2QB2 A;  2W8T A;  2BYJ A;  1OHV A;  1GC4 A;  2WKA A;  3QM2 A;  5EQC A;  3DZZ A;  2XBN A;  1AX4 A;  4PIW A;  3ACZ A;  1CL2 A;  1D7R A;  1S0A A;  2HP1 A;  4B98 A;  4DBC A;  3E9K A;  3VK4 A;  3WGB A;  4Q76 A;  2AY2 A;  3AEM C;  2GMS A;  2QA3 A;  4PFN A;  3AOV A;  3VK3 A;  1ELQ A;  3A8U X;  3MKJ A;  2Z9W A;  4LW2 A;  3FVX A;  1GD9 A;  4Q31 A;  1I29 A;  4MQQ A;  3WY7 A;  1TOJ A;  5K8B A;  3PA9 A;  3HDO A;  1D7V A;  1E5E A;  2WK7 A;  3E2Y A;  4E3R A;  2VMQ A;  1FC4 A;  2HOY A;  1PFF A;  1QJ3 A;  1SF2 A;  2ZYJ A;  1ART A;  2VYC A;  4EB5 A;  2BIG A;  4TN4 A;  2HOZ A;  2OGE A;  4WLJ A;  3AEM A;  2JGT A;  2BI3 A;  4E1O A;  1D7U A;  5HXX A;  4Y0I A;  3FRK A;  1QIS A;  3PD6 A;  5M4D A;  2W8J A;  4U2H A;  4EFF A;  1QIT A;  1ARS A;  1ZOD A;  3G7Q A;  1IJI A;  1FG3 A;  2WK9 A;  2VIA A;  3FQA A;  3W1J A;  2BYL A;  1M6S A;  3LVM A;  2BI1 A;  3RUY A;  2VMW A;  4AO4 A;  5LHA A;  1YAA A;  1B5P A;  5C6U A;  1SZK A;  2CY8 A;  2R2N A;  2YRR A;  2D7Y A;  2NMP A;  4UHO A;  5F9S A;  3E77 A;  3FFH A;  1LKC A;  2VMV A;  2G6W A;  1WST A;  1CZE A;  2YRI A;  3BCA A;  4N0B A;  3RCH A;  2OKK A;  1AY8 A;  4GE7 A;  3TFT A;  1AIA A;  1IUG A;  3HL2 A;  1VEF A;  4ZWM A;  1S09 A;  4P7Y A;  2O1B A;  4O6Z A;  1KMJ A;  2GMU A;  3KE3 A;  2BIE A;  5G09 A;  2GSA A;  2FQ6 A;  3FFR A;  4ADC A;  1WYV A;  4Q75 A;  4F4E A;  4W1V A;  4AOA A;  2VMT A;  4ATQ A;  3F9T A;  4WD2 A;  4JE5 A;  2YKU A;  5IWQ A;  1W23 A;  1JS6 A;  1EQB A;  4R5F A;  3ELP A;  4ZSW A;  1YIY A;  4CBS A;  4TV7 A;  4AZK A;  2AY5 A;  3EIA A;  5G4J A;  1O61 A;  2R5E A;  1ASC A;  1UKJ A;  4P3M A;  1FG7 A;  1YJS A;  1ASF A;  4ADE A;  5FT6 A;  1LK9 A;  2VGS A;  4AH3 A;  2PO3 A;  2VGZ A;  1RV3 A;  2W8U A;  3FZ7 A;  3DRD A;  1DGD A;  5FT4 A;  3MC6 C;  1G4X A;  3QHX A;  1O69 A;  2BWN A;  1ZC9 A;  1CJ0 A;  3JU7 A;  3AEJ C;  4LNJ A;  4JEX A;  5EAV A;  3N5M A;  2D64 A;  4XJM A;  1TAT A;  1W7M A;  4MKK A;  4OBV A;  1LC8 A;  3KGW A;  2PB0 A;  1KL2 A;  3FVS A;  1TOI A;  5EUN A;  3L44 A;  1CZC A;  1W7N A;  1BJO B;  2C81 A;  3EI8 A;  1BJN A;  3E6G A;  1AJS A;  1BS0 A;  1OAT A;  2AY6 A;  5EFS A;  1RVU A;  2CFB A;  4J8L A;  3FDD A;  4MGR A;  4GE9 A;  1ASG A;  4F5L A;  2VMZ A;  5J8Q A;  3B46 A;  2X5D A;  1AHE A;  1B8G A;  1MGV A;  3A9X A;  3HBX A;  4DQ6 A;  2DOU A;  1N2T A;  2D65 A;  2ZY3 A;  1WYT A;  1IBJ A;  5EUD A;  2CJH A;  4RJY A;  1SZU A;  1W3U A;  2DKJ A;  2VGU A;  3EI5 A;  3FCR A;  3NUI A;  4WXB A;  5LH9 A;  2VLH A;  2W7F A;  2QLR A;  1ZOB A;  2EGY A;  3AEN B;  3NU7 A;  1ASA A;  5EAA A;  4AZJ A;  3ATH A;  3JZL A;  1AHG A;  3LVJ A;  4IXZ A;  2AEU A;  4KAM A;  1GDE A;  3BWN C;  1PMM A;  1I48 A;  1GEY A;  2DKB A;  4ADD A;  2EPJ A;  1AHF A;  3N0L A;  4ITX A;  4ZM4 A;  2W7M A;  2HUI A;  3NYU A;  4MSO A;  2O7C A;  2E7U A;  3NDN A;  2VGT A;  1WYV B;  4ZAH A;  3AV7 A;  3FQ8 A;  5M49 A;  4RKC A;  2FM1 A;  3E2Z B;  3VAX A;  4WP0 A;  1V72 A;  2O0R A;  1RVY A;  2VMP A;  2ZC0 A;  2E7I A;  3ELE A;  2BWP A;  2YKX A;  5EIG B;  3JWA A;  3BWN A;  5D5S A;  2VI9 A;  4JF1 A;  3I4J A;  3WCO A;  4RIZ A;  2W7H A;  3I5T A;  1TOE A;  4BMK A;  2ORD A;  1S07 A;  1LW5 A;  2R0T A;  1AJR A;  1GC0 A;  5HDM A;  3BCB A;  2ZP7 A;  3CBF A;  1SVV A;  4GE4 A;  4WB0 B;  4DGT A;  2X8U A;  3AOW A;  1C7G A;  3DOD A;  1AKC A;  4XJO A;  4F5I A;  1YIZ A;  3ASB A;  5DJ9 A;  4ZLV A;  1MDZ A;  2GQN A;  4RIT A;  4UQV A;  2Z9U A;  3BCX A;  3USF A;  3MAF A;  4IYO A;  1H1C A;  2AY1 A;  1UU2 A;  3ZRP A;  1B4X A;  1C9C A;  2HOX A;  3HQT A;  2OGA A;  3WCN A;  1H0C A;  1QGN A;  2VGV A;  1AMQ A;  1AMS A;  3AEO A;  3K28 A;  2CTZ A;  1IX7 A;  3W1I A;  3M5U A;  4GDY A;  2BKW A;  4ADB A;  3AEL A;  1CQ7 A;  2CJG A;  3LVL B;  1ASB A;  1GCK A;  4I8A A;  1ASD A;  4XEW A;  1BKG A;  3E2F A;  3NUB A;  1BQA A;  3PJ0 A;  1C4K A;  2BI5 A;  4RLG A;  2W7I A;  3CAI A;  3EUC A;  3PGY A;  4OCA A;  2HP2 A;  1E5F A;  5G0A A;  5G2P A;  1C7N A;  1WYT B;  2EH6 A;  2R5C A;  3TFU A;  4KXK A;  2VMU A;  1B5O A;  4B9B A;  3UWC A;  1AIC A;  4CBR A;  2AY4 A;  1ASM A;  3OP7 A;  1Z3Z A;  1D2F A;  4OT8 A;  3GZC A;  1UU1 A;  2BI2 A;  1M4N A;  1YJZ A;  3AEN A;  4F5F A;  1WYU B;  3NTJ A;  4Y0D A;  3WKS A;  1YNU A;  1AHX A;  3PDB B;  4OYT A;  1KL1 A;  2AY9 A;  1GC3 A;  1X2A A;  2EZ1 A;  2DR1 A;  3B8X A;  4MQR A;  4OTL A;  4A6T A;  3EIB A;  1DJE A;  2CH2 A;  8AAT A;  1LC7 A;  3NX3 A;  4F5M A;  3FQ7 A;  3W1H A;  4J5U A;  3DR4 A;  1OXO A;  4F5K A;  3UAK A;  1GBN A;  2QMA A;  3FKD A;  2EZ2 A;  1AIB A;  4A6R A;  3I16 A;  1KKP A;  1BQD A;  3K40 A;  3B1E A;  1B9I A;  3PPL A;  4A0H A;  4KYO A;  2VIB A;  2AAT A;  1PG8 A;  1IAX A;  2BI9 A;  1WKG A;  2Z9V A;  4IXS A;  3MEB A;  1U08 A;  5AX8 A;  1LW4 A;  5DB5 A;  2HOR A;  2E7J A;  4K2I A;  1JG8 A;  2FN6 A;  1LC5 A;  3HLM A;  3ISL A;  2BWO A;  1X0M A;  4FFC A;  4IW7 A;  4MQP A;  3MAU A;  3GWP A;  2GB3 A;  1TOG A;  2RFV A;  1CQ6 A;  2HZP A;  3DXW A;  2VLF A;  1LS3 A;  3R9A A;  1GEX A;  3FDB A;  3LG0 A;  3DC1 A;  1CS1 A;  4OMA A;  5E3K A;  1KMK A;  4ZDO A;  4L0O A;  3RQ1 A;  5M46 A;  2QBT A;  4UHN A;  1OHY A;  5E4Z A;  1AY4 A;  4W8I A;  4WYE A;  3RBF A;  4CXQ A;  2CST A;  3QN6 A;  3IF2 A;  2ZY4 A;  1MAQ A;  3GET A;  2VMS A;  4N0W A;  5E5I A;  2X3L A;  3Q8N A;  3WKR A;  4H51 A;  2CIN A;  4RAE A;  1VP4 A;  2CB1 A;  1GC2 A;  5FT5 A;  5M4B A;  4WYF A;  1SFF A;  1N8P A;  2W7K A;  4WYD A; 
#chains in the Genus database with same CATH topology
 1UU0 A;  3HMU A;  4M2M A;  3E2Z A;  3AEP A;  2DGK A;  3CQ6 A;  4XQ2 A;  2C0R A;  3A9Z A;  1AJS B;  1BW0 A;  3G8M A;  4HVK A;  1AHY A;  3QI6 A;  3BN1 A;  1EJI A;  1BJW A;  2VGW A;  1QZ9 A;  2YCT A;  2YKY A;  1ORD A;  2WK8 A;  3JTX A;  2C7T A;  4WYC A;  1P3W A;  2VMO A;  1OHW A;  3KGX A;  3PD6 B;  4WB0 A;  3T32 A;  4F5G A;  3A9Y A;  1BJ4 A;  1TAS A;  2Z1Z A;  2ZUK A;  1WYU A;  1XI9 A;  4WXF A;  1ARI A;  4RJ0 A;  3PDB A;  3F0H A;  2W7J A;  4A72 A;  1EG5 A;  4A0R A;  1MLY A;  1AMR A;  4NOG A;  3G0T A;  2ZY5 A;  4IYO B;  1O4S A;  1ARH A;  2AY8 A;  2CJD A;  3FTB A;  4W91 A;  4IX8 A;  1W7L A;  3R4T A;  4GRX A;  1IX8 A;  5DX5 A;  2XH1 A;  1AAM A;  2AY7 A;  4ZM3 A;  1D7S A;  3COG A;  2G7J A;  4RM1 A;  3ZZJ A;  1G7W A;  1G7X A;  2WB6 A;  4XAU A;  4JF0 A;  2ZY2 A;  1ELU A;  3TCM A;  1C0N A;  4EMY A;  1DKA A;  3NYT A;  1QJ5 A;  4WBT A;  3FZ8 A;  4JEV A;  3ECD A;  3N4R A;  2F8J A;  2OAT A;  2ZSM A;  3B1C A;  1ASE A;  1V2E A;  1G4V A;  2D5Y A;  2D63 A;  3D6K A;  4A6U A;  4IXO A;  1VJO A;  1CL1 A;  2CH1 A;  1T3I A;  4QGR A;  3WGC A;  1MDX A;  2JJF A;  4CXR A;  3RI6 A;  4CVQ A;  2VMR A;  2E54 A;  2AEV A;  1S08 A;  2VMX A;  1Y4I A;  4JE5 D;  3WLX A;  4MY5 A;  2FNU A;  4M2K A;  4U1T A;  2V1P A;  4JEY A;  2JJH A;  3FZ6 A;  2X5F A;  3EI6 A;  5FT8 A;  1B9H A;  4BA5 A;  3NRA A;  4XK1 A;  5G2Q A;  1KKJ A;  3HT4 A;  1MDO A;  2JJE A;  4ZSY A;  1OXP A;  4AO9 A;  4R2N A;  1M0N A;  4W5K A;  3GZD A;  3QBO A;  4E3Q A;  5TF5 A;  3LV2 A;  4M2J A;  3RBL A;  3VP6 A;  3FVU A;  5BJ4 A;  2BIA A;  4W1X A;  4WLH A;  4ATP A;  2D7Z A;  3VOM A;  3AAT A;  1MAP A;  4UHM A;  7AAT A;  2HUU A;  1N31 A;  1V2F A;  1M32 A;  3K7Y A;  3ZRQ A;  3JWB A;  5F8V A;  5KTB A;  4K2M A;  2DGM A;  2HUF A;  3GBX A;  4UOY A;  2FKI A;  4WXG A;  1BT4 A;  4WYG A;  2EYQ A;  3MBB A;  2EO5 A;  3PAA A;  2D61 A;  4TMR A;  3NNK A;  3DR7 A;  3II0 A;  4MKJ A;  2KFP A;  2FYF A;  1AY5 A;  5JAY A;  5EIG A;  1M0Q A;  2Z67 A;  3VK2 A;  1PMO A;  2Z1Y A;  4LNM A;  2R5C B;  1CQ8 A;  3JW9 A;  4FL0 A;  4LW4 A;  4OBU A;  4BQ0 A;  1ECX A;  1S06 A;  3H7F A;  1WKH A;  3BWO A;  3KKI A;  1M0P A;  2Z20 A;  3EI9 A;  3EZS A;  4XJP A;  2JJG A;  4ISY A;  4BHD A;  1GEW A;  5HHY A;  3BS8 A;  3P1T A;  2YCN A;  1TOK A;  2W7E A;  1ASL A;  2W7L A;  2AY3 A;  4ITG A;  2OQX A;  3QPG A;  4F5H A;  1QIR A;  3BC8 A;  4R8D A;  3LY1 A;  2VI8 A;  3UE8 A;  4PVF A;  3FSL A;  3IHJ A;  1C7O A;  1DTY A;  1IAY A;  1SZS A;  2ZJG A;  3A2B A;  2FNI A;  3ZRR A;  3OKS A;  2DGL A;  3BB8 A;  4A0F A;  2A1V A;  3H14 A;  3DXV A;  3CQ4 A;  2V0Y A;  4JEW A;  3B1D A;  2OKJ A;  3MAD A;  4LC3 A;  3TQX A;  1Z7D A;  4ZWV A;  1DJU A;  2YOB A;  4RKD A;  1YJY A;  2W8W A;  2CAN A;  1DFO A;  4EU1 A;  5BJ3 A;  1BJO A;  1DGE A;  4ZDP A;  1O62 A;  2W8V A;  9AAT A;  5D95 A;  3PIU A;  3DU4 A;  2ZSL A;  3HVY A;  3MC6 A;  2D66 A;  5EUE A;  2W7D A;  3DYD A;  4R5Z A;  1TAR A;  1X28 A;  2PB2 A;  3L8A A;  3TAT A;  1AKA A;  3AEJ A;  4ZDL A;  1IVR A;  3ZZK A;  4EB7 A;  3FD0 A;  1M7Y A;  3N75 A;  4XJL A;  3N4S A;  3ASA A;  1V2D A;  1SPA A;  2JIS A;  3EI7 A;  1TPL A;  3PDX A;  4LNL A;  2QB3 A;  1J04 A;  1JS3 A;  2Z9X A;  4JEZ A;  4Q6R A;  4WYA A;  1I43 A;  5I92 A;  2BHX A;  3P6K A;  3BV0 A;  2Z61 A;  1YOO A;  1M0O A;  3NYS A;  2VMY A;  3MAF B;  2YKV A;  1MLZ A;  4E77 A;  4ZAS A;  1X29 A;  2C44 A;  2VMN A;  3WX9 A;  3WZF A;  4GSA A;  3GSB A;  1XEY A;  5G4I A;  2YHK A;  3GR9 A;  4K2B A;  2YCP A;  1ARG A;  3LWS A;  4F5J A;  4GEB A;  3RCH B;  1AAW A;  4W1W A;  1IX6 A;  4IY7 A;  1AMA A;  1J32 A;  4HF8 A;  4BA4 A;  3EZ1 A;  1RV4 A;  2W7G A;  1AKB A;  4A0G A;  3GZD C;  1DJ9 A;  5DJ1 A;  4PFF A;  2JG2 A;  1I41 A;  2Q7W A;  4OC9 A;  2TPL A;  3NU8 A;  1ASN A;  4Y0H A;  3LVK A;  3QGU A;  1JF9 A;  3GJU A;  3CQ5 A;  4A00 A;  3F6T A;  2QB2 A;  2W8T A;  2BYJ A;  1OHV A;  1GC4 A;  2WKA A;  3QM2 A;  5EQC A;  3DZZ A;  2XBN A;  1AX4 A;  4PIW A;  3ACZ A;  1CL2 A;  1D7R A;  1S0A A;  2HP1 A;  4B98 A;  4DBC A;  3E9K A;  3VK4 A;  3WGB A;  4Q76 A;  2AY2 A;  3AEM C;  2GMS A;  2QA3 A;  4PFN A;  3AOV A;  3VK3 A;  1ELQ A;  3A8U X;  3MKJ A;  2Z9W A;  4LW2 A;  3FVX A;  1GD9 A;  4Q31 A;  1I29 A;  4MQQ A;  3WY7 A;  1TOJ A;  5K8B A;  3PA9 A;  3HDO A;  1D7V A;  1E5E A;  2WK7 A;  3E2Y A;  4E3R A;  2VMQ A;  1FC4 A;  2HOY A;  1PFF A;  1QJ3 A;  1SF2 A;  2ZYJ A;  1ART A;  2VYC A;  4EB5 A;  2BIG A;  4TN4 A;  2HOZ A;  2OGE A;  4WLJ A;  3AEM A;  1KAF A;  2JGT A;  2BI3 A;  4E1O A;  1D7U A;  5HXX A;  4Y0I A;  3FRK A;  1QIS A;  3PD6 A;  5M4D A;  2W8J A;  4U2H A;  4EFF A;  1QIT A;  1ARS A;  1ZOD A;  3G7Q A;  1IJI A;  1FG3 A;  2WK9 A;  2VIA A;  3FQA A;  3W1J A;  2BYL A;  1M6S A;  3LVM A;  2BI1 A;  3RUY A;  2VMW A;  2QSR A;  4AO4 A;  5LHA A;  1YAA A;  1B5P A;  5C6U A;  1SZK A;  2CY8 A;  2R2N A;  2YRR A;  2D7Y A;  2NMP A;  4UHO A;  5F9S A;  3E77 A;  3FFH A;  1LKC A;  2VMV A;  2G6W A;  1WST A;  1CZE A;  2YRI A;  3BCA A;  4N0B A;  3RCH A;  2OKK A;  1AY8 A;  4GE7 A;  3TFT A;  1AIA A;  1IUG A;  3HL2 A;  1VEF A;  4ZWM A;  1S09 A;  4P7Y A;  2O1B A;  4O6Z A;  1KMJ A;  2GMU A;  3KE3 A;  2BIE A;  5G09 A;  2GSA A;  2FQ6 A;  3FFR A;  4ADC A;  1WYV A;  4Q75 A;  4F4E A;  4W1V A;  4AOA A;  2VMT A;  4ATQ A;  3F9T A;  4WD2 A;  4JE5 A;  2YKU A;  5IWQ A;  1W23 A;  1JS6 A;  1EQB A;  4R5F A;  3ELP A;  4ZSW A;  1YIY A;  4CBS A;  4TV7 A;  4AZK A;  2AY5 A;  3EIA A;  5G4J A;  1O61 A;  2R5E A;  1ASC A;  1UKJ A;  4P3M A;  1FG7 A;  1YJS A;  1ASF A;  4ADE A;  5FT6 A;  1LK9 A;  2VGS A;  4AH3 A;  2PO3 A;  2VGZ A;  1RV3 A;  2W8U A;  3FZ7 A;  3DRD A;  1DGD A;  5FT4 A;  3MC6 C;  1G4X A;  3QHX A;  1O69 A;  2BWN A;  1ZC9 A;  1CJ0 A;  3JU7 A;  3AEJ C;  4LNJ A;  4JEX A;  5EAV A;  3N5M A;  2D64 A;  3H9X A;  4XJM A;  1TAT A;  1W7M A;  4MKK A;  4OBV A;  1LC8 A;  3KGW A;  2PB0 A;  1KL2 A;  3FVS A;  1TOI A;  5EUN A;  3L44 A;  1CZC A;  1W7N A;  1BJO B;  2C81 A;  3EI8 A;  1BJN A;  3E6G A;  1AJS A;  1BS0 A;  1OAT A;  2AY6 A;  5EFS A;  1RVU A;  4K05 A;  2CFB A;  4H63 Q;  4J8L A;  3FDD A;  4MGR A;  4GE9 A;  1ASG A;  4F5L A;  2VMZ A;  5J8Q A;  3B46 A;  2X5D A;  1AHE A;  1B8G A;  1MGV A;  3A9X A;  3HBX A;  4DQ6 A;  2DOU A;  1N2T A;  2D65 A;  2ZY3 A;  1WYT A;  1IBJ A;  5EUD A;  2CJH A;  4RJY A;  1SZU A;  1W3U A;  2DKJ A;  2VGU A;  3EI5 A;  3FCR A;  3NUI A;  4WXB A;  5LH9 A;  2VLH A;  2W7F A;  2QLR A;  1ZOB A;  2EGY A;  3AEN B;  3NU7 A;  1ASA A;  5EAA A;  4AZJ A;  3ATH A;  3JZL A;  1AHG A;  3LVJ A;  4IXZ A;  2AEU A;  4KAM A;  1GDE A;  3BWN C;  1PMM A;  1I48 A;  1GEY A;  2DKB A;  4ADD A;  2EPJ A;  1AHF A;  3N0L A;  4ITX A;  4ZM4 A;  2W7M A;  2HUI A;  3NYU A;  4MSO A;  2O7C A;  2E7U A;  3NDN A;  2VGT A;  1WYV B;  4ZAH A;  3AV7 A;  3FQ8 A;  5M49 A;  4RKC A;  2FM1 A;  3E2Z B;  3VAX A;  4WP0 A;  1V72 A;  2O0R A;  1RVY A;  2VMP A;  2ZC0 A;  2E7I A;  3ELE A;  2BWP A;  2YKX A;  5EIG B;  3JWA A;  3BWN A;  5D5S A;  2VI9 A;  4JF1 A;  3I4J A;  3WCO A;  4RIZ A;  2W7H A;  3I5T A;  1TOE A;  4BMK A;  2ORD A;  1S07 A;  1LW5 A;  2R0T A;  1AJR A;  1GC0 A;  5HDM A;  3BCB A;  2ZP7 A;  3CBF A;  1SVV A;  4GE4 A;  4WB0 B;  4DGT A;  2X8U A;  3AOW A;  1C7G A;  3DOD A;  1AKC A;  4XJO A;  4F5I A;  1YIZ A;  3ASB A;  5DJ9 A;  4ZLV A;  1MDZ A;  2GQN A;  4RIT A;  4UQV A;  2Z9U A;  3BCX A;  3USF A;  3MAF A;  4IYO A;  1H1C A;  2AY1 A;  1UU2 A;  3ZRP A;  1B4X A;  1C9C A;  2HOX A;  3HQT A;  2OGA A;  3WCN A;  1H0C A;  1QGN A;  2VGV A;  1AMQ A;  1AMS A;  3AEO A;  3K28 A;  2CTZ A;  1IX7 A;  3W1I A;  3M5U A;  4GDY A;  2BKW A;  4ADB A;  3AEL A;  1CQ7 A;  2CJG A;  3LVL B;  1ASB A;  1GCK A;  4I8A A;  1ASD A;  4XEW A;  1BKG A;  3E2F A;  3NUB A;  1BQA A;  3PJ0 A;  1C4K A;  2BI5 A;  4RLG A;  2W7I A;  3CAI A;  3EUC A;  3PGY A;  4OCA A;  2HP2 A;  1E5F A;  5G0A A;  5G2P A;  1C7N A;  1WYT B;  2EH6 A;  2R5C A;  3TFU A;  4KXK A;  2VMU A;  1B5O A;  4B9B A;  3UWC A;  1AIC A;  4CBR A;  2AY4 A;  1ASM A;  3OP7 A;  1Z3Z A;  1D2F A;  4OT8 A;  3GZC A;  1UU1 A;  2BI2 A;  1M4N A;  1YJZ A;  3AEN A;  4F5F A;  1WYU B;  3NTJ A;  4Y0D A;  3WKS A;  3N4X A;  1YNU A;  1AHX A;  3PDB B;  4OYT A;  1KL1 A;  2AY9 A;  1GC3 A;  1X2A A;  2EZ1 A;  2DR1 A;  3B8X A;  4MQR A;  4OTL A;  4A6T A;  3EIB A;  1DJE A;  2CH2 A;  8AAT A;  1LC7 A;  3NX3 A;  4F5M A;  3FQ7 A;  3W1H A;  4J5U A;  3DR4 A;  1OXO A;  4F5K A;  3UAK A;  1GBN A;  2QMA A;  3FKD A;  2EZ2 A;  1AIB A;  4A6R A;  3I16 A;  1KKP A;  1BQD A;  3K40 A;  3B1E A;  1B9I A;  3PPL A;  4A0H A;  4KYO A;  2VIB A;  3N7N A;  2AAT A;  1PG8 A;  1IAX A;  2BI9 A;  1WKG A;  2Z9V A;  4IXS A;  3MEB A;  1U08 A;  5AX8 A;  1LW4 A;  5DB5 A;  2HOR A;  2E7J A;  4K2I A;  1JG8 A;  2FN6 A;  1LC5 A;  3HLM A;  3ISL A;  2BWO A;  1X0M A;  4FFC A;  4IW7 A;  4MQP A;  3MAU A;  3GWP A;  2GB3 A;  1TOG A;  2RFV A;  1CQ6 A;  2HZP A;  3DXW A;  2VLF A;  1LS3 A;  3R9A A;  1GEX A;  3FDB A;  3LG0 A;  3DC1 A;  1CS1 A;  4OMA A;  5E3K A;  1KMK A;  4ZDO A;  4L0O A;  3RQ1 A;  5M46 A;  2QBT A;  4UHN A;  1OHY A;  5E4Z A;  1AY4 A;  4W8I A;  4WYE A;  3RBF A;  4CXQ A;  2CST A;  3QN6 A;  3IF2 A;  2ZY4 A;  1MAQ A;  3GET A;  2VMS A;  4N0W A;  5E5I A;  2X3L A;  3Q8N A;  3WKR A;  4H51 A;  2CIN A;  4RAE A;  1VP4 A;  2CB1 A;  1GC2 A;  5FT5 A;  5M4B A;  4WYF A;  1SFF A;  1N8P A;  2W7K A;  4WYD A; 
#chains in the Genus database with same CATH homology
 1UU0 A;  3HMU A;  4M2M A;  3E2Z A;  3AEP A;  2DGK A;  3CQ6 A;  4XQ2 A;  2C0R A;  3A9Z A;  1AJS B;  1BW0 A;  3G8M A;  4HVK A;  1AHY A;  3QI6 A;  3BN1 A;  1EJI A;  1BJW A;  2VGW A;  1QZ9 A;  2YCT A;  2YKY A;  1ORD A;  2WK8 A;  3JTX A;  2C7T A;  4WYC A;  1P3W A;  2VMO A;  1OHW A;  3KGX A;  3PD6 B;  4WB0 A;  3T32 A;  4F5G A;  3A9Y A;  1BJ4 A;  1TAS A;  2Z1Z A;  2ZUK A;  1WYU A;  1XI9 A;  4WXF A;  1ARI A;  4RJ0 A;  3PDB A;  3F0H A;  2W7J A;  4A72 A;  1EG5 A;  4A0R A;  1MLY A;  1AMR A;  4NOG A;  3G0T A;  2ZY5 A;  4IYO B;  1O4S A;  1ARH A;  2AY8 A;  2CJD A;  3FTB A;  4W91 A;  4IX8 A;  1W7L A;  3R4T A;  4GRX A;  1IX8 A;  5DX5 A;  2XH1 A;  1AAM A;  2AY7 A;  4ZM3 A;  1D7S A;  3COG A;  2G7J A;  4RM1 A;  3ZZJ A;  1G7W A;  1G7X A;  2WB6 A;  4XAU A;  4JF0 A;  2ZY2 A;  1ELU A;  3TCM A;  1C0N A;  4EMY A;  1DKA A;  3NYT A;  1QJ5 A;  4WBT A;  3FZ8 A;  4JEV A;  3ECD A;  3N4R A;  2F8J A;  2OAT A;  2ZSM A;  3B1C A;  1ASE A;  1V2E A;  1G4V A;  2D5Y A;  2D63 A;  3D6K A;  4A6U A;  4IXO A;  1VJO A;  1CL1 A;  2CH1 A;  1T3I A;  4QGR A;  3WGC A;  1MDX A;  2JJF A;  4CXR A;  3RI6 A;  4CVQ A;  2VMR A;  2E54 A;  2AEV A;  1S08 A;  2VMX A;  1Y4I A;  4JE5 D;  3WLX A;  4MY5 A;  2FNU A;  4M2K A;  4U1T A;  2V1P A;  4JEY A;  2JJH A;  3FZ6 A;  2X5F A;  3EI6 A;  5FT8 A;  1B9H A;  4BA5 A;  3NRA A;  4XK1 A;  5G2Q A;  1KKJ A;  3HT4 A;  1MDO A;  2JJE A;  4ZSY A;  1OXP A;  4AO9 A;  4R2N A;  1M0N A;  4W5K A;  3GZD A;  3QBO A;  4E3Q A;  5TF5 A;  3LV2 A;  4M2J A;  3RBL A;  3VP6 A;  3FVU A;  5BJ4 A;  2BIA A;  4W1X A;  4WLH A;  4ATP A;  2D7Z A;  3VOM A;  3AAT A;  1MAP A;  4UHM A;  7AAT A;  2HUU A;  1N31 A;  1V2F A;  1M32 A;  3K7Y A;  3ZRQ A;  3JWB A;  5F8V A;  5KTB A;  4K2M A;  2DGM A;  2HUF A;  3GBX A;  4UOY A;  2FKI A;  4WXG A;  1BT4 A;  4WYG A;  2EYQ A;  3MBB A;  2EO5 A;  3PAA A;  2D61 A;  4TMR A;  3NNK A;  3DR7 A;  3II0 A;  4MKJ A;  2KFP A;  2FYF A;  1AY5 A;  5JAY A;  5EIG A;  1M0Q A;  2Z67 A;  3VK2 A;  1PMO A;  2Z1Y A;  4LNM A;  2R5C B;  1CQ8 A;  3JW9 A;  4FL0 A;  4LW4 A;  4OBU A;  4BQ0 A;  1ECX A;  1S06 A;  3H7F A;  1WKH A;  3BWO A;  3KKI A;  1M0P A;  2Z20 A;  3EI9 A;  3EZS A;  4XJP A;  2JJG A;  4ISY A;  4BHD A;  1GEW A;  5HHY A;  3BS8 A;  3P1T A;  2YCN A;  1TOK A;  2W7E A;  1ASL A;  2W7L A;  2AY3 A;  4ITG A;  2OQX A;  3QPG A;  4F5H A;  1QIR A;  3BC8 A;  4R8D A;  3LY1 A;  2VI8 A;  3UE8 A;  4PVF A;  3FSL A;  3IHJ A;  1C7O A;  1DTY A;  1IAY A;  1SZS A;  2ZJG A;  3A2B A;  2FNI A;  3ZRR A;  3OKS A;  2DGL A;  3BB8 A;  4A0F A;  2A1V A;  3H14 A;  3DXV A;  3CQ4 A;  2V0Y A;  4JEW A;  3B1D A;  2OKJ A;  3MAD A;  4LC3 A;  3TQX A;  1Z7D A;  4ZWV A;  1DJU A;  2YOB A;  4RKD A;  1YJY A;  2W8W A;  2CAN A;  1DFO A;  4EU1 A;  5BJ3 A;  1BJO A;  1DGE A;  4ZDP A;  1O62 A;  2W8V A;  9AAT A;  5D95 A;  3PIU A;  3DU4 A;  2ZSL A;  3HVY A;  3MC6 A;  2D66 A;  5EUE A;  2W7D A;  3DYD A;  4R5Z A;  1TAR A;  1X28 A;  2PB2 A;  3L8A A;  3TAT A;  1AKA A;  3AEJ A;  4ZDL A;  1IVR A;  3ZZK A;  4EB7 A;  3FD0 A;  1M7Y A;  3N75 A;  4XJL A;  3N4S A;  3ASA A;  1V2D A;  1SPA A;  2JIS A;  3EI7 A;  1TPL A;  3PDX A;  4LNL A;  2QB3 A;  1J04 A;  1JS3 A;  2Z9X A;  4JEZ A;  4Q6R A;  4WYA A;  1I43 A;  5I92 A;  2BHX A;  3P6K A;  3BV0 A;  2Z61 A;  1YOO A;  1M0O A;  3NYS A;  2VMY A;  3MAF B;  2YKV A;  1MLZ A;  4E77 A;  4ZAS A;  1X29 A;  2C44 A;  2VMN A;  3WX9 A;  3WZF A;  4GSA A;  3GSB A;  1XEY A;  5G4I A;  2YHK A;  3GR9 A;  4K2B A;  2YCP A;  1ARG A;  3LWS A;  4F5J A;  4GEB A;  3RCH B;  1AAW A;  4W1W A;  1IX6 A;  4IY7 A;  1AMA A;  1J32 A;  4HF8 A;  4BA4 A;  3EZ1 A;  1RV4 A;  2W7G A;  1AKB A;  4A0G A;  3GZD C;  1DJ9 A;  5DJ1 A;  4PFF A;  2JG2 A;  1I41 A;  2Q7W A;  4OC9 A;  2TPL A;  3NU8 A;  1ASN A;  4Y0H A;  3LVK A;  3QGU A;  1JF9 A;  3GJU A;  3CQ5 A;  4A00 A;  3F6T A;  2QB2 A;  2W8T A;  2BYJ A;  1OHV A;  1GC4 A;  2WKA A;  3QM2 A;  5EQC A;  3DZZ A;  2XBN A;  1AX4 A;  4PIW A;  3ACZ A;  1CL2 A;  1D7R A;  1S0A A;  2HP1 A;  4B98 A;  4DBC A;  3E9K A;  3VK4 A;  3WGB A;  4Q76 A;  2AY2 A;  3AEM C;  2GMS A;  2QA3 A;  4PFN A;  3AOV A;  3VK3 A;  1ELQ A;  3A8U X;  3MKJ A;  2Z9W A;  4LW2 A;  3FVX A;  1GD9 A;  4Q31 A;  1I29 A;  4MQQ A;  3WY7 A;  1TOJ A;  5K8B A;  3PA9 A;  3HDO A;  1D7V A;  1E5E A;  2WK7 A;  3E2Y A;  4E3R A;  2VMQ A;  1FC4 A;  2HOY A;  1PFF A;  1QJ3 A;  1SF2 A;  2ZYJ A;  1ART A;  2VYC A;  4EB5 A;  2BIG A;  4TN4 A;  2HOZ A;  2OGE A;  4WLJ A;  3AEM A;  2JGT A;  2BI3 A;  4E1O A;  1D7U A;  5HXX A;  4Y0I A;  3FRK A;  1QIS A;  3PD6 A;  5M4D A;  2W8J A;  4U2H A;  4EFF A;  1QIT A;  1ARS A;  1ZOD A;  3G7Q A;  1IJI A;  1FG3 A;  2WK9 A;  2VIA A;  3FQA A;  3W1J A;  2BYL A;  1M6S A;  3LVM A;  2BI1 A;  3RUY A;  2VMW A;  2QSR A;  4AO4 A;  5LHA A;  1YAA A;  1B5P A;  5C6U A;  1SZK A;  2CY8 A;  2R2N A;  2YRR A;  2D7Y A;  2NMP A;  4UHO A;  5F9S A;  3E77 A;  3FFH A;  1LKC A;  2VMV A;  2G6W A;  1WST A;  1CZE A;  2YRI A;  3BCA A;  4N0B A;  3RCH A;  2OKK A;  1AY8 A;  4GE7 A;  3TFT A;  1AIA A;  1IUG A;  3HL2 A;  1VEF A;  4ZWM A;  1S09 A;  4P7Y A;  2O1B A;  4O6Z A;  1KMJ A;  2GMU A;  3KE3 A;  2BIE A;  5G09 A;  2GSA A;  2FQ6 A;  3FFR A;  4ADC A;  1WYV A;  4Q75 A;  4F4E A;  4W1V A;  4AOA A;  2VMT A;  4ATQ A;  3F9T A;  4WD2 A;  4JE5 A;  2YKU A;  5IWQ A;  1W23 A;  1JS6 A;  1EQB A;  4R5F A;  3ELP A;  4ZSW A;  1YIY A;  4CBS A;  4TV7 A;  4AZK A;  2AY5 A;  3EIA A;  5G4J A;  1O61 A;  2R5E A;  1ASC A;  1UKJ A;  4P3M A;  1FG7 A;  1YJS A;  1ASF A;  4ADE A;  5FT6 A;  1LK9 A;  2VGS A;  4AH3 A;  2PO3 A;  2VGZ A;  1RV3 A;  2W8U A;  3FZ7 A;  3DRD A;  1DGD A;  5FT4 A;  3MC6 C;  1G4X A;  3QHX A;  1O69 A;  2BWN A;  1ZC9 A;  1CJ0 A;  3JU7 A;  3AEJ C;  4LNJ A;  4JEX A;  5EAV A;  3N5M A;  2D64 A;  3H9X A;  4XJM A;  1TAT A;  1W7M A;  4MKK A;  4OBV A;  1LC8 A;  3KGW A;  2PB0 A;  1KL2 A;  3FVS A;  1TOI A;  5EUN A;  3L44 A;  1CZC A;  1W7N A;  1BJO B;  2C81 A;  3EI8 A;  1BJN A;  3E6G A;  1AJS A;  1BS0 A;  1OAT A;  2AY6 A;  5EFS A;  1RVU A;  4K05 A;  2CFB A;  4H63 Q;  4J8L A;  3FDD A;  4MGR A;  4GE9 A;  1ASG A;  4F5L A;  2VMZ A;  5J8Q A;  3B46 A;  2X5D A;  1AHE A;  1B8G A;  1MGV A;  3A9X A;  3HBX A;  4DQ6 A;  2DOU A;  1N2T A;  2D65 A;  2ZY3 A;  1WYT A;  1IBJ A;  5EUD A;  2CJH A;  4RJY A;  1SZU A;  1W3U A;  2DKJ A;  2VGU A;  3EI5 A;  3FCR A;  3NUI A;  4WXB A;  5LH9 A;  2VLH A;  2W7F A;  2QLR A;  1ZOB A;  2EGY A;  3AEN B;  3NU7 A;  1ASA A;  5EAA A;  4AZJ A;  3ATH A;  3JZL A;  1AHG A;  3LVJ A;  4IXZ A;  2AEU A;  4KAM A;  1GDE A;  3BWN C;  1PMM A;  1I48 A;  1GEY A;  2DKB A;  4ADD A;  2EPJ A;  1AHF A;  3N0L A;  4ITX A;  4ZM4 A;  2W7M A;  2HUI A;  3NYU A;  4MSO A;  2O7C A;  2E7U A;  3NDN A;  2VGT A;  1WYV B;  4ZAH A;  3AV7 A;  3FQ8 A;  5M49 A;  4RKC A;  2FM1 A;  3E2Z B;  3VAX A;  4WP0 A;  1V72 A;  2O0R A;  1RVY A;  2VMP A;  2ZC0 A;  2E7I A;  3ELE A;  2BWP A;  2YKX A;  5EIG B;  3JWA A;  3BWN A;  5D5S A;  2VI9 A;  4JF1 A;  3I4J A;  3WCO A;  4RIZ A;  2W7H A;  3I5T A;  1TOE A;  4BMK A;  2ORD A;  1S07 A;  1LW5 A;  2R0T A;  1AJR A;  1GC0 A;  5HDM A;  3BCB A;  2ZP7 A;  3CBF A;  1SVV A;  4GE4 A;  4WB0 B;  4DGT A;  2X8U A;  3AOW A;  1C7G A;  3DOD A;  1AKC A;  4XJO A;  4F5I A;  1YIZ A;  3ASB A;  5DJ9 A;  4ZLV A;  1MDZ A;  2GQN A;  4RIT A;  4UQV A;  2Z9U A;  3BCX A;  3USF A;  3MAF A;  4IYO A;  1H1C A;  2AY1 A;  1UU2 A;  3ZRP A;  1B4X A;  1C9C A;  2HOX A;  3HQT A;  2OGA A;  3WCN A;  1H0C A;  1QGN A;  2VGV A;  1AMQ A;  1AMS A;  3AEO A;  3K28 A;  2CTZ A;  1IX7 A;  3W1I A;  3M5U A;  4GDY A;  2BKW A;  4ADB A;  3AEL A;  1CQ7 A;  2CJG A;  3LVL B;  1ASB A;  1GCK A;  4I8A A;  1ASD A;  4XEW A;  1BKG A;  3E2F A;  3NUB A;  1BQA A;  3PJ0 A;  1C4K A;  2BI5 A;  4RLG A;  2W7I A;  3CAI A;  3EUC A;  3PGY A;  4OCA A;  2HP2 A;  1E5F A;  5G0A A;  5G2P A;  1C7N A;  1WYT B;  2EH6 A;  2R5C A;  3TFU A;  4KXK A;  2VMU A;  1B5O A;  4B9B A;  3UWC A;  1AIC A;  4CBR A;  2AY4 A;  1ASM A;  3OP7 A;  1Z3Z A;  1D2F A;  4OT8 A;  3GZC A;  1UU1 A;  2BI2 A;  1M4N A;  1YJZ A;  3AEN A;  4F5F A;  1WYU B;  3NTJ A;  4Y0D A;  3WKS A;  3N4X A;  1YNU A;  1AHX A;  3PDB B;  4OYT A;  1KL1 A;  2AY9 A;  1GC3 A;  1X2A A;  2EZ1 A;  2DR1 A;  3B8X A;  4MQR A;  4OTL A;  4A6T A;  3EIB A;  1DJE A;  2CH2 A;  8AAT A;  1LC7 A;  3NX3 A;  4F5M A;  3FQ7 A;  3W1H A;  4J5U A;  3DR4 A;  1OXO A;  4F5K A;  3UAK A;  1GBN A;  2QMA A;  3FKD A;  2EZ2 A;  1AIB A;  4A6R A;  3I16 A;  1KKP A;  1BQD A;  3K40 A;  3B1E A;  1B9I A;  3PPL A;  4A0H A;  4KYO A;  2VIB A;  3N7N A;  2AAT A;  1PG8 A;  1IAX A;  2BI9 A;  1WKG A;  2Z9V A;  4IXS A;  3MEB A;  1U08 A;  5AX8 A;  1LW4 A;  5DB5 A;  2HOR A;  2E7J A;  4K2I A;  1JG8 A;  2FN6 A;  1LC5 A;  3HLM A;  3ISL A;  2BWO A;  1X0M A;  4FFC A;  4IW7 A;  4MQP A;  3MAU A;  3GWP A;  2GB3 A;  1TOG A;  2RFV A;  1CQ6 A;  2HZP A;  3DXW A;  2VLF A;  1LS3 A;  3R9A A;  1GEX A;  3FDB A;  3LG0 A;  3DC1 A;  1CS1 A;  4OMA A;  5E3K A;  1KMK A;  4ZDO A;  4L0O A;  3RQ1 A;  5M46 A;  2QBT A;  4UHN A;  1OHY A;  5E4Z A;  1AY4 A;  4W8I A;  4WYE A;  3RBF A;  4CXQ A;  2CST A;  3QN6 A;  3IF2 A;  2ZY4 A;  1MAQ A;  3GET A;  2VMS A;  4N0W A;  5E5I A;  2X3L A;  3Q8N A;  3WKR A;  4H51 A;  2CIN A;  4RAE A;  1VP4 A;  2CB1 A;  1GC2 A;  5FT5 A;  5M4B A;  4WYF A;  1SFF A;  1N8P A;  2W7K A;  4WYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...