3ZRWA

The structure of the dimeric hamp-dhp fusion a291v mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AF1503 PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 41
structure length 111
sequence length 111
chains with identical sequence C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrwA00
1IXMA 4ZKIA 3A0RA 4LC1A 4U7OA 4JYBA 1JOYA 3MD0A 2C2AA 2LFRA 4FMTA 4MT8A 4KP4A 4GT1A 4MTXA 5B1OA 4U7NA 4GCZA 4Q20A 3ZRXA 4I5SA 4JYCA 3D36A 4JASA 3ZCCA 2WWWA 3DGEA 3ZRWA 3NXSA 5C93A 5B1NA 3P32A 4QPJA 4QPKA 2QM7A 2FTKA 3ZRVA 3ZRWB 4BIZA 3TK1A 1F51A 2P67A 2LFSA 4JAVA 4FPPA 5IDJA 4JAUA 2QM8A 4BIUA
chains in the Genus database with same CATH superfamily
2IH1C 2P4KA 2DYRB 2ZDIC 4H44B 1RP3B 1Y74A 2R9IA 3PN1A 2GUZB 1MMMA 1FXKC 1RSOB 1XHXA 2ZQMA 3K3WA 3H1JH 2RNBA 4LFAB 1TVKB 2R70A 3B77A 3FFQA 2CTQA 4FLZA 2F93B 2YICA 4X1IB 4JAVA 5GTIZ 2YXLA 4JYBA 1I0HA 4D7SA 1OCOC 3JAWB 2IJKA 5IYBO 2BTQB 1EZVH 3IGAC 1IBMO 4JYCA 4AILC 1RPRA 3NR7A 2FKXA 1YDXA 1Q6HA 3STLC 1MA1A 3DC5A 3JARB 5KUKA 4O2BB 3T1CA 1JX9A 4B7EA 2BSKA 4CS2A 3AK1A 3VQYA 1JFFA 4JYAO 1M56C 1PV0A 4FMTA 3BABA 2FMLA 5EYPA 1XMOB 4BWAA 2MW2B 1GMGA 1Y74B 3SJQC 4J10A 4K35A 1SERA 2DWEC 2YEVA 3ZS8C 4LF4B 2P06A 4O4JA 1S72V 4DR4O 3BEHA 5IJ0A 3OTOO 2JK5C 1GN4A 4X88A 4J7JA 1XMQO 3CCEV 5KHHA 4WF9V 4DV5O 1BQ0A 5LHGA 3ZEDA 3RGBA 4BW9A 4OPHA 1FJGB 3GWKC 1J5EB 3DTUB 2G38A 2EBOA 1MSDA 5E1AC 2HR3A 1JFFB 3JAMN 3HKBA 1Y76A 1BHAA 5EYPB 2E74B 1T5EA 4K0KO 2CAZC 3CB2A 5IDJA 3QO8A 3QO7A 1CXZB 1V55C 3AK3A 2YEVB 4UV8A 2P5OA 1JOYA 1AI6A 1OCCC 4LF6B 4X66O 1WB8A 4GX2A 1SA0A 5JVDA 2JVDA 5IJ0B 2OTJV 2JRIA 1TUBA 3JATA 4UCVA 4YY3O 1JJ2U 3FKSG 1EN6A 2OT5A 3P3PA 2A06H 1H2KA 3J7AU 2VQFB 4PA6A 4DV0O 1FAFA 4DR6O 1ZSPA 1XOUA 4I55A 2JJ1G 4IL6Z 4XDLA 2KB1A 3K08A 3U0ZA 4NYKA 2X6CA 5L3BA 1VQ6V 3D3IA 1QHTA 5B1AB 1AR4A 4X64B 2H8PC 1YVWA 5LGTA 2GBOA 2P90A 3D8CA 3K5OA 3SJBC 2HHHB 3HKBB 4JI7O 3ZHRA 1R1BA 1TAEA 1SQGA 2FL4A 2YIDA 5KHIA 3B4SA 1B6QA 2HJFC 4KHPB 3U11A 4CS4A 3K79A 4DR3O 3RN4A 2XASA 4KFMA 5EIBD 1VQ8V 3EXAA 5BMVA 1NVPD 3TXQA 5JVDB 5IJ9A 4PDVA 3KCYA 1HR0O 1TUBB 2RMKB 2AXTZ 3JATB 5CB4A 2GV9A 3N27A 3B2EE 3AG1C 2QA4V 2IU0A 2ZE7A 4UCRA 4NXMB 4DV7O 4DV1O 5BY1A 4I55B 3D36A 2UU9O 1EN5A 4JTAB 2L6LA 1QCEA 3MDSA 4J9YB 4JGSA 4DV2O 1YSCA 1W0KG 3ZHSA 3KZIZ 4LWSA 1N32B 3E86A 1DF4A 2LFSA 1QU7A 2AW9A 5HFMA 4FLVA 3KKYA 2IJHA 3LSQA 2A3QA 1FXKA 2RDCA 4RO2A 1VIBA 1Q90D 3AG4B 1FPOA 1XBLA 1JQ0A 1AJNA 4TSFG 3FAVA 3E22A 1CP9A 2ZXWC 5BMVB 4N23A 2Z5UA 1QBZA 5IJ9B 4LP8A 4R6ZA 4DXWA 5H6RA 1FFXA 2QTOA 5CB4B 3ZRSA 3ETEA 2D2CB 2HJDA 3TJTA 2A7WA 2VWKA 1P4RA 1H2NA 3P30A 2JGUA 4DR5O 4DV3O 4JYYA 5LGNA 3ETDA 4DV4B 2KG7A 4JI0O 2Y4TA 4JI1O 1NTKH 3DSQA 1MSWD 4NXNB 3LDDA 4X62B 4UCOA 1G8MA 4B3RO 3CRAA 2ZM6B 1SZTA 1O9HA 3C90A 3OR6C 1FXKB 3OW2U 1XEQA 4J80A 5LA6A 2UXDB 4F4LA 5JJJB 4X8AA 4EKWA 2ZE6A 4EFBA 1Q6IA 3FAVB 1NI8A 3BRCA 2B5UA 5LBQA 2UXCB 1OCOB 1FFXB 1K5QA 2CTPA 1QQCA 1Z5VA 2KQXA 3N2GA 4RUFA 3E8HA 4YXWG 5LMNB 3Q4HA 2ZR2A 3APQA 1SQQH 4TV8A 1PL0A 4R7CA 4ZBMA 3C3TA 4QE7A 2W6JG 4LF9B 1XILA 1Y6XA 2W0FC 1I94B 4HNAA 1JMKC 3L74H 4TWKA 2Y48A 3T1HO 1P7BA 4YHHB 4B3SB 4DR2B 4FLYA 2KG7B 4PA7A 3CJHB 1M56B 1R3LC 1QR8A 3ZX6A 4JI4B 3CHXA 4UCSA 1SC5B 3BA9A 1H8HG 1QR9A 3IC7A 2IM9A 4JAUA 2XAGA 3CPWU 1K7DA 4IIJA 3OUFA 1KECA 1KYOF 1NU1H 1VQ7V 2X0LA 3ZRWA 1NR7A 2QJ1A 1GO3F 1R3JC 3JCUZ 3DXRA 3ASNC 1V9PA 2ZT9B 1U97A 2JIZG 3SR2C 2DN9A 2A0LA 3JASA 3N2GB 4U7OA 2Q7EA 4TV8B 2OWOA 3B40A 4XDKA 5GTHZ 4HNAB 5EBWC 3JSNA 4YIOA 1I08A 4UVBA 3H1IH 1BGYH 1UFIA 1JR9A 3O65A 2QKAA 4TQDA 5H9CA 2HLDG 2N74A 3ZMVA 1IDSA 1SETA 1QVGU 1M9NA 4DK0A 4G27B 2HP8A 3RYFB 4FM0A 1KP3A 5LP6C 4H37A 1N34B 4IIJB 1V55B 3T4DA 2LW1A 1OCCB 2ZINA 3JD3A 1WAZA 1D2DA 3ZRWB 4I0XA 4PD4F 1QNMA 4TV9A 2ZIOA 2CDYA 3K58A 3DXRB 3JSLA 4WFAV 4PDLA 5CMUA 2FB5A 1FFTB 1D5AA 5IYDO 1A32A 1D5NA 2CH7A 4HZ3A 1W59A 1AVMA 3JASB 1NH2B 1N33O 1WP7A 4X20A 4CS3A 3ABKC 2P6JA 2PF4E 4L8JA 3SPJA 4JI8B 4I7ZB 3D3QA 4P30A 4X1KA 1U96A 2DJVA 5CN0A 4P9OA 4LF8B 3SYOA 2UXBO 3K06A 5LMUO 2Z3YA 2Y0IA 4UXNA 1L8DA 3UO3A 4JI2B 2WLKA 3EHBB 1I5XA 1N0NA 2Q9LA 5JCOC 1R3KC 1VQ4V 4C7UA 2QM8A 2YIAA 4LH7A 5D5PA 1DK1A 1NJIW 1KD1W 1NKDA 2CGOA 3LSSA 3P3NA 2DMXA 3BY6A 4TV9B 5GW7A 4AI8A 4FFBA 2CK3G 1M93A 2OTLV 4CH3A 3LSUA 1YCIA 1MOFA 3AG1B 1AI5A 5IE9A 1S77D 1GAXA 1K92A 3CP1A 2IJJA 4GKJO 1HNZB 2WPDG 2Q7GA 3L75H 4X20B 4MVSA 5LL6Y 4O4IB 4JTCB 4WBNA 1WN7A 4JI6B 1NTMH 1XQ8A 2QM4A 4UCUA 3K5NA 1KB9F 2QSAA 2WWWA 4O4HB 2B1IA 2JEXA 1W2BU 4YJ3B 3K04A 3ZJZA 1HNWB 3CD6V 1ZUQA 4F6RA 3LDEA 2QR4A 1M1KW 4TOIA 3JD2A 2IW5A 2XAQA 4Z2WA 4JI3B 4GX0A 1PL4A 1R73A 4U3JA 4K3AA 3S3WA 1IBKO 1BQZA 3SPIA 3R66A 2ZXWB 2Q5ZA 4B3TB 2Q7HA 1R6TA 4FFBB 4D6TH 3CCLV 2EIJC 4I50B 4GZRB 3OFNG 3CWBH 1H2SB 4WCEV 3ZHQA 1JA8A 1K73W 3BFRA 2KSDA 1WLEA 2UUCB 3ABMC 5DECA 5LGUA 4DV6B 1LR1A 2XAJA 3RYCA 4WBNB 2WLIA 2AZ0A 4G2KA 1ENVA 4H0LB 3THOA 3CRQA 2Q67A 2DOSA 5BZBA 3SGIA 5B3SC 4O2AA 2KKWA 5CA0A 4OGQB 4CBCA 2YIBD 2ZE8A 1FJGO 1KBHA 1SQBH 4F6RB 4DUYB 1P49A 3JAKA 1YTFD 1K4CC 1XNRB 2P7TC 4QPJA 1AROP 1M57C 1F4NA 1K4DC 3FB8C 3ML0A 1RM1C 4LFCO 1SF9A 4OPAA 1K3EA 2Y4UA 3VOUA 4DO2A 4JAAA 4YJ2A 4LH6A 4J42A 2HEPA 1MZEA 4D7TA 1S76D 3VQXA 1F4MA 3WG7C 4W4KA 4FLTA 1PNKA 2CUGA 1L0NH 4JI5B 1NQTA 3I56V 3E89A 4UV9A 1DTOA 4ZKIA 2BSKB 3CC7V 4NB5A 2OYQA 1BS3A 4MW8A 1IXBA 2LP7A 1IBMB 4NTYA 3WU2Z 4O2AB 4I5SA 2E3CA 3OEEG 5CA0B 2DWDC 2ZR3A 5LP6A 1PNLA 5JJEB 4UB8Z 5EIBC 1N8RW 1P7GA 4X64O 1EBOA 4FM2A 3CX5F 4E4EA 2HHHO 3CMAV 5JQGA 1HDJA 4NTWA 1J95A 1VP7A 2QWQB 4BIUA 3OR7C 2CE4A 2PGGA 5BR8B 4JYAB 1PKXA 2EULA 2N05A 3ASNB 4KHPO 2XNDG 4O4JB 2F43G 3RBZA 3LUTB 3EFFK 4LCUC 4FVMA 3I55V 1B3QA 3CS5A 2BCCH 1Z5WA 4R8CA 3G4SV 1I5YA 2A9HA 1YHQV 4BR6A 2QM7A 5EBMC 2OIEA 4DR4B 1H8EG 3OTOB 3ETQA 2VQEB 3A0BZ 3K03A 3ZRXA 2LW7A 1M5IA 5IY5C 1XMQB 4E2LA 5KX5A 2H94A 1K5SA 2ODMA 4J41A 3ABTA 1VF6C 5LP6B 1G4YB 2DYSC 4FLUA 3H1LH 1BCCH 4H13B 5CBGA 5H2FZ 1Y76B 5JCOA 3L72H 2E5LO 4LR3A 1VQPV 5JQGB 5KLVH 1GN3A 2GDSA 4MTGA 1K34A 2HG5C 2UUBB 2IU3A 1SS3A 4ZI7A 5L3GA 2GTAA 3QVNA 4QE9A 4K0KB 1IBLO 3FB6C 2N04A 3JALA 1SA0B 1OHHG 2R9RB 2NN4A 2AGAA 1F7YA 3ABKB 3ZHVA 1K8AW 4TT3G 4GKKO 1WPBA 3JCZA 3RFRA 3CRMA 4X66B 4U7NA 1Y67A 2RQ6A 2QDOA 5IWAB 3CCVV 4FZ0A 4YY3B 3MHSC 3O9OA 1S5LZ 4PDMA 4R50A 4LFBB 1EM1A 4GUNA 4JZ2A 3X2QC 2Q4PA 5KX5B 4DV0B 2BOCC 1N36O 2JEUA 4DYLA 4DV4O 3HKDA 1B04A 3SYCA 2V4DA 4DR7O 2CTWA 1GH6A 2YI8A 3FYEB 2IBZH 1HWYA 3G71V 2ARHA 2Q0OC 1SKVA 3E8FA 3RW0A 3ABUA 3H1HH 2WLMA 4GX1A 5A2QN 2YC0A 1AP5A 4ZI7B 3ICXA 2UXDO 4LC1A 2Z0AA 4LF7O 2DE0X 1L0LH 1GRJA 4CZZA 1KKDA 1K9MW 3STZC 3H1KH 4MW3A 3RVZA 1AR1B 1BE3H 5EZYA 1HR0B 4RQEA 3G6BA 5J9PC 1OJHA 1I94O 4FM1A 2DW4A 4KP4A 4LWSB 1IURA 4YHHO 4DV7B 1VARA 4DV1B 4B3SO 4B3MO 3U10A 4NVPA 2UU9B 3HKDB 4X89A 1WA8A 4GX5A 3T4ZA 4DV2B 2LJ2A 4JI4O 2EX3A 3QTCA 2PUSA 2XUMA 3OMAB 1YIJV 4BIOA 2Q8VA 5LHHA 3FYIB 2EIJB 3UO2A 3CEIA 1AJPA 3K59A 3E22B 4MTFA 3ASOC 3M99B 2F4VO 3ABMB 3K57A 3P32A 3M8AA 4NTXA 1VQ5V 2UXNA 4WFBV 4ZOLA 1YJWV 3G67A 4PELA 1KU9A 4IT5A 4B08A 3OT7A 1VQLV 1JPXA 2JGDA 3TETA 5JH7A 3SPHA 4RQFA 1MZFA 5B3SB 3OD4A 1Q82W 2W0XA 3W7SA 3QNEA 4ZHQA 1FYJA 2Y69C 1Q7YW 3T1YO 4UVCA 1CPYA 1ZTEA 2W6IG 1GM9A 3DC6A 1WA8B 2EIMC 4DV3B 3CC4V 1O9GA 1FD9A 2F23A 4JI0B 1SESA 2A79B 4JI1B 1M57B 1QLEC 3BVOA 1AI4A 4MTXA 1ZWIC 4WFFA 3H9VA 1RM1B 1N34O 5LA6B 4EEQA 3H01A 3OEHG 4QGPA 4O4LA 3CRCA 4NR1A 4X1YA 1E79G 4CC6A 1K33A 1F51A 4WFGA 1XI1A 2NNUA 3N2KA 2UXXA 3ZBHA 1S5JA 3WG7B 4JV5B 2B9ZA 1R6NA 4PA9A 3AG7A 1VQ9V 3Q4HB 3UCSC 1TGOA 5A9GA 4L87A 5CBHA 2YXYA 2R9AA 1JCHA 1BZKA 1H2MA 3LNNA 4ABMA 2K1EA 4JI8O 4UUJC 1ZAUA 3CCMV 1GK9A 3APOA 1VF6A 2ZNIA 2P67A 4ZHQB 3SJAC 2AZ2A 4CC5A 1XNQB 5B66Z 3MHHC 3EVKA 2NLJC 2LGQA 1PD3A 2EIKC 1W0JG 4ICGA 3T2MA 3GVMA 4FIPC 1WP8A 3BAAA 4Z1MG 4JI2O 5FLXN 4DUZO 4O4LB 2R72A 3ZIAG 5IT9N 1FXHA 1ZX3A 1AP6A 1ORQC 4MVZA 5E79Z 1GKFA 1HW7A 2QEXV 4GT1A 2E75B 3N2KB 1YITV 3IAYA 4P9PA 5AG2A 4LBEC 1WJZA 1SRYA 2PI4A 5H6QA 5IY5B 5L3CA 1GM8A 1AI7A 1IX9A 4AQYB 5LOVA 4I9WA 2F66C 3MD0A 2XTAA 2DYSB 2P4VA 3OGIB 4DR1B 2UUAO 1LUWA 3UQ8A 3SPCA 2WA3A 1R6KA 4IHJA 1RPOA 1NBMG 1MG1A 5DEDA 1KKCA 1Q43A 3GB7C 4W4LA 2ITDC 3K5LA 1Q86W 3RWRD 1N0JA 1IXMA 3K5MA 4JI3O 4OX9B 4I0XB 1OCRC 3ABLC 2YXHA 1H38A 4N21A 3J81N 1AR5A 4LFAO 1TA8A 2AHZA 2CH7B 4AHCA 3PJSK 3ZRVA 2GUZA 1RSOA 4GLXA 3AG3C 3CCQV 2UUCO 1TVKA 1ZLZA 3X2QB 4X1KB 1B06A 3WB1A 3FX7A 1SQVH 4MSWC 5LOVB 4KUMA 3TCUA 2IH3C 2JS3A 4LF5B 2DQ0A 3J80N 4ZIBA 4IHJB 2BTQA 1YJNV 1KC8W 3B8NA 3CCRV 4X65B 4X9QA 3B8MA 4O2BA 1G1XB 2UXBB 1VF7A 1I7FA 1H2GA 1XMOO 2HKOA 2EJRA 2ZE5A 2F1MA 5EC2C 2CTRA 2M7WA 2HVKC 2OCCC 3A2FA 2E76B 1HNXB 1Q3EA 3SJCC 1FS0G 4LF4O 3CCJV 2JJ2G 4MVMA 5CA1A 2EZPA 4Q20A 3OTFA 4EFEA 4J11A 2XHBA 1VMGA 1COWG 3OMIB 1XDCA 3S3XA 4GKJB 3LDCA 4XBFA 4JI5O 4CH4A 4EB6A 3KCXA 1GN2A 1XL4A 2C2AA 5KHKA 1VQOV 1J5EO 4DRXA 1UPGA 1EFRG 5JWPA 3F5TA 1WPXA 2X6BA 4U3JB 3W7UA 3JD4A 3ASOB 1E1RG 3RYIA 5KA5A 1IVSA 2PY5A 2VS0A 4J7KA 2YUAA 1NTZH 1VEWA 3CYOA 2RJZA 5BR8O 3UT5A 1KUQA 2WLJA 1BMFG 3ZMSA 1IBKB 4LF6O 3QG5A 2L35A 5ITZA 2B1GA 5CA1B 4A5UB 2PZSA 1S3JA 4KXRA 4DW1A 2PTMA 4YIPA 4MS2A 3RYCB 1AILA 2WLIB 2VQFO 2Y69B 2QWNB 4LNUA 2QKSA 5B5EZ 2VQEO 5F2VO 3IJ4A 3M7MX 2HFEC 3AEIA 5B1OA 3G6EV 4GCZA 4OXSA 2EIMB 4EB6B 5D5QA 2PYJA 4FLWA 2YI9A 3ZCCA 2FYUH 4RWUA 1WNSA 1QLEB 4DRXB 1WB7A 1TUEB 4WFHA 3TGUH 3JAKB 2WA4A 2EINC 2QWOB 1VQNV 3CCSV 1YF2A 3L70H 2RN9A 2BE3A 2V1DA 3RYIB 4MVUA 3W7WA 1V54C 2ZCEA 3HB3B 2BTOA 3MAQA 5BXZA 2EILC 3UT5B 1KP2A 3CMEV 2UUBO 2CGNA 5FNVA 1YI2V 1GN6A 2Q6AA 3OE7G 3K0DA 3HR0A 4YJ2B 5ITZB 2HVJC 2X6AA 4LFCB 2PI5A 5KHGA 2OIGA 1VQMV 3HPLC 4NXMO 1HP8A 5IWAO 4K8ZA 4LNUB 2WLNA 1SQFA 2QWPB 2ZKOA 1OZ0A 2K9PA 4DV5B 1R3IC 2MK3A 3AG2C 3F5WC 4LFBO 3OM3B 2GHYA 2EIKB 1N32O 2VRZA 3CE2A 1XREA 3K9SA 2Q0AA 3K9AA 3ZMZA 1P84F 3JYCA 4MVRA 4QNHB 2ILMA 1GTOA 3BA8A 2P22C 3R65A 1L1FA 4JF3A 5FNVB 2ETNA 4FFKA 5K1PA 2YSUB 2EJ7A 5B1BC 2YIBA 1OCZC 1ROPA 1VF5B 1ZL8A 1BL8A 3CC2V 5KMGA 2ZD9A 3E83A 2M6YA 5KAIZ 1S0VA 3ZMTA 1G6UA 1FKAO 3L9DA 3ZHTA 4I4TA 5K1XA 1AJQA 4DR6B 2XOKG 1AB3A 2F95B 4DW0A 5TISZ 4NXNO 4X62O 2ZM6O 1YZBA 3CRRA 3A8TA 1OCRB 3ABLB 4HBNA 2ADPA 3WB0A 5EK0A 1DGSA 2X7RB 1N4CA 4JI7B 1EZJA 4MTOA 2E5LB 2Q69A 4RUEA 1NH2D 3OMNB 4CH6A 1PPJH 2ZDIA 4ASUG 3JALB 2LQTA 3RYHA 4DR3B 2IJIA 1KQSU 1Z2GA 3AG3B 1PP9H 4J7ZA 3OAAG 2UXCO 4HAMA 5KA6A 2JS5A 1ZL8B 2DYRC 1IBLB 1YTFB 3QF7A 1SQXH 5LMNO 5KMGB 4PA4A 1BHBA 4LF9O 3A0RA 4GKKB 5CBFA 3E2EA 4J9ZB 3VQVA 4I4TB 3KG2A 1GM7A 4DR2O 4JTDB 3I5DA 2GSMB 3F7YC 2WSSG 4KL1A 1N36B 3HKEA 3ZN1A 3CJHA 2OCCB 1NZ6A 1RFYA 4FK5C 5EBLC 4DR7B 1JVMA 1S5HC 2EZOA 4NKGB 5KHJA 3RT3C 2VWJA 2ZNJA 4TUYA 4UFZA 4QJFB 3RYHB 3OUSA 4BIZA 5LYJA 5C93A 2QWRB 5LXTA 3ZHUA 3F7VC 4LF7B 4JV5O 1NS1A 5EZYB 4BW5A 3W7TA 5LHIA 2XT9A 3CCUV 4PI0A 1XHZA 1XUQA 5IYCO 4IYIA 1K97A 4DR5B 1Q8IA 1PM9A 1XNQO 1DF5A 3CXCU 2QGNA 4B3MB 4IYHA 4WFEA 3SYPA 3HKEB 5J2UA 3FD9A 2YS8A 4B3RB 3FB7C 3CXHF 4FJCC 5L3EA 1THZA 1Y66A 2Y0PA 1M4UA 2XAFA 4PHZA 2ITCC 3IC9A 4TUYB 3RYFA 2QTSA 1JJOA 3HKCA 2NR5A 1F23A 4ZOLB 2O57A 2LFRA 5LYJB 5LXTB 4U3FH 3B09A 2F4VB 5FPRA 3NXSA 1NR1A 5CA3A 3ZN0A 5IYZA 2AHYA 2JGDB 5JH7B 4FZ1A 1MNGA 3SPGA 1MABG 5EC1C 2RCVA 5L3DA 2LO1A 3GWOA 3OGCC 1Q5OA 4AQYO 5FPOA 2WAMA 1NVPB 2EINB 3T1HB 4LF8O 4DR1O 4MVQA 2ADQB 4JASA 5C8YA 3DGEA 1OV9A 2WLHA 3E8BA 3T1YB 4H33A 4QIWF 1V54B 4PI2A 4B7KA 5J2UB 2EILB 1FXVA 5HFLA 3TK1A 4RAIA 1IZ3A 3IFXA 4MVOA 1Q6UA 1EN4A 4X1YB 4PA3A 5J2TA 2DQ3A 5B1AC 3QO5A 4PDRA 4OX9O 4I9QA 2Q68A 3HKCB 1URFA 1UJWB 3UKMA 1US6A 2ATKC 3ZMUA 1QVFU 3UM7A 5L3FA 1M90W 4PV1B 3WFVA 5JJNB 1Y4MA 2YDEA 1HNZO 1CEZA 3VQWA 5IYZB 4QPKA 2GTSA 4DK1A 1E1QG 3AG2B 1SZXA 3JD0A 4JI6O 3FB5C 4K8XA 3W7XA 2H3OA 5FL7G 3BCCH 1XL6A 4IGGA 1NT2B 3TXSA 2V7QG 4LF5O 4O4IA 4UVAA 1BT8A 1QLNA 5KAFZ 4Q6GA 2FTKA 5GONA 5C8YB 3A0HZ 3L71H 1HNWO 2WLLA 4FPPA 1YJ9V 5DN6G 4X65O 2LGWA 3JD1A 4O4HA 4HYOA 1SQPH 4GYCB 4YJ3A 1YXBA 1LNQA 5J2TB 5B1BB 1VQKV 5B1NA 4FLXA 1BSMA 3C3SA 1X4TA 4B3TO 1OCZB 3L73H 3WB2A 4DUZB 1HNXO 4G28B 3SYAA 2XAHA 3BPZA 5KUMA 4Z1VA 2D3OW 3AG4C 3BHPA 4JZGA 4F6EA 4DV6O 1LUVA 1YEWA 3E8GA 4I50A 2PYLA 2QE7G 4X1IA 1N33B 3RVYA 1PNMA 3ETGA 5DM6V 4P2ZA 2JDIG 1H2LA 3SYQA 4UB6Z 3VBBA 4BAYA 3JAWA 3AK2A 3LNMB 2OCHA 2QKCA 3K0GA 3E35A 2ZIMA 2BOBC 5GONB 3JARA 4MT8A 2WLLB 4UCTA 2UUAB 3G80A 4DUYO 3SDLA 3D36C 1DLBA 5LMUB 1Q81W 4CH5A 4PJ0Z 1XNRO 1X59A 3CSXA 2Q73A 1KMIZ 4JPRA 4XDJA 5H5NA 4TQFA
chains in the Genus database with same CATH topology
2IH1C 2X6AA 4RQEA 2PI5A 5H9CA 2HLDG 2DYRB 5J9PC 3ZMVA 1SETA 2ZDIC 1QVGU 1M9NA 2DW4A 2R9IA 4G27B 1VQMV 4KP4A 3HPLC 1KP3A 1FXKC 2ZQMA 4H37A 3K3WA 1V55B 4X89A 3T4DA 2WLNA 1OZ0A 3B77A 4GX5A 3T4ZA 1OCCB 1R3IC 2MK3A 3AG2C 3F5WC 3OM3B 3JD3A 2GHYA 3ZRWB 2EIKB 4JAVA 3OMAB 1YIJV 4JYBA 3K9AA 4WFAV 5LHHA 3FYIB 3ZMZA 4PDLA 2EIJB 5CMUA 1FFTB 1OCOC 5IYDO 1AJPA 2IJKA 5IYBO 3JYCA 4MVRA 3IGAC 4HZ3A 4JYCA 4QNHB 1RPRA 1GTOA 4MTFA 3ASOC 3M99B 3STLC 1NH2B 3ABMB 3P32A 5KUKA 3T1CA 1JX9A 3ABKC 1VQ5V 2UXNA 2P6JA 4WFBV 3SPJA 3R65A 1YJWV 4PELA 1L1FA 4JF3A 4P30A 1VQLV 2YSUB 5B1BC 5CN0A 1JPXA 1M56C 4P9OA 4FMTA 1OCZC 3TETA 1ROPA 3SYOA 3SPHA 1BL8A 4RQFA 3K06A 5B3SB 3CC2V 1Q82W 1GMGA 3W7SA 2ZD9A 3QNEA 2Z3YA 4UXNA 3SJQC 3E83A 2Y69C 1Q7YW 1SERA 2DWEC 4UVCA 1CPYA 2YEVA 1S0VA 2W6IG 3ZMTA 1GM9A 2WLKA 3EHBB 1I5XA 2EIMC 3CC4V 1R3KC 1VQ4V 1S72V 1AJQA 2QM8A 3BEHA 1NJIW 1SESA 2A79B 1KD1W 2XOKG 1M57B 1QLEC 1NKDA 2JK5C 1AI4A 4MTXA 3LSSA 4X88A 3BY6A 1ZWIC 4WFFA 5GW7A 2CK3G 2OTLV 1RM1B 3H01A 3CCEV 3OEHG 1MOFA 3AG1B 4WF9V 1AI5A 1S77D 1E79G 1OCRB 3ABLB 1K92A 3CP1A 2IJJA 5EK0A 5LHGA 2WPDG 1K33A 1F51A 4WFGA 2X7RB 2NNUA 1EZJA 4MTOA 2UXXA 4MVSA 2Q69A 4RUEA 1NH2D 3OMNB 3WG7B 4JTCB 1R6NA 2ZDIA 4PA9A 1VQ9V 4ASUG 3DTUB 2EBOA 5E1AC 4L87A 5CBHA 2IJIA 1KQSU 2HR3A 3AG3B 2WWWA 3OAAG 4HAMA 1JCHA 2B1IA 1BHAA 2JEXA 5KA6A 2DYRC 2K1EA 4UUJC 1W2BU 1YTFB 3CCMV 1GK9A 3ZJZA 3K04A 3CD6V 2P67A 4PA4A 3LDEA 5IDJA 1M1KW 3QO8A 1BHBA 3QO7A 1V55C 3JD2A 3A0RA 2IW5A 2XAQA 2YEVB 5CBFA 4UV8A 1JOYA 1AI6A 3E2EA 3MHHC 1OCCC 4GX0A 4J9ZB 1R73A 2NLJC 4GX2A 1PD3A 3KG2A 3SPIA 1GM7A 2EIKC 1W0JG 2ZXWB 3T2MA 4JTDB 2OTJV 4FIPC 1JJ2U 4Z1MG 2GSMB 3F7YC 3FKSG 3CCLV 2EIJC 2OT5A 2WSSG 3OFNG 4WCEV 4PA6A 1K73W 3ZIAG 1FXHA 1WLEA 3ZN1A 1ORQC 2JJ1G 4MVZA 2OCCB 3ABMC 1GKFA 4XDLA 2KB1A 4FK5C 3K08A 5EBLC 5LGUA 2QEXV 4GT1A 1JVMA 1YITV 2X6CA 5L3BA 1S5HC 2EZOA 1VQ6V 2XAJA 4P9PA 4LBEC 3D3IA 1SRYA 2PI4A 4QJFB 5B1AB 2WLIA 5H6QA 4G2KA 2H8PC 1ENVA 2Q67A 2P90A 3OUSA 5LGTA 5IY5B 4BIZA 5L3CA 1GM8A 1AI7A 5BZBA 5B3SC 5C93A 1B6QA 3F7VC 2HJFC 4CBCA 4I9WA 3MD0A 2DYSB 3K79A 1YTFD 3SPCA 1K4CC 1R6KA 4BW5A 3W7TA 2XASA 4KFMA 5LHIA 1RPOA 2P7TC 3CCUV 1VQ8V 4QPJA 1NBMG 1AROP 1MG1A 1M57C 1NVPD 4PDVA 3GB7C 1F4NA 5IYCO 1K4DC 2ITDC 3FB8C 1K97A 1Q86W 3ML0A 1RM1C 1IXMA 3AG1C 2QA4V 1DF5A 3CXCU 2IU0A 1K3EA 1OCRC 3ABLC 1H38A 4N21A 4WFEA 3SYPA 3VOUA 4DO2A 3D36A 4JTAB 3FB7C 4FJCC 1S76D 1QCEA 1F4MA 5L3EA 1THZA 2AHZA 4J9YB 1Y66A 3WG7C 4JGSA 1PNKA 3PJSK 1YSCA 1W0KG 2XAFA 2ITCC 3ZRVA 3E86A 1DF4A 1NQTA 2LFSA 3I56V 3E89A 3AG3C 4UV9A 1DTOA 3CCQV 5HFMA 4ZKIA 3CC7V 1F23A 2IJHA 3LSQA 2LFRA 4MW8A 2LP7A 3X2QB 4I5SA 3OEEG 2DWDC 2ZR3A 1FXKA 1PNLA 4MSWC 4RO2A 3NXSA 1NR1A 5CA3A 1N8RW 4KUMA 3ZN0A 3AG4B 3TCUA 2AHYA 2IH3C 2DQ0A 3SPGA 1EBOA 1MABG 5EC1C 1JQ0A 1AJNA 5L3DA 3CMAV 3GWOA 3OGCC 4TSFG 1YJNV 1KC8W 3B8NA 1J95A 3CCRV 4BIUA 1CP9A 2ZXWC 3OR7C 4N23A 2Z5UA 1QBZA 1PKXA 2WAMA 4LP8A 1NVPB 2EINB 3B8MA 4R6ZA 3ASNB 4DXWA 5H6RA 2XNDG 2QTOA 4MVQA 2F43G 1H2GA 3LUTB 3RBZA 4JASA 2HKOA 3EFFK 3ETEA 3DGEA 3ZRSA 2EJRA 4LCUC 2WLHA 3I55V 3E8BA 4R8CA 4H33A 5EC2C 4QIWF 3G4SV 2M7WA 1V54B 1I5YA 2A9HA 2HVKC 2OCCC 1YHQV 2QM7A 1P4RA 1FXVA 2EILB 5HFLA 5EBMC 3TK1A 4RAIA 3P30A 3IFXA 1FS0G 4MVOA 1H8EG 5LGNA 3ETDA 4PA3A 3CCJV 2JJ2G 4MVMA 2DQ3A 5B1AC 3QO5A 4PDRA 2EZPA 3K03A 4Q20A 1MSWD 3ZRXA 2Q68A 3LDDA 5IY5C 1UJWB 3UKMA 1COWG 1G8MA 3OMIB 4E2LA 2H94A 1SZTA 2ATKC 1K5SA 3ZMUA 1QVFU 3UM7A 5L3FA 1M90W 3OR6C 3WFVA 1Y4MA 3ABTA 3LDCA 1FXKB 4XBFA 1G4YB 2DYSC 1CEZA 3OW2U 5CBGA 4QPKA 4F4LA 1XL4A 1E1QG 3AG2B 4X8AA 1VQPV 4EKWA 2C2AA 3JD0A 1VQOV 3FB5C 3W7XA 5FL7G 4MTGA 1XL6A 1K34A 2B5UA 5LBQA 2HG5C 2IU3A 1EFRG 1WPXA 2V7QG 5L3GA 1OCOB 1K5QA 4UVAA 2X6BA 1QLNA 4QE9A 4RUFA 3W7UA 3E8HA 3JD4A 2FTKA 3FB6C 4YXWG 1E1RG 2ZR2A 3ASOB 5KA5A 1OHHG 2R9RB 1PL0A 2WLLA 4R7CA 4FPPA 4QE7A 4ZBMA 1YJ9V 5DN6G 2W6JG 3CYOA 3JD1A 2W0FC 3ABKB 1K8AW 4TT3G 2WLJA 1BMFG 3JCZA 4TWKA 4HYOA 2Y48A 3ZMSA 1P7BA 4U7NA 1LNQA 2B1GA 4PA7A 5B1BB 3CCVV 1VQKV 1S3JA 5B1NA 1M56B 3MHSC 1OCZB 1R3LC 1QR8A 4R50A 4PDMA 3X2QC 4MS2A 4G28B 2BOCC 1H8HG 1QR9A 3IC7A 4JAUA 3SYAA 2WLIB 2XAHA 2JEUA 2XAGA 5KUMA 3CPWU 1K7DA 2Y69B 3OUFA 2QKSA 2D3OW 3AG4C 2HFEC 3SYCA 1KECA 3AEIA 5B1OA 3G6EV 4GCZA 4OXSA 2EIMB 3E8GA 1VQ7V 3ZCCA 2X0LA 2QE7G 3FYEB 3ZRWA 3RVYA 1NR7A 1PNMA 1GO3F 1HWYA 1QLEB 1R3JC 3ETGA 5DM6V 3G71V 4P2ZA 1TUEB 4WFHA 3E8FA 2JDIG 3RW0A 2EINC 3ABUA 3SYQA 3ASNC 2WLMA 4GX1A 3VBBA 4BAYA 3LNMB 3K0GA 2JIZG 3CCSV 1VQNV 3E35A 2A0LA 2BOBC 4LC1A 4U7OA 2V1DA 4MVUA 4MT8A 2WLLB 3W7WA 1V54C 4CZZA 3HB3B 1KKDA 2EILC 4XDKA 1DLBA 1K9MW 1KP2A 1Q81W 3CMEV 3STZC 5EBWC 4MW3A 3RVZA 1YI2V 2Q6AA 3OE7G 3K0DA 1AR1B 4JPRA 4UVBA 4XDJA 2HVJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXM A;  4ZKI A;  3A0R A;  4LC1 A;  4U7O A;  4JYB A;  1JOY A;  3MD0 A;  2C2A A;  2LFR A;  4FMT A;  4MT8 A;  4KP4 A;  4GT1 A;  4MTX A;  5B1O A;  4U7N A;  4GCZ A;  4Q20 A;  3ZRX A;  4I5S A;  4JYC A;  3D36 A;  4JAS A;  3ZCC A;  2WWW A;  3DGE A;  3ZRW A;  3NXS A;  5C93 A;  5B1N A;  3P32 A;  4QPJ A;  4QPK A;  2QM7 A;  2FTK A;  3ZRV A;  3ZRW B;  4BIZ A;  3TK1 A;  1F51 A;  2P67 A;  2LFS A;  4JAV A;  4FPP A;  5IDJ A;  4JAU A;  2QM8 A;  4BIU A; 
#chains in the Genus database with same CATH topology
 2IH1 C;  2P4K A;  2DYR B;  2ZDI C;  4H44 B;  1RP3 B;  1Y74 A;  2R9I A;  3PN1 A;  2GUZ B;  1MMM A;  1FXK C;  1RSO B;  1XHX A;  2ZQM A;  3K3W A;  3H1J H;  2RNB A;  4LFA B;  1TVK B;  2R70 A;  3B77 A;  3FFQ A;  2CTQ A;  4FLZ A;  2F93 B;  2YIC A;  4X1I B;  4JAV A;  5GTI Z;  2YXL A;  4JYB A;  1I0H A;  4D7S A;  1OCO C;  3JAW B;  2IJK A;  5IYB O;  2BTQ B;  1EZV H;  3IGA C;  1IBM O;  4JYC A;  4AIL C;  1RPR A;  3NR7 A;  2FKX A;  1YDX A;  1Q6H A;  3STL C;  1MA1 A;  3DC5 A;  3JAR B;  5KUK A;  4O2B B;  3T1C A;  1JX9 A;  4B7E A;  2BSK A;  4CS2 A;  3AK1 A;  3VQY A;  1JFF A;  4JYA O;  1M56 C;  1PV0 A;  4FMT A;  3BAB A;  2FML A;  5EYP A;  1XMO B;  4BWA A;  2MW2 B;  1GMG A;  1Y74 B;  3SJQ C;  4J10 A;  4K35 A;  1SER A;  2DWE C;  2YEV A;  3ZS8 C;  4LF4 B;  2P06 A;  4O4J A;  1S72 V;  4DR4 O;  3BEH A;  5IJ0 A;  3OTO O;  2JK5 C;  1GN4 A;  4X88 A;  4J7J A;  1XMQ O;  3CCE V;  5KHH A;  4WF9 V;  4DV5 O;  1BQ0 A;  5LHG A;  3ZED A;  3RGB A;  4BW9 A;  4OPH A;  1FJG B;  3GWK C;  1J5E B;  3DTU B;  2G38 A;  2EBO A;  1MSD A;  5E1A C;  2HR3 A;  1JFF B;  3JAM N;  3HKB A;  1Y76 A;  1BHA A;  5EYP B;  2E74 B;  1T5E A;  4K0K O;  2CAZ C;  3CB2 A;  5IDJ A;  3QO8 A;  3QO7 A;  1CXZ B;  1V55 C;  3AK3 A;  2YEV B;  4UV8 A;  2P5O A;  1JOY A;  1AI6 A;  1OCC C;  4LF6 B;  4X66 O;  1WB8 A;  4GX2 A;  1SA0 A;  5JVD A;  2JVD A;  5IJ0 B;  2OTJ V;  2JRI A;  1TUB A;  3JAT A;  4UCV A;  4YY3 O;  1JJ2 U;  3FKS G;  1EN6 A;  2OT5 A;  3P3P A;  2A06 H;  1H2K A;  3J7A U;  2VQF B;  4PA6 A;  4DV0 O;  1FAF A;  4DR6 O;  1ZSP A;  1XOU A;  4I55 A;  2JJ1 G;  4IL6 Z;  4XDL A;  2KB1 A;  3K08 A;  3U0Z A;  4NYK A;  2X6C A;  5L3B A;  1VQ6 V;  3D3I A;  1QHT A;  5B1A B;  1AR4 A;  4X64 B;  2H8P C;  1YVW A;  5LGT A;  2GBO A;  2P90 A;  3D8C A;  3K5O A;  3SJB C;  2HHH B;  3HKB B;  4JI7 O;  3ZHR A;  1R1B A;  1TAE A;  1SQG A;  2FL4 A;  2YID A;  5KHI A;  3B4S A;  1B6Q A;  2HJF C;  4KHP B;  3U11 A;  4CS4 A;  3K79 A;  4DR3 O;  3RN4 A;  2XAS A;  4KFM A;  5EIB D;  1VQ8 V;  3EXA A;  5BMV A;  1NVP D;  3TXQ A;  5JVD B;  5IJ9 A;  4PDV A;  3KCY A;  1HR0 O;  1TUB B;  2RMK B;  2AXT Z;  3JAT B;  5CB4 A;  2GV9 A;  3N27 A;  3B2E E;  3AG1 C;  2QA4 V;  2IU0 A;  2ZE7 A;  4UCR A;  4NXM B;  4DV7 O;  4DV1 O;  5BY1 A;  4I55 B;  3D36 A;  2UU9 O;  1EN5 A;  4JTA B;  2L6L A;  1QCE A;  3MDS A;  4J9Y B;  4JGS A;  4DV2 O;  1YSC A;  1W0K G;  3ZHS A;  3KZI Z;  4LWS A;  1N32 B;  3E86 A;  1DF4 A;  2LFS A;  1QU7 A;  2AW9 A;  5HFM A;  4FLV A;  3KKY A;  2IJH A;  3LSQ A;  2A3Q A;  1FXK A;  2RDC A;  4RO2 A;  1VIB A;  1Q90 D;  3AG4 B;  1FPO A;  1XBL A;  1JQ0 A;  1AJN A;  4TSF G;  3FAV A;  3E22 A;  1CP9 A;  2ZXW C;  5BMV B;  4N23 A;  2Z5U A;  1QBZ A;  5IJ9 B;  4LP8 A;  4R6Z A;  4DXW A;  5H6R A;  1FFX A;  2QTO A;  5CB4 B;  3ZRS A;  3ETE A;  2D2C B;  2HJD A;  3TJT A;  2A7W A;  2VWK A;  1P4R A;  1H2N A;  3P30 A;  2JGU A;  4DR5 O;  4DV3 O;  4JYY A;  5LGN A;  3ETD A;  4DV4 B;  2KG7 A;  4JI0 O;  2Y4T A;  4JI1 O;  1NTK H;  3DSQ A;  1MSW D;  4NXN B;  3LDD A;  4X62 B;  4UCO A;  1G8M A;  4B3R O;  3CRA A;  2ZM6 B;  1SZT A;  1O9H A;  3C90 A;  3OR6 C;  1FXK B;  3OW2 U;  1XEQ A;  4J80 A;  5LA6 A;  2UXD B;  4F4L A;  5JJJ B;  4X8A A;  4EKW A;  2ZE6 A;  4EFB A;  1Q6I A;  3FAV B;  1NI8 A;  3BRC A;  2B5U A;  5LBQ A;  2UXC B;  1OCO B;  1FFX B;  1K5Q A;  2CTP A;  1QQC A;  1Z5V A;  2KQX A;  3N2G A;  4RUF A;  3E8H A;  4YXW G;  5LMN B;  3Q4H A;  2ZR2 A;  3APQ A;  1SQQ H;  4TV8 A;  1PL0 A;  4R7C A;  4ZBM A;  3C3T A;  4QE7 A;  2W6J G;  4LF9 B;  1XIL A;  1Y6X A;  2W0F C;  1I94 B;  4HNA A;  1JMK C;  3L74 H;  4TWK A;  2Y48 A;  3T1H O;  1P7B A;  4YHH B;  4B3S B;  4DR2 B;  4FLY A;  2KG7 B;  4PA7 A;  3CJH B;  1M56 B;  1R3L C;  1QR8 A;  3ZX6 A;  4JI4 B;  3CHX A;  4UCS A;  1SC5 B;  3BA9 A;  1H8H G;  1QR9 A;  3IC7 A;  2IM9 A;  4JAU A;  2XAG A;  3CPW U;  1K7D A;  4IIJ A;  3OUF A;  1KEC A;  1KYO F;  1NU1 H;  1VQ7 V;  2X0L A;  3ZRW A;  1NR7 A;  2QJ1 A;  1GO3 F;  1R3J C;  3JCU Z;  3DXR A;  3ASN C;  1V9P A;  2ZT9 B;  1U97 A;  2JIZ G;  3SR2 C;  2DN9 A;  2A0L A;  3JAS A;  3N2G B;  4U7O A;  2Q7E A;  4TV8 B;  2OWO A;  3B40 A;  4XDK A;  5GTH Z;  4HNA B;  5EBW C;  3JSN A;  4YIO A;  1I08 A;  4UVB A;  3H1I H;  1BGY H;  1UFI A;  1JR9 A;  3O65 A;  2QKA A;  4TQD A;  5H9C A;  2HLD G;  2N74 A;  3ZMV A;  1IDS A;  1SET A;  1QVG U;  1M9N A;  4DK0 A;  4G27 B;  2HP8 A;  3RYF B;  4FM0 A;  1KP3 A;  5LP6 C;  4H37 A;  1N34 B;  4IIJ B;  1V55 B;  3T4D A;  2LW1 A;  1OCC B;  2ZIN A;  3JD3 A;  1WAZ A;  1D2D A;  3ZRW B;  4I0X A;  4PD4 F;  1QNM A;  4TV9 A;  2ZIO A;  2CDY A;  3K58 A;  3DXR B;  3JSL A;  4WFA V;  4PDL A;  5CMU A;  2FB5 A;  1FFT B;  1D5A A;  5IYD O;  1A32 A;  1D5N A;  2CH7 A;  4HZ3 A;  1W59 A;  1AVM A;  3JAS B;  1NH2 B;  1N33 O;  1WP7 A;  4X20 A;  4CS3 A;  3ABK C;  2P6J A;  2PF4 E;  4L8J A;  3SPJ A;  4JI8 B;  4I7Z B;  3D3Q A;  4P30 A;  4X1K A;  1U96 A;  2DJV A;  5CN0 A;  4P9O A;  4LF8 B;  3SYO A;  2UXB O;  3K06 A;  5LMU O;  2Z3Y A;  2Y0I A;  4UXN A;  1L8D A;  3UO3 A;  4JI2 B;  2WLK A;  3EHB B;  1I5X A;  1N0N A;  2Q9L A;  5JCO C;  1R3K C;  1VQ4 V;  4C7U A;  2QM8 A;  2YIA A;  4LH7 A;  5D5P A;  1DK1 A;  1NJI W;  1KD1 W;  1NKD A;  2CGO A;  3LSS A;  3P3N A;  2DMX A;  3BY6 A;  4TV9 B;  5GW7 A;  4AI8 A;  4FFB A;  2CK3 G;  1M93 A;  2OTL V;  4CH3 A;  3LSU A;  1YCI A;  1MOF A;  3AG1 B;  1AI5 A;  5IE9 A;  1S77 D;  1GAX A;  1K92 A;  3CP1 A;  2IJJ A;  4GKJ O;  1HNZ B;  2WPD G;  2Q7G A;  3L75 H;  4X20 B;  4MVS A;  5LL6 Y;  4O4I B;  4JTC B;  4WBN A;  1WN7 A;  4JI6 B;  1NTM H;  1XQ8 A;  2QM4 A;  4UCU A;  3K5N A;  1KB9 F;  2QSA A;  2WWW A;  4O4H B;  2B1I A;  2JEX A;  1W2B U;  4YJ3 B;  3K04 A;  3ZJZ A;  1HNW B;  3CD6 V;  1ZUQ A;  4F6R A;  3LDE A;  2QR4 A;  1M1K W;  4TOI A;  3JD2 A;  2IW5 A;  2XAQ A;  4Z2W A;  4JI3 B;  4GX0 A;  1PL4 A;  1R73 A;  4U3J A;  4K3A A;  3S3W A;  1IBK O;  1BQZ A;  3SPI A;  3R66 A;  2ZXW B;  2Q5Z A;  4B3T B;  2Q7H A;  1R6T A;  4FFB B;  4D6T H;  3CCL V;  2EIJ C;  4I50 B;  4GZR B;  3OFN G;  3CWB H;  1H2S B;  4WCE V;  3ZHQ A;  1JA8 A;  1K73 W;  3BFR A;  2KSD A;  1WLE A;  2UUC B;  3ABM C;  5DEC A;  5LGU A;  4DV6 B;  1LR1 A;  2XAJ A;  3RYC A;  4WBN B;  2WLI A;  2AZ0 A;  4G2K A;  1ENV A;  4H0L B;  3THO A;  3CRQ A;  2Q67 A;  2DOS A;  5BZB A;  3SGI A;  5B3S C;  4O2A A;  2KKW A;  5CA0 A;  4OGQ B;  4CBC A;  2YIB D;  2ZE8 A;  1FJG O;  1KBH A;  1SQB H;  4F6R B;  4DUY B;  1P49 A;  3JAK A;  1YTF D;  1K4C C;  1XNR B;  2P7T C;  4QPJ A;  1ARO P;  1M57 C;  1F4N A;  1K4D C;  3FB8 C;  3ML0 A;  1RM1 C;  4LFC O;  1SF9 A;  4OPA A;  1K3E A;  2Y4U A;  3VOU A;  4DO2 A;  4JAA A;  4YJ2 A;  4LH6 A;  4J42 A;  2HEP A;  1MZE A;  4D7T A;  1S76 D;  3VQX A;  1F4M A;  3WG7 C;  4W4K A;  4FLT A;  1PNK A;  2CUG A;  1L0N H;  4JI5 B;  1NQT A;  3I56 V;  3E89 A;  4UV9 A;  1DTO A;  4ZKI A;  2BSK B;  3CC7 V;  4NB5 A;  2OYQ A;  1BS3 A;  4MW8 A;  1IXB A;  2LP7 A;  1IBM B;  4NTY A;  3WU2 Z;  4O2A B;  4I5S A;  2E3C A;  3OEE G;  5CA0 B;  2DWD C;  2ZR3 A;  5LP6 A;  1PNL A;  5JJE B;  4UB8 Z;  5EIB C;  1N8R W;  1P7G A;  4X64 O;  1EBO A;  4FM2 A;  3CX5 F;  4E4E A;  2HHH O;  3CMA V;  5JQG A;  1HDJ A;  4NTW A;  1J95 A;  1VP7 A;  2QWQ B;  4BIU A;  3OR7 C;  2CE4 A;  2PGG A;  5BR8 B;  4JYA B;  1PKX A;  2EUL A;  2N05 A;  3ASN B;  4KHP O;  2XND G;  4O4J B;  2F43 G;  3RBZ A;  3LUT B;  3EFF K;  4LCU C;  4FVM A;  3I55 V;  1B3Q A;  3CS5 A;  2BCC H;  1Z5W A;  4R8C A;  3G4S V;  1I5Y A;  2A9H A;  1YHQ V;  4BR6 A;  2QM7 A;  5EBM C;  2OIE A;  4DR4 B;  1H8E G;  3OTO B;  3ETQ A;  2VQE B;  3A0B Z;  3K03 A;  3ZRX A;  2LW7 A;  1M5I A;  5IY5 C;  1XMQ B;  4E2L A;  5KX5 A;  2H94 A;  1K5S A;  2ODM A;  4J41 A;  3ABT A;  1VF6 C;  5LP6 B;  1G4Y B;  2DYS C;  4FLU A;  3H1L H;  1BCC H;  4H13 B;  5CBG A;  5H2F Z;  1Y76 B;  5JCO A;  3L72 H;  2E5L O;  4LR3 A;  1VQP V;  5JQG B;  5KLV H;  1GN3 A;  2GDS A;  4MTG A;  1K34 A;  2HG5 C;  2UUB B;  2IU3 A;  1SS3 A;  4ZI7 A;  5L3G A;  2GTA A;  3QVN A;  4QE9 A;  4K0K B;  1IBL O;  3FB6 C;  2N04 A;  3JAL A;  1SA0 B;  1OHH G;  2R9R B;  2NN4 A;  2AGA A;  1F7Y A;  3ABK B;  3ZHV A;  1K8A W;  4TT3 G;  4GKK O;  1WPB A;  3JCZ A;  3RFR A;  3CRM A;  4X66 B;  4U7N A;  1Y67 A;  2RQ6 A;  2QDO A;  5IWA B;  3CCV V;  4FZ0 A;  4YY3 B;  3MHS C;  3O9O A;  1S5L Z;  4PDM A;  4R50 A;  4LFB B;  1EM1 A;  4GUN A;  4JZ2 A;  3X2Q C;  2Q4P A;  5KX5 B;  4DV0 B;  2BOC C;  1N36 O;  2JEU A;  4DYL A;  4DV4 O;  3HKD A;  1B04 A;  3SYC A;  2V4D A;  4DR7 O;  2CTW A;  1GH6 A;  2YI8 A;  3FYE B;  2IBZ H;  1HWY A;  3G71 V;  2ARH A;  2Q0O C;  1SKV A;  3E8F A;  3RW0 A;  3ABU A;  3H1H H;  2WLM A;  4GX1 A;  5A2Q N;  2YC0 A;  1AP5 A;  4ZI7 B;  3ICX A;  2UXD O;  4LC1 A;  2Z0A A;  4LF7 O;  2DE0 X;  1L0L H;  1GRJ A;  4CZZ A;  1KKD A;  1K9M W;  3STZ C;  3H1K H;  4MW3 A;  3RVZ A;  1AR1 B;  1BE3 H;  5EZY A;  1HR0 B;  4RQE A;  3G6B A;  5J9P C;  1OJH A;  1I94 O;  4FM1 A;  2DW4 A;  4KP4 A;  4LWS B;  1IUR A;  4YHH O;  4DV7 B;  1VAR A;  4DV1 B;  4B3S O;  4B3M O;  3U10 A;  4NVP A;  2UU9 B;  3HKD B;  4X89 A;  1WA8 A;  4GX5 A;  3T4Z A;  4DV2 B;  2LJ2 A;  4JI4 O;  2EX3 A;  3QTC A;  2PUS A;  2XUM A;  3OMA B;  1YIJ V;  4BIO A;  2Q8V A;  5LHH A;  3FYI B;  2EIJ B;  3UO2 A;  3CEI A;  1AJP A;  3K59 A;  3E22 B;  4MTF A;  3ASO C;  3M99 B;  2F4V O;  3ABM B;  3K57 A;  3P32 A;  3M8A A;  4NTX A;  1VQ5 V;  2UXN A;  4WFB V;  4ZOL A;  1YJW V;  3G67 A;  4PEL A;  1KU9 A;  4IT5 A;  4B08 A;  3OT7 A;  1VQL V;  1JPX A;  2JGD A;  3TET A;  5JH7 A;  3SPH A;  4RQF A;  1MZF A;  5B3S B;  3OD4 A;  1Q82 W;  2W0X A;  3W7S A;  3QNE A;  4ZHQ A;  1FYJ A;  2Y69 C;  1Q7Y W;  3T1Y O;  4UVC A;  1CPY A;  1ZTE A;  2W6I G;  1GM9 A;  3DC6 A;  1WA8 B;  2EIM C;  4DV3 B;  3CC4 V;  1O9G A;  1FD9 A;  2F23 A;  4JI0 B;  1SES A;  2A79 B;  4JI1 B;  1M57 B;  1QLE C;  3BVO A;  1AI4 A;  4MTX A;  1ZWI C;  4WFF A;  3H9V A;  1RM1 B;  1N34 O;  5LA6 B;  4EEQ A;  3H01 A;  3OEH G;  4QGP A;  4O4L A;  3CRC A;  4NR1 A;  4X1Y A;  1E79 G;  4CC6 A;  1K33 A;  1F51 A;  4WFG A;  1XI1 A;  2NNU A;  3N2K A;  2UXX A;  3ZBH A;  1S5J A;  3WG7 B;  4JV5 B;  2B9Z A;  1R6N A;  4PA9 A;  3AG7 A;  1VQ9 V;  3Q4H B;  3UCS C;  1TGO A;  5A9G A;  4L87 A;  5CBH A;  2YXY A;  2R9A A;  1JCH A;  1BZK A;  1H2M A;  3LNN A;  4ABM A;  2K1E A;  4JI8 O;  4UUJ C;  1ZAU A;  3CCM V;  1GK9 A;  3APO A;  1VF6 A;  2ZNI A;  2P67 A;  4ZHQ B;  3SJA C;  2AZ2 A;  4CC5 A;  1XNQ B;  5B66 Z;  3MHH C;  3EVK A;  2NLJ C;  2LGQ A;  1PD3 A;  2EIK C;  1W0J G;  4ICG A;  3T2M A;  3GVM A;  4FIP C;  1WP8 A;  3BAA A;  4Z1M G;  4JI2 O;  5FLX N;  4DUZ O;  4O4L B;  2R72 A;  3ZIA G;  5IT9 N;  1FXH A;  1ZX3 A;  1AP6 A;  1ORQ C;  4MVZ A;  5E79 Z;  1GKF A;  1HW7 A;  2QEX V;  4GT1 A;  2E75 B;  3N2K B;  1YIT V;  3IAY A;  4P9P A;  5AG2 A;  4LBE C;  1WJZ A;  1SRY A;  2PI4 A;  5H6Q A;  5IY5 B;  5L3C A;  1GM8 A;  1AI7 A;  1IX9 A;  4AQY B;  5LOV A;  4I9W A;  2F66 C;  3MD0 A;  2XTA A;  2DYS B;  2P4V A;  3OGI B;  4DR1 B;  2UUA O;  1LUW A;  3UQ8 A;  3SPC A;  2WA3 A;  1R6K A;  4IHJ A;  1RPO A;  1NBM G;  1MG1 A;  5DED A;  1KKC A;  1Q43 A;  3GB7 C;  4W4L A;  2ITD C;  3K5L A;  1Q86 W;  3RWR D;  1N0J A;  1IXM A;  3K5M A;  4JI3 O;  4OX9 B;  4I0X B;  1OCR C;  3ABL C;  2YXH A;  1H38 A;  4N21 A;  3J81 N;  1AR5 A;  4LFA O;  1TA8 A;  2AHZ A;  2CH7 B;  4AHC A;  3PJS K;  3ZRV A;  2GUZ A;  1RSO A;  4GLX A;  3AG3 C;  3CCQ V;  2UUC O;  1TVK A;  1ZLZ A;  3X2Q B;  4X1K B;  1B06 A;  3WB1 A;  3FX7 A;  1SQV H;  4MSW C;  5LOV B;  4KUM A;  3TCU A;  2IH3 C;  2JS3 A;  4LF5 B;  2DQ0 A;  3J80 N;  4ZIB A;  4IHJ B;  2BTQ A;  1YJN V;  1KC8 W;  3B8N A;  3CCR V;  4X65 B;  4X9Q A;  3B8M A;  4O2B A;  1G1X B;  2UXB B;  1VF7 A;  1I7F A;  1H2G A;  1XMO O;  2HKO A;  2EJR A;  2ZE5 A;  2F1M A;  5EC2 C;  2CTR A;  2M7W A;  2HVK C;  2OCC C;  3A2F A;  2E76 B;  1HNX B;  1Q3E A;  3SJC C;  1FS0 G;  4LF4 O;  3CCJ V;  2JJ2 G;  4MVM A;  5CA1 A;  2EZP A;  4Q20 A;  3OTF A;  4EFE A;  4J11 A;  2XHB A;  1VMG A;  1COW G;  3OMI B;  1XDC A;  3S3X A;  4GKJ B;  3LDC A;  4XBF A;  4JI5 O;  4CH4 A;  4EB6 A;  3KCX A;  1GN2 A;  1XL4 A;  2C2A A;  5KHK A;  1VQO V;  1J5E O;  4DRX A;  1UPG A;  1EFR G;  5JWP A;  3F5T A;  1WPX A;  2X6B A;  4U3J B;  3W7U A;  3JD4 A;  3ASO B;  1E1R G;  3RYI A;  5KA5 A;  1IVS A;  2PY5 A;  2VS0 A;  4J7K A;  2YUA A;  1NTZ H;  1VEW A;  3CYO A;  2RJZ A;  5BR8 O;  3UT5 A;  1KUQ A;  2WLJ A;  1BMF G;  3ZMS A;  1IBK B;  4LF6 O;  3QG5 A;  2L35 A;  5ITZ A;  2B1G A;  5CA1 B;  4A5U B;  2PZS A;  1S3J A;  4KXR A;  4DW1 A;  2PTM A;  4YIP A;  4MS2 A;  3RYC B;  1AIL A;  2WLI B;  2VQF O;  2Y69 B;  2QWN B;  4LNU A;  2QKS A;  5B5E Z;  2VQE O;  5F2V O;  3IJ4 A;  3M7M X;  2HFE C;  3AEI A;  5B1O A;  3G6E V;  4GCZ A;  4OXS A;  2EIM B;  4EB6 B;  5D5Q A;  2PYJ A;  4FLW A;  2YI9 A;  3ZCC A;  2FYU H;  4RWU A;  1WNS A;  1QLE B;  4DRX B;  1WB7 A;  1TUE B;  4WFH A;  3TGU H;  3JAK B;  2WA4 A;  2EIN C;  2QWO B;  1VQN V;  3CCS V;  1YF2 A;  3L70 H;  2RN9 A;  2BE3 A;  2V1D A;  3RYI B;  4MVU A;  3W7W A;  1V54 C;  2ZCE A;  3HB3 B;  2BTO A;  3MAQ A;  5BXZ A;  2EIL C;  3UT5 B;  1KP2 A;  3CME V;  2UUB O;  2CGN A;  5FNV A;  1YI2 V;  1GN6 A;  2Q6A A;  3OE7 G;  3K0D A;  3HR0 A;  4YJ2 B;  5ITZ B;  2HVJ C;  2X6A A;  4LFC B;  2PI5 A;  5KHG A;  2OIG A;  1VQM V;  3HPL C;  4NXM O;  1HP8 A;  5IWA O;  4K8Z A;  4LNU B;  2WLN A;  1SQF A;  2QWP B;  2ZKO A;  1OZ0 A;  2K9P A;  4DV5 B;  1R3I C;  2MK3 A;  3AG2 C;  3F5W C;  4LFB O;  3OM3 B;  2GHY A;  2EIK B;  1N32 O;  2VRZ A;  3CE2 A;  1XRE A;  3K9S A;  2Q0A A;  3K9A A;  3ZMZ A;  1P84 F;  3JYC A;  4MVR A;  4QNH B;  2ILM A;  1GTO A;  3BA8 A;  2P22 C;  3R65 A;  1L1F A;  4JF3 A;  5FNV B;  2ETN A;  4FFK A;  5K1P A;  2YSU B;  2EJ7 A;  5B1B C;  2YIB A;  1OCZ C;  1ROP A;  1VF5 B;  1ZL8 A;  1BL8 A;  3CC2 V;  5KMG A;  2ZD9 A;  3E83 A;  2M6Y A;  5KAI Z;  1S0V A;  3ZMT A;  1G6U A;  1FKA O;  3L9D A;  3ZHT A;  4I4T A;  5K1X A;  1AJQ A;  4DR6 B;  2XOK G;  1AB3 A;  2F95 B;  4DW0 A;  5TIS Z;  4NXN O;  4X62 O;  2ZM6 O;  1YZB A;  3CRR A;  3A8T A;  1OCR B;  3ABL B;  4HBN A;  2ADP A;  3WB0 A;  5EK0 A;  1DGS A;  2X7R B;  1N4C A;  4JI7 B;  1EZJ A;  4MTO A;  2E5L B;  2Q69 A;  4RUE A;  1NH2 D;  3OMN B;  4CH6 A;  1PPJ H;  2ZDI A;  4ASU G;  3JAL B;  2LQT A;  3RYH A;  4DR3 B;  2IJI A;  1KQS U;  1Z2G A;  3AG3 B;  1PP9 H;  4J7Z A;  3OAA G;  2UXC O;  4HAM A;  5KA6 A;  2JS5 A;  1ZL8 B;  2DYR C;  1IBL B;  1YTF B;  3QF7 A;  1SQX H;  5LMN O;  5KMG B;  4PA4 A;  1BHB A;  4LF9 O;  3A0R A;  4GKK B;  5CBF A;  3E2E A;  4J9Z B;  3VQV A;  4I4T B;  3KG2 A;  1GM7 A;  4DR2 O;  4JTD B;  3I5D A;  2GSM B;  3F7Y C;  2WSS G;  4KL1 A;  1N36 B;  3HKE A;  3ZN1 A;  3CJH A;  2OCC B;  1NZ6 A;  1RFY A;  4FK5 C;  5EBL C;  4DR7 B;  1JVM A;  1S5H C;  2EZO A;  4NKG B;  5KHJ A;  3RT3 C;  2VWJ A;  2ZNJ A;  4TUY A;  4UFZ A;  4QJF B;  3RYH B;  3OUS A;  4BIZ A;  5LYJ A;  5C93 A;  2QWR B;  5LXT A;  3ZHU A;  3F7V C;  4LF7 B;  4JV5 O;  1NS1 A;  5EZY B;  4BW5 A;  3W7T A;  5LHI A;  2XT9 A;  3CCU V;  4PI0 A;  1XHZ A;  1XUQ A;  5IYC O;  4IYI A;  1K97 A;  4DR5 B;  1Q8I A;  1PM9 A;  1XNQ O;  1DF5 A;  3CXC U;  2QGN A;  4B3M B;  4IYH A;  4WFE A;  3SYP A;  3HKE B;  5J2U A;  3FD9 A;  2YS8 A;  4B3R B;  3FB7 C;  3CXH F;  4FJC C;  5L3E A;  1THZ A;  1Y66 A;  2Y0P A;  1M4U A;  2XAF A;  4PHZ A;  2ITC C;  3IC9 A;  4TUY B;  3RYF A;  2QTS A;  1JJO A;  3HKC A;  2NR5 A;  1F23 A;  4ZOL B;  2O57 A;  2LFR A;  5LYJ B;  5LXT B;  4U3F H;  3B09 A;  2F4V B;  5FPR A;  3NXS A;  1NR1 A;  5CA3 A;  3ZN0 A;  5IYZ A;  2AHY A;  2JGD B;  5JH7 B;  4FZ1 A;  1MNG A;  3SPG A;  1MAB G;  5EC1 C;  2RCV A;  5L3D A;  2LO1 A;  3GWO A;  3OGC C;  1Q5O A;  4AQY O;  5FPO A;  2WAM A;  1NVP B;  2EIN B;  3T1H B;  4LF8 O;  4DR1 O;  4MVQ A;  2ADQ B;  4JAS A;  5C8Y A;  3DGE A;  1OV9 A;  2WLH A;  3E8B A;  3T1Y B;  4H33 A;  4QIW F;  1V54 B;  4PI2 A;  4B7K A;  5J2U B;  2EIL B;  1FXV A;  5HFL A;  3TK1 A;  4RAI A;  1IZ3 A;  3IFX A;  4MVO A;  1Q6U A;  1EN4 A;  4X1Y B;  4PA3 A;  5J2T A;  2DQ3 A;  5B1A C;  3QO5 A;  4PDR A;  4OX9 O;  4I9Q A;  2Q68 A;  3HKC B;  1URF A;  1UJW B;  3UKM A;  1US6 A;  2ATK C;  3ZMU A;  1QVF U;  3UM7 A;  5L3F A;  1M90 W;  4PV1 B;  3WFV A;  5JJN B;  1Y4M A;  2YDE A;  1HNZ O;  1CEZ A;  3VQW A;  5IYZ B;  4QPK A;  2GTS A;  4DK1 A;  1E1Q G;  3AG2 B;  1SZX A;  3JD0 A;  4JI6 O;  3FB5 C;  4K8X A;  3W7X A;  2H3O A;  5FL7 G;  3BCC H;  1XL6 A;  4IGG A;  1NT2 B;  3TXS A;  2V7Q G;  4LF5 O;  4O4I A;  4UVA A;  1BT8 A;  1QLN A;  5KAF Z;  4Q6G A;  2FTK A;  5GON A;  5C8Y B;  3A0H Z;  3L71 H;  1HNW O;  2WLL A;  4FPP A;  1YJ9 V;  5DN6 G;  4X65 O;  2LGW A;  3JD1 A;  4O4H A;  4HYO A;  1SQP H;  4GYC B;  4YJ3 A;  1YXB A;  1LNQ A;  5J2T B;  5B1B B;  1VQK V;  5B1N A;  4FLX A;  1BSM A;  3C3S A;  1X4T A;  4B3T O;  1OCZ B;  3L73 H;  3WB2 A;  4DUZ B;  1HNX O;  4G28 B;  3SYA A;  2XAH A;  3BPZ A;  5KUM A;  4Z1V A;  2D3O W;  3AG4 C;  3BHP A;  4JZG A;  4F6E A;  4DV6 O;  1LUV A;  1YEW A;  3E8G A;  4I50 A;  2PYL A;  2QE7 G;  4X1I A;  1N33 B;  3RVY A;  1PNM A;  3ETG A;  5DM6 V;  4P2Z A;  2JDI G;  1H2L A;  3SYQ A;  4UB6 Z;  3VBB A;  4BAY A;  3JAW A;  3AK2 A;  3LNM B;  2OCH A;  2QKC A;  3K0G A;  3E35 A;  2ZIM A;  2BOB C;  5GON B;  3JAR A;  4MT8 A;  2WLL B;  4UCT A;  2UUA B;  3G80 A;  4DUY O;  3SDL A;  3D36 C;  1DLB A;  5LMU B;  1Q81 W;  4CH5 A;  4PJ0 Z;  1XNR O;  1X59 A;  3CSX A;  2Q73 A;  1KMI Z;  4JPR A;  4XDJ A;  5H5N A;  4TQF A; 
#chains in the Genus database with same CATH homology
 2IH1 C;  2X6A A;  4RQE A;  2PI5 A;  5H9C A;  2HLD G;  2DYR B;  5J9P C;  3ZMV A;  1SET A;  2ZDI C;  1QVG U;  1M9N A;  2DW4 A;  2R9I A;  4G27 B;  1VQM V;  4KP4 A;  3HPL C;  1KP3 A;  1FXK C;  2ZQM A;  4H37 A;  3K3W A;  1V55 B;  4X89 A;  3T4D A;  2WLN A;  1OZ0 A;  3B77 A;  4GX5 A;  3T4Z A;  1OCC B;  1R3I C;  2MK3 A;  3AG2 C;  3F5W C;  3OM3 B;  3JD3 A;  2GHY A;  3ZRW B;  2EIK B;  4JAV A;  3OMA B;  1YIJ V;  4JYB A;  3K9A A;  4WFA V;  5LHH A;  3FYI B;  3ZMZ A;  4PDL A;  2EIJ B;  5CMU A;  1FFT B;  1OCO C;  5IYD O;  1AJP A;  2IJK A;  5IYB O;  3JYC A;  4MVR A;  3IGA C;  4HZ3 A;  4JYC A;  4QNH B;  1RPR A;  1GTO A;  4MTF A;  3ASO C;  3M99 B;  3STL C;  1NH2 B;  3ABM B;  3P32 A;  5KUK A;  3T1C A;  1JX9 A;  3ABK C;  1VQ5 V;  2UXN A;  2P6J A;  4WFB V;  3SPJ A;  3R65 A;  1YJW V;  4PEL A;  1L1F A;  4JF3 A;  4P30 A;  1VQL V;  2YSU B;  5B1B C;  5CN0 A;  1JPX A;  1M56 C;  4P9O A;  4FMT A;  1OCZ C;  3TET A;  1ROP A;  3SYO A;  3SPH A;  1BL8 A;  4RQF A;  3K06 A;  5B3S B;  3CC2 V;  1Q82 W;  1GMG A;  3W7S A;  2ZD9 A;  3QNE A;  2Z3Y A;  4UXN A;  3SJQ C;  3E83 A;  2Y69 C;  1Q7Y W;  1SER A;  2DWE C;  4UVC A;  1CPY A;  2YEV A;  1S0V A;  2W6I G;  3ZMT A;  1GM9 A;  2WLK A;  3EHB B;  1I5X A;  2EIM C;  3CC4 V;  1R3K C;  1VQ4 V;  1S72 V;  1AJQ A;  2QM8 A;  3BEH A;  1NJI W;  1SES A;  2A79 B;  1KD1 W;  2XOK G;  1M57 B;  1QLE C;  1NKD A;  2JK5 C;  1AI4 A;  4MTX A;  3LSS A;  4X88 A;  3BY6 A;  1ZWI C;  4WFF A;  5GW7 A;  2CK3 G;  2OTL V;  1RM1 B;  3H01 A;  3CCE V;  3OEH G;  1MOF A;  3AG1 B;  4WF9 V;  1AI5 A;  1S77 D;  1E79 G;  1OCR B;  3ABL B;  1K92 A;  3CP1 A;  2IJJ A;  5EK0 A;  5LHG A;  2WPD G;  1K33 A;  1F51 A;  4WFG A;  2X7R B;  2NNU A;  1EZJ A;  4MTO A;  2UXX A;  4MVS A;  2Q69 A;  4RUE A;  1NH2 D;  3OMN B;  3WG7 B;  4JTC B;  1R6N A;  2ZDI A;  4PA9 A;  1VQ9 V;  4ASU G;  3DTU B;  2EBO A;  5E1A C;  4L87 A;  5CBH A;  2IJI A;  1KQS U;  2HR3 A;  3AG3 B;  2WWW A;  3OAA G;  4HAM A;  1JCH A;  2B1I A;  1BHA A;  2JEX A;  5KA6 A;  2DYR C;  2K1E A;  4UUJ C;  1W2B U;  1YTF B;  3CCM V;  1GK9 A;  3ZJZ A;  3K04 A;  3CD6 V;  2P67 A;  4PA4 A;  3LDE A;  5IDJ A;  1M1K W;  3QO8 A;  1BHB A;  3QO7 A;  1V55 C;  3JD2 A;  3A0R A;  2IW5 A;  2XAQ A;  2YEV B;  5CBF A;  4UV8 A;  1JOY A;  1AI6 A;  3E2E A;  3MHH C;  1OCC C;  4GX0 A;  4J9Z B;  1R73 A;  2NLJ C;  4GX2 A;  1PD3 A;  3KG2 A;  3SPI A;  1GM7 A;  2EIK C;  1W0J G;  2ZXW B;  3T2M A;  4JTD B;  2OTJ V;  4FIP C;  1JJ2 U;  4Z1M G;  2GSM B;  3F7Y C;  3FKS G;  3CCL V;  2EIJ C;  2OT5 A;  2WSS G;  3OFN G;  4WCE V;  4PA6 A;  1K73 W;  3ZIA G;  1FXH A;  1WLE A;  3ZN1 A;  1ORQ C;  2JJ1 G;  4MVZ A;  2OCC B;  3ABM C;  1GKF A;  4XDL A;  2KB1 A;  4FK5 C;  3K08 A;  5EBL C;  5LGU A;  2QEX V;  4GT1 A;  1JVM A;  1YIT V;  2X6C A;  5L3B A;  1S5H C;  2EZO A;  1VQ6 V;  2XAJ A;  4P9P A;  4LBE C;  3D3I A;  1SRY A;  2PI4 A;  4QJF B;  5B1A B;  2WLI A;  5H6Q A;  4G2K A;  2H8P C;  1ENV A;  2Q67 A;  2P90 A;  3OUS A;  5LGT A;  5IY5 B;  4BIZ A;  5L3C A;  1GM8 A;  1AI7 A;  5BZB A;  5B3S C;  5C93 A;  1B6Q A;  3F7V C;  2HJF C;  4CBC A;  4I9W A;  3MD0 A;  2DYS B;  3K79 A;  1YTF D;  3SPC A;  1K4C C;  1R6K A;  4BW5 A;  3W7T A;  2XAS A;  4KFM A;  5LHI A;  1RPO A;  2P7T C;  3CCU V;  1VQ8 V;  4QPJ A;  1NBM G;  1ARO P;  1MG1 A;  1M57 C;  1NVP D;  4PDV A;  3GB7 C;  1F4N A;  5IYC O;  1K4D C;  2ITD C;  3FB8 C;  1K97 A;  1Q86 W;  3ML0 A;  1RM1 C;  1IXM A;  3AG1 C;  2QA4 V;  1DF5 A;  3CXC U;  2IU0 A;  1K3E A;  1OCR C;  3ABL C;  1H38 A;  4N21 A;  4WFE A;  3SYP A;  3VOU A;  4DO2 A;  3D36 A;  4JTA B;  3FB7 C;  4FJC C;  1S76 D;  1QCE A;  1F4M A;  5L3E A;  1THZ A;  2AHZ A;  4J9Y B;  1Y66 A;  3WG7 C;  4JGS A;  1PNK A;  3PJS K;  1YSC A;  1W0K G;  2XAF A;  2ITC C;  3ZRV A;  3E86 A;  1DF4 A;  1NQT A;  2LFS A;  3I56 V;  3E89 A;  3AG3 C;  4UV9 A;  1DTO A;  3CCQ V;  5HFM A;  4ZKI A;  3CC7 V;  1F23 A;  2IJH A;  3LSQ A;  2LFR A;  4MW8 A;  2LP7 A;  3X2Q B;  4I5S A;  3OEE G;  2DWD C;  2ZR3 A;  1FXK A;  1PNL A;  4MSW C;  4RO2 A;  3NXS A;  1NR1 A;  5CA3 A;  1N8R W;  4KUM A;  3ZN0 A;  3AG4 B;  3TCU A;  2AHY A;  2IH3 C;  2DQ0 A;  3SPG A;  1EBO A;  1MAB G;  5EC1 C;  1JQ0 A;  1AJN A;  5L3D A;  3CMA V;  3GWO A;  3OGC C;  4TSF G;  1YJN V;  1KC8 W;  3B8N A;  1J95 A;  3CCR V;  4BIU A;  1CP9 A;  2ZXW C;  3OR7 C;  4N23 A;  2Z5U A;  1QBZ A;  1PKX A;  2WAM A;  4LP8 A;  1NVP B;  2EIN B;  3B8M A;  4R6Z A;  3ASN B;  4DXW A;  5H6R A;  2XND G;  2QTO A;  4MVQ A;  2F43 G;  1H2G A;  3LUT B;  3RBZ A;  4JAS A;  2HKO A;  3EFF K;  3ETE A;  3DGE A;  3ZRS A;  2EJR A;  4LCU C;  2WLH A;  3I55 V;  3E8B A;  4R8C A;  4H33 A;  5EC2 C;  4QIW F;  3G4S V;  2M7W A;  1V54 B;  1I5Y A;  2A9H A;  2HVK C;  2OCC C;  1YHQ V;  2QM7 A;  1P4R A;  1FXV A;  2EIL B;  5HFL A;  5EBM C;  3TK1 A;  4RAI A;  3P30 A;  3IFX A;  1FS0 G;  4MVO A;  1H8E G;  5LGN A;  3ETD A;  4PA3 A;  3CCJ V;  2JJ2 G;  4MVM A;  2DQ3 A;  5B1A C;  3QO5 A;  4PDR A;  2EZP A;  3K03 A;  4Q20 A;  1MSW D;  3ZRX A;  2Q68 A;  3LDD A;  5IY5 C;  1UJW B;  3UKM A;  1COW G;  1G8M A;  3OMI B;  4E2L A;  2H94 A;  1SZT A;  2ATK C;  1K5S A;  3ZMU A;  1QVF U;  3UM7 A;  5L3F A;  1M90 W;  3OR6 C;  3WFV A;  1Y4M A;  3ABT A;  3LDC A;  1FXK B;  4XBF A;  1G4Y B;  2DYS C;  1CEZ A;  3OW2 U;  5CBG A;  4QPK A;  4F4L A;  1XL4 A;  1E1Q G;  3AG2 B;  4X8A A;  1VQP V;  4EKW A;  2C2A A;  3JD0 A;  1VQO V;  3FB5 C;  3W7X A;  5FL7 G;  4MTG A;  1XL6 A;  1K34 A;  2B5U A;  5LBQ A;  2HG5 C;  2IU3 A;  1EFR G;  1WPX A;  2V7Q G;  5L3G A;  1OCO B;  1K5Q A;  4UVA A;  2X6B A;  1QLN A;  4QE9 A;  4RUF A;  3W7U A;  3E8H A;  3JD4 A;  2FTK A;  3FB6 C;  4YXW G;  1E1R G;  2ZR2 A;  3ASO B;  5KA5 A;  1OHH G;  2R9R B;  1PL0 A;  2WLL A;  4R7C A;  4FPP A;  4QE7 A;  4ZBM A;  1YJ9 V;  5DN6 G;  2W6J G;  3CYO A;  3JD1 A;  2W0F C;  3ABK B;  1K8A W;  4TT3 G;  2WLJ A;  1BMF G;  3JCZ A;  4TWK A;  4HYO A;  2Y48 A;  3ZMS A;  1P7B A;  4U7N A;  1LNQ A;  2B1G A;  4PA7 A;  5B1B B;  3CCV V;  1VQK V;  1S3J A;  5B1N A;  1M56 B;  3MHS C;  1OCZ B;  1R3L C;  1QR8 A;  4R50 A;  4PDM A;  3X2Q C;  4MS2 A;  4G28 B;  2BOC C;  1H8H G;  1QR9 A;  3IC7 A;  4JAU A;  3SYA A;  2WLI B;  2XAH A;  2JEU A;  2XAG A;  5KUM A;  3CPW U;  1K7D A;  2Y69 B;  3OUF A;  2QKS A;  2D3O W;  3AG4 C;  2HFE C;  3SYC A;  1KEC A;  3AEI A;  5B1O A;  3G6E V;  4GCZ A;  4OXS A;  2EIM B;  3E8G A;  1VQ7 V;  3ZCC A;  2X0L A;  2QE7 G;  3FYE B;  3ZRW A;  3RVY A;  1NR7 A;  1PNM A;  1GO3 F;  1HWY A;  1QLE B;  1R3J C;  3ETG A;  5DM6 V;  3G71 V;  4P2Z A;  1TUE B;  4WFH A;  3E8F A;  2JDI G;  3RW0 A;  2EIN C;  3ABU A;  3SYQ A;  3ASN C;  2WLM A;  4GX1 A;  3VBB A;  4BAY A;  3LNM B;  3K0G A;  2JIZ G;  3CCS V;  1VQN V;  3E35 A;  2A0L A;  2BOB C;  4LC1 A;  4U7O A;  2V1D A;  4MVU A;  4MT8 A;  2WLL B;  3W7W A;  1V54 C;  4CZZ A;  3HB3 B;  1KKD A;  2EIL C;  4XDK A;  1DLB A;  1K9M W;  1KP2 A;  1Q81 W;  3CME V;  3STZ C;  5EBW C;  4MW3 A;  3RVZ A;  1YI2 V;  2Q6A A;  3OE7 G;  3K0D A;  1AR1 B;  4JPR A;  4UVB A;  4XDJ A;  2HVJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...