3ZRWA

The structure of the dimeric hamp-dhp fusion a291v mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords AF1503 PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ
total genus 41
structure length 111
sequence length 111
chains with identical sequence C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrwA00
2LFRA 4ZKIA 5B1NA 4JAUA 1IXMA 2QM8A 4MT8A 4QPJA 1JOYA 4Q20A 4U7NA 3P32A 4FMTA 4FPPA 4MTXA 3ZRVA 4JYBA 5IDJA 3NXSA 4GCZA 3TK1A 3ZCCA 4BIZA 3A0RA 3ZRXA 4I5SA 4LC1A 4KP4A 5C93A 2C2AA 2P67A 5B1OA 3D36A 4QPKA 2LFSA 4JASA 3ZRWB 2WWWA 3ZRWA 4GT1A 4JAVA 4JYCA 4U7OA 3MD0A 3DGEA 2FTKA 2QM7A 1F51A 4BIUA
chains in the Genus database with same CATH superfamily
4RUEA 5FNVA 2E5LO 3L72H 5KAFZ 4Q20A 1WB7A 2RN9A 4D7TA 3H01A 2MK3A 1LUVA 5BXZA 3UM7A 4JI0B 1FAFA 4O2BB 1IXBA 5HFMA 3W7SA 5IWAB 1S72V 3JASA 4GLXA 1I7FA 3B4SA 4O4IB 5CMUA 5KX5B 1N32O 2E75B 1CP9A 1N32B 1D5NA 2A7WA 4DUYB 1W0KG 4FM0A 3FB6C 1WAZA 5GONA 2YSUB 3RN4A 2YS8A 3HB3B 4YJ2A 2P4KA 4WFBV 5L3GA 3ZRVA 4J42A 2ZQMA 2NLJC 2W0XA 3ZCCA 3L70H 5IYZB 5IJ9B 3T1CA 4PI0A 5B1OA 1BE3H 4KHPB 1K33A 4KHPO 5EBLC 2QR4A 4LCUC 2JJ2G 1FKAO 3AK2A 3RYIB 2BTOA 3DSQA 4PDVA 2F1MA 4TV8B 4ZBMA 4EFBA 1IXMA 1S0VA 1XOUA 1P84F 1H2GA 4IL6Z 1K4DC 2F43G 1R3JC 1SF9A 3LSUA 2YEVA 3UKMA 5LGUA 2LFSA 4AQYO 1QLEB 4UCVA 1FFXB 1Q5OA 3JAWB 2GBOA 3KCYA 3ABMB 1R6NA 3WG7B 1LNQA 4YXWG 3ABTA 1O9HA 2G38A 3C90A 4UV9A 3P3PA 2QWNB 4Z2WA 3NR7A 2XHBA 3HKEA 4U3FH 2Q4PA 4X9QA 5JVDB 4LBEC 1IBKO 3OUSA 3RYCA 4X62B 1VP7A 2HJDA 4PDMA 5H9CA 1YZBA 2NNUA 4FJCC 3F7VC 2JIZG 5GTIZ 2UXXA 5J2UA 4PA9A 2Q6AA 1TVKB 1WB8A 1I0HA 4RAIA 2EINB 2W6JG 4PDLA 5JH7A 3JYCA 5BR8O 1LR1A 1Y74A 5CBFA 3OAAG 3CMAV 4B7EA 3CRMA 4GKKO 4JI8B 2ZKOA 1H2SB 3SJQC 4P9PA 3JARB 2WLLA 3AG3B 3CRAA 3SYQA 2KG7B 2Q0OC 4U7NA 1S5LZ 3G71V 2YDEA 5CBHA 1S3JA 2PZSA 4DRXB 4O4JB 4DV5O 3STLC 4RO2A 4DK0A 1YITV 5LYJA 4JASA 3ZRWB 1Q6IA 4DW1A 4I9QA 4CC5A 1IURA 1NBMG 4CH4A 4N23A 3E83A 2DYSC 3CXCU 1M9NA 2JRIA 4OX9B 3CWBH 1H8EG 5D5QA 2UXDB 5JQGB 1OZ0A 2QTOA 4R50A 2KB1A 1XL4A 1YJNV 3CJHB 2PI4A 3K5LA 4OGQB 4JI0O 3EHBB 4UB8Z 1BZKA 1H2LA 3CPWU 4HNAA 4DR4O 2OYQA 2OCCC 5EC1C 3DC6A 3E89A 1HDJA 1GM7A 5IYDO 4G28B 3K04A 1M93A 2CTWA 5KMGA 3K5MA 2PI5A 3K5OA 4B3TB 4GKJB 3BCCH 3JAWA 4B3TO 5FL7G 2VS0A 1OCCC 3M7MX 1KC8W 3CE2A 4XDKA 4GX2A 5JJNB 3SPIA 3FFQA 3JALB 2DMXA 2GUZB 2JK5C 2WLKA 1JX9A 3HKBA 3ICXA 5IJ9A 2BTQB 1WP8A 4DV2B 4B3MO 4PA3A 2L35A 1UJWB 4MVRA 3CC7V 3SPGA 3SYCA 1QBZA 3D8CA 4JI7O 4FZ1A 3SPHA 1OCRC 1RPRA 5LP6B 3ZX6A 2A0LA 1M5IA 4YY3O 4H13B 5J2TB 1M56C 4B08A 4LF5B 4J7ZA 2ZD9A 2HHHB 3I5DA 4GT1A 2OWOA 4U7OA 4CH3A 4R7CA 1JFFB 2ZE7A 1SQXH 4JZGA 4FZ0A 2IU0A 2R9IA 4DXWA 2PGGA 1JR9A 3B40A 3T1HB 1N34O 3OGIB 1NS1A 2R72A 4F4LA 2DYRC 4DV1B 3MHSC 2UXNA 3BVOA 4JI4O 3N2KA 2QGNA 3ZN0A 1QLNA 1NH2D 3BFRA 1PKXA 4CH6A 3J80N 4RQFA 2GV9A 2EBOA 2DYRB 4KXRA 4TWKA 5IWAO 5LXTB 1ZTEA 1Y74B 4KP4A 3T2MA 1IBLO 1XREA 3AG3C 2XASA 4IGGA 3CB2A 2V4DA 4PI2A 4JI8O 1Q6UA 1SESA 3AG1C 2QM8A 5E1AC 3FB7C 2QKAA 5EC2C 5DN6G 2QKSA 1NU1H 2OCHA 5IT9N 2HR3A 2Y69C 3QNEA 1SC5B 3ZHTA 3A0BZ 2OTJV 5LXTA 5KA5A 1VQOV 5BMVB 2HLDG 4B3RB 4U3JB 4X88A 4B3RO 4JTAB 3BY6A 2XAFA 3N2GB 4MTXA 5B1AC 2K9PA 4XBFA 1R6KA 4PHZA 4WF9V 1QHTA 4K8XA 2LW7A 4AQYB 1NR1A 2D2CB 4FK5C 1AR5A 4LF9B 4UCRA 5LP6C 1M57B 1Z5VA 2PTMA 1IZ3A 1SZXA 4X1YA 4JI3O 4I50B 1GM8A 1ZAUA 5EYPA 3U10A 1YVWA 4JPRA 3O9OA 4EEQA 5IYZA 1XMQB 2K1EA 4DR5O 5LA6B 4DRXA 1AI5A 3ZMUA 3ABKB 1PL4A 1N0NA 3DTUB 4GZRB 1FXKC 3K5NA 4MVSA 4MSWC 5K1XA 3OTOO 5LYJB 2YIDA 4MVUA 4B3MB 1RPOA 2VWKA 4K0KB 2AHZA 4P2ZA 3OE7G 1DLBA 3ASOB 5FPRA 4I50A 4DV7B 4GKKB 3ZMSA 1XEQA 2FMLA 4LF5O 3ZN1A 5IJ0A 4I55B 4WFEA 1AJNA 2HVKC 4BIOA 4FLUA 5FNVB 3OD4A 3SPCA 5BZBA 2ZNIA 3ASOC 4PA4A 2QWQB 4DV5B 1URFA 4P30A 4PELA 1X4TA 1OV9A 3PJSK 4FFKA 2WPDG 1FXKA 1Y67A 1BT8A 2YEVB 2YXLA 1Z2GA 3R66A 3CJHA 2FTKA 4JI4B 4OX9O 1X59A 3BA9A 3WB1A 2UXDO 2B9ZA 4LFCB 3BEHA 1WN7A 3KZIZ 1XQ8A 5IJ0B 1XNQB 4YHHB 2ARHA 1FYJA 1DK1A 4NB5A 1GN3A 2IJKA 4O4IA 3L71H 4DR4B 3I56V 3SGIA 3JATA 2YC0A 5JJJB 3JCUZ 2DQ0A 4FLZA 2Z5UA 3FYIB 1P4RA 2WLLB 3HKDB 1F4NA 2CTPA 2F95B 3RYFB 2OIEA 1B3QA 1KP2A 4B3SB 1AVMA 1KYOF 4JYBA 3J81N 3RYHA 4B3SO 3E2EA 4ZHQA 1K4CC 3F7YC 5TISZ 1E1QG 1KD1W 4NKGB 4OPHA 1V54C 5EIBD 2X6BA 5K1PA 2ADQB 2PF4E 3FB5C 4WCEV 3THOA 5ITZB 2UUAB 4JI6O 3QO5A 1TVKA 3ABKC 4E4EA 1VQLV 1NJIW 2N74A 2XTAA 4O4HB 3ABMC 3RWRD 3SR2C 5LGTA 1XILA 1OCZC 4YY3B 1GH6A 3T1YB 3T1YO 4H44B 3SYOA 1NI8A 2QE7G 1EZVH 4LF9O 1VQNV 2CGOA 1K7DA 2IBZH 1W59A 4IYIA 1H8HG 1R73A 1Q82W 3UT5B 4XDJA 1QCEA 5IY5B 4AHCA 2E74B 4F6RB 5IDJA 1BMFG 3HKEB 1VQ8V 1THZA 4UCSA 1HNWO 2X0LA 2W6IG 3D36A 4X62O 3ZMZA 4TT3G 3S3WA 2A9HA 1BSMA 5KHIA 2GUZA 4FM1A 3FD9A 1HNXO 3CD6V 4O2AB 5EZYA 1BL8A 1D5AA 4DR1O 2E76B 2BE3A 4MS2A 1EFRG 4PA7A 5KHJA 3GWOA 5CA1A 4FIPC 4ZIBA 1VMGA 1ZSPA 4I55A 1DGSA 1AP5A 4O2BA 1ZLZA 2OT5A 3BAAA 3DC5A 3N2KB 4X8AA 2EIMB 4CBCA 3ETQA 5KX5A 2YICA 2XAGA 1VEWA 1WJZA 1BHAA 4DR3O 1ZUQA 1NVPD 3JD4A 1Y66A 3G4SV 5IYBO 1I94B 3AG2C 3CSXA 5C8YA 4GX5A 4DO2A 3G6BA 2YI8A 2PYLA 4DR2B 4LWSB 1XNRB 4LNUA 2DN9A 4JF3A 1I08A 4JI2B 5L3FA 4GCZA 1GK9A 4UCUA 1G1XB 4JZ2A 1VQ4V 1FJGO 3AG4B 3QO7A 1HNZB 1AI4A 1HNZO 4ABMA 3UQ8A 4JI3B 3R65A 2V1DA 3RGBA 5KMGB 1W2BU 3JASB 4BWAA 2EULA 4UVAA 1K3EA 2FYUH 1K92A 5JH7B 1BS3A 1YJWV 1KB9F 4X65B 1TGOA 2ZNJA 5L3BA 3HKCB 3UO3A 4JYCA 1BQZA 1FXVA 1TUBA 1PD3A 2IH3C 4X1KB 4DV2O 5GTHZ 4UUJC 2RCVA 2CH7A 3P30A 3UCSC 2JS3A 4JI6B 4IIJB 3X2QC 4JI7B 1YCIA 4GYCB 3C3TA 4UB6Z 1MZFA 4QE9A 1UPGA 2R9AA 3TETA 1I5XA 4JYAB 3E22A 2HHHO 1S5JA 4NTYA 5HFLA 1PM9A 1S5HC 1F51A 1YXBA 3B09A 1OHHG 1YTFD 2LGQA 2E3CA 1Z5WA 2HKOA 2ZT9B 4O2AA 5LHHA 2R70A 2ZDIC 1Q3EA 3VQXA 3ZRSA 4I0XB 4GX0A 1P7GA 1MG1A 4QPKA 1B06A 4I7ZB 3TGUH 3B77A 4UVBA 4HZ3A 2X7RB 4UCOA 3SJBC 1G4YB 4LFCO 4ZOLB 2N04A 1NKDA 2P7TC 1HNXB 4I0XA 2NR5A 1XDCA 4YHHO 1I5YA 4HBNA 2JEXA 5B66Z 4O4JA 3G67A 4PA6A 2BSKA 2OCCB 5L3DA 3RYFA 1IBLB 2LO1A 3U11A 4ZI7B 1B04A 1F4MA 2X6AA 3DGEA 3AG4C 3JSLA 4Z1VA 3OTFA 3E8HA 2JS5A 3A8TA 3HKBB 3CCUV 3GB7C 3C3SA 4TV9A 2JEUA 4FLWA 1IVSA 1WNSA 4FPPA 2Q0AA 3OUFA 3RVYA 5JVDA 5CBGA 3CRRA 3ASNB 3K06A 4DR3B 3HPLC 4UXNA 3MAQA 1Q6HA 4H33A 4JTDB 1AI7A 3OMNB 1XUQA 2UUAO 3OEHG 5JQGA 1SZTA 4AI8A 1ZL8B 1WA8A 1KUQA 1HR0O 2ZE5A 4L87A 1XNRO 3STZC 4I5SA 3L75H 2RJZA 2Q9LA 4X20A 1FJGB 3F5WC 2XAJA 1ZX3A 2AGAA 3CCQV 2O57A 4CS2A 1XHZA 3B2EE 5H6RA 1TAEA 2UUCO 4R6ZA 4IIJA 1AB3A 1TUEB 2IW5A 3CHXA 4NVPA 4BIZA 1MZEA 5B5EZ 2C2AA 4A5UB 1IDSA 3H9VA 4MW8A 2Q69A 4X65O 2ZM6B 2KSDA 2ATKC 3JCZA 2LGWA 4JV5B 2UU9O 2IJIA 5DECA 1DF4A 2CGNA 1YSCA 1P49A 1H2NA 4O4LA 2F23A 4K0KO 2OIGA 1L1FA 1OJHA 4E2LA 1J5EB 3QF7A 2Z3YA 2RDCA 2CTQA 2GTSA 4Z1MG 4DV7O 2PY5A 1M57C 4UCTA 4P9OA 1UFIA 3TXSA 1HW7A 3JAMN 2QWPB 5JCOA 1RFYA 1KMIZ 1HWYA 2BSKB 5CB4B 3OR7C 5KHGA 4TOIA 1SETA 1J95A 2VQFB 1JJOA 1K34A 4OXSA 4UVCA 3WU2Z 4G27B 5J2UB 4JI1B 3ASNC 3ZJZA 2Y0PA 4JI1O 4ZHQB 4MTOA 3G6EV 1QR8A 3K58A 4FLTA 4DR2O 1AR4A 1XNQO 4TUYA 3L74H 4YIPA 1EM1A 5E79Z 4JI2O 3RYIA 2ZR2A 4HYOA 4J80A 3ZBHA 2CDYA 1FS0G 3JD3A 2A06H 1K97A 4O4HA 2Z0AA 2F66C 3W7WA 1H2KA 1QLEC 3P3NA 4JAUA 2QA4V 3KCXA 4GUNA 2EINC 2P06A 4LP8A 2XOKG 1PPJH 4MVZA 2F4VO 1H2MA 2EILB 1VIBA 3MHHC 1RSOA 3CRCA 3OW2U 3ABUA 3LNMB 1RM1C 5CA3A 2XAQA 1VQ5V 3OM3B 2EIMC 1SQVH 3FYEB 1NR7A 4CS3A 2W0FC 1K8AW 2Y4TA 1W0JG 3D3IA 5KA6A 3CCEV 1XHXA 1KBHA 4W4KA 1QU7A 4EB6B 1JPXA 1SQPH 1V9PA 3CYOA 3CCLV 3IGAC 3FAVB 1GO3F 1YEWA 4DR7B 3OMIB 2N05A 4EB6A 1HNWB 3CRQA 5CN0A 1GMGA 2XUMA 2Y69B 5H5NA 4QJFB 5LOVB 1WPBA 2FKXA 5LMUB 4DR6B 2ZM6O 2JDIG 1Q43A 1ORQC 4XDLA 4BW5A 2EIJB 1YDXA 2UU9B 4AILC 3D36C 2PUSA 2M7WA 3ZHQA 2UUBO 5IYCO 4DR1B 1WP7A 2KQXA 2RNBA 1QNMA 4WBNB 1JMKC 4TV9B 4CS4A 3DXRB 2JGUA 3ZMTA 4LWSA 1VF5B 4N21A 2DW4A 2EX3A 1H38A 5EK0A 4EFEA 3M8AA 2H8PC 4YIOA 4PDRA 5J9PC 4HNAB 2P5OA 1L0NH 3H1KH 5GW7A 3QTCA 2XNDG 1FXHA 4X64B 3L73H 1YTFB 1KECA 1YIJV 1VQKV 5J2TA 1IX9A 3RBZA 3K9AA 2XAHA 5CA0B 1I94O 2DOSA 1DF5A 2LJ2A 3LNNA 1YI2V 4X1IB 3BHPA 1N4CA 1FXKB 2ZIMA 3ABLB 4ASUG 2A3QA 4RWUA 3WB0A 3ZHRA 3A0HZ 1SERA 1AJQA 4QNHB 2AZ0A 4DW0A 3RYHB 1GM9A 1N36O 1YF2A 3WB2A 1L0LH 5B1BB 1R6TA 1Q81W 3K79A 2LFRA 3VQWA 1EN4A 2IJHA 2YUAA 3RYCB 3Q4HA 3IC9A 1MOFA 2IH1C 3NXSA 2ADPA 1NVPB 4J41A 4I4TA 2QTSA 2M6YA 1Y6XA 4JV5O 3OEEG 1SA0A 2AHYA 2QM7A 5EIBC 1SQGA 4LF8O 2EJRA 3JD1A 1XI1A 5KLVH 5KHKA 2DQ3A 1GN6A 1KQSU 5EBMC 3LDEA 2WA4A 1OCOB 2VRZA 1EN6A 4JYAO 2RQ6A 5KUMA 4KFMA 1NTMH 2WLHA 3ZHVA 1QVGU 1U96A 1JVMA 4LF4O 2ZXWB 1FPOA 4BIUA 1G6UA 1L8DA 4CC6A 4K3AA 4NR1A 1EZJA 2B1IA 5AG2A 2X6CA 4FM2A 2ZINA 3W7XA 3K3WA 4DR7O 5LA6A 3ZHUA 2AW9A 2YIBD 4X66B 3GVMA 4JGSA 3SPJA 4DV3O 1G8MA 3L9DA 2WLNA 4DV3B 1TUBB 2QWRB 5JWPA 1NTKH 5LOVA 3ABLC 2YI9A 3MD0A 4PD4F 4FFBB 4MVOA 5KHHA 3K9SA 4DR6O 4LF6O 1SRYA 4ZKIA 5DM6V 3K0DA 1ROPA 2QJ1A 4JYYA 2JGDA 4FMTA 2EJ7A 4TQFA 5CA1B 4IYHA 3EVKA 4J11A 1E79G 4NXNB 2LW1A 3CP1A 2Y4UA 1WA8B 1ZWIC 1K5SA 5F2VO 4KUMA 3CMEV 3FX7A 4ICGA 3E8BA 4X1KA 2B1GA 5CB4A 3SYAA 5FLXN 1VQ9V 2DWEC 2F4VB 1KKCA 3K59A 3KG2A 2EZPA 1VARA 4FLXA 4FLVA 4YJ3B 2QKCA 4HAMA 1AP6A 3LSQA 1FD9A 2HEPA 1YHQV 2WLMA 4LF7O 3EFFK 4LF7B 4LH6A 2Q67A 1K5QA 4YJ2B 1HR0B 2P90A 2FL4A 3W7UA 1PNMA 1EN5A 3CCVV 2Y48A 3Q4HB 5IE9A 3VQYA 2WLIB 2Q8VA 4L8JA 5C93A 5L3CA 2WA3A 1MA1A 1BGYH 2BCCH 5JCOC 4BW9A 3H1LH 1BCCH 3N27A 2GTAA 2OTLV 1V55B 2H94A 4PJ0Z 1Q7YW 4MTGA 2UUCB 4LFBB 2ZIOA 4BAYA 1SQFA 2GSMB 2UXCB 4KL1A 2JJ1G 2ZE6A 3A2FA 3OT7A 5LMUO 4IT5A 3GWKC 1BHBA 4WBNA 1NH2B 3FB8C 4X1IA 3K03A 3I55V 2HVJC 5CA0A 2UUBB 4EKWA 1P7BA 1J5EO 2HG5C 1AILA 3ZIAG 5LMNO 1U97A 4RUFA 5FPOA 3E22B 4C7UA 3CCSV 4DV0B 2CAZC 1CPYA 2QM4A 2P22C 1PNKA 2H3OA 1OCZB 1Q8IA 3UO2A 3CCRV 5KUKA 4H0LB 2GDSA 3K0GA 1LUWA 2IU3A 2UXBO 2CE4A 1OCOC 1VQ6V 3FKSG 5L3EA 4D7SA 1MNGA 2F93B 2WSSG 2VQFO 1Y76B 4TQDA 1GKFA 4UFZA 4FVMA 2Q5ZA 3IFXA 2L6LA 3TJTA 4I4TB 1BQ0A 3JAKA 3F5TA 4U3JA 1WLEA 2ZDIA 3IJ4A 1MSDA 2Q7HA 4WFAV 2KKWA 5B3SB 1AR1B 5C8YB 4IHJA 1N36B 1TA8A 4X1YB 2DJVA 2ZE8A 1M4UA 1VQPV 2HJFC 1JQ0A 1N33B 3O65A 3E8FA 2EIKC 5LHIA 2D3OW 3BPZA 3LUTB 4DK1A 3B8NA 1QQCA 2DYSB 1OCRB 2P67A 4MVMA 2Y0IA 5EYPB 4ZOLA 4IHJB 3W7TA 4LF8B 4J10A 1AJPA 2QWOB 5B1NA 1PL0A 1JCHA 1RM1B 1GAXA 3EXAA 4CZZA 3TK1A 2EIKB 1COWG 3BRCA 3MDSA 5LP6A 1M56B 2DE0X 3LDDA 5IY5C 5GONB 1MMMA 3CXHF 3S3XA 4WFFA 2GHYA 4LF4B 3CC4V 1VF6C 2BTQA 3SDLA 2IM9A 3TCUA 2QDOA 3M99B 1RP3B 4O4LB 3JD0A 4QE7A 2UXCO 4JAAA 3LDCA 4MVQA 4DYLA 4DV4O 3RW0A 5KAIZ 3SJAC 1OCCB 1IBKB 2VQEB 2IJJA 1VF6A 2QEXV 4UV8A 4PV1B 2LP7A 4QPJA 2LQTA 2R9RB 1GN4A 2YXYA 1KKDA 5BR8B 1VF7A 2ITDC 4LNUB 1N8RW 4DUZB 5B1AB 5LL6Y 4DUZO 3CS5A 4TV8A 4RQEA 2EZOA 3BA8A 4J9YB 2UXBB 3VBBA 2P6JA 1MSWD 3CEIA 4X64O 1QR9A 1GN2A 2JGDB 1IBMO 3IAYA 3QG5A 3VOUA 3ETGA 5B3SC 4JAVA 1JA8A 2ILMA 3AK1A 3SYPA 2EILC 1O9GA 3AK3A 1JFFA 3ML0A 3JARA 1R3IC 3JD2A 3E86A 4H37A 2ZR3A 3FAVA 4X20B 4R8CA 1M1KW 4WFGA 2A79B 2HFEC 2ITCC 3HKDA 1A32A 3E8GA 4G2KA 5DEDA 2Q68A 2WWWA 4NXMO 1ZL8A 4NXMB 2ETNA 5BMVA 4LFBO 4DUYO 4Q6GA 4I9WA 5LHGA 1N33O 4B7KA 3OR6C 4K8ZA 4LFAO 2NN4A 4LFAB 2V7QG 3T4DA 5BY1A 2P4VA 3OGCC 3RFRA 2RMKB 3IC7A 2DWDC 2CH7B 3ZRWA 3CCMV 4JTCB 2VWJA 3HKCA 4F6EA 2FB5A 2MW2B 3VQVA 1DTOA 1Q90D 1SQBH 3ZMVA 2PYJA 1SKVA 4LC1A 4K35A 4DV6O 5D5PA 3LSSA 3UT5A 1N0JA 4DV6B 3SJCC 3AG1B 2CK3G 4NYKA 4CH5A 1R1BA 1V55C 1KP3A 1EBOA 1F7YA 3E35A 1VQMV 2KG7A 4ZI7A 2BOCC 3N2GA 3K57A 3K08A 3P32A 4X66O 2Q7GA 3T1HO 3H1HH 2QSAA 3ZRXA 3RVZA 2WLIA 4DV1O 1XMOO 3WFVA 4LF6B 5H2FZ 4NTXA 2VQEO 2E5LB 1F23A 2ODMA 3AG2B 3B8MA 1US6A 3OFNG 4MT8A 1K9MW 2CTRA 3CC2V 3A0RA 4BR6A 5B1BC 4NXNO 3APOA 3APQA 3ZHSA 2ZCEA 3G80A 1XL6A 1WPXA 4TUYB 1NZ6A 4LR3A 1KU9A 3JATB 1SQQH 2CUGA 4MTFA 5A2QN 1Y4MA 2HP8A 1AROP 3OMAB 2XT9A 4NTWA 4J7KA 2JVDA 4GX1A 1Q86W 4YJ3A 5H6QA 1S77D 3TXQA 4JI5O 4FFBA 4JI5B 1JJ2U 3X2QB 3QO8A 1PP9H 2Q7EA 2EIJC 2YXHA 3H1JH 2WAMA 1XBLA 4QGPA 1K73W 1FFXA 1CXZB 1M90W 1E1RG 1NT2B 1NQTA 2Q73A 1B6QA 3KKYA 4LH7A 4F6RA 3RT3C 4J7JA 2ZXWC 4W4LA 1MABG 4QIWF 3WG7C 3CX5F 2AXTZ 2BOBC 5ITZA 3JSNA 4MW3A 1ENVA 1HP8A 1GRJA 5EZYB 3H1IH 1R3LC 5JJEB 4FLYA 4GKJO 4OPAA 4DV4B 1XMQO 4DR5B 3D3QA 2AZ2A 3ZEDA 1V54B 1RSOB 4J9ZB 1JOYA 3OTOB 1YJ9V 3U0ZA 1Y76A 5LMNB 1VQ7V 1NTZH 1SA0B 3T4ZA 2WLJA 4WFHA 4DV0O 3JALA 1QVFU 2B5UA 3HR0A 3AG7A 1S76D 4D6TH 1CEZA 2YIAA 1R3KC 5A9GA 4TSFG 1PV0A 1T5EA 5LBQA 3BABA 3AEIA 3CCJV 1AI6A 1FFTB 1PNLA 3DXRA 5LGNA 1IBMB 3JAKB 1N34B 1D2DA 2YIBA 3ETDA 4X89A 1SS3A 1GTOA 3QVNA 3J7AU 5EBWC 3ETEA 3PN1A 1XMOB 3ZS8C
chains in the Genus database with same CATH topology
4MTOA 3G6EV 4RUEA 1QR8A 3BEHA 4WFAV 4Q20A 5B3SB 3H01A 2MK3A 1AR1B 3UM7A 2ZR2A 4HYOA 5HFMA 3W7SA 1FS0G 3JD3A 1S72V 2IJKA 1K97A 1VQPV 3I56V 5CMUA 2HJFC 1JQ0A 1CP9A 3W7WA 1W0KG 2DQ0A 3FB6C 1QLEC 4JAUA 2QA4V 2Z5UA 3FYIB 1P4RA 2WLLB 2YSUB 1F4NA 2EINC 3HB3B 3E8FA 4WFBV 1KP2A 2XOKG 2EIKC 4LP8A 5L3GA 5LHIA 4MVZA 4JYBA 3ZRVA 2ZQMA 2D3OW 2NLJC 3LUTB 3ZCCA 3E2EA 3B8NA 2DYSB 1K4CC 1OCRB 2EILB 2P67A 3F7YC 3T1CA 1E1QG 3MHHC 5B1OA 4MVMA 3OW2U 1KD1W 1K33A 1V54C 3ABUA 3LNMB 1RM1C 5CA3A 2X6BA 5EBLC 4LCUC 3W7TA 2JJ2G 3FB5C 4WCEV 4PDVA 2XAQA 1AJPA 5B1NA 3QO5A 4ZBMA 1IXMA 1PL0A 3ABKC 1VQLV 1NJIW 1JCHA 3OM3B 1VQ5V 1S0VA 2EIMC 1RM1B 3ABMC 4CZZA 1H2GA 3FYEB 1NR7A 3TK1A 5LGTA 2W0FC 1K4DC 2EIKB 1K8AW 2F43G 1OCZC 1COWG 1R3JC 2YEVA 3UKMA 1W0JG 1M56B 5LGUA 3D3IA 3LDDA 5KA6A 5IY5C 3CCEV 2LFSA 1QLEB 4WFFA 3SYOA 2GHYA 2QE7G 3CC4V 1VQNV 1JPXA 1K7DA 3ABMB 1R6NA 3CYOA 3CCLV 3WG7B 1LNQA 3TCUA 1H8HG 1R73A 4YXWG 3ABTA 3IGAC 1Q82W 1GO3F 3M99B 4XDJA 4UV9A 1QCEA 5IY5B 3OMIB 5IDJA 1BMFG 3JD0A 4QE7A 1VQ8V 5CN0A 1THZA 3LDCA 1GMGA 2X0LA 2W6IG 2Y69B 4MVQA 3D36A 4LBEC 3RW0A 4QJFB 3ZMZA 3OUSA 4TT3G 1OCCB 2A9HA 4PDMA 2IJJA 2JDIG 5H9CA 2NNUA 4FJCC 3F7VC 2JIZG 1ORQC 4XDLA 4BW5A 2EIJB 2QEXV 2UXXA 4UV8A 3CD6V 4PA9A 2Q6AA 2LP7A 2M7WA 4QPJA 2R9RB 4RAIA 5IYCO 2EINB 1BL8A 2W6JG 4PDLA 3JYCA 1KKDA 4MS2A 1EFRG 4PA7A 3GWOA 5CBFA 3OAAG 3CMAV 3ZMTA 2ITDC 4FIPC 1N8RW 4N21A 2DW4A 5B1AB 1H38A 5EK0A 3SJQC 4RQEA 4P9PA 2H8PC 4PDRA 2OT5A 2WLLA 5J9PC 2EZOA 3AG3B 3SYQA 4J9YB 4U7NA 4X8AA 2P6JA 2EIMB 3VBBA 4CBCA 3G71V 5CBHA 1MSWD 1S3JA 5GW7A 2XNDG 1FXHA 1QR9A 2XAGA 1YTFB 1BHAA 1KECA 1YIJV 3STLC 4RO2A 1VQKV 1NVPD 1YITV 3RBZA 3JD4A 3K9AA 2XAHA 3VOUA 1Y66A 3ETGA 4JASA 3ZRWB 5IYBO 3G4SV 5B3SC 1DF5A 4JAVA 3AG2C 1NBMG 1YI2V 4GX5A 4DO2A 4N23A 3SYPA 3E83A 2DYSC 2EILC 3CXCU 3ABLB 1FXKB 3ML0A 1M9NA 1R3IC 4ASUG 1H8EG 3JD2A 3E86A 1OZ0A 2QTOA 4H37A 4R50A 2KB1A 2ZR3A 1XL4A 1SERA 1AJQA 4QNHB 4JF3A 1YJNV 4R8CA 4GCZA 5L3FA 1GK9A 1M1KW 2PI4A 1GM9A 4WFGA 1VQ4V 3EHBB 2A79B 2HFEC 3CPWU 2ITCC 3AG4B 3QO7A 3E8GA 1AI4A 4G2KA 2Q68A 2WWWA 5B1BB 1Q81W 2OCCC 5EC1C 3E89A 2V1DA 3K79A 3R65A 2LFRA 1GM7A 5IYDO 4G28B 1W2BU 4I9WA 3K04A 5LHGA 3OR6C 2IJHA 4UVAA 2PI5A 1MOFA 2V7QG 3T4DA 2IH1C 3NXSA 1K3EA 1NVPB 1K92A 5FL7G 3OGCC 1OCCC 1YJWV 1KC8W 4XDKA 3IC7A 2DWDC 4GX2A 5L3BA 3SPIA 3ZRWA 4JYCA 3OEEG 1FXVA 2JK5C 1PD3A 1JX9A 2AHYA 2QM7A 2WLKA 4JTCB 2IH3C 3CCMV 2EJRA 3JD1A 4UUJC 3P30A 4PA3A 2DQ3A 1UJWB 3X2QC 4MVRA 1KQSU 5EBMC 3LDEA 3CC7V 3SPGA 1DTOA 3SYCA 1QBZA 3ZMVA 1OCOB 4QE9A 3SPHA 1OCRC 1RPRA 3TETA 1I5XA 4LC1A 2A0LA 5KUMA 3LSSA 4KFMA 3AG1B 1M56C 2CK3G 2WLHA 2ZD9A 4GT1A 4U7OA 5HFLA 1KP3A 1V55C 1S5HC 1QVGU 1EBOA 1JVMA 1F51A 2ZXWB 4BIUA 3E35A 4R7CA 1VQMV 1OHHG 1YTFD 1EZJA 2B1IA 2R9IA 2IU0A 2BOCC 4DXWA 2X6CA 3K08A 2HKOA 3P32A 3W7XA 3K3WA 5LHHA 4JGSA 3ZRXA 3SPJA 3RVZA 1G8MA 4F4LA 2WLNA 2ZDIC 3ZRSA 2DYRC 4GX0A 2WLIA 1MG1A 4QPKA 3B77A 4UVBA 3MHSC 2UXNA 3ABLC 3MD0A 4MVOA 4HZ3A 3WFVA 2X7RB 1G4YB 1F23A 3AG2B 1SRYA 4ZKIA 3B8MA 5DM6V 1NKDA 3ZN0A 2P7TC 1QLNA 1NH2D 3K0DA 3OFNG 4MT8A 1PKXA 1ROPA 1K9MW 1I5YA 4RQFA 2JEXA 4FMTA 2EBOA 2DYRB 4TWKA 3CC2V 4PA6A 2OCCB 3A0RA 5L3DA 5B1BC 3T2MA 4KP4A 1E79G 3CP1A 3AG3C 2XASA 1ZWIC 1XL6A 1WPXA 1F4MA 1K5SA 2X6AA 3DGEA 3AG4C 4KUMA 3CMEV 3E8HA 1SESA 4MTFA 3E8BA 2B1GA 1Y4MA 3AG1C 3CCUV 2QM8A 3GB7C 3SYAA 1AROP 3OMAB 1VQ9V 2JEUA 2DWEC 5E1AC 3KG2A 4FPPA 3FB7C 3OUFA 4GX1A 2EZPA 5EC2C 3RVYA 5DN6G 1Q86W 5CBGA 3ASNB 3K06A 5H6QA 2QKSA 1S77D 2HR3A 2Y69C 3QNEA 4HAMA 3HPLC 1JJ2U 3LSQA 4UXNA 2OTJV 3X2QB 4H33A 4JTDB 1AI7A 3QO8A 2WLMA 1YHQV 3OMNB 5KA5A 3EFFK 1VQOV 2EIJC 2HLDG 3OEHG 1SZTA 2Q67A 2WAMA 4X88A 1K5QA 4JTAB 1K73W 3BY6A 2P90A 2XAFA 1M90W 1E1RG 4MTXA 1NQTA 4L87A 1B6QA 5B1AC 3W7UA 4XBFA 1PNMA 1R6KA 4WF9V 3CCVV 3STZC 2Y48A 4I5SA 2ZXWC 2WLIB 5C93A 1MABG 5L3CA 1NR1A 3F5WC 2XAJA 4FK5C 4QIWF 3WG7C 1M57B 3CCQV 2BOBC 2OTLV 1V55B 2H94A 1Q7YW 4MW3A 4MTGA 5H6RA 1ENVA 1GM8A 4R6ZA 4BAYA 2GSMB 1TUEB 1R3LC 2IW5A 2JJ1G 4JPRA 4BIZA 2C2AA 2K1EA 4MW8A 2Q69A 1BHBA 1NH2B 1AI5A 2ATKC 3JCZA 3ZMUA 3ABKB 3FB8C 3K03A 2IJIA 3DTUB 3I55V 1DF4A 1FXKC 1YSCA 4MVSA 2HVJC 4MSWC 1V54B 4MVUA 4J9ZB 1JOYA 4EKWA 1YJ9V 1RPOA 1P7BA 1L1FA 2HG5C 3ZIAG 4E2LA 1VQ7V 2AHZA 4RUFA 2Z3YA 3T4ZA 4P2ZA 2WLJA 4WFHA 3OE7G 1QVFU 1DLBA 4Z1MG 3ASOB 3CCSV 1M57C 2B5UA 1CPYA 4P9OA 1S76D 3ZMSA 1CEZA 1PNKA 1OCZB 3ZN1A 1R3KC 3CCRV 4WFEA 1AJNA 5KUKA 2HVKC 4TSFG 3K0GA 2IU3A 5LBQA 1HWYA 3AEIA 3CCJV 1AI6A 3SPCA 1FFTB 1OCOC 5BZBA 3FKSG 3OR7C 5L3EA 1VQ6V 1PNLA 1SETA 2WSSG 3ASOC 1GKFA 1J95A 4PA4A 3IFXA 4P30A 4PELA 5LGNA 3PJSK 1K34A 1FXKA 2WPDG 4OXSA 4UVCA 4G27B 3ETDA 4X89A 1GTOA 2YEVB 5EBWC 3ETEA 1WLEA 3ASNC 2FTKA 3ZJZA 2ZDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFR A;  4ZKI A;  5B1N A;  4JAU A;  1IXM A;  2QM8 A;  4MT8 A;  4QPJ A;  1JOY A;  4Q20 A;  4U7N A;  3P32 A;  4FMT A;  4FPP A;  4MTX A;  3ZRV A;  4JYB A;  5IDJ A;  3NXS A;  4GCZ A;  3TK1 A;  3ZCC A;  4BIZ A;  3A0R A;  3ZRX A;  4I5S A;  4LC1 A;  4KP4 A;  5C93 A;  2C2A A;  2P67 A;  5B1O A;  3D36 A;  4QPK A;  2LFS A;  4JAS A;  3ZRW B;  2WWW A;  3ZRW A;  4GT1 A;  4JAV A;  4JYC A;  4U7O A;  3MD0 A;  3DGE A;  2FTK A;  2QM7 A;  1F51 A;  4BIU A; 
#chains in the Genus database with same CATH topology
 4RUE A;  5FNV A;  2E5L O;  3L72 H;  5KAF Z;  4Q20 A;  1WB7 A;  2RN9 A;  4D7T A;  3H01 A;  2MK3 A;  1LUV A;  5BXZ A;  3UM7 A;  4JI0 B;  1FAF A;  4O2B B;  1IXB A;  5HFM A;  3W7S A;  5IWA B;  1S72 V;  3JAS A;  4GLX A;  1I7F A;  3B4S A;  4O4I B;  5CMU A;  5KX5 B;  1N32 O;  2E75 B;  1CP9 A;  1N32 B;  1D5N A;  2A7W A;  4DUY B;  1W0K G;  4FM0 A;  3FB6 C;  1WAZ A;  5GON A;  2YSU B;  3RN4 A;  2YS8 A;  3HB3 B;  4YJ2 A;  2P4K A;  4WFB V;  5L3G A;  3ZRV A;  4J42 A;  2ZQM A;  2NLJ C;  2W0X A;  3ZCC A;  3L70 H;  5IYZ B;  5IJ9 B;  3T1C A;  4PI0 A;  5B1O A;  1BE3 H;  4KHP B;  1K33 A;  4KHP O;  5EBL C;  2QR4 A;  4LCU C;  2JJ2 G;  1FKA O;  3AK2 A;  3RYI B;  2BTO A;  3DSQ A;  4PDV A;  2F1M A;  4TV8 B;  4ZBM A;  4EFB A;  1IXM A;  1S0V A;  1XOU A;  1P84 F;  1H2G A;  4IL6 Z;  1K4D C;  2F43 G;  1R3J C;  1SF9 A;  3LSU A;  2YEV A;  3UKM A;  5LGU A;  2LFS A;  4AQY O;  1QLE B;  4UCV A;  1FFX B;  1Q5O A;  3JAW B;  2GBO A;  3KCY A;  3ABM B;  1R6N A;  3WG7 B;  1LNQ A;  4YXW G;  3ABT A;  1O9H A;  2G38 A;  3C90 A;  4UV9 A;  3P3P A;  2QWN B;  4Z2W A;  3NR7 A;  2XHB A;  3HKE A;  4U3F H;  2Q4P A;  4X9Q A;  5JVD B;  4LBE C;  1IBK O;  3OUS A;  3RYC A;  4X62 B;  1VP7 A;  2HJD A;  4PDM A;  5H9C A;  1YZB A;  2NNU A;  4FJC C;  3F7V C;  2JIZ G;  5GTI Z;  2UXX A;  5J2U A;  4PA9 A;  2Q6A A;  1TVK B;  1WB8 A;  1I0H A;  4RAI A;  2EIN B;  2W6J G;  4PDL A;  5JH7 A;  3JYC A;  5BR8 O;  1LR1 A;  1Y74 A;  5CBF A;  3OAA G;  3CMA V;  4B7E A;  3CRM A;  4GKK O;  4JI8 B;  2ZKO A;  1H2S B;  3SJQ C;  4P9P A;  3JAR B;  2WLL A;  3AG3 B;  3CRA A;  3SYQ A;  2KG7 B;  2Q0O C;  4U7N A;  1S5L Z;  3G71 V;  2YDE A;  5CBH A;  1S3J A;  2PZS A;  4DRX B;  4O4J B;  4DV5 O;  3STL C;  4RO2 A;  4DK0 A;  1YIT V;  5LYJ A;  4JAS A;  3ZRW B;  1Q6I A;  4DW1 A;  4I9Q A;  4CC5 A;  1IUR A;  1NBM G;  4CH4 A;  4N23 A;  3E83 A;  2DYS C;  3CXC U;  1M9N A;  2JRI A;  4OX9 B;  3CWB H;  1H8E G;  5D5Q A;  2UXD B;  5JQG B;  1OZ0 A;  2QTO A;  4R50 A;  2KB1 A;  1XL4 A;  1YJN V;  3CJH B;  2PI4 A;  3K5L A;  4OGQ B;  4JI0 O;  3EHB B;  4UB8 Z;  1BZK A;  1H2L A;  3CPW U;  4HNA A;  4DR4 O;  2OYQ A;  2OCC C;  5EC1 C;  3DC6 A;  3E89 A;  1HDJ A;  1GM7 A;  5IYD O;  4G28 B;  3K04 A;  1M93 A;  2CTW A;  5KMG A;  3K5M A;  2PI5 A;  3K5O A;  4B3T B;  4GKJ B;  3BCC H;  3JAW A;  4B3T O;  5FL7 G;  2VS0 A;  1OCC C;  3M7M X;  1KC8 W;  3CE2 A;  4XDK A;  4GX2 A;  5JJN B;  3SPI A;  3FFQ A;  3JAL B;  2DMX A;  2GUZ B;  2JK5 C;  2WLK A;  1JX9 A;  3HKB A;  3ICX A;  5IJ9 A;  2BTQ B;  1WP8 A;  4DV2 B;  4B3M O;  4PA3 A;  2L35 A;  1UJW B;  4MVR A;  3CC7 V;  3SPG A;  3SYC A;  1QBZ A;  3D8C A;  4JI7 O;  4FZ1 A;  3SPH A;  1OCR C;  1RPR A;  5LP6 B;  3ZX6 A;  2A0L A;  1M5I A;  4YY3 O;  4H13 B;  5J2T B;  1M56 C;  4B08 A;  4LF5 B;  4J7Z A;  2ZD9 A;  2HHH B;  3I5D A;  4GT1 A;  2OWO A;  4U7O A;  4CH3 A;  4R7C A;  1JFF B;  2ZE7 A;  1SQX H;  4JZG A;  4FZ0 A;  2IU0 A;  2R9I A;  4DXW A;  2PGG A;  1JR9 A;  3B40 A;  3T1H B;  1N34 O;  3OGI B;  1NS1 A;  2R72 A;  4F4L A;  2DYR C;  4DV1 B;  3MHS C;  2UXN A;  3BVO A;  4JI4 O;  3N2K A;  2QGN A;  3ZN0 A;  1QLN A;  1NH2 D;  3BFR A;  1PKX A;  4CH6 A;  3J80 N;  4RQF A;  2GV9 A;  2EBO A;  2DYR B;  4KXR A;  4TWK A;  5IWA O;  5LXT B;  1ZTE A;  1Y74 B;  4KP4 A;  3T2M A;  1IBL O;  1XRE A;  3AG3 C;  2XAS A;  4IGG A;  3CB2 A;  2V4D A;  4PI2 A;  4JI8 O;  1Q6U A;  1SES A;  3AG1 C;  2QM8 A;  5E1A C;  3FB7 C;  2QKA A;  5EC2 C;  5DN6 G;  2QKS A;  1NU1 H;  2OCH A;  5IT9 N;  2HR3 A;  2Y69 C;  3QNE A;  1SC5 B;  3ZHT A;  3A0B Z;  2OTJ V;  5LXT A;  5KA5 A;  1VQO V;  5BMV B;  2HLD G;  4B3R B;  4U3J B;  4X88 A;  4B3R O;  4JTA B;  3BY6 A;  2XAF A;  3N2G B;  4MTX A;  5B1A C;  2K9P A;  4XBF A;  1R6K A;  4PHZ A;  4WF9 V;  1QHT A;  4K8X A;  2LW7 A;  4AQY B;  1NR1 A;  2D2C B;  4FK5 C;  1AR5 A;  4LF9 B;  4UCR A;  5LP6 C;  1M57 B;  1Z5V A;  2PTM A;  1IZ3 A;  1SZX A;  4X1Y A;  4JI3 O;  4I50 B;  1GM8 A;  1ZAU A;  5EYP A;  3U10 A;  1YVW A;  4JPR A;  3O9O A;  4EEQ A;  5IYZ A;  1XMQ B;  2K1E A;  4DR5 O;  5LA6 B;  4DRX A;  1AI5 A;  3ZMU A;  3ABK B;  1PL4 A;  1N0N A;  3DTU B;  4GZR B;  1FXK C;  3K5N A;  4MVS A;  4MSW C;  5K1X A;  3OTO O;  5LYJ B;  2YID A;  4MVU A;  4B3M B;  1RPO A;  2VWK A;  4K0K B;  2AHZ A;  4P2Z A;  3OE7 G;  1DLB A;  3ASO B;  5FPR A;  4I50 A;  4DV7 B;  4GKK B;  3ZMS A;  1XEQ A;  2FML A;  4LF5 O;  3ZN1 A;  5IJ0 A;  4I55 B;  4WFE A;  1AJN A;  2HVK C;  4BIO A;  4FLU A;  5FNV B;  3OD4 A;  3SPC A;  5BZB A;  2ZNI A;  3ASO C;  4PA4 A;  2QWQ B;  4DV5 B;  1URF A;  4P30 A;  4PEL A;  1X4T A;  1OV9 A;  3PJS K;  4FFK A;  2WPD G;  1FXK A;  1Y67 A;  1BT8 A;  2YEV B;  2YXL A;  1Z2G A;  3R66 A;  3CJH A;  2FTK A;  4JI4 B;  4OX9 O;  1X59 A;  3BA9 A;  3WB1 A;  2UXD O;  2B9Z A;  4LFC B;  3BEH A;  1WN7 A;  3KZI Z;  1XQ8 A;  5IJ0 B;  1XNQ B;  4YHH B;  2ARH A;  1FYJ A;  1DK1 A;  4NB5 A;  1GN3 A;  2IJK A;  4O4I A;  3L71 H;  4DR4 B;  3I56 V;  3SGI A;  3JAT A;  2YC0 A;  5JJJ B;  3JCU Z;  2DQ0 A;  4FLZ A;  2Z5U A;  3FYI B;  1P4R A;  2WLL B;  3HKD B;  1F4N A;  2CTP A;  2F95 B;  3RYF B;  2OIE A;  1B3Q A;  1KP2 A;  4B3S B;  1AVM A;  1KYO F;  4JYB A;  3J81 N;  3RYH A;  4B3S O;  3E2E A;  4ZHQ A;  1K4C C;  3F7Y C;  5TIS Z;  1E1Q G;  1KD1 W;  4NKG B;  4OPH A;  1V54 C;  5EIB D;  2X6B A;  5K1P A;  2ADQ B;  2PF4 E;  3FB5 C;  4WCE V;  3THO A;  5ITZ B;  2UUA B;  4JI6 O;  3QO5 A;  1TVK A;  3ABK C;  4E4E A;  1VQL V;  1NJI W;  2N74 A;  2XTA A;  4O4H B;  3ABM C;  3RWR D;  3SR2 C;  5LGT A;  1XIL A;  1OCZ C;  4YY3 B;  1GH6 A;  3T1Y B;  3T1Y O;  4H44 B;  3SYO A;  1NI8 A;  2QE7 G;  1EZV H;  4LF9 O;  1VQN V;  2CGO A;  1K7D A;  2IBZ H;  1W59 A;  4IYI A;  1H8H G;  1R73 A;  1Q82 W;  3UT5 B;  4XDJ A;  1QCE A;  5IY5 B;  4AHC A;  2E74 B;  4F6R B;  5IDJ A;  1BMF G;  3HKE B;  1VQ8 V;  1THZ A;  4UCS A;  1HNW O;  2X0L A;  2W6I G;  3D36 A;  4X62 O;  3ZMZ A;  4TT3 G;  3S3W A;  2A9H A;  1BSM A;  5KHI A;  2GUZ A;  4FM1 A;  3FD9 A;  1HNX O;  3CD6 V;  4O2A B;  5EZY A;  1BL8 A;  1D5A A;  4DR1 O;  2E76 B;  2BE3 A;  4MS2 A;  1EFR G;  4PA7 A;  5KHJ A;  3GWO A;  5CA1 A;  4FIP C;  4ZIB A;  1VMG A;  1ZSP A;  4I55 A;  1DGS A;  1AP5 A;  4O2B A;  1ZLZ A;  2OT5 A;  3BAA A;  3DC5 A;  3N2K B;  4X8A A;  2EIM B;  4CBC A;  3ETQ A;  5KX5 A;  2YIC A;  2XAG A;  1VEW A;  1WJZ A;  1BHA A;  4DR3 O;  1ZUQ A;  1NVP D;  3JD4 A;  1Y66 A;  3G4S V;  5IYB O;  1I94 B;  3AG2 C;  3CSX A;  5C8Y A;  4GX5 A;  4DO2 A;  3G6B A;  2YI8 A;  2PYL A;  4DR2 B;  4LWS B;  1XNR B;  4LNU A;  2DN9 A;  4JF3 A;  1I08 A;  4JI2 B;  5L3F A;  4GCZ A;  1GK9 A;  4UCU A;  1G1X B;  4JZ2 A;  1VQ4 V;  1FJG O;  3AG4 B;  3QO7 A;  1HNZ B;  1AI4 A;  1HNZ O;  4ABM A;  3UQ8 A;  4JI3 B;  3R65 A;  2V1D A;  3RGB A;  5KMG B;  1W2B U;  3JAS B;  4BWA A;  2EUL A;  4UVA A;  1K3E A;  2FYU H;  1K92 A;  5JH7 B;  1BS3 A;  1YJW V;  1KB9 F;  4X65 B;  1TGO A;  2ZNJ A;  5L3B A;  3HKC B;  3UO3 A;  4JYC A;  1BQZ A;  1FXV A;  1TUB A;  1PD3 A;  2IH3 C;  4X1K B;  4DV2 O;  5GTH Z;  4UUJ C;  2RCV A;  2CH7 A;  3P30 A;  3UCS C;  2JS3 A;  4JI6 B;  4IIJ B;  3X2Q C;  4JI7 B;  1YCI A;  4GYC B;  3C3T A;  4UB6 Z;  1MZF A;  4QE9 A;  1UPG A;  2R9A A;  3TET A;  1I5X A;  4JYA B;  3E22 A;  2HHH O;  1S5J A;  4NTY A;  5HFL A;  1PM9 A;  1S5H C;  1F51 A;  1YXB A;  3B09 A;  1OHH G;  1YTF D;  2LGQ A;  2E3C A;  1Z5W A;  2HKO A;  2ZT9 B;  4O2A A;  5LHH A;  2R70 A;  2ZDI C;  1Q3E A;  3VQX A;  3ZRS A;  4I0X B;  4GX0 A;  1P7G A;  1MG1 A;  4QPK A;  1B06 A;  4I7Z B;  3TGU H;  3B77 A;  4UVB A;  4HZ3 A;  2X7R B;  4UCO A;  3SJB C;  1G4Y B;  4LFC O;  4ZOL B;  2N04 A;  1NKD A;  2P7T C;  1HNX B;  4I0X A;  2NR5 A;  1XDC A;  4YHH O;  1I5Y A;  4HBN A;  2JEX A;  5B66 Z;  4O4J A;  3G67 A;  4PA6 A;  2BSK A;  2OCC B;  5L3D A;  3RYF A;  1IBL B;  2LO1 A;  3U11 A;  4ZI7 B;  1B04 A;  1F4M A;  2X6A A;  3DGE A;  3AG4 C;  3JSL A;  4Z1V A;  3OTF A;  3E8H A;  2JS5 A;  3A8T A;  3HKB B;  3CCU V;  3GB7 C;  3C3S A;  4TV9 A;  2JEU A;  4FLW A;  1IVS A;  1WNS A;  4FPP A;  2Q0A A;  3OUF A;  3RVY A;  5JVD A;  5CBG A;  3CRR A;  3ASN B;  3K06 A;  4DR3 B;  3HPL C;  4UXN A;  3MAQ A;  1Q6H A;  4H33 A;  4JTD B;  1AI7 A;  3OMN B;  1XUQ A;  2UUA O;  3OEH G;  5JQG A;  1SZT A;  4AI8 A;  1ZL8 B;  1WA8 A;  1KUQ A;  1HR0 O;  2ZE5 A;  4L87 A;  1XNR O;  3STZ C;  4I5S A;  3L75 H;  2RJZ A;  2Q9L A;  4X20 A;  1FJG B;  3F5W C;  2XAJ A;  1ZX3 A;  2AGA A;  3CCQ V;  2O57 A;  4CS2 A;  1XHZ A;  3B2E E;  5H6R A;  1TAE A;  2UUC O;  4R6Z A;  4IIJ A;  1AB3 A;  1TUE B;  2IW5 A;  3CHX A;  4NVP A;  4BIZ A;  1MZE A;  5B5E Z;  2C2A A;  4A5U B;  1IDS A;  3H9V A;  4MW8 A;  2Q69 A;  4X65 O;  2ZM6 B;  2KSD A;  2ATK C;  3JCZ A;  2LGW A;  4JV5 B;  2UU9 O;  2IJI A;  5DEC A;  1DF4 A;  2CGN A;  1YSC A;  1P49 A;  1H2N A;  4O4L A;  2F23 A;  4K0K O;  2OIG A;  1L1F A;  1OJH A;  4E2L A;  1J5E B;  3QF7 A;  2Z3Y A;  2RDC A;  2CTQ A;  2GTS A;  4Z1M G;  4DV7 O;  2PY5 A;  1M57 C;  4UCT A;  4P9O A;  1UFI A;  3TXS A;  1HW7 A;  3JAM N;  2QWP B;  5JCO A;  1RFY A;  1KMI Z;  1HWY A;  2BSK B;  5CB4 B;  3OR7 C;  5KHG A;  4TOI A;  1SET A;  1J95 A;  2VQF B;  1JJO A;  1K34 A;  4OXS A;  4UVC A;  3WU2 Z;  4G27 B;  5J2U B;  4JI1 B;  3ASN C;  3ZJZ A;  2Y0P A;  4JI1 O;  4ZHQ B;  4MTO A;  3G6E V;  1QR8 A;  3K58 A;  4FLT A;  4DR2 O;  1AR4 A;  1XNQ O;  4TUY A;  3L74 H;  4YIP A;  1EM1 A;  5E79 Z;  4JI2 O;  3RYI A;  2ZR2 A;  4HYO A;  4J80 A;  3ZBH A;  2CDY A;  1FS0 G;  3JD3 A;  2A06 H;  1K97 A;  4O4H A;  2Z0A A;  2F66 C;  3W7W A;  1H2K A;  1QLE C;  3P3N A;  4JAU A;  2QA4 V;  3KCX A;  4GUN A;  2EIN C;  2P06 A;  4LP8 A;  2XOK G;  1PPJ H;  4MVZ A;  2F4V O;  1H2M A;  2EIL B;  1VIB A;  3MHH C;  1RSO A;  3CRC A;  3OW2 U;  3ABU A;  3LNM B;  1RM1 C;  5CA3 A;  2XAQ A;  1VQ5 V;  3OM3 B;  2EIM C;  1SQV H;  3FYE B;  1NR7 A;  4CS3 A;  2W0F C;  1K8A W;  2Y4T A;  1W0J G;  3D3I A;  5KA6 A;  3CCE V;  1XHX A;  1KBH A;  4W4K A;  1QU7 A;  4EB6 B;  1JPX A;  1SQP H;  1V9P A;  3CYO A;  3CCL V;  3IGA C;  3FAV B;  1GO3 F;  1YEW A;  4DR7 B;  3OMI B;  2N05 A;  4EB6 A;  1HNW B;  3CRQ A;  5CN0 A;  1GMG A;  2XUM A;  2Y69 B;  5H5N A;  4QJF B;  5LOV B;  1WPB A;  2FKX A;  5LMU B;  4DR6 B;  2ZM6 O;  2JDI G;  1Q43 A;  1ORQ C;  4XDL A;  4BW5 A;  2EIJ B;  1YDX A;  2UU9 B;  4AIL C;  3D36 C;  2PUS A;  2M7W A;  3ZHQ A;  2UUB O;  5IYC O;  4DR1 B;  1WP7 A;  2KQX A;  2RNB A;  1QNM A;  4WBN B;  1JMK C;  4TV9 B;  4CS4 A;  3DXR B;  2JGU A;  3ZMT A;  4LWS A;  1VF5 B;  4N21 A;  2DW4 A;  2EX3 A;  1H38 A;  5EK0 A;  4EFE A;  3M8A A;  2H8P C;  4YIO A;  4PDR A;  5J9P C;  4HNA B;  2P5O A;  1L0N H;  3H1K H;  5GW7 A;  3QTC A;  2XND G;  1FXH A;  4X64 B;  3L73 H;  1YTF B;  1KEC A;  1YIJ V;  1VQK V;  5J2T A;  1IX9 A;  3RBZ A;  3K9A A;  2XAH A;  5CA0 B;  1I94 O;  2DOS A;  1DF5 A;  2LJ2 A;  3LNN A;  1YI2 V;  4X1I B;  3BHP A;  1N4C A;  1FXK B;  2ZIM A;  3ABL B;  4ASU G;  2A3Q A;  4RWU A;  3WB0 A;  3ZHR A;  3A0H Z;  1SER A;  1AJQ A;  4QNH B;  2AZ0 A;  4DW0 A;  3RYH B;  1GM9 A;  1N36 O;  1YF2 A;  3WB2 A;  1L0L H;  5B1B B;  1R6T A;  1Q81 W;  3K79 A;  2LFR A;  3VQW A;  1EN4 A;  2IJH A;  2YUA A;  3RYC B;  3Q4H A;  3IC9 A;  1MOF A;  2IH1 C;  3NXS A;  2ADP A;  1NVP B;  4J41 A;  4I4T A;  2QTS A;  2M6Y A;  1Y6X A;  4JV5 O;  3OEE G;  1SA0 A;  2AHY A;  2QM7 A;  5EIB C;  1SQG A;  4LF8 O;  2EJR A;  3JD1 A;  1XI1 A;  5KLV H;  5KHK A;  2DQ3 A;  1GN6 A;  1KQS U;  5EBM C;  3LDE A;  2WA4 A;  1OCO B;  2VRZ A;  1EN6 A;  4JYA O;  2RQ6 A;  5KUM A;  4KFM A;  1NTM H;  2WLH A;  3ZHV A;  1QVG U;  1U96 A;  1JVM A;  4LF4 O;  2ZXW B;  1FPO A;  4BIU A;  1G6U A;  1L8D A;  4CC6 A;  4K3A A;  4NR1 A;  1EZJ A;  2B1I A;  5AG2 A;  2X6C A;  4FM2 A;  2ZIN A;  3W7X A;  3K3W A;  4DR7 O;  5LA6 A;  3ZHU A;  2AW9 A;  2YIB D;  4X66 B;  3GVM A;  4JGS A;  3SPJ A;  4DV3 O;  1G8M A;  3L9D A;  2WLN A;  4DV3 B;  1TUB B;  2QWR B;  5JWP A;  1NTK H;  5LOV A;  3ABL C;  2YI9 A;  3MD0 A;  4PD4 F;  4FFB B;  4MVO A;  5KHH A;  3K9S A;  4DR6 O;  4LF6 O;  1SRY A;  4ZKI A;  5DM6 V;  3K0D A;  1ROP A;  2QJ1 A;  4JYY A;  2JGD A;  4FMT A;  2EJ7 A;  4TQF A;  5CA1 B;  4IYH A;  3EVK A;  4J11 A;  1E79 G;  4NXN B;  2LW1 A;  3CP1 A;  2Y4U A;  1WA8 B;  1ZWI C;  1K5S A;  5F2V O;  4KUM A;  3CME V;  3FX7 A;  4ICG A;  3E8B A;  4X1K A;  2B1G A;  5CB4 A;  3SYA A;  5FLX N;  1VQ9 V;  2DWE C;  2F4V B;  1KKC A;  3K59 A;  3KG2 A;  2EZP A;  1VAR A;  4FLX A;  4FLV A;  4YJ3 B;  2QKC A;  4HAM A;  1AP6 A;  3LSQ A;  1FD9 A;  2HEP A;  1YHQ V;  2WLM A;  4LF7 O;  3EFF K;  4LF7 B;  4LH6 A;  2Q67 A;  1K5Q A;  4YJ2 B;  1HR0 B;  2P90 A;  2FL4 A;  3W7U A;  1PNM A;  1EN5 A;  3CCV V;  2Y48 A;  3Q4H B;  5IE9 A;  3VQY A;  2WLI B;  2Q8V A;  4L8J A;  5C93 A;  5L3C A;  2WA3 A;  1MA1 A;  1BGY H;  2BCC H;  5JCO C;  4BW9 A;  3H1L H;  1BCC H;  3N27 A;  2GTA A;  2OTL V;  1V55 B;  2H94 A;  4PJ0 Z;  1Q7Y W;  4MTG A;  2UUC B;  4LFB B;  2ZIO A;  4BAY A;  1SQF A;  2GSM B;  2UXC B;  4KL1 A;  2JJ1 G;  2ZE6 A;  3A2F A;  3OT7 A;  5LMU O;  4IT5 A;  3GWK C;  1BHB A;  4WBN A;  1NH2 B;  3FB8 C;  4X1I A;  3K03 A;  3I55 V;  2HVJ C;  5CA0 A;  2UUB B;  4EKW A;  1P7B A;  1J5E O;  2HG5 C;  1AIL A;  3ZIA G;  5LMN O;  1U97 A;  4RUF A;  5FPO A;  3E22 B;  4C7U A;  3CCS V;  4DV0 B;  2CAZ C;  1CPY A;  2QM4 A;  2P22 C;  1PNK A;  2H3O A;  1OCZ B;  1Q8I A;  3UO2 A;  3CCR V;  5KUK A;  4H0L B;  2GDS A;  3K0G A;  1LUW A;  2IU3 A;  2UXB O;  2CE4 A;  1OCO C;  1VQ6 V;  3FKS G;  5L3E A;  4D7S A;  1MNG A;  2F93 B;  2WSS G;  2VQF O;  1Y76 B;  4TQD A;  1GKF A;  4UFZ A;  4FVM A;  2Q5Z A;  3IFX A;  2L6L A;  3TJT A;  4I4T B;  1BQ0 A;  3JAK A;  3F5T A;  4U3J A;  1WLE A;  2ZDI A;  3IJ4 A;  1MSD A;  2Q7H A;  4WFA V;  2KKW A;  5B3S B;  1AR1 B;  5C8Y B;  4IHJ A;  1N36 B;  1TA8 A;  4X1Y B;  2DJV A;  2ZE8 A;  1M4U A;  1VQP V;  2HJF C;  1JQ0 A;  1N33 B;  3O65 A;  3E8F A;  2EIK C;  5LHI A;  2D3O W;  3BPZ A;  3LUT B;  4DK1 A;  3B8N A;  1QQC A;  2DYS B;  1OCR B;  2P67 A;  4MVM A;  2Y0I A;  5EYP B;  4ZOL A;  4IHJ B;  3W7T A;  4LF8 B;  4J10 A;  1AJP A;  2QWO B;  5B1N A;  1PL0 A;  1JCH A;  1RM1 B;  1GAX A;  3EXA A;  4CZZ A;  3TK1 A;  2EIK B;  1COW G;  3BRC A;  3MDS A;  5LP6 A;  1M56 B;  2DE0 X;  3LDD A;  5IY5 C;  5GON B;  1MMM A;  3CXH F;  3S3X A;  4WFF A;  2GHY A;  4LF4 B;  3CC4 V;  1VF6 C;  2BTQ A;  3SDL A;  2IM9 A;  3TCU A;  2QDO A;  3M99 B;  1RP3 B;  4O4L B;  3JD0 A;  4QE7 A;  2UXC O;  4JAA A;  3LDC A;  4MVQ A;  4DYL A;  4DV4 O;  3RW0 A;  5KAI Z;  3SJA C;  1OCC B;  1IBK B;  2VQE B;  2IJJ A;  1VF6 A;  2QEX V;  4UV8 A;  4PV1 B;  2LP7 A;  4QPJ A;  2LQT A;  2R9R B;  1GN4 A;  2YXY A;  1KKD A;  5BR8 B;  1VF7 A;  2ITD C;  4LNU B;  1N8R W;  4DUZ B;  5B1A B;  5LL6 Y;  4DUZ O;  3CS5 A;  4TV8 A;  4RQE A;  2EZO A;  3BA8 A;  4J9Y B;  2UXB B;  3VBB A;  2P6J A;  1MSW D;  3CEI A;  4X64 O;  1QR9 A;  1GN2 A;  2JGD B;  1IBM O;  3IAY A;  3QG5 A;  3VOU A;  3ETG A;  5B3S C;  4JAV A;  1JA8 A;  2ILM A;  3AK1 A;  3SYP A;  2EIL C;  1O9G A;  3AK3 A;  1JFF A;  3ML0 A;  3JAR A;  1R3I C;  3JD2 A;  3E86 A;  4H37 A;  2ZR3 A;  3FAV A;  4X20 B;  4R8C A;  1M1K W;  4WFG A;  2A79 B;  2HFE C;  2ITC C;  3HKD A;  1A32 A;  3E8G A;  4G2K A;  5DED A;  2Q68 A;  2WWW A;  4NXM O;  1ZL8 A;  4NXM B;  2ETN A;  5BMV A;  4LFB O;  4DUY O;  4Q6G A;  4I9W A;  5LHG A;  1N33 O;  4B7K A;  3OR6 C;  4K8Z A;  4LFA O;  2NN4 A;  4LFA B;  2V7Q G;  3T4D A;  5BY1 A;  2P4V A;  3OGC C;  3RFR A;  2RMK B;  3IC7 A;  2DWD C;  2CH7 B;  3ZRW A;  3CCM V;  4JTC B;  2VWJ A;  3HKC A;  4F6E A;  2FB5 A;  2MW2 B;  3VQV A;  1DTO A;  1Q90 D;  1SQB H;  3ZMV A;  2PYJ A;  1SKV A;  4LC1 A;  4K35 A;  4DV6 O;  5D5P A;  3LSS A;  3UT5 A;  1N0J A;  4DV6 B;  3SJC C;  3AG1 B;  2CK3 G;  4NYK A;  4CH5 A;  1R1B A;  1V55 C;  1KP3 A;  1EBO A;  1F7Y A;  3E35 A;  1VQM V;  2KG7 A;  4ZI7 A;  2BOC C;  3N2G A;  3K57 A;  3K08 A;  3P32 A;  4X66 O;  2Q7G A;  3T1H O;  3H1H H;  2QSA A;  3ZRX A;  3RVZ A;  2WLI A;  4DV1 O;  1XMO O;  3WFV A;  4LF6 B;  5H2F Z;  4NTX A;  2VQE O;  2E5L B;  1F23 A;  2ODM A;  3AG2 B;  3B8M A;  1US6 A;  3OFN G;  4MT8 A;  1K9M W;  2CTR A;  3CC2 V;  3A0R A;  4BR6 A;  5B1B C;  4NXN O;  3APO A;  3APQ A;  3ZHS A;  2ZCE A;  3G80 A;  1XL6 A;  1WPX A;  4TUY B;  1NZ6 A;  4LR3 A;  1KU9 A;  3JAT B;  1SQQ H;  2CUG A;  4MTF A;  5A2Q N;  1Y4M A;  2HP8 A;  1ARO P;  3OMA B;  2XT9 A;  4NTW A;  4J7K A;  2JVD A;  4GX1 A;  1Q86 W;  4YJ3 A;  5H6Q A;  1S77 D;  3TXQ A;  4JI5 O;  4FFB A;  4JI5 B;  1JJ2 U;  3X2Q B;  3QO8 A;  1PP9 H;  2Q7E A;  2EIJ C;  2YXH A;  3H1J H;  2WAM A;  1XBL A;  4QGP A;  1K73 W;  1FFX A;  1CXZ B;  1M90 W;  1E1R G;  1NT2 B;  1NQT A;  2Q73 A;  1B6Q A;  3KKY A;  4LH7 A;  4F6R A;  3RT3 C;  4J7J A;  2ZXW C;  4W4L A;  1MAB G;  4QIW F;  3WG7 C;  3CX5 F;  2AXT Z;  2BOB C;  5ITZ A;  3JSN A;  4MW3 A;  1ENV A;  1HP8 A;  1GRJ A;  5EZY B;  3H1I H;  1R3L C;  5JJE B;  4FLY A;  4GKJ O;  4OPA A;  4DV4 B;  1XMQ O;  4DR5 B;  3D3Q A;  2AZ2 A;  3ZED A;  1V54 B;  1RSO B;  4J9Z B;  1JOY A;  3OTO B;  1YJ9 V;  3U0Z A;  1Y76 A;  5LMN B;  1VQ7 V;  1NTZ H;  1SA0 B;  3T4Z A;  2WLJ A;  4WFH A;  4DV0 O;  3JAL A;  1QVF U;  2B5U A;  3HR0 A;  3AG7 A;  1S76 D;  4D6T H;  1CEZ A;  2YIA A;  1R3K C;  5A9G A;  4TSF G;  1PV0 A;  1T5E A;  5LBQ A;  3BAB A;  3AEI A;  3CCJ V;  1AI6 A;  1FFT B;  1PNL A;  3DXR A;  5LGN A;  1IBM B;  3JAK B;  1N34 B;  1D2D A;  2YIB A;  3ETD A;  4X89 A;  1SS3 A;  1GTO A;  3QVN A;  3J7A U;  5EBW C;  3ETE A;  3PN1 A;  1XMO B;  3ZS8 C; 
#chains in the Genus database with same CATH homology
 4MTO A;  3G6E V;  4RUE A;  1QR8 A;  3BEH A;  4WFA V;  4Q20 A;  5B3S B;  3H01 A;  2MK3 A;  1AR1 B;  3UM7 A;  2ZR2 A;  4HYO A;  5HFM A;  3W7S A;  1FS0 G;  3JD3 A;  1S72 V;  2IJK A;  1K97 A;  1VQP V;  3I56 V;  5CMU A;  2HJF C;  1JQ0 A;  1CP9 A;  3W7W A;  1W0K G;  2DQ0 A;  3FB6 C;  1QLE C;  4JAU A;  2QA4 V;  2Z5U A;  3FYI B;  1P4R A;  2WLL B;  2YSU B;  1F4N A;  2EIN C;  3HB3 B;  3E8F A;  4WFB V;  1KP2 A;  2XOK G;  2EIK C;  4LP8 A;  5L3G A;  5LHI A;  4MVZ A;  4JYB A;  3ZRV A;  2ZQM A;  2D3O W;  2NLJ C;  3LUT B;  3ZCC A;  3E2E A;  3B8N A;  2DYS B;  1K4C C;  1OCR B;  2EIL B;  2P67 A;  3F7Y C;  3T1C A;  1E1Q G;  3MHH C;  5B1O A;  4MVM A;  3OW2 U;  1KD1 W;  1K33 A;  1V54 C;  3ABU A;  3LNM B;  1RM1 C;  5CA3 A;  2X6B A;  5EBL C;  4LCU C;  3W7T A;  2JJ2 G;  3FB5 C;  4WCE V;  4PDV A;  2XAQ A;  1AJP A;  5B1N A;  3QO5 A;  4ZBM A;  1IXM A;  1PL0 A;  3ABK C;  1VQL V;  1NJI W;  1JCH A;  3OM3 B;  1VQ5 V;  1S0V A;  2EIM C;  1RM1 B;  3ABM C;  4CZZ A;  1H2G A;  3FYE B;  1NR7 A;  3TK1 A;  5LGT A;  2W0F C;  1K4D C;  2EIK B;  1K8A W;  2F43 G;  1OCZ C;  1COW G;  1R3J C;  2YEV A;  3UKM A;  1W0J G;  1M56 B;  5LGU A;  3D3I A;  3LDD A;  5KA6 A;  5IY5 C;  3CCE V;  2LFS A;  1QLE B;  4WFF A;  3SYO A;  2GHY A;  2QE7 G;  3CC4 V;  1VQN V;  1JPX A;  1K7D A;  3ABM B;  1R6N A;  3CYO A;  3CCL V;  3WG7 B;  1LNQ A;  3TCU A;  1H8H G;  1R73 A;  4YXW G;  3ABT A;  3IGA C;  1Q82 W;  1GO3 F;  3M99 B;  4XDJ A;  4UV9 A;  1QCE A;  5IY5 B;  3OMI B;  5IDJ A;  1BMF G;  3JD0 A;  4QE7 A;  1VQ8 V;  5CN0 A;  1THZ A;  3LDC A;  1GMG A;  2X0L A;  2W6I G;  2Y69 B;  4MVQ A;  3D36 A;  4LBE C;  3RW0 A;  4QJF B;  3ZMZ A;  3OUS A;  4TT3 G;  1OCC B;  2A9H A;  4PDM A;  2IJJ A;  2JDI G;  5H9C A;  2NNU A;  4FJC C;  3F7V C;  2JIZ G;  1ORQ C;  4XDL A;  4BW5 A;  2EIJ B;  2QEX V;  2UXX A;  4UV8 A;  3CD6 V;  4PA9 A;  2Q6A A;  2LP7 A;  2M7W A;  4QPJ A;  2R9R B;  4RAI A;  5IYC O;  2EIN B;  1BL8 A;  2W6J G;  4PDL A;  3JYC A;  1KKD A;  4MS2 A;  1EFR G;  4PA7 A;  3GWO A;  5CBF A;  3OAA G;  3CMA V;  3ZMT A;  2ITD C;  4FIP C;  1N8R W;  4N21 A;  2DW4 A;  5B1A B;  1H38 A;  5EK0 A;  3SJQ C;  4RQE A;  4P9P A;  2H8P C;  4PDR A;  2OT5 A;  2WLL A;  5J9P C;  2EZO A;  3AG3 B;  3SYQ A;  4J9Y B;  4U7N A;  4X8A A;  2P6J A;  2EIM B;  3VBB A;  4CBC A;  3G71 V;  5CBH A;  1MSW D;  1S3J A;  5GW7 A;  2XND G;  1FXH A;  1QR9 A;  2XAG A;  1YTF B;  1BHA A;  1KEC A;  1YIJ V;  3STL C;  4RO2 A;  1VQK V;  1NVP D;  1YIT V;  3RBZ A;  3JD4 A;  3K9A A;  2XAH A;  3VOU A;  1Y66 A;  3ETG A;  4JAS A;  3ZRW B;  5IYB O;  3G4S V;  5B3S C;  1DF5 A;  4JAV A;  3AG2 C;  1NBM G;  1YI2 V;  4GX5 A;  4DO2 A;  4N23 A;  3SYP A;  3E83 A;  2DYS C;  2EIL C;  3CXC U;  3ABL B;  1FXK B;  3ML0 A;  1M9N A;  1R3I C;  4ASU G;  1H8E G;  3JD2 A;  3E86 A;  1OZ0 A;  2QTO A;  4H37 A;  4R50 A;  2KB1 A;  2ZR3 A;  1XL4 A;  1SER A;  1AJQ A;  4QNH B;  4JF3 A;  1YJN V;  4R8C A;  4GCZ A;  5L3F A;  1GK9 A;  1M1K W;  2PI4 A;  1GM9 A;  4WFG A;  1VQ4 V;  3EHB B;  2A79 B;  2HFE C;  3CPW U;  2ITC C;  3AG4 B;  3QO7 A;  3E8G A;  1AI4 A;  4G2K A;  2Q68 A;  2WWW A;  5B1B B;  1Q81 W;  2OCC C;  5EC1 C;  3E89 A;  2V1D A;  3K79 A;  3R65 A;  2LFR A;  1GM7 A;  5IYD O;  4G28 B;  1W2B U;  4I9W A;  3K04 A;  5LHG A;  3OR6 C;  2IJH A;  4UVA A;  2PI5 A;  1MOF A;  2V7Q G;  3T4D A;  2IH1 C;  3NXS A;  1K3E A;  1NVP B;  1K92 A;  5FL7 G;  3OGC C;  1OCC C;  1YJW V;  1KC8 W;  4XDK A;  3IC7 A;  2DWD C;  4GX2 A;  5L3B A;  3SPI A;  3ZRW A;  4JYC A;  3OEE G;  1FXV A;  2JK5 C;  1PD3 A;  1JX9 A;  2AHY A;  2QM7 A;  2WLK A;  4JTC B;  2IH3 C;  3CCM V;  2EJR A;  3JD1 A;  4UUJ C;  3P30 A;  4PA3 A;  2DQ3 A;  1UJW B;  3X2Q C;  4MVR A;  1KQS U;  5EBM C;  3LDE A;  3CC7 V;  3SPG A;  1DTO A;  3SYC A;  1QBZ A;  3ZMV A;  1OCO B;  4QE9 A;  3SPH A;  1OCR C;  1RPR A;  3TET A;  1I5X A;  4LC1 A;  2A0L A;  5KUM A;  3LSS A;  4KFM A;  3AG1 B;  1M56 C;  2CK3 G;  2WLH A;  2ZD9 A;  4GT1 A;  4U7O A;  5HFL A;  1KP3 A;  1V55 C;  1S5H C;  1QVG U;  1EBO A;  1JVM A;  1F51 A;  2ZXW B;  4BIU A;  3E35 A;  4R7C A;  1VQM V;  1OHH G;  1YTF D;  1EZJ A;  2B1I A;  2R9I A;  2IU0 A;  2BOC C;  4DXW A;  2X6C A;  3K08 A;  2HKO A;  3P32 A;  3W7X A;  3K3W A;  5LHH A;  4JGS A;  3ZRX A;  3SPJ A;  3RVZ A;  1G8M A;  4F4L A;  2WLN A;  2ZDI C;  3ZRS A;  2DYR C;  4GX0 A;  2WLI A;  1MG1 A;  4QPK A;  3B77 A;  4UVB A;  3MHS C;  2UXN A;  3ABL C;  3MD0 A;  4MVO A;  4HZ3 A;  3WFV A;  2X7R B;  1G4Y B;  1F23 A;  3AG2 B;  1SRY A;  4ZKI A;  3B8M A;  5DM6 V;  1NKD A;  3ZN0 A;  2P7T C;  1QLN A;  1NH2 D;  3K0D A;  3OFN G;  4MT8 A;  1PKX A;  1ROP A;  1K9M W;  1I5Y A;  4RQF A;  2JEX A;  4FMT A;  2EBO A;  2DYR B;  4TWK A;  3CC2 V;  4PA6 A;  2OCC B;  3A0R A;  5L3D A;  5B1B C;  3T2M A;  4KP4 A;  1E79 G;  3CP1 A;  3AG3 C;  2XAS A;  1ZWI C;  1XL6 A;  1WPX A;  1F4M A;  1K5S A;  2X6A A;  3DGE A;  3AG4 C;  4KUM A;  3CME V;  3E8H A;  1SES A;  4MTF A;  3E8B A;  2B1G A;  1Y4M A;  3AG1 C;  3CCU V;  2QM8 A;  3GB7 C;  3SYA A;  1ARO P;  3OMA B;  1VQ9 V;  2JEU A;  2DWE C;  5E1A C;  3KG2 A;  4FPP A;  3FB7 C;  3OUF A;  4GX1 A;  2EZP A;  5EC2 C;  3RVY A;  5DN6 G;  1Q86 W;  5CBG A;  3ASN B;  3K06 A;  5H6Q A;  2QKS A;  1S77 D;  2HR3 A;  2Y69 C;  3QNE A;  4HAM A;  3HPL C;  1JJ2 U;  3LSQ A;  4UXN A;  2OTJ V;  3X2Q B;  4H33 A;  4JTD B;  1AI7 A;  3QO8 A;  2WLM A;  1YHQ V;  3OMN B;  5KA5 A;  3EFF K;  1VQO V;  2EIJ C;  2HLD G;  3OEH G;  1SZT A;  2Q67 A;  2WAM A;  4X88 A;  1K5Q A;  4JTA B;  1K73 W;  3BY6 A;  2P90 A;  2XAF A;  1M90 W;  1E1R G;  4MTX A;  1NQT A;  4L87 A;  1B6Q A;  5B1A C;  3W7U A;  4XBF A;  1PNM A;  1R6K A;  4WF9 V;  3CCV V;  3STZ C;  2Y48 A;  4I5S A;  2ZXW C;  2WLI B;  5C93 A;  1MAB G;  5L3C A;  1NR1 A;  3F5W C;  2XAJ A;  4FK5 C;  4QIW F;  3WG7 C;  1M57 B;  3CCQ V;  2BOB C;  2OTL V;  1V55 B;  2H94 A;  1Q7Y W;  4MW3 A;  4MTG A;  5H6R A;  1ENV A;  1GM8 A;  4R6Z A;  4BAY A;  2GSM B;  1TUE B;  1R3L C;  2IW5 A;  2JJ1 G;  4JPR A;  4BIZ A;  2C2A A;  2K1E A;  4MW8 A;  2Q69 A;  1BHB A;  1NH2 B;  1AI5 A;  2ATK C;  3JCZ A;  3ZMU A;  3ABK B;  3FB8 C;  3K03 A;  2IJI A;  3DTU B;  3I55 V;  1DF4 A;  1FXK C;  1YSC A;  4MVS A;  2HVJ C;  4MSW C;  1V54 B;  4MVU A;  4J9Z B;  1JOY A;  4EKW A;  1YJ9 V;  1RPO A;  1P7B A;  1L1F A;  2HG5 C;  3ZIA G;  4E2L A;  1VQ7 V;  2AHZ A;  4RUF A;  2Z3Y A;  3T4Z A;  4P2Z A;  2WLJ A;  4WFH A;  3OE7 G;  1QVF U;  1DLB A;  4Z1M G;  3ASO B;  3CCS V;  1M57 C;  2B5U A;  1CPY A;  4P9O A;  1S76 D;  3ZMS A;  1CEZ A;  1PNK A;  1OCZ B;  3ZN1 A;  1R3K C;  3CCR V;  4WFE A;  1AJN A;  5KUK A;  2HVK C;  4TSF G;  3K0G A;  2IU3 A;  5LBQ A;  1HWY A;  3AEI A;  3CCJ V;  1AI6 A;  3SPC A;  1FFT B;  1OCO C;  5BZB A;  3FKS G;  3OR7 C;  5L3E A;  1VQ6 V;  1PNL A;  1SET A;  2WSS G;  3ASO C;  1GKF A;  1J95 A;  4PA4 A;  3IFX A;  4P30 A;  4PEL A;  5LGN A;  3PJS K;  1K34 A;  1FXK A;  2WPD G;  4OXS A;  4UVC A;  4G27 B;  3ETD A;  4X89 A;  1GTO A;  2YEV B;  5EBW C;  3ETE A;  1WLE A;  3ASN C;  2FTK A;  3ZJZ A;  2ZDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...