3ZRWA

The structure of the dimeric hamp-dhp fusion a291v mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
b'STITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AF1503 PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 41
structure length 111
sequence length 111
chains with identical sequence C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrwA00
2WWWA 4JYCA 2LFRA 3MD0A 4MTXA 4GCZA 1F51A 5IDJA 3ZRWA 2QM8A 4MT8A 4FPPA 3A0RA 5B1OA 2QM7A 1JOYA 3ZRVA 5B1NA 4QPKA 4JAVA 4QPJA 4BIUA 4ZKIA 2FTKA 4Q20A 4JASA 4JYBA 3D36A 4BIZA 3P32A 4I5SA 2C2AA 3ZRXA 2P67A 4KP4A 5C93A 3NXSA 3ZRWB 3DGEA 4GT1A 3ZCCA 4U7NA 4JAUA 4U7OA 3TK1A 4LC1A 2LFSA 4FMTA 1IXMA
chains in the Genus database with same CATH superfamily
4DW0A 3G71V 2X6AA 3SYAA 2WWWA 2EIJC 1AR5A 4CBCA 3OTOO 1B6QA 2XAQA 4UFZA 3WU2Z 1S76D 1MZFA 1R3IC 2DOSA 1UJWB 1XNRB 3K5MA 2WA3A 3FB7C 5CBFA 2UUAO 1WPBA 5BY1A 3E22A 2DMXA 2DYSC 4PI0A 2W0XA 4DV4O 3IAYA 3K0GA 5JVDB 1L0NH 1DTOA 1WB7A 4QJFB 1SC5B 3CCJV 3K79A 3BPZA 5C8YA 4DR3O 2OCCC 5JCOA 3CCRV 3OR7C 4OPAA 1ORQC 3WFVA 4C7UA 3W7WA 1PL0A 2EBOA 5LL6Y 4HNAA 1NVPD 1RPOA 1JFFB 1N0NA 2LW7A 4HBNA 1H8HG 1WP8A 1H2KA 2QM7A 3K08A 2IBZH 1S5JA 1HDJA 2F43G 5E1AC 2UXNA 1R3LC 4R7CA 4B3SO 1I08A 2JGUA 5KHIA 1VQ7V 3KCYA 2QWOB 4PD4F 4U3FH 5KHKA 4GX1A 3CRMA 2HJDA 4P9PA 2DQ3A 1VF6A 2F4VO 4K0KB 2FMLA 5J2TB 4LF5O 2IU3A 2MK3A 4JI3B 3QO8A 3T4DA 1GN3A 1XL6A 1IBKO 4BAYA 3OGIB 4KP4A 2W6IG 2OCHA 5JQGA 1I94O 1YITV 3UKMA 4DUYB 2ZNJA 1ZX3A 4JZ2A 2WPDG 1HP8A 2BOBC 1PNLA 4JI7B 2BSKB 5ITZB 4LR3A 5IYZB 2ZE8A 3K3WA 4LF7B 4YXWG 1AI6A 2Y4TA 3DC5A 3OAAG 3X2QC 1FXKB 1L8DA 4DV5B 1VQ5V 4OX9O 2P4VA 1PPJH 4Z1VA 1HNXO 3G6EV 1OCCB 3FAVA 3TXQA 3BFRA 3CMEV 2UXBB 3RFRA 2QTOA 3I56V 2GHYA 2CTQA 5GW7A 2ADPA 2ZIMA 1VIBA 3HKEB 1OHHG 2XOKG 2XAJA 2ZDIA 2Q7GA 1XREA 2AGAA 3P30A 5J2UA 1KKDA 4WCEV 4NB5A 2Q4PA 4JI8B 2WLIB 4B3MO 1NR1A 3CCQV 4FFBA 2YIDA 1VQ4V 3GWOA 4H44B 2ZE7A 5H5NA 1D5AA 4I0XA 4FK5C 3DXRB 3ETDA 4DR2B 2QWPB 3CCLV 3JAWA 4NTYA 3RYHA 2VRZA 4GKJB 1BQZA 3ZIAG 4FM1A 1QLNA 5AG2A 3BRCA 2CGNA 4JI2O 4JI0B 3FB6C 3BVOA 3K04A 2OTLV 1JVMA 3ZRWA 3E22B 3I5DA 4FZ0A 4RQEA 2X0LA 2A06H 3IC7A 1XMOB 1M93A 3H1KH 4MW8A 4GZRB 3LNMB 4O4IA 2LGWA 3TJTA 4JI6O 5C8YB 3ZRSA 2Z5UA 5LYJA 2RN9A 2DN9A 3DTUB 2WLMA 1FXHA 3H9VA 5IT9N 2HHHB 2KSDA 4MSWC 3GWKC 1V55C 5FNVB 1SESA 5LP6C 4PA3A 3T1HB 4KL1A 4HNAB 3CCSV 4GLXA 2K9PA 3F5WC 3AK1A 4P2ZA 2Z0AA 4WBNA 3CC4V 3ZCCA 2WLNA 3K9SA 3L73H 2WAMA 1RM1C 5BMVA 3JD4A 4K35A 2HR3A 1GTOA 3IC9A 3K5OA 3RYCA 3EFFK 5EYPA 2XHBA 2YSUB 1EN4A 2IJIA 3CS5A 2HFEC 2ZXWC 3CP1A 3T4ZA 2E76B 5B3SB 1K4DC 3CYOA 4B3RO 4ZHQA 1JR9A 4X88A 1QHTA 3ZN0A 3JCZA 1R3KC 2JDIG 1CP9A 4J42A 4YY3B 2E74B 4DR1B 3HKDA 2ZINA 5JQGB 4QPKA 3LDEA 3C90A 3I55V 1I0HA 2PTMA 3JARA 1YHQV 2RDCA 4O4JA 2QEXV 2EIMC 4FFKA 4IHJA 4LF8B 1GKFA 5K1PA 5KX5A 2ETNA 3HB3B 3QO7A 4O2AA 3JAKA 2CAZC 5LHHA 5IY5C 1EZVH 2Q68A 1HR0B 1BMFG 2E75B 3FAVB 1KBHA 3D3IA 3OD4A 5L3EA 3BA9A 4N23A 1BSMA 4ICGA 1LNQA 4DO2A 1FYJA 5EK0A 3M7MX 1NH2D 4MVRA 3QO5A 1IBMB 1OCZB 4H13B 5J2UB 4UCVA 1Q5OA 1YZBA 3CCUV 2AW9A 1R6KA 2ZD9A 4KUMA 1TAEA 1XMQB 3SPCA 4LCUC 3AG1B 4FFBB 3E35A 4R6ZA 4TQDA 4D7TA 2EIKC 4X62O 1WPXA 2E3CA 4I0XB 3UO2A 2JVDA 4J9ZB 4J7KA 5LMUB 3JAWB 1XNQB 3RYHB 3SJBC 2EINC 4Q6GA 3ASNB 2PUSA 2CH7A 1V54C 2EULA 3OR6C 1M1KW 3FB5C 1QVFU 3ZRWB 3VQXA 2EILC 5CA1A 4DV2B 1IBLB 3D8CA 2W0FC 4O4IB 1GH6A 1ZAUA 1QLEB 4LNUA 4DR4O 5LYJB 3W7TA 4I5SA 1GM8A 2RMKB 1AR1B 1AI4A 2OWOA 4U3JA 3UQ8A 4QE9A 4DV0B 5IJ9A 3K5NA 4GKKB 1YJNV 1AVMA 4AQYB 4DV7B 1M57B 4NXMB 1SRYA 1URFA 4EFEA 3RYCB 3B2EE 5EYPB 5L3DA 5LP6A 4QPJA 4LFAO 2ZM6B 2DYRC 3RYIA 3ABTA 4DUZB 1K33A 3AG7A 4PA7A 3B8NA 2FKXA 4ZHQB 3SJQC 5EIBC 1SQPH 1E1RG 1Z2GA 2QDOA 4FLYA 1BT8A 1ENVA 2LQTA 4RUEA 2ZQMA 4LF9O 3ABUA 1AROP 3F7VC 1QU7A 3SYOA 1DF4A 2JS3A 3HKDB 2N74A 5BR8O 1VF7A 4DXWA 4FIPC 2K1EA 1HW7A 2BTQA 5J9PC 4LFBO 1L1FA 1L0LH 3JARB 4O4JB 4RWUA 4IHJB 2F1MA 3W7XA 4TUYA 2RCVA 5KX5B 2LJ2A 5LMNB 4UCSA 1YTFD 4BW5A 2ILMA 1H8EG 4UB8Z 1Q7YW 3FFQA 4O2AB 1COWG 2UXCO 3L72H 3JALB 5KHHA 1Y76A 3JAKB 1SQFA 2DW4A 4DR6B 3E89A 2EJRA 1EN5A 4GYCB 2YEVA 3CJHA 4YHHB 1BL8A 1SS3A 5IWAO 5DN6G 4DV3O 2QTSA 3SYPA 2R70A 2C2AA 1ZTEA 5ITZA 2HVJC 4IYIA 3OFNG 2AZ2A 4JI5O 2G38A 3X2QB 2NN4A 1JQ0A 1VQLV 3RT3C 5A9GA 3S3XA 3AK2A 4ASUG 2R72A 3ZMTA 2RJZA 3ASOC 5LA6A 1GK9A 2E5LO 4LF4B 2Q7EA 4JI1O 2V1DA 4A5UB 1GAXA 3B8MA 3ZBHA 4JAUA 5CBGA 1BHAA 1SZXA 3K06A 4JPRA 2CH7B 5IDJA 1R73A 2QWRB 4RAIA 1E1QG 2P06A 5CA1B 3JAMN 1HNZO 2ZCEA 2ODMA 3UT5A 5F2VO 5FL7G 4DV6B 2A0LA 1EFRG 2QWNB 1N36B 2Q67A 4LNUB 1FJGB 1NH2B 3AEIA 3RBZA 1PD3A 1NI8A 4IL6Z 5B1OA 4E2LA 1S3JA 3FYEB 5B5EZ 2JGDA 4W4KA 4ABMA 1VQOV 4GKKO 3STZC 1V9PA 2Q8VA 3FD9A 4X64B 4U3JB 3ZRXA 4LFCO 3A8TA 4DK0A 5IJ9B 2Q7HA 2BCCH 1OCOC 4OGQB 1GN6A 3QF7A 2Q73A 2DWEC 2OIEA 4DR7O 2Y4UA 1VQ9V 3G6BA 4DK1A 1V55B 4DR5B 1AILA 3T1CA 5LP6B 3PN1A 4K8ZA 4XDJA 3RYIB 3P32A 3AG2C 4J41A 4F6EA 1JA8A 5FNVA 3ZEDA 5LGTA 4NXNB 1EM1A 5EBLC 1KC8W 1K92A 2XASA 2PYJA 5HFMA 4FLTA 1FKAO 1T5EA 2YXYA 3LSQA 1KKCA 5KUKA 2V7QG 4B3TO 2BTQB 4I50A 3D3QA 3L71H 4PA4A 1YIJV 1FS0G 4D7SA 1NT2B 1ZUQA 1Q43A 4MTFA 2FYUH 4KHPO 3WG7B 4FLWA 4TUYB 3C3TA 3W7UA 1NTZH 4OPHA 4E4EA 1TGOA 3QG5A 2N05A 4DR6O 2VQFO 2KKWA 4PV1B 1ZLZA 3K0DA 2UUBO 1QR8A 4FM2A 1Y76B 5CMUA 1MABG 4WFBV 3L74H 2ZE5A 1H2LA 4BWAA 3RVZA 3ZHRA 2YEVB 3CJHB 5B1BB 2H3OA 3ZN1A 1PL4A 4MTGA 5KAIZ 4X65B 2IJJA 1U96A 2P7TC 1EBOA 4TV9A 3K5LA 1NU1H 1KU9A 1Z5VA 5CBHA 3CXHF 4JAVA 1K5SA 4H37A 4TOIA 5L3GA 2ZR2A 1YJWV 5IY5B 4JYAB 4IGGA 4H33A 2JEUA 1XDCA 1ROPA 1NTMH 3NXSA 1BE3H 1HNWO 3R66A 2NNUA 2QE7G 5LA6B 1K4CC 3T2MA 1J5EB 3CRCA 4JI4B 1F51A 3ZHSA 5LGUA 1YTFB 1YEWA 2QM4A 1SQQH 3J80N 2NLJC 1M56B 2DQ0A 1AJQA 1K73W 1F4NA 2P22C 1IZ3A 2A3QA 4MVZA 4PA6A 1O9GA 5IE9A 4MVSA 3UT5B 4XBFA 2AHYA 1N33B 2UXDB 3CRAA 1WA8A 5KHGA 1XNRO 2F66C 4XDKA 1R6NA 3SGIA 1N34B 1M9NA 2PGGA 4HZ3A 4JYYA 5IJ0A 4RO2A 2JGDB 2EILB 4TV8A 4MVQA 3JD1A 4CS2A 2CDYA 4FJCC 3JASA 3E86A 5B1NA 1H2NA 1WNSA 2YIBD 2EJ7A 5KA6A 3ABMC 3SR2C 4GX5A 1KP3A 1O9HA 3FB8C 4LBEC 3ZHUA 4FLZA 4I9QA 3F5TA 1SQXH 3T1YB 4DV1B 4B7EA 3PJSK 4WFHA 1N0JA 4X66B 2B1IA 2ZNIA 1QNMA 3B09A 4PDLA 2ADQB 4PI2A 4PJ0Z 3CE2A 1LR1A 3RWRD 1W0JG 1WP7A 4X8AA 3TETA 1N32B 2Q0OC 3BABA 2Y48A 4I50B 4JYCA 2DYRB 3EXAA 4K0KO 1NKDA 4X1IB 4JV5B 3AG4C 4JI3O 5JJJB 4P9OA 5L3BA 3F7YC 1LUVA 2YIBA 1THZA 4DRXA 1FAFA 1LUWA 3ZMZA 1Q90D 4IYHA 4J7ZA 3K57A 4DUYO 3SPGA 2CE4A 1Y4MA 5L3FA 1JCHA 4JI7O 1MG1A 2Q6AA 3JD0A 3LSSA 1NZ6A 4I55A 3SPIA 2D3OW 4LF7O 3SPJA 2GTAA 3GVMA 3KKYA 3LSUA 3VOUA 4FLUA 4TV9B 4YIPA 3THOA 4DV5O 3CEIA 4N21A 4XDLA 2IM9A 2UXBO 3JALA 2YC0A 2YDEA 4EEQA 2UU9B 3FKSG 3K9AA 2IH1C 4X1YA 1MMMA 3KZIZ 2Y0IA 1US6A 1P84F 4MTXA 1Q8IA 4JI8O 1GM9A 1QQCA 4O2BA 4JF3A 1UFIA 2BOCC 4EKWA 1JMKC 3OUFA 4HAMA 4JASA 1SQGA 2JK5C 2YXHA 3ZS8C 4DR2O 2ZR3A 1IXBA 1OCCC 1XL4A 3AG3C 4GKJO 2W6JG 4CH6A 2JIZG 3CRRA 5CB4A 2O57A 3IGAC 4X1KA 1WA8B 4JI0O 3B40A 3SDLA 1XBLA 2YI8A 3HKCA 5GTHZ 5IJ0B 1YVWA 1VEWA 4TV8B 1NQTA 5E79Z 1XMOO 1AI5A 1QCEA 1JJOA 3CCVV 4J7JA 4F4LA 3E8HA 2ZT9B 3JASB 1Q3EA 1AP5A 2PZSA 3LDCA 4CH3A 4EFBA 3JD2A 3MDSA 4GX0A 4QGPA 2CTWA 2HHHO 1KMIZ 2EIJB 2H8PC 1IDSA 2F95B 5DEDA 4G27B 1CXZB 4ZI7A 2OIGA 3T1HO 2CTRA 4J10A 1NBMG 4UCOA 4ZBMA 2DYSB 1F4MA 3K58A 3E8FA 1E79G 4LF6B 3H1JH 3UCSC 1JX9A 3OMAB 1SQVH 3K59A 4JAAA 1S5LZ 3LNNA 3E8BA 2UUCB 2OCCB 1VQ8V 1PNMA 2XAFA 3AG2B 3JSNA 1KUQA 1BS3A 1S77D 3UO3A 5JCOC 3U11A 1U97A 2MW2B 3IFXA 3OTOB 2JRIA 3CPWU 4PELA 2YI9A 4DRXB 4YY3O 4DR1O 4JTAB 1X59A 4WF9V 5JJNB 2Z3YA 3JCUZ 3B4SA 1XEQA 4OXSA 1PP9H 2UUAB 1M90W 5IYDO 2Y69C 4DV4B 5KMGA 4LF8O 1XUQA 1FFTB 4WFEA 3VQYA 1RPRA 4I55B 3NR7A 2WLLA 3A0RA 4DR3B 3HKBA 3L70H 3N2GA 1N8RW 1W2BU 4YJ2A 1HR0O 2XAHA 1KYOF 1Y74A 2KQXA 5DM6V 2ZKOA 3OEEG 5LBQA 4J80A 1BHBA 4FLXA 1BZKA 2F23A 2PYLA 4CH5A 1GMGA 4X1YB 1IBMO 2M6YA 4B3SB 1YXBA 1K97A 2FL4A 4UB6Z 2PI5A 4O4HB 1GRJA 5EZYB 1XMQO 4O2BB 4WFFA 5JH7A 3G67A 2P90A 2F4VB 1PKXA 3FX7A 3C3SA 5HFLA 4LF5B 2X6CA 4UCRA 5FPOA 1GN2A 1SZTA 4AILC 1IBKB 1S5HC 4UVAA 4CS3A 5LMUO 1XNQO 1MZEA 2GSMB 3WB2A 4BIZA 4WFAV 1GN4A 5CB4B 4X1KB 2A9HA 3Q4HA 1OV9A 1WB8A 5KUMA 4AI8A 3HKCB 1S72V 4DV2O 2DE0X 3AK3A 4CS4A 1IBLO 3WB1A 1WN7A 2JEXA 4J11A 2EZPA 1KECA 2NR5A 3ABLC 4WFGA 4AHCA 1TVKA 1AI7A 3OTFA 4OX9B 1HNXB 4X20A 1OCRC 4UV8A 4LC1A 2YICA 1XOUA 3LDDA 2A79B 4LWSA 4B08A 4ZI7B 3TXSA 2VS0A 4DV0O 3ASNC 5H6QA 3ETGA 1G4YB 3ZHQA 2GDSA 3DSQA 4MTOA 4JZGA 5EC2C 3ABMB 4AQYO 4DV7O 4NXMO 3EHBB 2VQEB 5EIBD 5D5QA 4UXNA 3APOA 4J9YB 3OT7A 4H0LB 1XQ8A 2YUAA 4LH6A 4B3MB 5KHJA 2CUGA 3TCUA 1TUEB 2ZM6O 4DUZO 1QLEC 4R8CA 4FLVA 4JTCB 1Q82W 1DK1A 5L3CA 1S0VA 3E8GA 5B66Z 1VQKV 1VF5B 1TUBA 3H01A 1P7BA 1YI2V 2DJVA 3CCMV 2XTAA 3P3PA 1QR9A 5TISZ 4JI2B 4YJ3A 1YSCA 2OT5A 2HJFC 3HR0A 4K8XA 1RM1B 1Q86W 3UM7A 2R9IA 3VBBA 3R65A 5KMGB 1M57C 3S3WA 2PF4E 4KFMA 2OYQA 4BIUA 3N2KA 1SQBH 5LMNO 3AG4B 1SETA 3IJ4A 2ZXWB 1P49A 1JJ2U 2XNDG 3LUTB 4JI6B 1SA0A 2B5UA 2WLLB 4X1IA 2A7WA 1K3EA 3HKBB 3N2GB 2AHZA 1YF2A 2QR4A 3M8AA 1GO3F 3H1HH 1G8MA 3ICXA 5FLXN 4YJ2B 4FPPA 2IW5A 1AJPA 1Y74B 4UCTA 4YHHO 1DLBA 4MVUA 2EIMB 3TK1A 3U10A 4NR1A 5D5PA 1K8AW 2LFRA 2CTPA 5CA0A 3HPLC 3J7AU 3CC2V 2GUZA 1VQNV 4B3RB 5B1AC 5JH7B 4LF4O 1MA1A 1WLEA 1GM7A 2XAGA 2QM8A 2IH3C 3ETEA 2ZIOA 4L8JA 1G6UA 2OTJV 2M7WA 2Q5ZA 5H6RA 3Q4HB 1RFYA 4I9WA 2RQ6A 2IJKA 2L6LA 3N27A 4CC5A 2P5OA 1VQPV 4KXRA 2ZE6A 3BHPA 4DV6O 3ZMSA 5LHIA 1N36O 2ARHA 3AG3B 1FJGO 3W7SA 1AR4A 2EIKB 3P3NA 2XUMA 1B04A 3BA8A 3RN4A 1TVKB 1VP7A 3ZRVA 4X20B 1CPYA 1FFXA 3ML0A 2Y0PA 4LWSB 2EINB 5LOVA 1V54B 3VQVA 4X64O 2QKAA 2VQEO 4F6RA 1WJZA 4BR6A 5CA3A 3D36C 1BCCH 1AB3A 4RUFA 2CK3G 2FB5A 1J95A 1VQ6V 1FD9A 4MVMA 4NTWA 1X4TA 3ETQA 1YCIA 3BCCH 3ABKC 1VARA 4W4LA 4DR5O 2JJ1G 2GBOA 3ZJZA 3BEHA 2KG7A 1RSOA 4GT1A 4X62B 2Q0AA 4NXNO 1F23A 4MW3A 3JYCA 4FZ1A 5DECA 2KB1A 1TUBB 1YDXA 2GTSA 1I5YA 3J81N 1QVGU 4NVPA 4YJ3B 4EB6A 3ZHVA 1VQMV 1XHXA 2P6JA 3MHSC 4LP8A 1I7FA 3E2EA 2H94A 3N2KB 3MD0A 3OW2U 4GCZA 2GV9A 4MT8A 4DR4B 3RW0A 1NTKH 1SA0B 2L35A 1P7GA 2LGQA 5IYCO 3ZX6A 1IX9A 2B9ZA 1XILA 3SYQA 5EC1C 2VWKA 4P30A 1P4RA 1KP2A 2Y69B 4PHZA 2ITCC 2P4KA 1KQSU 5A2QN 1PV0A 2QJ1A 2V4DA 5BZBA 3QNEA 1BGYH 1SKVA 4X65O 1YJ9V 1B3QA 2JJ2G 3SPHA 2QSAA 4Q20A 3O65A 4JYBA 1EN6A 4L87A 4PDRA 3RYFA 3STLC 3OMIB 2LW1A 3CXCU 3BAAA 3WG7C 2BTOA 5CA0B 5C93A 4D6TH 3GB7C 4JYAO 1PNKA 4LFAB 2ATKC 2GUZB 3JSLA 1ZL8A 4TT3G 1PM9A 3H1IH 1J5EO 1JOYA 4JI4O 1IURA 4I4TA 5LXTA 4ZKIA 4G2KA 4LF9B 4ZOLA 4YIOA 3JATA 4NKGB 5BR8B 5B1BC 5IYBO 1NVPB 2R9AA 3CC7V 4LFBB 1MNGA 2LFSA 3OUSA 1D5NA 4O4HA 2IU0A 1ZSPA 2LO1A 3ZMUA 5EZYA 3OGCC 4QIWF 5FPRA 2EZOA 1K34A 4NTXA 1N33O 3B77A 1NS1A 3CX5F 3ASOB 4B7KA 4K3AA 1F7YA 4HYOA 1QBZA 1OJHA 2UXDO 1FXKC 2UXCB 3M99B 2RNBA 1N34O 4DYLA 3E83A 1FFXB 4LH7A 3G80A 4ZIBA 2R9RB 2QWQB 4I7ZB 4O4LA 3A0HZ 1NR7A 5IWAB 4DV3B 5LOVB 3CMAV 1M56C 1JPXA 4F6RB 4DW1A 2XT9A 4CH4A 3RVYA 4TSFG 2YXLA 4CZZA 4JI5B 1Q6HA 3ABLB 2WLKA 1BQ0A 5GONA 1K9MW 1OCRB 3A2FA 4FMTA 3CSXA 4UVCA 3JD3A 3APQA 4BIOA 1KD1W 1K5QA 3T1YO 4DV1O 2LP7A 5H9CA 2E5LB 4X66O 2KG7B 1RSOB 4MS2A 4JI1B 5KA5A 2YS8A 2X6BA 3D36A 1Y67A 1FPOA 2DWDC 2JS5A 2Q69A 1EZJA 3SJCC 3OM3B 4X89A 1ZWIC 4JTDB 2HEPA 2D2CB 1N32O 2AXTZ 4IIJA 1OCOB 4EB6B 3G4SV 1AJNA 3CB2A 1AP6A 3ZMVA 4IT5A 1HNZB 1UPGA 1W0KG 4JV5O 3VQWA 5K1XA 5KAFZ 2P67A 2Q9LA 1OZ0A 2B1GA 3CCEV 4QNHB 2YIAA 4GUNA 5CN0A 3TGUH 1IXMA 4G28B 4MVOA 2HVKC 1XHZA 3CRQA 4WBNB 3H1LH 3SJAC 5BMVB 5JVDA 2BE3A 4LFCB 4TQFA 1R1BA 1W59A 2QKSA 2PY5A 3QVNA 5LHGA 4U7OA 3K03A 4DR7B 3DC6A 4BW9A 1Y66A 2QKCA 1H2MA 2WSSG 3RYFB 1HWYA 4NYKA 1DF5A 1JFFA 5B3SC 3CHXA 5BXZA 1VF6C 1ZL8B 2UU9O 1B06A 5EBWC 2HLDG 3EVKA 1RP3B 1Q6IA 4PA9A 4I4TB 5JWPA 2WLHA 5LXTB 1MOFA 4FM0A 1M4UA 3CD6V 3KCXA 4ZOLB 3JATB 5JJEB 3L75H 5KLVH 3BY6A 4B3TB 2HP8A 3A0BZ 2FTKA 1Q81W 1NJIW 1N4CA 3L9DA 5B1AB 1H2SB 1XI1A 5J2TA 4KHPB 4UCUA 4TWKA 4CC6A 1H38A 2VQFB 1SERA 1MSDA 2EX3A 4Z2WA 1A32A 2PI4A 4X9QA 1SF9A 2WLJA 2UUBB 1H2GA 4QE7A 3OE7G 1DGSA 2QGNA 2X7RB 1FXVA 2BSKA 2UXXA 4O4LB 1CEZA 1WAZA 1I94B 4PDMA 5IYZA 5GTIZ 4U7NA 4PDVA 4UUJC 2IJHA 1K7DA 1M5IA 1OCZC 2F93B 3QTCA 4UVBA 1FXKA 2ITDC 1Y6XA 2ZDIC 3OEHG 1R6TA 4FVMA 4UV9A 1TA8A 3KG2A 3MAQA 4RQFA 2QA4V 4R50A 2CGOA 5H2FZ 5GONB 3FYIB 1MSWD 1VMGA 2N04A 1R3JC 1HNWB 2HKOA 3AG1C 3OMNB 1KB9F 4GX2A 3U0ZA 1Z5WA 3ZHTA 3CWBH 3HKEA 3RGBA 4LF6O 3WB0A 1G1XB 2VWJA 3MHHC 3SYCA 2HG5C 5LGNA 2WA4A 2WLIA 3ABKB 4IIJB 2UUCO 4JGSA 3O9OA 4Z1MG 3DGEA 5EBMC 1I5XA 1D2DA 1Q6UA 2AZ0A 1IVSA 3DXRA
chains in the Genus database with same CATH topology
2DYRC 3ABTA 2X6AA 3AG3B 1K33A 2WWWA 4N21A 4PA7A 4XDLA 3SYAA 3G71V 3W7SA 2EIKB 3B8NA 2EIJC 4CBCA 1B6QA 2XAQA 3ZRVA 1S76D 1R3IC 1CPYA 3SJQC 1UJWB 1E1RG 3FKSG 1ENVA 3ML0A 3K9AA 2ZQMA 4RUEA 3ABUA 3FB7C 1AROP 2EINB 5CBFA 3F7VC 3SYOA 2IH1C 1DF4A 1V54B 2DYSC 4DXWA 4FIPC 2K1EA 5CA3A 5J9PC 1L1FA 3K0GA 4MTXA 1DTOA 4RUFA 2CK3G 1GM9A 1J95A 4QJFB 3CCJV 1VQ6V 4MVMA 3K79A 3W7XA 4JF3A 1YTFD 2BOCC 4EKWA 2OCCC 3ABKC 4BW5A 3OUFA 4HAMA 4JASA 2JJ1G 1H8EG 2JK5C 3CCRV 3OR7C 3ZJZA 3BEHA 1ORQC 3WFVA 1Q7YW 3W7WA 2ZR3A 1PL0A 4GT1A 1OCCC 1COWG 2EBOA 1XL4A 3AG3C 2W6JG 1NVPD 1RPOA 2DW4A 2JIZG 1F23A 4MW3A 3E89A 3IGAC 2EJRA 1H8HG 3JYCA 2KB1A 2YEVA 2QM7A 1I5YA 1BL8A 3K08A 5DN6G 1QVGU 3SYPA 1NQTA 2F43G 5E1AC 2UXNA 1R3LC 4R7CA 1VQMV 2C2AA 1AI5A 2P6JA 1QCEA 3MHSC 4LP8A 2HVJC 1VQ7V 3CCVV 3OFNG 4F4LA 3E8HA 3X2QB 3LDCA 3E2EA 1JQ0A 4GX1A 1VQLV 2H94A 4P9PA 2DQ3A 3MD0A 3JD2A 3OW2U 4GCZA 4GX0A 4MT8A 4ASUG 3ZMTA 3RW0A 2IU3A 2EIJB 2H8PC 2MK3A 3QO8A 3T4DA 3ASOC 1GK9A 4G27B 1XL6A 5IYCO 4BAYA 2V1DA 3SYQA 5EC1C 4P30A 3B8MA 1P4RA 2W6IG 4KP4A 1KP2A 1NBMG 2Y69B 1YITV 3UKMA 2ITCC 4JAUA 4ZBMA 1KQSU 2DYSB 5CBGA 1F4MA 2WPDG 3E8FA 1E79G 1BHAA 2BOBC 3K06A 1PNLA 4JPRA 1JX9A 3QNEA 3OMAB 5BZBA 5IDJA 1YJ9V 1R73A 4RAIA 1E1QG 3E8BA 2JJ2G 3SPHA 3K3WA 4Q20A 4JYBA 4L87A 2OCCB 4PDRA 4YXWG 1AI6A 3STLC 1PNMA 2XAFA 3OMIB 5FL7G 3CXCU 3WG7C 2A0LA 1VQ8V 3OAAG 3AG2B 5C93A 1EFRG 3GB7C 3X2QC 1FXKB 1PNKA 1VQ5V 1S77D 2ATKC 2Q67A 3G6EV 1OCCB 1NH2B 3AEIA 4TT3G 3RBZA 3IFXA 3CPWU 3CMEV 1PD3A 4PELA 2QTOA 3I56V 2GHYA 4JTAB 5B1OA 4E2LA 4WF9V 1JOYA 1S3JA 2Z3YA 3FYEB 1VQOV 4OXSA 4G2KA 4ZKIA 3STZC 1M90W 5GW7A 3ZRXA 5IYDO 5B1BC 5IYBO 2Y69C 1NVPB 1OHHG 2XOKG 2XAJA 2ZDIA 3CC7V 3P30A 1OCOC 1KKDA 4WCEV 1FFTB 2LFSA 4WFEA 1RPRA 2DWEC 2WLIB 3OUSA 1NR1A 2IU0A 3CCQV 2WLLA 3A0RA 1VQ4V 1VQ9V 3ZMUA 3GWOA 3OGCC 1V55B 4QIWF 1N8RW 2EZOA 3T1CA 1K34A 3B77A 4FK5C 3ASOB 3ETDA 4XDJA 1W2BU 3P32A 4HYOA 1QBZA 3AG2C 1FXKC 3CCLV 3M99B 2XAHA 5LGTA 5DM6V 3ZIAG 1QLNA 3E83A 5EBLC 1KC8W 1K92A 2XASA 5HFMA 3OEEG 2R9RB 5LBQA 3FB6C 1BHBA 3K04A 2OTLV 3LSQA 1NR7A 1JVMA 3ZRWA 5KUKA 2V7QG 1GMGA 1M56C 3CMAV 4RQEA 2X0LA 3IC7A 1JPXA 3RVYA 4TSFG 1K97A 4PA4A 2PI5A 4CZZA 1YIJV 4MW8A 1FS0G 3LNMB 3ABLB 2WLKA 4MTFA 3WG7B 3ZRSA 2Z5UA 4WFFA 1K9MW 1OCRB 3DTUB 4FMTA 3W7UA 2P90A 2WLMA 3JD3A 4UVCA 1FXHA 1PKXA 1KD1W 5HFLA 1K5QA 4MSWC 2LP7A 1V55C 2X6CA 5H9CA 1SZTA 3K0DA 1S5HC 1SESA 4MS2A 4UVAA 1QR8A 5KA5A 4PA3A 2X6BA 5CMUA 1MABG 4WFBV 3CCSV 3D36A 2GSMB 4BIZA 4WFAV 2DWDC 3F5WC 3RVZA 2Q69A 2A9HA 1EZJA 4P2ZA 3OM3B 5KUMA 3CC4V 2YEVB 3ZCCA 4X89A 2WLNA 5B1BB 1ZWIC 2WAMA 4JTDB 1RM1C 3JD4A 3ZN1A 1S72V 1OCOB 2HR3A 4MTGA 3G4SV 2IJJA 2P7TC 1GTOA 1EBOA 1AJNA 3EFFK 2YSUB 2IJIA 2JEXA 3ZMVA 5CBHA 4JAVA 1K5SA 4H37A 2HFEC 2ZXWC 3CP1A 3T4ZA 1W0KG 5L3GA 2ZR2A 5B3SB 1YJWV 2EZPA 5IY5B 1K4DC 1KECA 3CYOA 3ABLC 4H33A 2JEUA 2P67A 4WFGA 1OZ0A 2B1GA 1AI7A 1ROPA 4QNHB 3CCEV 3NXSA 5CN0A 4X88A 1OCRC 3ZN0A 2NNUA 3JCZA 2QE7G 4LC1A 4UV8A 1R3KC 1K4CC 2JDIG 1IXMA 3LDDA 3T2MA 2A79B 4G28B 4MVOA 1CP9A 2HVKC 1F51A 5LGUA 1YTFB 4QPKA 3ASNC 3LDEA 3ETGA 1G4YB 5H6QA 3I55V 4MTOA 2NLJC 1YHQV 1M56B 5EC2C 2QEXV 3ABMB 2QKSA 2EIMC 1GKFA 3EHBB 2DQ0A 5LHGA 4UXNA 1AJQA 4J9YB 1K73W 1F4NA 4U7OA 3HB3B 3K03A 4MVZA 4PA6A 3QO7A 1Y66A 3TCUA 1TUEB 4MVSA 1QLEC 2WSSG 4XBFA 4R8CA 1HWYA 4JTCB 1Q82W 2AHYA 1DF5A 5L3CA 1S0VA 3E8GA 5LHHA 5B3SC 5IY5C 1VQKV 2Q68A 1BMFG 3D3IA 4XDKA 1R6NA 5L3EA 5EBWC 2HLDG 3H01A 4N23A 1M9NA 1P7BA 4HZ3A 1YI2V 3CCMV 1LNQA 4RO2A 1QR9A 4PA9A 2EILB 1YSCA 2OT5A 2WLHA 2HJFC 4DO2A 4MVQA 1MOFA 3CD6V 5EK0A 1RM1B 3JD1A 4FJCC 1NH2D 4MVRA 1Q86W 3QO5A 3UM7A 2R9IA 1OCZB 3VBBA 3BY6A 3R65A 3E86A 5B1NA 1M57C 4KFMA 4BIUA 5KA6A 2FTKA 3ABMC 3AG4B 1SETA 1Q81W 1NJIW 4GX5A 2ZXWB 1KP3A 2ZD9A 1R6KA 4KUMA 5B1AB 3CCUV 1JJ2U 2XNDG 3FB8C 3LUTB 2B5UA 4LBEC 3SPCA 4LCUC 3AG1B 2WLLB 3E35A 4R6ZA 4TWKA 1K3EA 2AHZA 2EIKC 1H38A 1WPXA 1GO3F 1SERA 1G8MA 3PJSK 4WFHA 2B1IA 2PI4A 4FPPA 2IW5A 1AJPA 4J9ZB 2WLJA 1H2GA 4QE7A 3OE7G 4PDLA 1DLBA 2EINC 3ASNB 3OR6C 2X7RB 1V54C 1M1KW 1W0JG 1FXVA 2UXXA 4MVUA 4X8AA 1CEZA 3FB5C 1QVFU 3TETA 4PDMA 3ZRWB 2EILC 2EIMB 4U7NA 3TK1A 2Y48A 1K8AW 4PDVA 4UUJC 2IJHA 1K7DA 2LFRA 4JYCA 2DYRB 1OCZC 3HPLC 1FXKA 2ITDC 2ZDIC 4UVBA 2W0FC 3OEHG 4UV9A 3CC2V 1QLEB 1NKDA 3KG2A 4RQFA 2QA4V 4R50A 3AG4C 3FYIB 4P9OA 1VQNV 1MSWD 5L3BA 3F7YC 5B1AC 3W7TA 1THZA 1R3JC 1GM8A 4I5SA 2HKOA 3AG1C 3OMNB 1WLEA 4GX2A 1AR1B 1GM7A 3ZMZA 1AI4A 2XAGA 2QM8A 2IH3C 3ETEA 3SPGA 1Y4MA 2OTJV 4QE9A 5L3FA 1JCHA 2M7WA 5H6RA 1MG1A 2Q6AA 3JD0A 3MHHC 3SYCA 2HG5C 3LSSA 5LGNA 1YJNV 4I9WA 2WLIA 1M57B 3ABKB 2IJKA 3SPIA 2D3OW 4JGSA 1SRYA 3SPJA 1VQPV 4Z1MG 3VOUA 3DGEA 5EBMC 1I5XA 3ZMSA 5LHIA 5L3DA 4QPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWW A;  4JYC A;  2LFR A;  3MD0 A;  4MTX A;  4GCZ A;  1F51 A;  5IDJ A;  3ZRW A;  2QM8 A;  4MT8 A;  4FPP A;  3A0R A;  5B1O A;  2QM7 A;  1JOY A;  3ZRV A;  5B1N A;  4QPK A;  4JAV A;  4QPJ A;  4BIU A;  4ZKI A;  2FTK A;  4Q20 A;  4JAS A;  4JYB A;  3D36 A;  4BIZ A;  3P32 A;  4I5S A;  2C2A A;  3ZRX A;  2P67 A;  4KP4 A;  5C93 A;  3NXS A;  3ZRW B;  3DGE A;  4GT1 A;  3ZCC A;  4U7N A;  4JAU A;  4U7O A;  3TK1 A;  4LC1 A;  2LFS A;  4FMT A;  1IXM A; 
#chains in the Genus database with same CATH topology
 4DW0 A;  3G71 V;  2X6A A;  3SYA A;  2WWW A;  2EIJ C;  1AR5 A;  4CBC A;  3OTO O;  1B6Q A;  2XAQ A;  4UFZ A;  3WU2 Z;  1S76 D;  1MZF A;  1R3I C;  2DOS A;  1UJW B;  1XNR B;  3K5M A;  2WA3 A;  3FB7 C;  5CBF A;  2UUA O;  1WPB A;  5BY1 A;  3E22 A;  2DMX A;  2DYS C;  4PI0 A;  2W0X A;  4DV4 O;  3IAY A;  3K0G A;  5JVD B;  1L0N H;  1DTO A;  1WB7 A;  4QJF B;  1SC5 B;  3CCJ V;  3K79 A;  3BPZ A;  5C8Y A;  4DR3 O;  2OCC C;  5JCO A;  3CCR V;  3OR7 C;  4OPA A;  1ORQ C;  3WFV A;  4C7U A;  3W7W A;  1PL0 A;  2EBO A;  5LL6 Y;  4HNA A;  1NVP D;  1RPO A;  1JFF B;  1N0N A;  2LW7 A;  4HBN A;  1H8H G;  1WP8 A;  1H2K A;  2QM7 A;  3K08 A;  2IBZ H;  1S5J A;  1HDJ A;  2F43 G;  5E1A C;  2UXN A;  1R3L C;  4R7C A;  4B3S O;  1I08 A;  2JGU A;  5KHI A;  1VQ7 V;  3KCY A;  2QWO B;  4PD4 F;  4U3F H;  5KHK A;  4GX1 A;  3CRM A;  2HJD A;  4P9P A;  2DQ3 A;  1VF6 A;  2F4V O;  4K0K B;  2FML A;  5J2T B;  4LF5 O;  2IU3 A;  2MK3 A;  4JI3 B;  3QO8 A;  3T4D A;  1GN3 A;  1XL6 A;  1IBK O;  4BAY A;  3OGI B;  4KP4 A;  2W6I G;  2OCH A;  5JQG A;  1I94 O;  1YIT V;  3UKM A;  4DUY B;  2ZNJ A;  1ZX3 A;  4JZ2 A;  2WPD G;  1HP8 A;  2BOB C;  1PNL A;  4JI7 B;  2BSK B;  5ITZ B;  4LR3 A;  5IYZ B;  2ZE8 A;  3K3W A;  4LF7 B;  4YXW G;  1AI6 A;  2Y4T A;  3DC5 A;  3OAA G;  3X2Q C;  1FXK B;  1L8D A;  4DV5 B;  1VQ5 V;  4OX9 O;  2P4V A;  1PPJ H;  4Z1V A;  1HNX O;  3G6E V;  1OCC B;  3FAV A;  3TXQ A;  3BFR A;  3CME V;  2UXB B;  3RFR A;  2QTO A;  3I56 V;  2GHY A;  2CTQ A;  5GW7 A;  2ADP A;  2ZIM A;  1VIB A;  3HKE B;  1OHH G;  2XOK G;  2XAJ A;  2ZDI A;  2Q7G A;  1XRE A;  2AGA A;  3P30 A;  5J2U A;  1KKD A;  4WCE V;  4NB5 A;  2Q4P A;  4JI8 B;  2WLI B;  4B3M O;  1NR1 A;  3CCQ V;  4FFB A;  2YID A;  1VQ4 V;  3GWO A;  4H44 B;  2ZE7 A;  5H5N A;  1D5A A;  4I0X A;  4FK5 C;  3DXR B;  3ETD A;  4DR2 B;  2QWP B;  3CCL V;  3JAW A;  4NTY A;  3RYH A;  2VRZ A;  4GKJ B;  1BQZ A;  3ZIA G;  4FM1 A;  1QLN A;  5AG2 A;  3BRC A;  2CGN A;  4JI2 O;  4JI0 B;  3FB6 C;  3BVO A;  3K04 A;  2OTL V;  1JVM A;  3ZRW A;  3E22 B;  3I5D A;  4FZ0 A;  4RQE A;  2X0L A;  2A06 H;  3IC7 A;  1XMO B;  1M93 A;  3H1K H;  4MW8 A;  4GZR B;  3LNM B;  4O4I A;  2LGW A;  3TJT A;  4JI6 O;  5C8Y B;  3ZRS A;  2Z5U A;  5LYJ A;  2RN9 A;  2DN9 A;  3DTU B;  2WLM A;  1FXH A;  3H9V A;  5IT9 N;  2HHH B;  2KSD A;  4MSW C;  3GWK C;  1V55 C;  5FNV B;  1SES A;  5LP6 C;  4PA3 A;  3T1H B;  4KL1 A;  4HNA B;  3CCS V;  4GLX A;  2K9P A;  3F5W C;  3AK1 A;  4P2Z A;  2Z0A A;  4WBN A;  3CC4 V;  3ZCC A;  2WLN A;  3K9S A;  3L73 H;  2WAM A;  1RM1 C;  5BMV A;  3JD4 A;  4K35 A;  2HR3 A;  1GTO A;  3IC9 A;  3K5O A;  3RYC A;  3EFF K;  5EYP A;  2XHB A;  2YSU B;  1EN4 A;  2IJI A;  3CS5 A;  2HFE C;  2ZXW C;  3CP1 A;  3T4Z A;  2E76 B;  5B3S B;  1K4D C;  3CYO A;  4B3R O;  4ZHQ A;  1JR9 A;  4X88 A;  1QHT A;  3ZN0 A;  3JCZ A;  1R3K C;  2JDI G;  1CP9 A;  4J42 A;  4YY3 B;  2E74 B;  4DR1 B;  3HKD A;  2ZIN A;  5JQG B;  4QPK A;  3LDE A;  3C90 A;  3I55 V;  1I0H A;  2PTM A;  3JAR A;  1YHQ V;  2RDC A;  4O4J A;  2QEX V;  2EIM C;  4FFK A;  4IHJ A;  4LF8 B;  1GKF A;  5K1P A;  5KX5 A;  2ETN A;  3HB3 B;  3QO7 A;  4O2A A;  3JAK A;  2CAZ C;  5LHH A;  5IY5 C;  1EZV H;  2Q68 A;  1HR0 B;  1BMF G;  2E75 B;  3FAV B;  1KBH A;  3D3I A;  3OD4 A;  5L3E A;  3BA9 A;  4N23 A;  1BSM A;  4ICG A;  1LNQ A;  4DO2 A;  1FYJ A;  5EK0 A;  3M7M X;  1NH2 D;  4MVR A;  3QO5 A;  1IBM B;  1OCZ B;  4H13 B;  5J2U B;  4UCV A;  1Q5O A;  1YZB A;  3CCU V;  2AW9 A;  1R6K A;  2ZD9 A;  4KUM A;  1TAE A;  1XMQ B;  3SPC A;  4LCU C;  3AG1 B;  4FFB B;  3E35 A;  4R6Z A;  4TQD A;  4D7T A;  2EIK C;  4X62 O;  1WPX A;  2E3C A;  4I0X B;  3UO2 A;  2JVD A;  4J9Z B;  4J7K A;  5LMU B;  3JAW B;  1XNQ B;  3RYH B;  3SJB C;  2EIN C;  4Q6G A;  3ASN B;  2PUS A;  2CH7 A;  1V54 C;  2EUL A;  3OR6 C;  1M1K W;  3FB5 C;  1QVF U;  3ZRW B;  3VQX A;  2EIL C;  5CA1 A;  4DV2 B;  1IBL B;  3D8C A;  2W0F C;  4O4I B;  1GH6 A;  1ZAU A;  1QLE B;  4LNU A;  4DR4 O;  5LYJ B;  3W7T A;  4I5S A;  1GM8 A;  2RMK B;  1AR1 B;  1AI4 A;  2OWO A;  4U3J A;  3UQ8 A;  4QE9 A;  4DV0 B;  5IJ9 A;  3K5N A;  4GKK B;  1YJN V;  1AVM A;  4AQY B;  4DV7 B;  1M57 B;  4NXM B;  1SRY A;  1URF A;  4EFE A;  3RYC B;  3B2E E;  5EYP B;  5L3D A;  5LP6 A;  4QPJ A;  4LFA O;  2ZM6 B;  2DYR C;  3RYI A;  3ABT A;  4DUZ B;  1K33 A;  3AG7 A;  4PA7 A;  3B8N A;  2FKX A;  4ZHQ B;  3SJQ C;  5EIB C;  1SQP H;  1E1R G;  1Z2G A;  2QDO A;  4FLY A;  1BT8 A;  1ENV A;  2LQT A;  4RUE A;  2ZQM A;  4LF9 O;  3ABU A;  1ARO P;  3F7V C;  1QU7 A;  3SYO A;  1DF4 A;  2JS3 A;  3HKD B;  2N74 A;  5BR8 O;  1VF7 A;  4DXW A;  4FIP C;  2K1E A;  1HW7 A;  2BTQ A;  5J9P C;  4LFB O;  1L1F A;  1L0L H;  3JAR B;  4O4J B;  4RWU A;  4IHJ B;  2F1M A;  3W7X A;  4TUY A;  2RCV A;  5KX5 B;  2LJ2 A;  5LMN B;  4UCS A;  1YTF D;  4BW5 A;  2ILM A;  1H8E G;  4UB8 Z;  1Q7Y W;  3FFQ A;  4O2A B;  1COW G;  2UXC O;  3L72 H;  3JAL B;  5KHH A;  1Y76 A;  3JAK B;  1SQF A;  2DW4 A;  4DR6 B;  3E89 A;  2EJR A;  1EN5 A;  4GYC B;  2YEV A;  3CJH A;  4YHH B;  1BL8 A;  1SS3 A;  5IWA O;  5DN6 G;  4DV3 O;  2QTS A;  3SYP A;  2R70 A;  2C2A A;  1ZTE A;  5ITZ A;  2HVJ C;  4IYI A;  3OFN G;  2AZ2 A;  4JI5 O;  2G38 A;  3X2Q B;  2NN4 A;  1JQ0 A;  1VQL V;  3RT3 C;  5A9G A;  3S3X A;  3AK2 A;  4ASU G;  2R72 A;  3ZMT A;  2RJZ A;  3ASO C;  5LA6 A;  1GK9 A;  2E5L O;  4LF4 B;  2Q7E A;  4JI1 O;  2V1D A;  4A5U B;  1GAX A;  3B8M A;  3ZBH A;  4JAU A;  5CBG A;  1BHA A;  1SZX A;  3K06 A;  4JPR A;  2CH7 B;  5IDJ A;  1R73 A;  2QWR B;  4RAI A;  1E1Q G;  2P06 A;  5CA1 B;  3JAM N;  1HNZ O;  2ZCE A;  2ODM A;  3UT5 A;  5F2V O;  5FL7 G;  4DV6 B;  2A0L A;  1EFR G;  2QWN B;  1N36 B;  2Q67 A;  4LNU B;  1FJG B;  1NH2 B;  3AEI A;  3RBZ A;  1PD3 A;  1NI8 A;  4IL6 Z;  5B1O A;  4E2L A;  1S3J A;  3FYE B;  5B5E Z;  2JGD A;  4W4K A;  4ABM A;  1VQO V;  4GKK O;  3STZ C;  1V9P A;  2Q8V A;  3FD9 A;  4X64 B;  4U3J B;  3ZRX A;  4LFC O;  3A8T A;  4DK0 A;  5IJ9 B;  2Q7H A;  2BCC H;  1OCO C;  4OGQ B;  1GN6 A;  3QF7 A;  2Q73 A;  2DWE C;  2OIE A;  4DR7 O;  2Y4U A;  1VQ9 V;  3G6B A;  4DK1 A;  1V55 B;  4DR5 B;  1AIL A;  3T1C A;  5LP6 B;  3PN1 A;  4K8Z A;  4XDJ A;  3RYI B;  3P32 A;  3AG2 C;  4J41 A;  4F6E A;  1JA8 A;  5FNV A;  3ZED A;  5LGT A;  4NXN B;  1EM1 A;  5EBL C;  1KC8 W;  1K92 A;  2XAS A;  2PYJ A;  5HFM A;  4FLT A;  1FKA O;  1T5E A;  2YXY A;  3LSQ A;  1KKC A;  5KUK A;  2V7Q G;  4B3T O;  2BTQ B;  4I50 A;  3D3Q A;  3L71 H;  4PA4 A;  1YIJ V;  1FS0 G;  4D7S A;  1NT2 B;  1ZUQ A;  1Q43 A;  4MTF A;  2FYU H;  4KHP O;  3WG7 B;  4FLW A;  4TUY B;  3C3T A;  3W7U A;  1NTZ H;  4OPH A;  4E4E A;  1TGO A;  3QG5 A;  2N05 A;  4DR6 O;  2VQF O;  2KKW A;  4PV1 B;  1ZLZ A;  3K0D A;  2UUB O;  1QR8 A;  4FM2 A;  1Y76 B;  5CMU A;  1MAB G;  4WFB V;  3L74 H;  2ZE5 A;  1H2L A;  4BWA A;  3RVZ A;  3ZHR A;  2YEV B;  3CJH B;  5B1B B;  2H3O A;  3ZN1 A;  1PL4 A;  4MTG A;  5KAI Z;  4X65 B;  2IJJ A;  1U96 A;  2P7T C;  1EBO A;  4TV9 A;  3K5L A;  1NU1 H;  1KU9 A;  1Z5V A;  5CBH A;  3CXH F;  4JAV A;  1K5S A;  4H37 A;  4TOI A;  5L3G A;  2ZR2 A;  1YJW V;  5IY5 B;  4JYA B;  4IGG A;  4H33 A;  2JEU A;  1XDC A;  1ROP A;  1NTM H;  3NXS A;  1BE3 H;  1HNW O;  3R66 A;  2NNU A;  2QE7 G;  5LA6 B;  1K4C C;  3T2M A;  1J5E B;  3CRC A;  4JI4 B;  1F51 A;  3ZHS A;  5LGU A;  1YTF B;  1YEW A;  2QM4 A;  1SQQ H;  3J80 N;  2NLJ C;  1M56 B;  2DQ0 A;  1AJQ A;  1K73 W;  1F4N A;  2P22 C;  1IZ3 A;  2A3Q A;  4MVZ A;  4PA6 A;  1O9G A;  5IE9 A;  4MVS A;  3UT5 B;  4XBF A;  2AHY A;  1N33 B;  2UXD B;  3CRA A;  1WA8 A;  5KHG A;  1XNR O;  2F66 C;  4XDK A;  1R6N A;  3SGI A;  1N34 B;  1M9N A;  2PGG A;  4HZ3 A;  4JYY A;  5IJ0 A;  4RO2 A;  2JGD B;  2EIL B;  4TV8 A;  4MVQ A;  3JD1 A;  4CS2 A;  2CDY A;  4FJC C;  3JAS A;  3E86 A;  5B1N A;  1H2N A;  1WNS A;  2YIB D;  2EJ7 A;  5KA6 A;  3ABM C;  3SR2 C;  4GX5 A;  1KP3 A;  1O9H A;  3FB8 C;  4LBE C;  3ZHU A;  4FLZ A;  4I9Q A;  3F5T A;  1SQX H;  3T1Y B;  4DV1 B;  4B7E A;  3PJS K;  4WFH A;  1N0J A;  4X66 B;  2B1I A;  2ZNI A;  1QNM A;  3B09 A;  4PDL A;  2ADQ B;  4PI2 A;  4PJ0 Z;  3CE2 A;  1LR1 A;  3RWR D;  1W0J G;  1WP7 A;  4X8A A;  3TET A;  1N32 B;  2Q0O C;  3BAB A;  2Y48 A;  4I50 B;  4JYC A;  2DYR B;  3EXA A;  4K0K O;  1NKD A;  4X1I B;  4JV5 B;  3AG4 C;  4JI3 O;  5JJJ B;  4P9O A;  5L3B A;  3F7Y C;  1LUV A;  2YIB A;  1THZ A;  4DRX A;  1FAF A;  1LUW A;  3ZMZ A;  1Q90 D;  4IYH A;  4J7Z A;  3K57 A;  4DUY O;  3SPG A;  2CE4 A;  1Y4M A;  5L3F A;  1JCH A;  4JI7 O;  1MG1 A;  2Q6A A;  3JD0 A;  3LSS A;  1NZ6 A;  4I55 A;  3SPI A;  2D3O W;  4LF7 O;  3SPJ A;  2GTA A;  3GVM A;  3KKY A;  3LSU A;  3VOU A;  4FLU A;  4TV9 B;  4YIP A;  3THO A;  4DV5 O;  3CEI A;  4N21 A;  4XDL A;  2IM9 A;  2UXB O;  3JAL A;  2YC0 A;  2YDE A;  4EEQ A;  2UU9 B;  3FKS G;  3K9A A;  2IH1 C;  4X1Y A;  1MMM A;  3KZI Z;  2Y0I A;  1US6 A;  1P84 F;  4MTX A;  1Q8I A;  4JI8 O;  1GM9 A;  1QQC A;  4O2B A;  4JF3 A;  1UFI A;  2BOC C;  4EKW A;  1JMK C;  3OUF A;  4HAM A;  4JAS A;  1SQG A;  2JK5 C;  2YXH A;  3ZS8 C;  4DR2 O;  2ZR3 A;  1IXB A;  1OCC C;  1XL4 A;  3AG3 C;  4GKJ O;  2W6J G;  4CH6 A;  2JIZ G;  3CRR A;  5CB4 A;  2O57 A;  3IGA C;  4X1K A;  1WA8 B;  4JI0 O;  3B40 A;  3SDL A;  1XBL A;  2YI8 A;  3HKC A;  5GTH Z;  5IJ0 B;  1YVW A;  1VEW A;  4TV8 B;  1NQT A;  5E79 Z;  1XMO O;  1AI5 A;  1QCE A;  1JJO A;  3CCV V;  4J7J A;  4F4L A;  3E8H A;  2ZT9 B;  3JAS B;  1Q3E A;  1AP5 A;  2PZS A;  3LDC A;  4CH3 A;  4EFB A;  3JD2 A;  3MDS A;  4GX0 A;  4QGP A;  2CTW A;  2HHH O;  1KMI Z;  2EIJ B;  2H8P C;  1IDS A;  2F95 B;  5DED A;  4G27 B;  1CXZ B;  4ZI7 A;  2OIG A;  3T1H O;  2CTR A;  4J10 A;  1NBM G;  4UCO A;  4ZBM A;  2DYS B;  1F4M A;  3K58 A;  3E8F A;  1E79 G;  4LF6 B;  3H1J H;  3UCS C;  1JX9 A;  3OMA B;  1SQV H;  3K59 A;  4JAA A;  1S5L Z;  3LNN A;  3E8B A;  2UUC B;  2OCC B;  1VQ8 V;  1PNM A;  2XAF A;  3AG2 B;  3JSN A;  1KUQ A;  1BS3 A;  1S77 D;  3UO3 A;  5JCO C;  3U11 A;  1U97 A;  2MW2 B;  3IFX A;  3OTO B;  2JRI A;  3CPW U;  4PEL A;  2YI9 A;  4DRX B;  4YY3 O;  4DR1 O;  4JTA B;  1X59 A;  4WF9 V;  5JJN B;  2Z3Y A;  3JCU Z;  3B4S A;  1XEQ A;  4OXS A;  1PP9 H;  2UUA B;  1M90 W;  5IYD O;  2Y69 C;  4DV4 B;  5KMG A;  4LF8 O;  1XUQ A;  1FFT B;  4WFE A;  3VQY A;  1RPR A;  4I55 B;  3NR7 A;  2WLL A;  3A0R A;  4DR3 B;  3HKB A;  3L70 H;  3N2G A;  1N8R W;  1W2B U;  4YJ2 A;  1HR0 O;  2XAH A;  1KYO F;  1Y74 A;  2KQX A;  5DM6 V;  2ZKO A;  3OEE G;  5LBQ A;  4J80 A;  1BHB A;  4FLX A;  1BZK A;  2F23 A;  2PYL A;  4CH5 A;  1GMG A;  4X1Y B;  1IBM O;  2M6Y A;  4B3S B;  1YXB A;  1K97 A;  2FL4 A;  4UB6 Z;  2PI5 A;  4O4H B;  1GRJ A;  5EZY B;  1XMQ O;  4O2B B;  4WFF A;  5JH7 A;  3G67 A;  2P90 A;  2F4V B;  1PKX A;  3FX7 A;  3C3S A;  5HFL A;  4LF5 B;  2X6C A;  4UCR A;  5FPO A;  1GN2 A;  1SZT A;  4AIL C;  1IBK B;  1S5H C;  4UVA A;  4CS3 A;  5LMU O;  1XNQ O;  1MZE A;  2GSM B;  3WB2 A;  4BIZ A;  4WFA V;  1GN4 A;  5CB4 B;  4X1K B;  2A9H A;  3Q4H A;  1OV9 A;  1WB8 A;  5KUM A;  4AI8 A;  3HKC B;  1S72 V;  4DV2 O;  2DE0 X;  3AK3 A;  4CS4 A;  1IBL O;  3WB1 A;  1WN7 A;  2JEX A;  4J11 A;  2EZP A;  1KEC A;  2NR5 A;  3ABL C;  4WFG A;  4AHC A;  1TVK A;  1AI7 A;  3OTF A;  4OX9 B;  1HNX B;  4X20 A;  1OCR C;  4UV8 A;  4LC1 A;  2YIC A;  1XOU A;  3LDD A;  2A79 B;  4LWS A;  4B08 A;  4ZI7 B;  3TXS A;  2VS0 A;  4DV0 O;  3ASN C;  5H6Q A;  3ETG A;  1G4Y B;  3ZHQ A;  2GDS A;  3DSQ A;  4MTO A;  4JZG A;  5EC2 C;  3ABM B;  4AQY O;  4DV7 O;  4NXM O;  3EHB B;  2VQE B;  5EIB D;  5D5Q A;  4UXN A;  3APO A;  4J9Y B;  3OT7 A;  4H0L B;  1XQ8 A;  2YUA A;  4LH6 A;  4B3M B;  5KHJ A;  2CUG A;  3TCU A;  1TUE B;  2ZM6 O;  4DUZ O;  1QLE C;  4R8C A;  4FLV A;  4JTC B;  1Q82 W;  1DK1 A;  5L3C A;  1S0V A;  3E8G A;  5B66 Z;  1VQK V;  1VF5 B;  1TUB A;  3H01 A;  1P7B A;  1YI2 V;  2DJV A;  3CCM V;  2XTA A;  3P3P A;  1QR9 A;  5TIS Z;  4JI2 B;  4YJ3 A;  1YSC A;  2OT5 A;  2HJF C;  3HR0 A;  4K8X A;  1RM1 B;  1Q86 W;  3UM7 A;  2R9I A;  3VBB A;  3R65 A;  5KMG B;  1M57 C;  3S3W A;  2PF4 E;  4KFM A;  2OYQ A;  4BIU A;  3N2K A;  1SQB H;  5LMN O;  3AG4 B;  1SET A;  3IJ4 A;  2ZXW B;  1P49 A;  1JJ2 U;  2XND G;  3LUT B;  4JI6 B;  1SA0 A;  2B5U A;  2WLL B;  4X1I A;  2A7W A;  1K3E A;  3HKB B;  3N2G B;  2AHZ A;  1YF2 A;  2QR4 A;  3M8A A;  1GO3 F;  3H1H H;  1G8M A;  3ICX A;  5FLX N;  4YJ2 B;  4FPP A;  2IW5 A;  1AJP A;  1Y74 B;  4UCT A;  4YHH O;  1DLB A;  4MVU A;  2EIM B;  3TK1 A;  3U10 A;  4NR1 A;  5D5P A;  1K8A W;  2LFR A;  2CTP A;  5CA0 A;  3HPL C;  3J7A U;  3CC2 V;  2GUZ A;  1VQN V;  4B3R B;  5B1A C;  5JH7 B;  4LF4 O;  1MA1 A;  1WLE A;  1GM7 A;  2XAG A;  2QM8 A;  2IH3 C;  3ETE A;  2ZIO A;  4L8J A;  1G6U A;  2OTJ V;  2M7W A;  2Q5Z A;  5H6R A;  3Q4H B;  1RFY A;  4I9W A;  2RQ6 A;  2IJK A;  2L6L A;  3N27 A;  4CC5 A;  2P5O A;  1VQP V;  4KXR A;  2ZE6 A;  3BHP A;  4DV6 O;  3ZMS A;  5LHI A;  1N36 O;  2ARH A;  3AG3 B;  1FJG O;  3W7S A;  1AR4 A;  2EIK B;  3P3N A;  2XUM A;  1B04 A;  3BA8 A;  3RN4 A;  1TVK B;  1VP7 A;  3ZRV A;  4X20 B;  1CPY A;  1FFX A;  3ML0 A;  2Y0P A;  4LWS B;  2EIN B;  5LOV A;  1V54 B;  3VQV A;  4X64 O;  2QKA A;  2VQE O;  4F6R A;  1WJZ A;  4BR6 A;  5CA3 A;  3D36 C;  1BCC H;  1AB3 A;  4RUF A;  2CK3 G;  2FB5 A;  1J95 A;  1VQ6 V;  1FD9 A;  4MVM A;  4NTW A;  1X4T A;  3ETQ A;  1YCI A;  3BCC H;  3ABK C;  1VAR A;  4W4L A;  4DR5 O;  2JJ1 G;  2GBO A;  3ZJZ A;  3BEH A;  2KG7 A;  1RSO A;  4GT1 A;  4X62 B;  2Q0A A;  4NXN O;  1F23 A;  4MW3 A;  3JYC A;  4FZ1 A;  5DEC A;  2KB1 A;  1TUB B;  1YDX A;  2GTS A;  1I5Y A;  3J81 N;  1QVG U;  4NVP A;  4YJ3 B;  4EB6 A;  3ZHV A;  1VQM V;  1XHX A;  2P6J A;  3MHS C;  4LP8 A;  1I7F A;  3E2E A;  2H94 A;  3N2K B;  3MD0 A;  3OW2 U;  4GCZ A;  2GV9 A;  4MT8 A;  4DR4 B;  3RW0 A;  1NTK H;  1SA0 B;  2L35 A;  1P7G A;  2LGQ A;  5IYC O;  3ZX6 A;  1IX9 A;  2B9Z A;  1XIL A;  3SYQ A;  5EC1 C;  2VWK A;  4P30 A;  1P4R A;  1KP2 A;  2Y69 B;  4PHZ A;  2ITC C;  2P4K A;  1KQS U;  5A2Q N;  1PV0 A;  2QJ1 A;  2V4D A;  5BZB A;  3QNE A;  1BGY H;  1SKV A;  4X65 O;  1YJ9 V;  1B3Q A;  2JJ2 G;  3SPH A;  2QSA A;  4Q20 A;  3O65 A;  4JYB A;  1EN6 A;  4L87 A;  4PDR A;  3RYF A;  3STL C;  3OMI B;  2LW1 A;  3CXC U;  3BAA A;  3WG7 C;  2BTO A;  5CA0 B;  5C93 A;  4D6T H;  3GB7 C;  4JYA O;  1PNK A;  4LFA B;  2ATK C;  2GUZ B;  3JSL A;  1ZL8 A;  4TT3 G;  1PM9 A;  3H1I H;  1J5E O;  1JOY A;  4JI4 O;  1IUR A;  4I4T A;  5LXT A;  4ZKI A;  4G2K A;  4LF9 B;  4ZOL A;  4YIO A;  3JAT A;  4NKG B;  5BR8 B;  5B1B C;  5IYB O;  1NVP B;  2R9A A;  3CC7 V;  4LFB B;  1MNG A;  2LFS A;  3OUS A;  1D5N A;  4O4H A;  2IU0 A;  1ZSP A;  2LO1 A;  3ZMU A;  5EZY A;  3OGC C;  4QIW F;  5FPR A;  2EZO A;  1K34 A;  4NTX A;  1N33 O;  3B77 A;  1NS1 A;  3CX5 F;  3ASO B;  4B7K A;  4K3A A;  1F7Y A;  4HYO A;  1QBZ A;  1OJH A;  2UXD O;  1FXK C;  2UXC B;  3M99 B;  2RNB A;  1N34 O;  4DYL A;  3E83 A;  1FFX B;  4LH7 A;  3G80 A;  4ZIB A;  2R9R B;  2QWQ B;  4I7Z B;  4O4L A;  3A0H Z;  1NR7 A;  5IWA B;  4DV3 B;  5LOV B;  3CMA V;  1M56 C;  1JPX A;  4F6R B;  4DW1 A;  2XT9 A;  4CH4 A;  3RVY A;  4TSF G;  2YXL A;  4CZZ A;  4JI5 B;  1Q6H A;  3ABL B;  2WLK A;  1BQ0 A;  5GON A;  1K9M W;  1OCR B;  3A2F A;  4FMT A;  3CSX A;  4UVC A;  3JD3 A;  3APQ A;  4BIO A;  1KD1 W;  1K5Q A;  3T1Y O;  4DV1 O;  2LP7 A;  5H9C A;  2E5L B;  4X66 O;  2KG7 B;  1RSO B;  4MS2 A;  4JI1 B;  5KA5 A;  2YS8 A;  2X6B A;  3D36 A;  1Y67 A;  1FPO A;  2DWD C;  2JS5 A;  2Q69 A;  1EZJ A;  3SJC C;  3OM3 B;  4X89 A;  1ZWI C;  4JTD B;  2HEP A;  2D2C B;  1N32 O;  2AXT Z;  4IIJ A;  1OCO B;  4EB6 B;  3G4S V;  1AJN A;  3CB2 A;  1AP6 A;  3ZMV A;  4IT5 A;  1HNZ B;  1UPG A;  1W0K G;  4JV5 O;  3VQW A;  5K1X A;  5KAF Z;  2P67 A;  2Q9L A;  1OZ0 A;  2B1G A;  3CCE V;  4QNH B;  2YIA A;  4GUN A;  5CN0 A;  3TGU H;  1IXM A;  4G28 B;  4MVO A;  2HVK C;  1XHZ A;  3CRQ A;  4WBN B;  3H1L H;  3SJA C;  5BMV B;  5JVD A;  2BE3 A;  4LFC B;  4TQF A;  1R1B A;  1W59 A;  2QKS A;  2PY5 A;  3QVN A;  5LHG A;  4U7O A;  3K03 A;  4DR7 B;  3DC6 A;  4BW9 A;  1Y66 A;  2QKC A;  1H2M A;  2WSS G;  3RYF B;  1HWY A;  4NYK A;  1DF5 A;  1JFF A;  5B3S C;  3CHX A;  5BXZ A;  1VF6 C;  1ZL8 B;  2UU9 O;  1B06 A;  5EBW C;  2HLD G;  3EVK A;  1RP3 B;  1Q6I A;  4PA9 A;  4I4T B;  5JWP A;  2WLH A;  5LXT B;  1MOF A;  4FM0 A;  1M4U A;  3CD6 V;  3KCX A;  4ZOL B;  3JAT B;  5JJE B;  3L75 H;  5KLV H;  3BY6 A;  4B3T B;  2HP8 A;  3A0B Z;  2FTK A;  1Q81 W;  1NJI W;  1N4C A;  3L9D A;  5B1A B;  1H2S B;  1XI1 A;  5J2T A;  4KHP B;  4UCU A;  4TWK A;  4CC6 A;  1H38 A;  2VQF B;  1SER A;  1MSD A;  2EX3 A;  4Z2W A;  1A32 A;  2PI4 A;  4X9Q A;  1SF9 A;  2WLJ A;  2UUB B;  1H2G A;  4QE7 A;  3OE7 G;  1DGS A;  2QGN A;  2X7R B;  1FXV A;  2BSK A;  2UXX A;  4O4L B;  1CEZ A;  1WAZ A;  1I94 B;  4PDM A;  5IYZ A;  5GTI Z;  4U7N A;  4PDV A;  4UUJ C;  2IJH A;  1K7D A;  1M5I A;  1OCZ C;  2F93 B;  3QTC A;  4UVB A;  1FXK A;  2ITD C;  1Y6X A;  2ZDI C;  3OEH G;  1R6T A;  4FVM A;  4UV9 A;  1TA8 A;  3KG2 A;  3MAQ A;  4RQF A;  2QA4 V;  4R50 A;  2CGO A;  5H2F Z;  5GON B;  3FYI B;  1MSW D;  1VMG A;  2N04 A;  1R3J C;  1HNW B;  2HKO A;  3AG1 C;  3OMN B;  1KB9 F;  4GX2 A;  3U0Z A;  1Z5W A;  3ZHT A;  3CWB H;  3HKE A;  3RGB A;  4LF6 O;  3WB0 A;  1G1X B;  2VWJ A;  3MHH C;  3SYC A;  2HG5 C;  5LGN A;  2WA4 A;  2WLI A;  3ABK B;  4IIJ B;  2UUC O;  4JGS A;  3O9O A;  4Z1M G;  3DGE A;  5EBM C;  1I5X A;  1D2D A;  1Q6U A;  2AZ0 A;  1IVS A;  3DXR A; 
#chains in the Genus database with same CATH homology
 2DYR C;  3ABT A;  2X6A A;  3AG3 B;  1K33 A;  2WWW A;  4N21 A;  4PA7 A;  4XDL A;  3SYA A;  3G71 V;  3W7S A;  2EIK B;  3B8N A;  2EIJ C;  4CBC A;  1B6Q A;  2XAQ A;  3ZRV A;  1S76 D;  1R3I C;  1CPY A;  3SJQ C;  1UJW B;  1E1R G;  3FKS G;  1ENV A;  3ML0 A;  3K9A A;  2ZQM A;  4RUE A;  3ABU A;  3FB7 C;  1ARO P;  2EIN B;  5CBF A;  3F7V C;  3SYO A;  2IH1 C;  1DF4 A;  1V54 B;  2DYS C;  4DXW A;  4FIP C;  2K1E A;  5CA3 A;  5J9P C;  1L1F A;  3K0G A;  4MTX A;  1DTO A;  4RUF A;  2CK3 G;  1GM9 A;  1J95 A;  4QJF B;  3CCJ V;  1VQ6 V;  4MVM A;  3K79 A;  3W7X A;  4JF3 A;  1YTF D;  2BOC C;  4EKW A;  2OCC C;  3ABK C;  4BW5 A;  3OUF A;  4HAM A;  4JAS A;  2JJ1 G;  1H8E G;  2JK5 C;  3CCR V;  3OR7 C;  3ZJZ A;  3BEH A;  1ORQ C;  3WFV A;  1Q7Y W;  3W7W A;  2ZR3 A;  1PL0 A;  4GT1 A;  1OCC C;  1COW G;  2EBO A;  1XL4 A;  3AG3 C;  2W6J G;  1NVP D;  1RPO A;  2DW4 A;  2JIZ G;  1F23 A;  4MW3 A;  3E89 A;  3IGA C;  2EJR A;  1H8H G;  3JYC A;  2KB1 A;  2YEV A;  2QM7 A;  1I5Y A;  1BL8 A;  3K08 A;  5DN6 G;  1QVG U;  3SYP A;  1NQT A;  2F43 G;  5E1A C;  2UXN A;  1R3L C;  4R7C A;  1VQM V;  2C2A A;  1AI5 A;  2P6J A;  1QCE A;  3MHS C;  4LP8 A;  2HVJ C;  1VQ7 V;  3CCV V;  3OFN G;  4F4L A;  3E8H A;  3X2Q B;  3LDC A;  3E2E A;  1JQ0 A;  4GX1 A;  1VQL V;  2H94 A;  4P9P A;  2DQ3 A;  3MD0 A;  3JD2 A;  3OW2 U;  4GCZ A;  4GX0 A;  4MT8 A;  4ASU G;  3ZMT A;  3RW0 A;  2IU3 A;  2EIJ B;  2H8P C;  2MK3 A;  3QO8 A;  3T4D A;  3ASO C;  1GK9 A;  4G27 B;  1XL6 A;  5IYC O;  4BAY A;  2V1D A;  3SYQ A;  5EC1 C;  4P30 A;  3B8M A;  1P4R A;  2W6I G;  4KP4 A;  1KP2 A;  1NBM G;  2Y69 B;  1YIT V;  3UKM A;  2ITC C;  4JAU A;  4ZBM A;  1KQS U;  2DYS B;  5CBG A;  1F4M A;  2WPD G;  3E8F A;  1E79 G;  1BHA A;  2BOB C;  3K06 A;  1PNL A;  4JPR A;  1JX9 A;  3QNE A;  3OMA B;  5BZB A;  5IDJ A;  1YJ9 V;  1R73 A;  4RAI A;  1E1Q G;  3E8B A;  2JJ2 G;  3SPH A;  3K3W A;  4Q20 A;  4JYB A;  4L87 A;  2OCC B;  4PDR A;  4YXW G;  1AI6 A;  3STL C;  1PNM A;  2XAF A;  3OMI B;  5FL7 G;  3CXC U;  3WG7 C;  2A0L A;  1VQ8 V;  3OAA G;  3AG2 B;  5C93 A;  1EFR G;  3GB7 C;  3X2Q C;  1FXK B;  1PNK A;  1VQ5 V;  1S77 D;  2ATK C;  2Q67 A;  3G6E V;  1OCC B;  1NH2 B;  3AEI A;  4TT3 G;  3RBZ A;  3IFX A;  3CPW U;  3CME V;  1PD3 A;  4PEL A;  2QTO A;  3I56 V;  2GHY A;  4JTA B;  5B1O A;  4E2L A;  4WF9 V;  1JOY A;  1S3J A;  2Z3Y A;  3FYE B;  1VQO V;  4OXS A;  4G2K A;  4ZKI A;  3STZ C;  1M90 W;  5GW7 A;  3ZRX A;  5IYD O;  5B1B C;  5IYB O;  2Y69 C;  1NVP B;  1OHH G;  2XOK G;  2XAJ A;  2ZDI A;  3CC7 V;  3P30 A;  1OCO C;  1KKD A;  4WCE V;  1FFT B;  2LFS A;  4WFE A;  1RPR A;  2DWE C;  2WLI B;  3OUS A;  1NR1 A;  2IU0 A;  3CCQ V;  2WLL A;  3A0R A;  1VQ4 V;  1VQ9 V;  3ZMU A;  3GWO A;  3OGC C;  1V55 B;  4QIW F;  1N8R W;  2EZO A;  3T1C A;  1K34 A;  3B77 A;  4FK5 C;  3ASO B;  3ETD A;  4XDJ A;  1W2B U;  3P32 A;  4HYO A;  1QBZ A;  3AG2 C;  1FXK C;  3CCL V;  3M99 B;  2XAH A;  5LGT A;  5DM6 V;  3ZIA G;  1QLN A;  3E83 A;  5EBL C;  1KC8 W;  1K92 A;  2XAS A;  5HFM A;  3OEE G;  2R9R B;  5LBQ A;  3FB6 C;  1BHB A;  3K04 A;  2OTL V;  3LSQ A;  1NR7 A;  1JVM A;  3ZRW A;  5KUK A;  2V7Q G;  1GMG A;  1M56 C;  3CMA V;  4RQE A;  2X0L A;  3IC7 A;  1JPX A;  3RVY A;  4TSF G;  1K97 A;  4PA4 A;  2PI5 A;  4CZZ A;  1YIJ V;  4MW8 A;  1FS0 G;  3LNM B;  3ABL B;  2WLK A;  4MTF A;  3WG7 B;  3ZRS A;  2Z5U A;  4WFF A;  1K9M W;  1OCR B;  3DTU B;  4FMT A;  3W7U A;  2P90 A;  2WLM A;  3JD3 A;  4UVC A;  1FXH A;  1PKX A;  1KD1 W;  5HFL A;  1K5Q A;  4MSW C;  2LP7 A;  1V55 C;  2X6C A;  5H9C A;  1SZT A;  3K0D A;  1S5H C;  1SES A;  4MS2 A;  4UVA A;  1QR8 A;  5KA5 A;  4PA3 A;  2X6B A;  5CMU A;  1MAB G;  4WFB V;  3CCS V;  3D36 A;  2GSM B;  4BIZ A;  4WFA V;  2DWD C;  3F5W C;  3RVZ A;  2Q69 A;  2A9H A;  1EZJ A;  4P2Z A;  3OM3 B;  5KUM A;  3CC4 V;  2YEV B;  3ZCC A;  4X89 A;  2WLN A;  5B1B B;  1ZWI C;  2WAM A;  4JTD B;  1RM1 C;  3JD4 A;  3ZN1 A;  1S72 V;  1OCO B;  2HR3 A;  4MTG A;  3G4S V;  2IJJ A;  2P7T C;  1GTO A;  1EBO A;  1AJN A;  3EFF K;  2YSU B;  2IJI A;  2JEX A;  3ZMV A;  5CBH A;  4JAV A;  1K5S A;  4H37 A;  2HFE C;  2ZXW C;  3CP1 A;  3T4Z A;  1W0K G;  5L3G A;  2ZR2 A;  5B3S B;  1YJW V;  2EZP A;  5IY5 B;  1K4D C;  1KEC A;  3CYO A;  3ABL C;  4H33 A;  2JEU A;  2P67 A;  4WFG A;  1OZ0 A;  2B1G A;  1AI7 A;  1ROP A;  4QNH B;  3CCE V;  3NXS A;  5CN0 A;  4X88 A;  1OCR C;  3ZN0 A;  2NNU A;  3JCZ A;  2QE7 G;  4LC1 A;  4UV8 A;  1R3K C;  1K4C C;  2JDI G;  1IXM A;  3LDD A;  3T2M A;  2A79 B;  4G28 B;  4MVO A;  1CP9 A;  2HVK C;  1F51 A;  5LGU A;  1YTF B;  4QPK A;  3ASN C;  3LDE A;  3ETG A;  1G4Y B;  5H6Q A;  3I55 V;  4MTO A;  2NLJ C;  1YHQ V;  1M56 B;  5EC2 C;  2QEX V;  3ABM B;  2QKS A;  2EIM C;  1GKF A;  3EHB B;  2DQ0 A;  5LHG A;  4UXN A;  1AJQ A;  4J9Y B;  1K73 W;  1F4N A;  4U7O A;  3HB3 B;  3K03 A;  4MVZ A;  4PA6 A;  3QO7 A;  1Y66 A;  3TCU A;  1TUE B;  4MVS A;  1QLE C;  2WSS G;  4XBF A;  4R8C A;  1HWY A;  4JTC B;  1Q82 W;  2AHY A;  1DF5 A;  5L3C A;  1S0V A;  3E8G A;  5LHH A;  5B3S C;  5IY5 C;  1VQK V;  2Q68 A;  1BMF G;  3D3I A;  4XDK A;  1R6N A;  5L3E A;  5EBW C;  2HLD G;  3H01 A;  4N23 A;  1M9N A;  1P7B A;  4HZ3 A;  1YI2 V;  3CCM V;  1LNQ A;  4RO2 A;  1QR9 A;  4PA9 A;  2EIL B;  1YSC A;  2OT5 A;  2WLH A;  2HJF C;  4DO2 A;  4MVQ A;  1MOF A;  3CD6 V;  5EK0 A;  1RM1 B;  3JD1 A;  4FJC C;  1NH2 D;  4MVR A;  1Q86 W;  3QO5 A;  3UM7 A;  2R9I A;  1OCZ B;  3VBB A;  3BY6 A;  3R65 A;  3E86 A;  5B1N A;  1M57 C;  4KFM A;  4BIU A;  5KA6 A;  2FTK A;  3ABM C;  3AG4 B;  1SET A;  1Q81 W;  1NJI W;  4GX5 A;  2ZXW B;  1KP3 A;  2ZD9 A;  1R6K A;  4KUM A;  5B1A B;  3CCU V;  1JJ2 U;  2XND G;  3FB8 C;  3LUT B;  2B5U A;  4LBE C;  3SPC A;  4LCU C;  3AG1 B;  2WLL B;  3E35 A;  4R6Z A;  4TWK A;  1K3E A;  2AHZ A;  2EIK C;  1H38 A;  1WPX A;  1GO3 F;  1SER A;  1G8M A;  3PJS K;  4WFH A;  2B1I A;  2PI4 A;  4FPP A;  2IW5 A;  1AJP A;  4J9Z B;  2WLJ A;  1H2G A;  4QE7 A;  3OE7 G;  4PDL A;  1DLB A;  2EIN C;  3ASN B;  3OR6 C;  2X7R B;  1V54 C;  1M1K W;  1W0J G;  1FXV A;  2UXX A;  4MVU A;  4X8A A;  1CEZ A;  3FB5 C;  1QVF U;  3TET A;  4PDM A;  3ZRW B;  2EIL C;  2EIM B;  4U7N A;  3TK1 A;  2Y48 A;  1K8A W;  4PDV A;  4UUJ C;  2IJH A;  1K7D A;  2LFR A;  4JYC A;  2DYR B;  1OCZ C;  3HPL C;  1FXK A;  2ITD C;  2ZDI C;  4UVB A;  2W0F C;  3OEH G;  4UV9 A;  3CC2 V;  1QLE B;  1NKD A;  3KG2 A;  4RQF A;  2QA4 V;  4R50 A;  3AG4 C;  3FYI B;  4P9O A;  1VQN V;  1MSW D;  5L3B A;  3F7Y C;  5B1A C;  3W7T A;  1THZ A;  1R3J C;  1GM8 A;  4I5S A;  2HKO A;  3AG1 C;  3OMN B;  1WLE A;  4GX2 A;  1AR1 B;  1GM7 A;  3ZMZ A;  1AI4 A;  2XAG A;  2QM8 A;  2IH3 C;  3ETE A;  3SPG A;  1Y4M A;  2OTJ V;  4QE9 A;  5L3F A;  1JCH A;  2M7W A;  5H6R A;  1MG1 A;  2Q6A A;  3JD0 A;  3MHH C;  3SYC A;  2HG5 C;  3LSS A;  5LGN A;  1YJN V;  4I9W A;  2WLI A;  1M57 B;  3ABK B;  2IJK A;  3SPI A;  2D3O W;  4JGS A;  1SRY A;  3SPJ A;  1VQP V;  4Z1M G;  3VOU A;  3DGE A;  5EBM C;  1I5X A;  3ZMS A;  5LHI A;  5L3D A;  4QPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...