3ZRWA

The structure of the dimeric hamp-dhp fusion a291v mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords AF1503 PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ
total genus 41
structure length 111
sequence length 111
chains with identical sequence C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrwA00
4I5SA 2LFRA 2P67A 4GCZA 3A0RA 3ZRVA 4MT8A 4BIZA 4JAUA 3NXSA 4FPPA 4U7NA 2QM7A 5B1NA 4BIUA 4GT1A 4LC1A 2FTKA 3P32A 4JYBA 4QPKA 1IXMA 4KP4A 3MD0A 3DGEA 3ZRWA 4ZKIA 5IDJA 4JAVA 3ZRWB 2LFSA 4MTXA 2WWWA 4U7OA 4Q20A 2QM8A 5B1OA 3TK1A 3ZRXA 1JOYA 2C2AA 5C93A 4JASA 1F51A 4FMTA 3D36A 3ZCCA 4JYCA 4QPJA
chains in the Genus database with same CATH superfamily
1XL6A 4DR3O 3THOA 1HNZB 5JCOA 2H3OA 4AQYO 3OGCC 2YC0A 3SPCA 4R8CA 3JAWB 5FPRA 3CC4V 1DK1A 3O9OA 4JYBA 3K5NA 4NXNO 4X1YA 3RYIB 1HNXO 4BR6A 3RYFB 2DWEC 5FPOA 5LMUB 4CH3A 3LSUA 4NR1A 5K1PA 1Y76B 3G6EV 5EZYB 4LFCB 4CH5A 1SQPH 4J7ZA 3HKBB 5KUMA 4R50A 2M7WA 4X1KB 2QJ1A 3CCUV 1WPBA 4JGSA 4D6TH 1YTFB 4OGQB 2ZKOA 1URFA 1VMGA 2UU9O 3OR6C 5HFMA 3AG3C 1SQQH 2X6BA 1BL8A 1PKXA 3G80A 3L74H 2G38A 1RSOA 4FM0A 1ZX3A 4UB6Z 2EBOA 5KLVH 1N0NA 5B1AB 1VQKV 1G8MA 1XOUA 3MD0A 1Q3EA 3FAVB 1VQNV 1FS0G 5D5QA 1HNXB 4PELA 4DRXA 4QJFB 1V9PA 3ZN0A 3SJCC 1K73W 4JPRA 2A9HA 4JTDB 1BQ0A 4FM1A 2B1IA 2BSKA 2XAJA 5LA6B 4I55B 4F6RA 2EIMC 2IU3A 4I50B 2Q8VA 1Y66A 5IDJA 1ORQC 4RAIA 3ZRWB 4JTAB 4H0LB 1SQVH 4GKKO 2PZSA 1YTFD 2CTRA 2JVDA 5HFLA 3C90A 2QTSA 4P30A 5AG2A 1QR9A 1HNWO 2ITDC 4X62O 2ZE8A 2ZD9A 1AI7A 5L3CA 2OWOA 1GTOA 2GDSA 4JAVA 4DR1O 4Z2WA 3SYAA 1QU7A 2E76B 5C93A 3E22A 1YXBA 2N74A 2ETNA 3UKMA 3K57A 1SF9A 4DW1A 2Y69B 4O2BA 2DQ3A 4O2AA 4EEQA 3U0ZA 3TJTA 2IBZH 2VS0A 3ICXA 2OT5A 4NXMB 2RJZA 1SESA 1XNQO 2WPDG 5LL6Y 1XHZA 1A32A 4ZBMA 3GWKC 1PD3A 1I94O 2DYSB 4LF4B 1UFIA 1YITV 1D2DA 4TV8A 4L8JA 4Z1VA 1K3EA 1BCCH 3VQVA 3Q4HA 2B1GA 2L6LA 3OD4A 2X7RB 4JAAA 2D3OW 1PNKA 2ZDIA 1GN3A 2R9IA 5LP6B 3D3QA 3E8HA 4DV7B 3UT5B 3G67A 2DYRC 4UV9A 3AK3A 2HKOA 3K5MA 2CTPA 1W2BU 1H2KA 3UM7A 1X59A 4QPKA 2BOBC 4IHJA 3K04A 4I4TB 2ZDIC 2WWWA 4RUEA 4P2ZA 1V55C 2IJIA 1KBHA 3BA8A 2QWRB 1XMQO 1XREA 5ITZA 4W4KA 4X20B 4JI0O 1Q81W 3L73H 1AR4A 3FB8C 3ZBHA 1VQ8V 3CP1A 1BSMA 1K4CC 4U3JA 2DW4A 2LJ2A 3BABA 4O4IA 2CAZC 4ZHQB 4DUZB 2WSSG 5KAFZ 2OCCB 3EVKA 5D5PA 3T1CA 5KA6A 2WLNA 3CC2V 4FLWA 4I5SA 3GVMA 3ABLC 1VQPV 1IBLB 5B1NA 4X65B 3JSNA 4JI8B 1XMOB 4Z1MG 3H1LH 4KXRA 4J10A 4FLTA 1Y67A 2WA4A 2DE0X 3FKSG 3OAAG 2VQFB 5B1OA 4KHPO 3CJHA 2UXDO 4B3RO 1LR1A 2W0FC 2E3CA 4AI8A 3WG7B 1J5EO 2FL4A 1N34O 1NT2B 2KG7B 2XUMA 4OX9B 4F4LA 3SJBC 1V55B 4LFAB 4WCEV 4MW8A 3VOUA 3E35A 1RFYA 2K1EA 3AEIA 2Q73A 1M90W 3ASNC 2XAFA 3CRAA 1BHBA 1VQ6V 3FYIB 2ATKC 2GSMB 2Q4PA 5KMGB 1SZXA 1Q6IA 3FB5C 4D7TA 5J2TB 5IJ0A 2UXBB 2ZR3A 3OMIB 1EFRG 1OCOB 4FVMA 2Q5ZA 3LSQA 5GTIZ 2UXDB 1R3KC 2P22C 4DR6O 3T2MA 1K92A 2ZT9B 1YJNV 4DV3O 4FM2A 3CRQA 5LA6A 2IW5A 4I55A 4F6RB 1I94B 3MHSC 2P4KA 1ENVA 3M99B 1O9HA 4XBFA 3ZRWA 3RBZA 2Y0IA 3RYHB 1Z5WA 1OCCB 2JGDB 4U7OA 1NU1H 4Q20A 2ZIMA 3DXRB 2GTSA 1F51A 2QWPB 3K03A 1AROP 4HNAA 1K9MW 2WLJA 2EIKC 5E1AC 3K58A 4R7CA 4OPAA 3ZHUA 4X66B 4DV1O 1UPGA 2YXLA 2WLIA 4NYKA 2QEXV 4K0KO 1QVFU 5JQGB 3JD0A 4LF7O 1AJPA 3AG4C 3KKYA 3KCYA 2QKCA 5CA1A 1WP8A 4YJ2A 1DLBA 3AG1B 3QNEA 3S3WA 3JALA 3OW2U 1AI6A 3AG7A 1P49A 1FPOA 1JQ0A 3SPHA 3ABMC 4PA7A 5LMUO 3JASA 2BTQB 1ZWIC 3MDSA 1TGOA 2IH3C 2YIAA 4PA3A 4IGGA 4J11A 1QVGU 4IT5A 1VIBA 5B3SB 4PDRA 4TOIA 4DV4O 3KCXA 3AG4B 3T1YO 2JK5C 1M57C 3LDEA 5LGNA 1CEZA 1FXHA 1IDSA 3P30A 4I0XB 4L87A 2OIGA 4B3MB 2R72A 3J80N 2F66C 3LSSA 3CMEV 4YJ3A 4DV4B 4TV9A 4X1KA 2JDIG 2GUZB 4RWUA 1F23A 2AZ0A 3T1HB 1FAFA 1BS3A 1E1QG 2E5LO 1P4RA 3QG5A 4FFKA 3K59A 1AI4A 1KP2A 1I5XA 3R66A 3HR0A 1CPYA 2QE7G 4J80A 4JZGA 4WBNA 3ZX6A 1RSOB 4O4HA 1AP6A 4KFMA 1SA0A 3U11A 3ZHRA 1FFTB 4CH4A 4JI4O 2E75B 1NTZH 3ABKC 5GONA 3FAVA 5LBQA 4EFBA 3E86A 4UUJC 1R1BA 1R6KA 3A0BZ 3ZRSA 3W7UA 3WU2Z 5BR8B 3JARA 3WB0A 1BMFG 3U10A 2D2CB 4GUNA 4FFBB 3B2EE 1U96A 1XILA 2FYUH 4JI5O 2ZIOA 4PJ0Z 2EIKB 4BIUA 2WA3A 3L71H 3LNMB 1VQ7V 2NR5A 1FJGO 3JAKB 4CS3A 3E2EA 1IX9A 3X2QB 1OV9A 4PA6A 1R3JC 3ZRXA 4IYHA 5J2UA 3LUTB 1GRJA 5CBGA 1WA8B 2E5LB 3ZHSA 3HPLC 2A06H 2K9PA 1AJNA 4UVBA 3ETDA 5FNVB 3ZHTA 4CH6A 3K08A 4NVPA 1HR0B 3N2GB 4JI3O 5EYPA 1YZBA 2ZE6A 1ZL8A 2PF4E 2R9RB 1W59A 4A5UB 4PDMA 2AZ2A 1JX9A 4ZIBA 1EN6A 4JI2O 1WP7A 2UU9B 1COWG 3IC7A 3SPIA 1KD1W 2EINB 3K0GA 3RN4A 3ABMB 3ZRVA 4DR7O 4DR5B 4R6ZA 3R65A 3M7MX 2WLKA 1SS3A 3BPZA 4PD4F 3AG2B 3STLC 5H2FZ 1M9NA 1MA1A 2P90A 4PV1B 4UCSA 2QM4A 1BHAA 1EN4A 2F23A 2FTKA 4TUYB 2YSUB 4DV0O 1WB8A 4J42A 2RDCA 4DRXB 4K3AA 3AG2C 5EIBC 4LF8B 1K33A 1OCZB 1VF6A 5LXTA 4C7UA 1H2MA 1OCCC 3OTOB 4FK5C 1WB7A 2V1DA 4JI7O 4DV3B 4YY3O 3ZMSA 5C8YB 4MVMA 2QWQB 3AK2A 1TVKA 3D36C 3G4SV 5EK0A 4E2LA 1WAZA 4FLUA 5JWPA 2XT9A 5H5NA 4DK0A 1GH6A 3CYOA 2W0XA 1JFFA 3CRRA 4DV6B 1XNRO 1SRYA 3ZS8C 3W7SA 2UUCB 3B8NA 3OMNB 1Y4MA 4MVRA 2LGWA 4EKWA 4JZ2A 4IIJA 3I56V 4LFBB 4FLVA 4P9OA 2YXHA 1U97A 3CE2A 1H2NA 1VQOV 5LHIA 3TGUH 2UXBO 1H8HG 3JCZA 2H94A 1YEWA 1NVPB 3RFRA 4B08A 1L0LH 1GM7A 4B7KA 1BE3H 1OCZC 4UVCA 4QNHB 4KHPB 3H1JH 1GO3F 1R73A 2W6JG 2RMKB 4LFAO 3I55V 1YJ9V 4MTFA 2ZNJA 2MW2B 1NI8A 4GX1A 1IBMO 3JSLA 2QGNA 3RYIA 4O4JB 2NN4A 3T4ZA 3CXHF 2F93B 4FLXA 2F43G 4LC1A 5KHJA 3WB2A 4EB6A 4O4LA 4DUZO 2JJ1G 4UCTA 2CGNA 4JI7B 2YIBD 3AG3B 1HWYA 5TISZ 3A8TA 3GB7C 1F7YA 1XNQB 1Q86W 4HAMA 1S0VA 2EX3A 3L75H 4CC5A 3DTUB 4GX5A 5IWAO 3ABLB 1YDXA 2DYSC 2IJHA 4X1IB 1NVPD 3JARB 4Q6GA 5GTHZ 3KG2A 3OEHG 2CDYA 2LQTA 2OCCC 2YEVA 1NR7A 5ITZB 4GKJB 2PGGA 1YIJV 4MSWC 2GTAA 4O4IB 1SERA 4DV6O 3G6BA 2ADQB 3JAKA 1HNWB 5F2VO 4NKGB 2DMXA 4DR2O 3HB3B 3HKCB 3JATA 1FFXA 5JJNB 3SDLA 1JJ2U 4FZ1A 3TK1A 4QE7A 2CH7A 4LCUC 1US6A 1XBLA 3O65A 3QTCA 2YXYA 4LF4O 2P67A 4X64B 3CCVV 1RM1C 2BTOA 3DC6A 5B66Z 4LF8O 1X4TA 1PM9A 1R6NA 3HKEB 5JJEB 1D5NA 2Q0AA 2Z0AA 2HJDA 3BRCA 4YHHO 1I08A 3L70H 3ML0A 4GZRB 5LYJB 3DSQA 3TXQA 3K79A 2ARHA 1BQZA 2OIEA 2EZPA 3W7XA 3CSXA 5KX5A 4PDVA 4X62B 4JASA 1K8AW 5J2TA 5BR8O 4YIPA 4JYCA 3ZN1A 3OT7A 4TUYA 2HHHB 2P6JA 4D7SA 4K35A 4JI4B 3JD1A 5KAIZ 1S77D 3IJ4A 2AXTZ 5LXTB 5EIBD 2VRZA 5CB4A 4HZ3A 3F5WC 2C2AA 4BAYA 2OYQA 1NTMH 2XOKG 2BOCC 4DV5B 2RNBA 1GN2A 1SQXH 2XAQA 5C8YA 5CA0B 2ZQMA 4B3SB 3CCQV 1I0HA 3B09A 1IXMA 1SC5B 3JD3A 1L8DA 2HR3A 1IURA 5H6QA 3HKBA 4WF9V 1P7GA 1K5SA 4WBNB 2Q69A 5KMGA 2ITCC 4DR4B 1HR0O 1M56C 4MS2A 4IIJB 4B3TO 3ZIAG 2EIJB 5B1BC 5GONB 1VF7A 4H33A 5KA5A 3JYCA 1WJZA 3GWOA 1DGSA 4WFBV 3ABUA 1XUQA 2HLDG 2Q7HA 1KP3A 4QIWF 1AB3A 4J7JA 3K5LA 4WFAV 1TUEB 1KU9A 3PN1A 1Q82W 1V54C 3VQYA 4QPJA 1VQ5V 1MOFA 5EC2C 1H2GA 1L1FA 1QCEA 3I5DA 4LFCO 1KMIZ 2ZM6O 2UXCB 1L0NH 1QLEC 2YIBA 3IAYA 3SYOA 4G28B 4NXNB 1AR5A 3CCEV 1G4YB 4PA9A 1LNQA 3T1HO 4LF7B 1CP9A 4FMTA 3RVZA 2N04A 3N27A 3APOA 4LWSA 1R3IC 4DR4O 2JS3A 4TT3G 1IBKB 2OTJV 2ZE7A 4X66O 4LF9O 3PJSK 4PHZA 4PDLA 2F1MA 4KP4A 2O57A 4K8ZA 5JQGA 1TUBB 1LUWA 2EJRA 1Z2GA 3QF7A 1SETA 2HG5C 2Y4UA 2GBOA 2RN9A 2PYJA 2R70A 2EIJC 5B1BB 2GUZA 5B1AC 4X20A 4ZI7A 2EULA 1G1XB 1I5YA 5J9PC 4DR3B 3AK1A 4GT1A 4X64O 1K4DC 1Q5OA 3C3TA 1NS1A 3F5TA 4MTGA 1I7FA 3VBBA 2HHHO 1NQTA 4MW3A 3HKDB 4FLZA 2QWNB 4ICGA 1FKAO 1ZTEA 2LW1A 4MT8A 3FD9A 1SQGA 3F7VC 1GK9A 3W7TA 2ZM6B 2UXCO 1N32O 1FFXB 1N8RW 2PUSA 2F4VB 1YHQV 2IH1C 2JEUA 3QVNA 4I0XA 4FFBA 4I50A 1KKDA 3K3WA 4GYCB 5JH7A 4TQFA 4MVUA 1QQCA 3CXCU 2UXNA 1R3LC 5LOVB 5LGTA 1WPXA 4GCZA 3A0RA 2KG7A 1Y76A 1DF4A 1PNLA 1RPOA 4G27B 3H9VA 1P7BA 1Y74B 4WFEA 4B3TB 4AHCA 5BMVA 4F6EA 3HKEA 2A79B 2E74B 1OCRB 1B3QA 2KKWA 5IYBO 4XDKA 3L72H 3SPGA 1NBMG 3A0HZ 2WLLB 3OFNG 3OE7G 4DV2O 2Q67A 5EYPB 3E22B 2JGUA 5LP6C 1GAXA 2XTAA 4IL6Z 2ZNIA 3CB2A 4X65O 1MSWD 4WFGA 2ZXWC 5IYDO 4LP8A 2N05A 1KKCA 2UUAB 3ETEA 3FFQA 2UXXA 3D8CA 1KECA 1YVWA 3ZMUA 5CA3A 4RQFA 4U3JB 5BY1A 1H8EG 1AILA 4BWAA 2YICA 2GV9A 1QHTA 3RYHA 1GMGA 1PP9H 1V54B 1QLEB 3B8MA 5J2UB 3DXRA 2QM8A 3ZJZA 1FXVA 4X1YB 2BSKB 1N34B 5LP6A 2X6AA 1ZAUA 1OZ0A 4MVQA 4EB6B 3J7AU 1BT8A 1XHXA 2VQFO 1KB9F 4LNUA 3H1KH 4JYAB 1G6UA 1O9GA 1JOYA 1GKFA 1XMOO 4IHJB 4LF6B 1LUVA 4YIOA 4J7KA 2DYRB 1J5EB 4GX2A 1RM1B 2EZOA 4TQDA 3QO5A 1ROPA 2YI8A 1JA8A 2V4DA 4NTWA 5B5EZ 4RQEA 5JVDA 2OTLV 1UJWB 3UCSC 4ZHQA 4U3FH 2AW9A 1EBOA 5DEDA 1XMQB 3E8FA 4NXMO 1OJHA 4DV0B 4DR2B 2XASA 1NTKH 3JASB 3HKCA 2RQ6A 3H01A 2KB1A 2XAHA 4JYAO 4MVZA 3WG7C 1HP8A 4KUMA 2M6YA 4P9PA 1TAEA 2QKAA 5LMNB 4PI0A 1EN5A 4JI0B 4RUFA 1W0JG 2YDEA 2ZCEA 4NTXA 3NXSA 4BIOA 4TV8B 2X0LA 1N33O 3P32A 4OX9O 1EZVH 3JAWA 1TUBA 4HBNA 4TV9B 4J41A 5LHHA 3TCUA 3JAMN 3JD4A 5FNVA 3QO8A 2NLJC 2RCVA 3EHBB 4LFBO 3N2GA 3UT5A 3KZIZ 2QSAA 3DC5A 3F7YC 4FJCC 1J95A 4X88A 1K34A 2CE4A 5IY5B 4O2BB 3H1IH 3MHHC 3VQXA 1IBLO 3RVYA 1HW7A 3N2KA 1H38A 4X8AA 2F95B 5A9GA 4QGPA 3D3IA 3CCMV 5KUKA 1ZUQA 4YJ2B 1PV0A 2HFEC 1PL0A 1W0KG 3CEIA 4I9WA 2HVJC 3T4DA 2FKXA 1FXKC 2LFRA 1CXZB 4YY3B 3BFRA 1RPRA 3EFFK 3FB7C 3H1HH 2IU0A 2Q9LA 4MTOA 4NTYA 2XHBA 2VQEB 4N23A 3W7WA 2YEVB 1KUQA 5L3EA 4XDLA 1XDCA 1IZ3A 1AI5A 2A0LA 1GM8A 2HP8A 3SGIA 4MVSA 5IJ9A 3OUFA 1AR1B 1TA8A 3ZCCA 5IT9N 2QR4A 1NZ6A 3L9DA 2ZE5A 5EZYA 3IGAC 3IC9A 5B3SC 3ZHQA 4FLYA 3K9AA 2PY5A 3IFXA 3ZEDA 5FLXN 2ZR2A 2DOSA 4UVAA 4B7EA 3FX7A 1BGYH 3K06A 1MABG 1Q90D 5K1XA 3OR7C 1MSDA 3RYCA 1XNRB 3CJHB 2LGQA 4G2KA 3AG1C 1EZJA 2UUAO 2Q68A 1WLEA 4LH6A 1M5IA 5LHGA 2CTWA 4CS2A 4ABMA 3OMAB 1QLNA 4ZOLA 4DV2B 3G71V 4UCVA 4DXWA 2YIDA 4DUYB 3BAAA 3BA9A 5IJ0B 1N36O 2P7TC 4LF5O 1NKDA 2ZINA 1JR9A 5KX5B 3J81N 2MK3A 5FL7G 2DN9A 4UFZA 3OM3B 2BTQA 3RGBA 2QA4V 1MZEA 3OUSA 4AILC 2CH7B 1ZLZA 4IYIA 1M57B 4LF9B 1F4MA 2YS8A 3ETQA 3OEEG 3RT3C 2LW7A 1Q6HA 4JI5B 2P06A 3B4SA 1K97A 1TVKB 2Q6AA 1VARA 2JEXA 2ILMA 4WFFA 1VF6C 1S3JA 2ODMA 2VWKA 3E83A 4YJ3B 4DK1A 5GW7A 2B9ZA 1JFFB 1PPJH 3CD6V 2LFSA 3RYFA 3JD2A 5EBMC 1K5QA 2EILC 3SYQA 4LH7A 3CS5A 4K8XA 2VWJA 2Y48A 4HYOA 1E79G 3E8GA 2VQEO 4B3MO 1SZTA 1ZL8B 4JF3A 4DUYO 4DV1B 2GHYA 4RO2A 4O2AB 4OXSA 3CCJV 1GM9A 4W4LA 1D5AA 4CS4A 1F4NA 4YHHB 3HKDA 3FYEB 5CA1B 1Q43A 2LP7A 5IY5C 5JCOC 1SQFA 3CWBH 4OPHA 1XQ8A 4DV5O 4N21A 2Y0PA 3WB1A 1P84F 2ZXWB 1S72V 3LDDA 2XNDG 4JTCB 3APQA 3FB6C 4QE9A 4DR6B 5LOVA 5CA0A 3WFVA 1VEWA 3M8AA 1T5EA 5BZBA 2JIZG 2Q0OC 1NH2D 4BW5A 2CK3G 4J9YB 1PNMA 2AGAA 5BXZA 2QTOA 3K5OA 1MMMA 3ABTA 4EFEA 4O4LB 4K0KB 1N4CA 3QO7A 2JS5A 3LDCA 4KL1A 3E89A 1VQMV 3CX5F 2B5UA 5CMUA 2KSDA 4I4TA 1ZSPA 1MNGA 3EXAA 4X89A 2FB5A 1FXKA 5IYZB 1OCRC 1VQLV 1YCIA 5A2QN 1XI1A 1AVMA 1FYJA 1WN7A 1S5HC 2DQ0A 2HVKC 1WNSA 5E79Z 1H2LA 2HEPA 4FIPC 1KYOF 4B3RB 4CZZA 1HNZO 2UUBO 5H9CA 2JJ2G 3JALB 1S76D 3T1YB 3CPWU 2EINC 2Q7GA 3K9SA 2EIMB 5EC1C 1K7DA 1IBMB 1AP5A 3ZMTA 4B3SO 3CRCA 2BE3A 5IJ9B 2WLHA 1IXBA 5L3DA 1YI2V 2HJFC 3OTFA 2P4VA 2QDOA 4JV5B 2DJVA 2L35A 1XL4A 1MG1A 2X6CA 4JI1B 2W6IG 4FPPA 2QM7A 4X9QA 2YUAA 3OGIB 4LNUB 5DN6G 5JH7B 1HDJA 3CCSV 1XEQA 1JJOA 2YI9A 1M56B 4O4JA 2IJKA 3D36A 1JMKC 5CBHA 2ADPA 1AJQA 3CHXA 2Y4TA 1SQBH 4GLXA 2Q7EA 5LMNO 5L3FA 3B40A 3SYPA 5KHIA 5KHKA 1NR1A 3SPJA 4UXNA 1NH2B 4JI1O 3ASOC 2CGOA 1B04A 3BVOA 4ZOLB 2R9AA 4MTXA 4CC6A 1JVMA 3S3XA 3ASNB 4JV5O 2PYLA 1QBZA 2AHZA 4JI8O 3P3NA 5EBWC 1IVSA 1Y6XA 1NJIW 1B06A 2PI5A 1E1RG 4X1IA 2H8PC 4LF6O 3CMAV 3ASOB 5CBFA 4NB5A 1RP3B 4JI6B 3CC7V 5CB4B 4UCOA 3LNNA 5L3GA 4JI6O 1Z5VA 3C3SA 3TETA 1M4UA 4DO2A 5LGUA 2JGDA 3BEHA 3ZHVA 2PI4A 2CUGA 1SKVA 2EJ7A 3NR7A 5DM6V 4JAUA 3JATB 5JJJB 3B77A 1QNMA 1N33B 4DYLA 3RWRD 2XAGA 3UO3A 2KQXA 2P5OA 3P3PA 2A7WA 2Y69C 2WLLA 4GKJO 4TWKA 4I9QA 2EILB 3STZC 1MZFA 2QWOB 3BHPA 1YF2A 1N32B 1BZKA 4U7NA 3CCRV 5IWAB 4UCUA 1JCHA 3N2KB 2Z5UA 3DGEA 2FMLA 5H6RA 1Q6UA 4ASUG 5IE9A 1PL4A 4MVOA 3K0DA 4JYYA 3SR2C 5L3BA 4JI2B 2BCCH 3BY6A 2IM9A 3MAQA 2QKSA 4LBEC 5IYCO 2NNUA 3A2FA 4UB8Z 1Q8IA 2PTMA 5KHGA 1DF5A 3RW0A 1VF5B 4O4HB 4CBCA 1S5LZ 2A3QA 5EBLC 2JRIA 3BCCH 2UUCO 5JVDB 4DV7O 3ZMVA 3UO2A 4BW9A 4PI2A 1M1KW 1FD9A 5DECA 4LR3A 2IJJA 1YJWV 1N0JA 4H37A 1OCOC 5KHHA 3VQWA 4YXWG 4LWSB 3X2QC 1IBKO 3Q4HB 2WLMA 2Z3YA 2F4VO 2UUBB 1VP7A 4H44B 3SJAC 1Q7YW 1KQSU 1THZA 4TSFG 1OHHG 3RYCB 1JPXA 4DR5O 3ETGA 4ZI7B 1YSCA 2LO1A 1VQ4V 1WA8A 1FXKB 5IYZA 1S5JA 1GN6A 4HNAB 1Y74A 2V7QG 1KC8W 4XDJA 5BMVB 4GX0A 1EM1A 1SA0B 1DTOA 5LYJA 4J9ZB 3TXSA 4H13B 2OCHA 3ABKB 4DR1B 2WAMA 4PA4A 2WLIB 3ZMZA 4I7ZB 3SJQC 1GN4A 1QR8A 4E4EA 1B6QA 4DR7B 2DWDC 4UCRA 3JCUZ 4BIZA 3CRMA 3CCLV 1R6TA 1M93A 4FZ0A 4DW0A 3E8BA 4ZKIA 4GKKB 4AQYB 1VQ9V 4UV8A 3SYCA 4WFHA 1FJGB 2AHYA 1N36B 4LF5B 3OTOO 5CN0A 2CTQA 1H2SB 3UQ8A 4JI3B
chains in the Genus database with same CATH topology
1M56C 1XL6A 3LSSA 3CMEV 4MS2A 1NKDA 3OGCC 3ZIAG 2EIJB 5B1BC 2JDIG 4H33A 3SPCA 5KA5A 1F23A 3JYCA 4R8CA 3GWOA 2MK3A 5FL7G 3CC4V 4WFBV 1E1QG 4JYBA 3ABUA 3OM3B 2HLDG 1P4RA 2QA4V 1KP3A 2DWEC 4QIWF 3OUSA 4WFAV 1TUEB 3G6EV 1AI4A 1KP2A 1I5XA 1Q82W 1M57B 1F4MA 1V54C 1CPYA 2QE7G 3OEEG 4QPJA 1VQ5V 5KUMA 4KFMA 4R50A 1MOFA 5EC2C 1H2GA 1FFTB 1L1FA 1K97A 2Q6AA 2JEXA 1QCEA 2M7WA 4WFFA 3ABKC 3CCUV 4JGSA 1S3JA 3E83A 1YTFB 5LBQA 1QLEC 3E86A 4UUJC 5GW7A 1R6KA 3SYOA 2LFSA 3CD6V 4G28B 3ZRSA 3JD2A 5EBMC 3W7UA 1G4YB 1K5QA 4PA9A 3CCEV 1LNQA 2EILC 3SYQA 3OR6C 5HFMA 1CP9A 3AG3C 4FMTA 3RVZA 2X6BA 1BMFG 1BL8A 1PKXA 1R3IC 2Y48A 4HYOA 1E79G 3E8GA 4TT3G 1SZTA 2OTJV 4JF3A 2EIKB 4BIUA 2EBOA 2GHYA 3LNMB 4RO2A 5B1AB 1VQ7V 1VQKV 3PJSK 4OXSA 3CCJV 1G8MA 1GM9A 3MD0A 4KP4A 4PDLA 1VQNV 3E2EA 1FS0G 3X2QB 1F4NA 2EJRA 3FYEB 1R3JC 4PA6A 3ZRXA 1SETA 2HG5C 4PELA 3LUTB 5CBGA 4QJFB 3ZN0A 2EIJC 5B1BB 1K73W 3HPLC 4JPRA 2A9HA 4JTDB 5B1AC 1AJNA 4UVBA 2LP7A 5IY5C 3ETDA 2B1IA 1I5YA 2XAJA 5J9PC 3K08A 4N21A 4GT1A 2EIMC 2IU3A 2ZXWB 1S72V 3LDDA 1K4DC 1Y66A 5IDJA 1ORQC 4RAIA 3ZRWB 2XNDG 4JTCB 2R9RB 4JTAB 3FB6C 4QE9A 4MTGA 4PDMA 3VBBA 1JX9A 1NQTA 4MW3A 1YTFD 3WFVA 5HFLA 1COWG 5BZBA 4P30A 2JIZG 3IC7A 3SPIA 2EINB 3K0GA 1KD1W 3ABMB 1NH2D 3ZRVA 4MT8A 2CK3G 4BW5A 1QR9A 4J9YB 1PNMA 3F7VC 2QTOA 2ITDC 1GK9A 3ABTA 4R6ZA 3W7TA 3R65A 2ZD9A 1AI7A 2WLKA 3QO7A 5L3CA 1N8RW 3LDCA 1GTOA 1YHQV 4JAVA 2IH1C 2JEUA 3E89A 1VQMV 3AG2B 3SYAA 2B5UA 5CMUA 1KKDA 5C93A 3STLC 3K3WA 1M9NA 4MVUA 3CXCU 2UXNA 3UKMA 1R3LC 5LGTA 4X89A 1WPXA 2Y69B 2DQ3A 2P90A 1FXKA 4GCZA 1OCRC 3A0RA 1VQLV 1BHAA 2FTKA 1S5HC 2OT5A 2YSUB 1DF4A 1PNLA 2DQ0A 2HVKC 1RPOA 1SESA 4G27B 1P7BA 4WFEA 4FIPC 3AG2C 2WPDG 2A79B 4CZZA 1OCRB 1K33A 5H9CA 1OCZB 5IYBO 4ZBMA 4XDKA 1OCCC 2JJ2G 1PD3A 3SPGA 1NBMG 2DYSB 4FK5C 2WLLB 3OFNG 2V1DA 1YITV 1S76D 3OE7G 2Q67A 3ZMSA 3CPWU 2EINC 1K3EA 4MVMA 3G4SV 2B1GA 5EK0A 4E2LA 1MSWD 4WFGA 2EIMB 2ZXWC 5IYDO 2X7RB 2D3OW 4LP8A 5EC1C 1K7DA 1PNKA 2ZDIA 3ZMTA 2R9IA 3CYOA 3ETEA 2WLHA 5L3DA 2UXXA 1YI2V 1SRYA 2HJFC 3E8HA 3W7SA 1KECA 2DYRC 4UV9A 3B8NA 3ZMUA 5CA3A 1XL4A 3OMNB 1Y4MA 1MG1A 4RQFA 4MVRA 2X6CA 2HKOA 1H8EG 4EKWA 1W2BU 2W6IG 4FPPA 2QM7A 3I56V 3UM7A 4QPKA 2BOBC 4P9OA 1GMGA 5DN6G 3K04A 1V54B 1QLEB 3B8MA 3CCSV 2ZDIC 2WWWA 4RUEA 2QM8A 4P2ZA 3ZJZA 1FXVA 1V55C 1M56B 2IJIA 1VQOV 5LHIA 2IJKA 3D36A 5CBHA 1H8HG 3JCZA 2H94A 1NVPB 1AJQA 2X6AA 1OZ0A 4MVQA 1GM7A 1OCZC 1Q81W 4UVCA 5L3FA 3SYPA 3FB8C 4QNHB 1NR1A 3SPJA 4UXNA 1NH2B 1VQ8V 3CP1A 1K4CC 3ASOC 1GO3F 2DW4A 2WSSG 4MTXA 1JVMA 1R73A 2W6JG 2OCCB 3ASNB 1GKFA 1QBZA 1JOYA 2AHZA 5EBWC 3T1CA 5KA6A 3I55V 1YJ9V 2WLNA 3CC2V 4MTFA 1NJIW 2DYRB 4I5SA 4GX1A 4GX2A 2PI5A 1RM1B 1E1RG 3ABLC 3T4ZA 2EZOA 1VQPV 2H8PC 5B1NA 2F43G 3CMAV 3QO5A 4LC1A 1ROPA 3ASOB 4Z1MG 5CBFA 2JJ1G 3CC7V 4RQEA 3AG3B 3FKSG 1HWYA 3OAAG 5L3GA 5B1OA 2OTLV 1UJWB 3TETA 4DO2A 5LGUA 3GB7C 1EBOA 3BEHA 2W0FC 2PI4A 3E8FA 1Q86W 4HAMA 1S0VA 3WG7B 5DM6V 4JAUA 2XASA 3DTUB 4GX5A 3B77A 3ABLB 4F4LA 1V55B 2XAGA 2DYSC 3H01A 2KB1A 2IJHA 4WCEV 4MW8A 1NVPD 3VOUA 2XAHA 4MVZA 3E35A 2K1EA 3AEIA 3KG2A 3OEHG 3WG7C 1M90W 2Y69C 4KUMA 3ASNC 2OCCC 1NR7A 2XAFA 2YEVA 2WLLA 4P9PA 1BHBA 4TWKA 1VQ6V 3FYIB 1YIJV 2ATKC 2GSMB 4MSWC 2EILB 4RUFA 3STZC 1W0JG 3FB5C 1SERA 3NXSA 4U7NA 3CCRV 2X0LA 3P32A 2ZR3A 1EFRG 1OCOB 3OMIB 1JCHA 2Z5UA 3DGEA 3HB3B 5H6RA 5LHHA 3TCUA 4ASUG 3LSQA 1JJ2U 3JD4A 4MVOA 3K0DA 3TK1A 5L3BA 3QO8A 1R3KC 4QE7A 2NLJC 3BY6A 3EHBB 3T2MA 4LCUC 1K92A 2QKSA 4LBEC 5IYCO 2NNUA 1YJNV 3F7YC 1DF5A 2IW5A 2P67A 3RW0A 4CBCA 3MHSC 3CCVV 1RM1C 4FJCC 1J95A 4X88A 1K34A 5EBLC 5IY5B 1ENVA 3M99B 3MHHC 3ZMVA 4XBFA 3ZRWA 3RBZA 3RVYA 1OCCB 1H38A 4X8AA 4U7OA 1M1KW 4Q20A 1R6NA 3D3IA 2IJJA 3CCMV 5KUKA 2HFEC 1F51A 1PL0A 1W0KG 1YJWV 3K03A 4H37A 1AROP 4I9WA 1OCOC 2HVJC 3T4DA 1K9MW 1FXKC 2EIKC 2LFRA 2WLJA 3ML0A 5E1AC 4R7CA 1RPRA 4YXWG 3K79A 3EFFK 3FB7C 2IU0A 4MTOA 3X2QC 4N23A 3W7WA 2YEVB 2EZPA 2WLMA 2Z3YA 5L3EA 3W7XA 4XDLA 1Q7YW 1AI5A 2A0LA 2WLIA 4PDVA 2QEXV 1GM8A 1KQSU 1QVFU 1THZA 3JD0A 4TSFG 1OHHG 1JPXA 4MVSA 4JASA 3ETGA 3OUFA 1K8AW 1AR1B 1YSCA 1AJPA 3ZCCA 4JYCA 1VQ4V 3AG4C 3ZN1A 1FXKB 3IGAC 5B3SC 1DLBA 2V7QG 1KC8W 4XDJA 2P6JA 4GX0A 3K9AA 3IFXA 1DTOA 2ZR2A 3AG1B 3JD1A 4J9ZB 1S77D 3QNEA 4UVAA 3ABKB 3OW2U 2WAMA 1AI6A 1JQ0A 3F5WC 4HZ3A 2C2AA 3K06A 1MABG 2WLIB 4PA4A 4BAYA 3OR7C 2XOKG 3ZMZA 3SJQC 3SPHA 2BOCC 1QR8A 3ABMC 4PA7A 2XAQA 1B6QA 4G2KA 3AG1C 1EZJA 2DWDC 2ZQMA 1ZWIC 2Q68A 2IH3C 4PA3A 3CCQV 4BIZA 1WLEA 1QVGU 3CCLV 5LHGA 5B3SB 4PDRA 1IXMA 3E8BA 3JD3A 4ZKIA 1VQ9V 3OMAB 1QLNA 4UV8A 3AG4B 2HR3A 4WFHA 2JK5C 1M57C 3SYCA 2AHYA 3LDEA 5H6QA 5LGNA 1CEZA 4WF9V 3G71V 1FXHA 1K5SA 4DXWA 3P30A 4L87A 5CN0A 2Q69A 2ITCC 2P7TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5S A;  2LFR A;  2P67 A;  4GCZ A;  3A0R A;  3ZRV A;  4MT8 A;  4BIZ A;  4JAU A;  3NXS A;  4FPP A;  4U7N A;  2QM7 A;  5B1N A;  4BIU A;  4GT1 A;  4LC1 A;  2FTK A;  3P32 A;  4JYB A;  4QPK A;  1IXM A;  4KP4 A;  3MD0 A;  3DGE A;  3ZRW A;  4ZKI A;  5IDJ A;  4JAV A;  3ZRW B;  2LFS A;  4MTX A;  2WWW A;  4U7O A;  4Q20 A;  2QM8 A;  5B1O A;  3TK1 A;  3ZRX A;  1JOY A;  2C2A A;  5C93 A;  4JAS A;  1F51 A;  4FMT A;  3D36 A;  3ZCC A;  4JYC A;  4QPJ A; 
#chains in the Genus database with same CATH topology
 1XL6 A;  4DR3 O;  3THO A;  1HNZ B;  5JCO A;  2H3O A;  4AQY O;  3OGC C;  2YC0 A;  3SPC A;  4R8C A;  3JAW B;  5FPR A;  3CC4 V;  1DK1 A;  3O9O A;  4JYB A;  3K5N A;  4NXN O;  4X1Y A;  3RYI B;  1HNX O;  4BR6 A;  3RYF B;  2DWE C;  5FPO A;  5LMU B;  4CH3 A;  3LSU A;  4NR1 A;  5K1P A;  1Y76 B;  3G6E V;  5EZY B;  4LFC B;  4CH5 A;  1SQP H;  4J7Z A;  3HKB B;  5KUM A;  4R50 A;  2M7W A;  4X1K B;  2QJ1 A;  3CCU V;  1WPB A;  4JGS A;  4D6T H;  1YTF B;  4OGQ B;  2ZKO A;  1URF A;  1VMG A;  2UU9 O;  3OR6 C;  5HFM A;  3AG3 C;  1SQQ H;  2X6B A;  1BL8 A;  1PKX A;  3G80 A;  3L74 H;  2G38 A;  1RSO A;  4FM0 A;  1ZX3 A;  4UB6 Z;  2EBO A;  5KLV H;  1N0N A;  5B1A B;  1VQK V;  1G8M A;  1XOU A;  3MD0 A;  1Q3E A;  3FAV B;  1VQN V;  1FS0 G;  5D5Q A;  1HNX B;  4PEL A;  4DRX A;  4QJF B;  1V9P A;  3ZN0 A;  3SJC C;  1K73 W;  4JPR A;  2A9H A;  4JTD B;  1BQ0 A;  4FM1 A;  2B1I A;  2BSK A;  2XAJ A;  5LA6 B;  4I55 B;  4F6R A;  2EIM C;  2IU3 A;  4I50 B;  2Q8V A;  1Y66 A;  5IDJ A;  1ORQ C;  4RAI A;  3ZRW B;  4JTA B;  4H0L B;  1SQV H;  4GKK O;  2PZS A;  1YTF D;  2CTR A;  2JVD A;  5HFL A;  3C90 A;  2QTS A;  4P30 A;  5AG2 A;  1QR9 A;  1HNW O;  2ITD C;  4X62 O;  2ZE8 A;  2ZD9 A;  1AI7 A;  5L3C A;  2OWO A;  1GTO A;  2GDS A;  4JAV A;  4DR1 O;  4Z2W A;  3SYA A;  1QU7 A;  2E76 B;  5C93 A;  3E22 A;  1YXB A;  2N74 A;  2ETN A;  3UKM A;  3K57 A;  1SF9 A;  4DW1 A;  2Y69 B;  4O2B A;  2DQ3 A;  4O2A A;  4EEQ A;  3U0Z A;  3TJT A;  2IBZ H;  2VS0 A;  3ICX A;  2OT5 A;  4NXM B;  2RJZ A;  1SES A;  1XNQ O;  2WPD G;  5LL6 Y;  1XHZ A;  1A32 A;  4ZBM A;  3GWK C;  1PD3 A;  1I94 O;  2DYS B;  4LF4 B;  1UFI A;  1YIT V;  1D2D A;  4TV8 A;  4L8J A;  4Z1V A;  1K3E A;  1BCC H;  3VQV A;  3Q4H A;  2B1G A;  2L6L A;  3OD4 A;  2X7R B;  4JAA A;  2D3O W;  1PNK A;  2ZDI A;  1GN3 A;  2R9I A;  5LP6 B;  3D3Q A;  3E8H A;  4DV7 B;  3UT5 B;  3G67 A;  2DYR C;  4UV9 A;  3AK3 A;  2HKO A;  3K5M A;  2CTP A;  1W2B U;  1H2K A;  3UM7 A;  1X59 A;  4QPK A;  2BOB C;  4IHJ A;  3K04 A;  4I4T B;  2ZDI C;  2WWW A;  4RUE A;  4P2Z A;  1V55 C;  2IJI A;  1KBH A;  3BA8 A;  2QWR B;  1XMQ O;  1XRE A;  5ITZ A;  4W4K A;  4X20 B;  4JI0 O;  1Q81 W;  3L73 H;  1AR4 A;  3FB8 C;  3ZBH A;  1VQ8 V;  3CP1 A;  1BSM A;  1K4C C;  4U3J A;  2DW4 A;  2LJ2 A;  3BAB A;  4O4I A;  2CAZ C;  4ZHQ B;  4DUZ B;  2WSS G;  5KAF Z;  2OCC B;  3EVK A;  5D5P A;  3T1C A;  5KA6 A;  2WLN A;  3CC2 V;  4FLW A;  4I5S A;  3GVM A;  3ABL C;  1VQP V;  1IBL B;  5B1N A;  4X65 B;  3JSN A;  4JI8 B;  1XMO B;  4Z1M G;  3H1L H;  4KXR A;  4J10 A;  4FLT A;  1Y67 A;  2WA4 A;  2DE0 X;  3FKS G;  3OAA G;  2VQF B;  5B1O A;  4KHP O;  3CJH A;  2UXD O;  4B3R O;  1LR1 A;  2W0F C;  2E3C A;  4AI8 A;  3WG7 B;  1J5E O;  2FL4 A;  1N34 O;  1NT2 B;  2KG7 B;  2XUM A;  4OX9 B;  4F4L A;  3SJB C;  1V55 B;  4LFA B;  4WCE V;  4MW8 A;  3VOU A;  3E35 A;  1RFY A;  2K1E A;  3AEI A;  2Q73 A;  1M90 W;  3ASN C;  2XAF A;  3CRA A;  1BHB A;  1VQ6 V;  3FYI B;  2ATK C;  2GSM B;  2Q4P A;  5KMG B;  1SZX A;  1Q6I A;  3FB5 C;  4D7T A;  5J2T B;  5IJ0 A;  2UXB B;  2ZR3 A;  3OMI B;  1EFR G;  1OCO B;  4FVM A;  2Q5Z A;  3LSQ A;  5GTI Z;  2UXD B;  1R3K C;  2P22 C;  4DR6 O;  3T2M A;  1K92 A;  2ZT9 B;  1YJN V;  4DV3 O;  4FM2 A;  3CRQ A;  5LA6 A;  2IW5 A;  4I55 A;  4F6R B;  1I94 B;  3MHS C;  2P4K A;  1ENV A;  3M99 B;  1O9H A;  4XBF A;  3ZRW A;  3RBZ A;  2Y0I A;  3RYH B;  1Z5W A;  1OCC B;  2JGD B;  4U7O A;  1NU1 H;  4Q20 A;  2ZIM A;  3DXR B;  2GTS A;  1F51 A;  2QWP B;  3K03 A;  1ARO P;  4HNA A;  1K9M W;  2WLJ A;  2EIK C;  5E1A C;  3K58 A;  4R7C A;  4OPA A;  3ZHU A;  4X66 B;  4DV1 O;  1UPG A;  2YXL A;  2WLI A;  4NYK A;  2QEX V;  4K0K O;  1QVF U;  5JQG B;  3JD0 A;  4LF7 O;  1AJP A;  3AG4 C;  3KKY A;  3KCY A;  2QKC A;  5CA1 A;  1WP8 A;  4YJ2 A;  1DLB A;  3AG1 B;  3QNE A;  3S3W A;  3JAL A;  3OW2 U;  1AI6 A;  3AG7 A;  1P49 A;  1FPO A;  1JQ0 A;  3SPH A;  3ABM C;  4PA7 A;  5LMU O;  3JAS A;  2BTQ B;  1ZWI C;  3MDS A;  1TGO A;  2IH3 C;  2YIA A;  4PA3 A;  4IGG A;  4J11 A;  1QVG U;  4IT5 A;  1VIB A;  5B3S B;  4PDR A;  4TOI A;  4DV4 O;  3KCX A;  3AG4 B;  3T1Y O;  2JK5 C;  1M57 C;  3LDE A;  5LGN A;  1CEZ A;  1FXH A;  1IDS A;  3P30 A;  4I0X B;  4L87 A;  2OIG A;  4B3M B;  2R72 A;  3J80 N;  2F66 C;  3LSS A;  3CME V;  4YJ3 A;  4DV4 B;  4TV9 A;  4X1K A;  2JDI G;  2GUZ B;  4RWU A;  1F23 A;  2AZ0 A;  3T1H B;  1FAF A;  1BS3 A;  1E1Q G;  2E5L O;  1P4R A;  3QG5 A;  4FFK A;  3K59 A;  1AI4 A;  1KP2 A;  1I5X A;  3R66 A;  3HR0 A;  1CPY A;  2QE7 G;  4J80 A;  4JZG A;  4WBN A;  3ZX6 A;  1RSO B;  4O4H A;  1AP6 A;  4KFM A;  1SA0 A;  3U11 A;  3ZHR A;  1FFT B;  4CH4 A;  4JI4 O;  2E75 B;  1NTZ H;  3ABK C;  5GON A;  3FAV A;  5LBQ A;  4EFB A;  3E86 A;  4UUJ C;  1R1B A;  1R6K A;  3A0B Z;  3ZRS A;  3W7U A;  3WU2 Z;  5BR8 B;  3JAR A;  3WB0 A;  1BMF G;  3U10 A;  2D2C B;  4GUN A;  4FFB B;  3B2E E;  1U96 A;  1XIL A;  2FYU H;  4JI5 O;  2ZIO A;  4PJ0 Z;  2EIK B;  4BIU A;  2WA3 A;  3L71 H;  3LNM B;  1VQ7 V;  2NR5 A;  1FJG O;  3JAK B;  4CS3 A;  3E2E A;  1IX9 A;  3X2Q B;  1OV9 A;  4PA6 A;  1R3J C;  3ZRX A;  4IYH A;  5J2U A;  3LUT B;  1GRJ A;  5CBG A;  1WA8 B;  2E5L B;  3ZHS A;  3HPL C;  2A06 H;  2K9P A;  1AJN A;  4UVB A;  3ETD A;  5FNV B;  3ZHT A;  4CH6 A;  3K08 A;  4NVP A;  1HR0 B;  3N2G B;  4JI3 O;  5EYP A;  1YZB A;  2ZE6 A;  1ZL8 A;  2PF4 E;  2R9R B;  1W59 A;  4A5U B;  4PDM A;  2AZ2 A;  1JX9 A;  4ZIB A;  1EN6 A;  4JI2 O;  1WP7 A;  2UU9 B;  1COW G;  3IC7 A;  3SPI A;  1KD1 W;  2EIN B;  3K0G A;  3RN4 A;  3ABM B;  3ZRV A;  4DR7 O;  4DR5 B;  4R6Z A;  3R65 A;  3M7M X;  2WLK A;  1SS3 A;  3BPZ A;  4PD4 F;  3AG2 B;  3STL C;  5H2F Z;  1M9N A;  1MA1 A;  2P90 A;  4PV1 B;  4UCS A;  2QM4 A;  1BHA A;  1EN4 A;  2F23 A;  2FTK A;  4TUY B;  2YSU B;  4DV0 O;  1WB8 A;  4J42 A;  2RDC A;  4DRX B;  4K3A A;  3AG2 C;  5EIB C;  4LF8 B;  1K33 A;  1OCZ B;  1VF6 A;  5LXT A;  4C7U A;  1H2M A;  1OCC C;  3OTO B;  4FK5 C;  1WB7 A;  2V1D A;  4JI7 O;  4DV3 B;  4YY3 O;  3ZMS A;  5C8Y B;  4MVM A;  2QWQ B;  3AK2 A;  1TVK A;  3D36 C;  3G4S V;  5EK0 A;  4E2L A;  1WAZ A;  4FLU A;  5JWP A;  2XT9 A;  5H5N A;  4DK0 A;  1GH6 A;  3CYO A;  2W0X A;  1JFF A;  3CRR A;  4DV6 B;  1XNR O;  1SRY A;  3ZS8 C;  3W7S A;  2UUC B;  3B8N A;  3OMN B;  1Y4M A;  4MVR A;  2LGW A;  4EKW A;  4JZ2 A;  4IIJ A;  3I56 V;  4LFB B;  4FLV A;  4P9O A;  2YXH A;  1U97 A;  3CE2 A;  1H2N A;  1VQO V;  5LHI A;  3TGU H;  2UXB O;  1H8H G;  3JCZ A;  2H94 A;  1YEW A;  1NVP B;  3RFR A;  4B08 A;  1L0L H;  1GM7 A;  4B7K A;  1BE3 H;  1OCZ C;  4UVC A;  4QNH B;  4KHP B;  3H1J H;  1GO3 F;  1R73 A;  2W6J G;  2RMK B;  4LFA O;  3I55 V;  1YJ9 V;  4MTF A;  2ZNJ A;  2MW2 B;  1NI8 A;  4GX1 A;  1IBM O;  3JSL A;  2QGN A;  3RYI A;  4O4J B;  2NN4 A;  3T4Z A;  3CXH F;  2F93 B;  4FLX A;  2F43 G;  4LC1 A;  5KHJ A;  3WB2 A;  4EB6 A;  4O4L A;  4DUZ O;  2JJ1 G;  4UCT A;  2CGN A;  4JI7 B;  2YIB D;  3AG3 B;  1HWY A;  5TIS Z;  3A8T A;  3GB7 C;  1F7Y A;  1XNQ B;  1Q86 W;  4HAM A;  1S0V A;  2EX3 A;  3L75 H;  4CC5 A;  3DTU B;  4GX5 A;  5IWA O;  3ABL B;  1YDX A;  2DYS C;  2IJH A;  4X1I B;  1NVP D;  3JAR B;  4Q6G A;  5GTH Z;  3KG2 A;  3OEH G;  2CDY A;  2LQT A;  2OCC C;  2YEV A;  1NR7 A;  5ITZ B;  4GKJ B;  2PGG A;  1YIJ V;  4MSW C;  2GTA A;  4O4I B;  1SER A;  4DV6 O;  3G6B A;  2ADQ B;  3JAK A;  1HNW B;  5F2V O;  4NKG B;  2DMX A;  4DR2 O;  3HB3 B;  3HKC B;  3JAT A;  1FFX A;  5JJN B;  3SDL A;  1JJ2 U;  4FZ1 A;  3TK1 A;  4QE7 A;  2CH7 A;  4LCU C;  1US6 A;  1XBL A;  3O65 A;  3QTC A;  2YXY A;  4LF4 O;  2P67 A;  4X64 B;  3CCV V;  1RM1 C;  2BTO A;  3DC6 A;  5B66 Z;  4LF8 O;  1X4T A;  1PM9 A;  1R6N A;  3HKE B;  5JJE B;  1D5N A;  2Q0A A;  2Z0A A;  2HJD A;  3BRC A;  4YHH O;  1I08 A;  3L70 H;  3ML0 A;  4GZR B;  5LYJ B;  3DSQ A;  3TXQ A;  3K79 A;  2ARH A;  1BQZ A;  2OIE A;  2EZP A;  3W7X A;  3CSX A;  5KX5 A;  4PDV A;  4X62 B;  4JAS A;  1K8A W;  5J2T A;  5BR8 O;  4YIP A;  4JYC A;  3ZN1 A;  3OT7 A;  4TUY A;  2HHH B;  2P6J A;  4D7S A;  4K35 A;  4JI4 B;  3JD1 A;  5KAI Z;  1S77 D;  3IJ4 A;  2AXT Z;  5LXT B;  5EIB D;  2VRZ A;  5CB4 A;  4HZ3 A;  3F5W C;  2C2A A;  4BAY A;  2OYQ A;  1NTM H;  2XOK G;  2BOC C;  4DV5 B;  2RNB A;  1GN2 A;  1SQX H;  2XAQ A;  5C8Y A;  5CA0 B;  2ZQM A;  4B3S B;  3CCQ V;  1I0H A;  3B09 A;  1IXM A;  1SC5 B;  3JD3 A;  1L8D A;  2HR3 A;  1IUR A;  5H6Q A;  3HKB A;  4WF9 V;  1P7G A;  1K5S A;  4WBN B;  2Q69 A;  5KMG A;  2ITC C;  4DR4 B;  1HR0 O;  1M56 C;  4MS2 A;  4IIJ B;  4B3T O;  3ZIA G;  2EIJ B;  5B1B C;  5GON B;  1VF7 A;  4H33 A;  5KA5 A;  3JYC A;  1WJZ A;  3GWO A;  1DGS A;  4WFB V;  3ABU A;  1XUQ A;  2HLD G;  2Q7H A;  1KP3 A;  4QIW F;  1AB3 A;  4J7J A;  3K5L A;  4WFA V;  1TUE B;  1KU9 A;  3PN1 A;  1Q82 W;  1V54 C;  3VQY A;  4QPJ A;  1VQ5 V;  1MOF A;  5EC2 C;  1H2G A;  1L1F A;  1QCE A;  3I5D A;  4LFC O;  1KMI Z;  2ZM6 O;  2UXC B;  1L0N H;  1QLE C;  2YIB A;  3IAY A;  3SYO A;  4G28 B;  4NXN B;  1AR5 A;  3CCE V;  1G4Y B;  4PA9 A;  1LNQ A;  3T1H O;  4LF7 B;  1CP9 A;  4FMT A;  3RVZ A;  2N04 A;  3N27 A;  3APO A;  4LWS A;  1R3I C;  4DR4 O;  2JS3 A;  4TT3 G;  1IBK B;  2OTJ V;  2ZE7 A;  4X66 O;  4LF9 O;  3PJS K;  4PHZ A;  4PDL A;  2F1M A;  4KP4 A;  2O57 A;  4K8Z A;  5JQG A;  1TUB B;  1LUW A;  2EJR A;  1Z2G A;  3QF7 A;  1SET A;  2HG5 C;  2Y4U A;  2GBO A;  2RN9 A;  2PYJ A;  2R70 A;  2EIJ C;  5B1B B;  2GUZ A;  5B1A C;  4X20 A;  4ZI7 A;  2EUL A;  1G1X B;  1I5Y A;  5J9P C;  4DR3 B;  3AK1 A;  4GT1 A;  4X64 O;  1K4D C;  1Q5O A;  3C3T A;  1NS1 A;  3F5T A;  4MTG A;  1I7F A;  3VBB A;  2HHH O;  1NQT A;  4MW3 A;  3HKD B;  4FLZ A;  2QWN B;  4ICG A;  1FKA O;  1ZTE A;  2LW1 A;  4MT8 A;  3FD9 A;  1SQG A;  3F7V C;  1GK9 A;  3W7T A;  2ZM6 B;  2UXC O;  1N32 O;  1FFX B;  1N8R W;  2PUS A;  2F4V B;  1YHQ V;  2IH1 C;  2JEU A;  3QVN A;  4I0X A;  4FFB A;  4I50 A;  1KKD A;  3K3W A;  4GYC B;  5JH7 A;  4TQF A;  4MVU A;  1QQC A;  3CXC U;  2UXN A;  1R3L C;  5LOV B;  5LGT A;  1WPX A;  4GCZ A;  3A0R A;  2KG7 A;  1Y76 A;  1DF4 A;  1PNL A;  1RPO A;  4G27 B;  3H9V A;  1P7B A;  1Y74 B;  4WFE A;  4B3T B;  4AHC A;  5BMV A;  4F6E A;  3HKE A;  2A79 B;  2E74 B;  1OCR B;  1B3Q A;  2KKW A;  5IYB O;  4XDK A;  3L72 H;  3SPG A;  1NBM G;  3A0H Z;  2WLL B;  3OFN G;  3OE7 G;  4DV2 O;  2Q67 A;  5EYP B;  3E22 B;  2JGU A;  5LP6 C;  1GAX A;  2XTA A;  4IL6 Z;  2ZNI A;  3CB2 A;  4X65 O;  1MSW D;  4WFG A;  2ZXW C;  5IYD O;  4LP8 A;  2N05 A;  1KKC A;  2UUA B;  3ETE A;  3FFQ A;  2UXX A;  3D8C A;  1KEC A;  1YVW A;  3ZMU A;  5CA3 A;  4RQF A;  4U3J B;  5BY1 A;  1H8E G;  1AIL A;  4BWA A;  2YIC A;  2GV9 A;  1QHT A;  3RYH A;  1GMG A;  1PP9 H;  1V54 B;  1QLE B;  3B8M A;  5J2U B;  3DXR A;  2QM8 A;  3ZJZ A;  1FXV A;  4X1Y B;  2BSK B;  1N34 B;  5LP6 A;  2X6A A;  1ZAU A;  1OZ0 A;  4MVQ A;  4EB6 B;  3J7A U;  1BT8 A;  1XHX A;  2VQF O;  1KB9 F;  4LNU A;  3H1K H;  4JYA B;  1G6U A;  1O9G A;  1JOY A;  1GKF A;  1XMO O;  4IHJ B;  4LF6 B;  1LUV A;  4YIO A;  4J7K A;  2DYR B;  1J5E B;  4GX2 A;  1RM1 B;  2EZO A;  4TQD A;  3QO5 A;  1ROP A;  2YI8 A;  1JA8 A;  2V4D A;  4NTW A;  5B5E Z;  4RQE A;  5JVD A;  2OTL V;  1UJW B;  3UCS C;  4ZHQ A;  4U3F H;  2AW9 A;  1EBO A;  5DED A;  1XMQ B;  3E8F A;  4NXM O;  1OJH A;  4DV0 B;  4DR2 B;  2XAS A;  1NTK H;  3JAS B;  3HKC A;  2RQ6 A;  3H01 A;  2KB1 A;  2XAH A;  4JYA O;  4MVZ A;  3WG7 C;  1HP8 A;  4KUM A;  2M6Y A;  4P9P A;  1TAE A;  2QKA A;  5LMN B;  4PI0 A;  1EN5 A;  4JI0 B;  4RUF A;  1W0J G;  2YDE A;  2ZCE A;  4NTX A;  3NXS A;  4BIO A;  4TV8 B;  2X0L A;  1N33 O;  3P32 A;  4OX9 O;  1EZV H;  3JAW A;  1TUB A;  4HBN A;  4TV9 B;  4J41 A;  5LHH A;  3TCU A;  3JAM N;  3JD4 A;  5FNV A;  3QO8 A;  2NLJ C;  2RCV A;  3EHB B;  4LFB O;  3N2G A;  3UT5 A;  3KZI Z;  2QSA A;  3DC5 A;  3F7Y C;  4FJC C;  1J95 A;  4X88 A;  1K34 A;  2CE4 A;  5IY5 B;  4O2B B;  3H1I H;  3MHH C;  3VQX A;  1IBL O;  3RVY A;  1HW7 A;  3N2K A;  1H38 A;  4X8A A;  2F95 B;  5A9G A;  4QGP A;  3D3I A;  3CCM V;  5KUK A;  1ZUQ A;  4YJ2 B;  1PV0 A;  2HFE C;  1PL0 A;  1W0K G;  3CEI A;  4I9W A;  2HVJ C;  3T4D A;  2FKX A;  1FXK C;  2LFR A;  1CXZ B;  4YY3 B;  3BFR A;  1RPR A;  3EFF K;  3FB7 C;  3H1H H;  2IU0 A;  2Q9L A;  4MTO A;  4NTY A;  2XHB A;  2VQE B;  4N23 A;  3W7W A;  2YEV B;  1KUQ A;  5L3E A;  4XDL A;  1XDC A;  1IZ3 A;  1AI5 A;  2A0L A;  1GM8 A;  2HP8 A;  3SGI A;  4MVS A;  5IJ9 A;  3OUF A;  1AR1 B;  1TA8 A;  3ZCC A;  5IT9 N;  2QR4 A;  1NZ6 A;  3L9D A;  2ZE5 A;  5EZY A;  3IGA C;  3IC9 A;  5B3S C;  3ZHQ A;  4FLY A;  3K9A A;  2PY5 A;  3IFX A;  3ZED A;  5FLX N;  2ZR2 A;  2DOS A;  4UVA A;  4B7E A;  3FX7 A;  1BGY H;  3K06 A;  1MAB G;  1Q90 D;  5K1X A;  3OR7 C;  1MSD A;  3RYC A;  1XNR B;  3CJH B;  2LGQ A;  4G2K A;  3AG1 C;  1EZJ A;  2UUA O;  2Q68 A;  1WLE A;  4LH6 A;  1M5I A;  5LHG A;  2CTW A;  4CS2 A;  4ABM A;  3OMA B;  1QLN A;  4ZOL A;  4DV2 B;  3G71 V;  4UCV A;  4DXW A;  2YID A;  4DUY B;  3BAA A;  3BA9 A;  5IJ0 B;  1N36 O;  2P7T C;  4LF5 O;  1NKD A;  2ZIN A;  1JR9 A;  5KX5 B;  3J81 N;  2MK3 A;  5FL7 G;  2DN9 A;  4UFZ A;  3OM3 B;  2BTQ A;  3RGB A;  2QA4 V;  1MZE A;  3OUS A;  4AIL C;  2CH7 B;  1ZLZ A;  4IYI A;  1M57 B;  4LF9 B;  1F4M A;  2YS8 A;  3ETQ A;  3OEE G;  3RT3 C;  2LW7 A;  1Q6H A;  4JI5 B;  2P06 A;  3B4S A;  1K97 A;  1TVK B;  2Q6A A;  1VAR A;  2JEX A;  2ILM A;  4WFF A;  1VF6 C;  1S3J A;  2ODM A;  2VWK A;  3E83 A;  4YJ3 B;  4DK1 A;  5GW7 A;  2B9Z A;  1JFF B;  1PPJ H;  3CD6 V;  2LFS A;  3RYF A;  3JD2 A;  5EBM C;  1K5Q A;  2EIL C;  3SYQ A;  4LH7 A;  3CS5 A;  4K8X A;  2VWJ A;  2Y48 A;  4HYO A;  1E79 G;  3E8G A;  2VQE O;  4B3M O;  1SZT A;  1ZL8 B;  4JF3 A;  4DUY O;  4DV1 B;  2GHY A;  4RO2 A;  4O2A B;  4OXS A;  3CCJ V;  1GM9 A;  4W4L A;  1D5A A;  4CS4 A;  1F4N A;  4YHH B;  3HKD A;  3FYE B;  5CA1 B;  1Q43 A;  2LP7 A;  5IY5 C;  5JCO C;  1SQF A;  3CWB H;  4OPH A;  1XQ8 A;  4DV5 O;  4N21 A;  2Y0P A;  3WB1 A;  1P84 F;  2ZXW B;  1S72 V;  3LDD A;  2XND G;  4JTC B;  3APQ A;  3FB6 C;  4QE9 A;  4DR6 B;  5LOV A;  5CA0 A;  3WFV A;  1VEW A;  3M8A A;  1T5E A;  5BZB A;  2JIZ G;  2Q0O C;  1NH2 D;  4BW5 A;  2CK3 G;  4J9Y B;  1PNM A;  2AGA A;  5BXZ A;  2QTO A;  3K5O A;  1MMM A;  3ABT A;  4EFE A;  4O4L B;  4K0K B;  1N4C A;  3QO7 A;  2JS5 A;  3LDC A;  4KL1 A;  3E89 A;  1VQM V;  3CX5 F;  2B5U A;  5CMU A;  2KSD A;  4I4T A;  1ZSP A;  1MNG A;  3EXA A;  4X89 A;  2FB5 A;  1FXK A;  5IYZ B;  1OCR C;  1VQL V;  1YCI A;  5A2Q N;  1XI1 A;  1AVM A;  1FYJ A;  1WN7 A;  1S5H C;  2DQ0 A;  2HVK C;  1WNS A;  5E79 Z;  1H2L A;  2HEP A;  4FIP C;  1KYO F;  4B3R B;  4CZZ A;  1HNZ O;  2UUB O;  5H9C A;  2JJ2 G;  3JAL B;  1S76 D;  3T1Y B;  3CPW U;  2EIN C;  2Q7G A;  3K9S A;  2EIM B;  5EC1 C;  1K7D A;  1IBM B;  1AP5 A;  3ZMT A;  4B3S O;  3CRC A;  2BE3 A;  5IJ9 B;  2WLH A;  1IXB A;  5L3D A;  1YI2 V;  2HJF C;  3OTF A;  2P4V A;  2QDO A;  4JV5 B;  2DJV A;  2L35 A;  1XL4 A;  1MG1 A;  2X6C A;  4JI1 B;  2W6I G;  4FPP A;  2QM7 A;  4X9Q A;  2YUA A;  3OGI B;  4LNU B;  5DN6 G;  5JH7 B;  1HDJ A;  3CCS V;  1XEQ A;  1JJO A;  2YI9 A;  1M56 B;  4O4J A;  2IJK A;  3D36 A;  1JMK C;  5CBH A;  2ADP A;  1AJQ A;  3CHX A;  2Y4T A;  1SQB H;  4GLX A;  2Q7E A;  5LMN O;  5L3F A;  3B40 A;  3SYP A;  5KHI A;  5KHK A;  1NR1 A;  3SPJ A;  4UXN A;  1NH2 B;  4JI1 O;  3ASO C;  2CGO A;  1B04 A;  3BVO A;  4ZOL B;  2R9A A;  4MTX A;  4CC6 A;  1JVM A;  3S3X A;  3ASN B;  4JV5 O;  2PYL A;  1QBZ A;  2AHZ A;  4JI8 O;  3P3N A;  5EBW C;  1IVS A;  1Y6X A;  1NJI W;  1B06 A;  2PI5 A;  1E1R G;  4X1I A;  2H8P C;  4LF6 O;  3CMA V;  3ASO B;  5CBF A;  4NB5 A;  1RP3 B;  4JI6 B;  3CC7 V;  5CB4 B;  4UCO A;  3LNN A;  5L3G A;  4JI6 O;  1Z5V A;  3C3S A;  3TET A;  1M4U A;  4DO2 A;  5LGU A;  2JGD A;  3BEH A;  3ZHV A;  2PI4 A;  2CUG A;  1SKV A;  2EJ7 A;  3NR7 A;  5DM6 V;  4JAU A;  3JAT B;  5JJJ B;  3B77 A;  1QNM A;  1N33 B;  4DYL A;  3RWR D;  2XAG A;  3UO3 A;  2KQX A;  2P5O A;  3P3P A;  2A7W A;  2Y69 C;  2WLL A;  4GKJ O;  4TWK A;  4I9Q A;  2EIL B;  3STZ C;  1MZF A;  2QWO B;  3BHP A;  1YF2 A;  1N32 B;  1BZK A;  4U7N A;  3CCR V;  5IWA B;  4UCU A;  1JCH A;  3N2K B;  2Z5U A;  3DGE A;  2FML A;  5H6R A;  1Q6U A;  4ASU G;  5IE9 A;  1PL4 A;  4MVO A;  3K0D A;  4JYY A;  3SR2 C;  5L3B A;  4JI2 B;  2BCC H;  3BY6 A;  2IM9 A;  3MAQ A;  2QKS A;  4LBE C;  5IYC O;  2NNU A;  3A2F A;  4UB8 Z;  1Q8I A;  2PTM A;  5KHG A;  1DF5 A;  3RW0 A;  1VF5 B;  4O4H B;  4CBC A;  1S5L Z;  2A3Q A;  5EBL C;  2JRI A;  3BCC H;  2UUC O;  5JVD B;  4DV7 O;  3ZMV A;  3UO2 A;  4BW9 A;  4PI2 A;  1M1K W;  1FD9 A;  5DEC A;  4LR3 A;  2IJJ A;  1YJW V;  1N0J A;  4H37 A;  1OCO C;  5KHH A;  3VQW A;  4YXW G;  4LWS B;  3X2Q C;  1IBK O;  3Q4H B;  2WLM A;  2Z3Y A;  2F4V O;  2UUB B;  1VP7 A;  4H44 B;  3SJA C;  1Q7Y W;  1KQS U;  1THZ A;  4TSF G;  1OHH G;  3RYC B;  1JPX A;  4DR5 O;  3ETG A;  4ZI7 B;  1YSC A;  2LO1 A;  1VQ4 V;  1WA8 A;  1FXK B;  5IYZ A;  1S5J A;  1GN6 A;  4HNA B;  1Y74 A;  2V7Q G;  1KC8 W;  4XDJ A;  5BMV B;  4GX0 A;  1EM1 A;  1SA0 B;  1DTO A;  5LYJ A;  4J9Z B;  3TXS A;  4H13 B;  2OCH A;  3ABK B;  4DR1 B;  2WAM A;  4PA4 A;  2WLI B;  3ZMZ A;  4I7Z B;  3SJQ C;  1GN4 A;  1QR8 A;  4E4E A;  1B6Q A;  4DR7 B;  2DWD C;  4UCR A;  3JCU Z;  4BIZ A;  3CRM A;  3CCL V;  1R6T A;  1M93 A;  4FZ0 A;  4DW0 A;  3E8B A;  4ZKI A;  4GKK B;  4AQY B;  1VQ9 V;  4UV8 A;  3SYC A;  4WFH A;  1FJG B;  2AHY A;  1N36 B;  4LF5 B;  3OTO O;  5CN0 A;  2CTQ A;  1H2S B;  3UQ8 A;  4JI3 B; 
#chains in the Genus database with same CATH homology
 1M56 C;  1XL6 A;  3LSS A;  3CME V;  4MS2 A;  1NKD A;  3OGC C;  3ZIA G;  2EIJ B;  5B1B C;  2JDI G;  4H33 A;  3SPC A;  5KA5 A;  1F23 A;  3JYC A;  4R8C A;  3GWO A;  2MK3 A;  5FL7 G;  3CC4 V;  4WFB V;  1E1Q G;  4JYB A;  3ABU A;  3OM3 B;  2HLD G;  1P4R A;  2QA4 V;  1KP3 A;  2DWE C;  4QIW F;  3OUS A;  4WFA V;  1TUE B;  3G6E V;  1AI4 A;  1KP2 A;  1I5X A;  1Q82 W;  1M57 B;  1F4M A;  1V54 C;  1CPY A;  2QE7 G;  3OEE G;  4QPJ A;  1VQ5 V;  5KUM A;  4KFM A;  4R50 A;  1MOF A;  5EC2 C;  1H2G A;  1FFT B;  1L1F A;  1K97 A;  2Q6A A;  2JEX A;  1QCE A;  2M7W A;  4WFF A;  3ABK C;  3CCU V;  4JGS A;  1S3J A;  3E83 A;  1YTF B;  5LBQ A;  1QLE C;  3E86 A;  4UUJ C;  5GW7 A;  1R6K A;  3SYO A;  2LFS A;  3CD6 V;  4G28 B;  3ZRS A;  3JD2 A;  5EBM C;  3W7U A;  1G4Y B;  1K5Q A;  4PA9 A;  3CCE V;  1LNQ A;  2EIL C;  3SYQ A;  3OR6 C;  5HFM A;  1CP9 A;  3AG3 C;  4FMT A;  3RVZ A;  2X6B A;  1BMF G;  1BL8 A;  1PKX A;  1R3I C;  2Y48 A;  4HYO A;  1E79 G;  3E8G A;  4TT3 G;  1SZT A;  2OTJ V;  4JF3 A;  2EIK B;  4BIU A;  2EBO A;  2GHY A;  3LNM B;  4RO2 A;  5B1A B;  1VQ7 V;  1VQK V;  3PJS K;  4OXS A;  3CCJ V;  1G8M A;  1GM9 A;  3MD0 A;  4KP4 A;  4PDL A;  1VQN V;  3E2E A;  1FS0 G;  3X2Q B;  1F4N A;  2EJR A;  3FYE B;  1R3J C;  4PA6 A;  3ZRX A;  1SET A;  2HG5 C;  4PEL A;  3LUT B;  5CBG A;  4QJF B;  3ZN0 A;  2EIJ C;  5B1B B;  1K73 W;  3HPL C;  4JPR A;  2A9H A;  4JTD B;  5B1A C;  1AJN A;  4UVB A;  2LP7 A;  5IY5 C;  3ETD A;  2B1I A;  1I5Y A;  2XAJ A;  5J9P C;  3K08 A;  4N21 A;  4GT1 A;  2EIM C;  2IU3 A;  2ZXW B;  1S72 V;  3LDD A;  1K4D C;  1Y66 A;  5IDJ A;  1ORQ C;  4RAI A;  3ZRW B;  2XND G;  4JTC B;  2R9R B;  4JTA B;  3FB6 C;  4QE9 A;  4MTG A;  4PDM A;  3VBB A;  1JX9 A;  1NQT A;  4MW3 A;  1YTF D;  3WFV A;  5HFL A;  1COW G;  5BZB A;  4P30 A;  2JIZ G;  3IC7 A;  3SPI A;  2EIN B;  3K0G A;  1KD1 W;  3ABM B;  1NH2 D;  3ZRV A;  4MT8 A;  2CK3 G;  4BW5 A;  1QR9 A;  4J9Y B;  1PNM A;  3F7V C;  2QTO A;  2ITD C;  1GK9 A;  3ABT A;  4R6Z A;  3W7T A;  3R65 A;  2ZD9 A;  1AI7 A;  2WLK A;  3QO7 A;  5L3C A;  1N8R W;  3LDC A;  1GTO A;  1YHQ V;  4JAV A;  2IH1 C;  2JEU A;  3E89 A;  1VQM V;  3AG2 B;  3SYA A;  2B5U A;  5CMU A;  1KKD A;  5C93 A;  3STL C;  3K3W A;  1M9N A;  4MVU A;  3CXC U;  2UXN A;  3UKM A;  1R3L C;  5LGT A;  4X89 A;  1WPX A;  2Y69 B;  2DQ3 A;  2P90 A;  1FXK A;  4GCZ A;  1OCR C;  3A0R A;  1VQL V;  1BHA A;  2FTK A;  1S5H C;  2OT5 A;  2YSU B;  1DF4 A;  1PNL A;  2DQ0 A;  2HVK C;  1RPO A;  1SES A;  4G27 B;  1P7B A;  4WFE A;  4FIP C;  3AG2 C;  2WPD G;  2A79 B;  4CZZ A;  1OCR B;  1K33 A;  5H9C A;  1OCZ B;  5IYB O;  4ZBM A;  4XDK A;  1OCC C;  2JJ2 G;  1PD3 A;  3SPG A;  1NBM G;  2DYS B;  4FK5 C;  2WLL B;  3OFN G;  2V1D A;  1YIT V;  1S76 D;  3OE7 G;  2Q67 A;  3ZMS A;  3CPW U;  2EIN C;  1K3E A;  4MVM A;  3G4S V;  2B1G A;  5EK0 A;  4E2L A;  1MSW D;  4WFG A;  2EIM B;  2ZXW C;  5IYD O;  2X7R B;  2D3O W;  4LP8 A;  5EC1 C;  1K7D A;  1PNK A;  2ZDI A;  3ZMT A;  2R9I A;  3CYO A;  3ETE A;  2WLH A;  5L3D A;  2UXX A;  1YI2 V;  1SRY A;  2HJF C;  3E8H A;  3W7S A;  1KEC A;  2DYR C;  4UV9 A;  3B8N A;  3ZMU A;  5CA3 A;  1XL4 A;  3OMN B;  1Y4M A;  1MG1 A;  4RQF A;  4MVR A;  2X6C A;  2HKO A;  1H8E G;  4EKW A;  1W2B U;  2W6I G;  4FPP A;  2QM7 A;  3I56 V;  3UM7 A;  4QPK A;  2BOB C;  4P9O A;  1GMG A;  5DN6 G;  3K04 A;  1V54 B;  1QLE B;  3B8M A;  3CCS V;  2ZDI C;  2WWW A;  4RUE A;  2QM8 A;  4P2Z A;  3ZJZ A;  1FXV A;  1V55 C;  1M56 B;  2IJI A;  1VQO V;  5LHI A;  2IJK A;  3D36 A;  5CBH A;  1H8H G;  3JCZ A;  2H94 A;  1NVP B;  1AJQ A;  2X6A A;  1OZ0 A;  4MVQ A;  1GM7 A;  1OCZ C;  1Q81 W;  4UVC A;  5L3F A;  3SYP A;  3FB8 C;  4QNH B;  1NR1 A;  3SPJ A;  4UXN A;  1NH2 B;  1VQ8 V;  3CP1 A;  1K4C C;  3ASO C;  1GO3 F;  2DW4 A;  2WSS G;  4MTX A;  1JVM A;  1R73 A;  2W6J G;  2OCC B;  3ASN B;  1GKF A;  1QBZ A;  1JOY A;  2AHZ A;  5EBW C;  3T1C A;  5KA6 A;  3I55 V;  1YJ9 V;  2WLN A;  3CC2 V;  4MTF A;  1NJI W;  2DYR B;  4I5S A;  4GX1 A;  4GX2 A;  2PI5 A;  1RM1 B;  1E1R G;  3ABL C;  3T4Z A;  2EZO A;  1VQP V;  2H8P C;  5B1N A;  2F43 G;  3CMA V;  3QO5 A;  4LC1 A;  1ROP A;  3ASO B;  4Z1M G;  5CBF A;  2JJ1 G;  3CC7 V;  4RQE A;  3AG3 B;  3FKS G;  1HWY A;  3OAA G;  5L3G A;  5B1O A;  2OTL V;  1UJW B;  3TET A;  4DO2 A;  5LGU A;  3GB7 C;  1EBO A;  3BEH A;  2W0F C;  2PI4 A;  3E8F A;  1Q86 W;  4HAM A;  1S0V A;  3WG7 B;  5DM6 V;  4JAU A;  2XAS A;  3DTU B;  4GX5 A;  3B77 A;  3ABL B;  4F4L A;  1V55 B;  2XAG A;  2DYS C;  3H01 A;  2KB1 A;  2IJH A;  4WCE V;  4MW8 A;  1NVP D;  3VOU A;  2XAH A;  4MVZ A;  3E35 A;  2K1E A;  3AEI A;  3KG2 A;  3OEH G;  3WG7 C;  1M90 W;  2Y69 C;  4KUM A;  3ASN C;  2OCC C;  1NR7 A;  2XAF A;  2YEV A;  2WLL A;  4P9P A;  1BHB A;  4TWK A;  1VQ6 V;  3FYI B;  1YIJ V;  2ATK C;  2GSM B;  4MSW C;  2EIL B;  4RUF A;  3STZ C;  1W0J G;  3FB5 C;  1SER A;  3NXS A;  4U7N A;  3CCR V;  2X0L A;  3P32 A;  2ZR3 A;  1EFR G;  1OCO B;  3OMI B;  1JCH A;  2Z5U A;  3DGE A;  3HB3 B;  5H6R A;  5LHH A;  3TCU A;  4ASU G;  3LSQ A;  1JJ2 U;  3JD4 A;  4MVO A;  3K0D A;  3TK1 A;  5L3B A;  3QO8 A;  1R3K C;  4QE7 A;  2NLJ C;  3BY6 A;  3EHB B;  3T2M A;  4LCU C;  1K92 A;  2QKS A;  4LBE C;  5IYC O;  2NNU A;  1YJN V;  3F7Y C;  1DF5 A;  2IW5 A;  2P67 A;  3RW0 A;  4CBC A;  3MHS C;  3CCV V;  1RM1 C;  4FJC C;  1J95 A;  4X88 A;  1K34 A;  5EBL C;  5IY5 B;  1ENV A;  3M99 B;  3MHH C;  3ZMV A;  4XBF A;  3ZRW A;  3RBZ A;  3RVY A;  1OCC B;  1H38 A;  4X8A A;  4U7O A;  1M1K W;  4Q20 A;  1R6N A;  3D3I A;  2IJJ A;  3CCM V;  5KUK A;  2HFE C;  1F51 A;  1PL0 A;  1W0K G;  1YJW V;  3K03 A;  4H37 A;  1ARO P;  4I9W A;  1OCO C;  2HVJ C;  3T4D A;  1K9M W;  1FXK C;  2EIK C;  2LFR A;  2WLJ A;  3ML0 A;  5E1A C;  4R7C A;  1RPR A;  4YXW G;  3K79 A;  3EFF K;  3FB7 C;  2IU0 A;  4MTO A;  3X2Q C;  4N23 A;  3W7W A;  2YEV B;  2EZP A;  2WLM A;  2Z3Y A;  5L3E A;  3W7X A;  4XDL A;  1Q7Y W;  1AI5 A;  2A0L A;  2WLI A;  4PDV A;  2QEX V;  1GM8 A;  1KQS U;  1QVF U;  1THZ A;  3JD0 A;  4TSF G;  1OHH G;  1JPX A;  4MVS A;  4JAS A;  3ETG A;  3OUF A;  1K8A W;  1AR1 B;  1YSC A;  1AJP A;  3ZCC A;  4JYC A;  1VQ4 V;  3AG4 C;  3ZN1 A;  1FXK B;  3IGA C;  5B3S C;  1DLB A;  2V7Q G;  1KC8 W;  4XDJ A;  2P6J A;  4GX0 A;  3K9A A;  3IFX A;  1DTO A;  2ZR2 A;  3AG1 B;  3JD1 A;  4J9Z B;  1S77 D;  3QNE A;  4UVA A;  3ABK B;  3OW2 U;  2WAM A;  1AI6 A;  1JQ0 A;  3F5W C;  4HZ3 A;  2C2A A;  3K06 A;  1MAB G;  2WLI B;  4PA4 A;  4BAY A;  3OR7 C;  2XOK G;  3ZMZ A;  3SJQ C;  3SPH A;  2BOC C;  1QR8 A;  3ABM C;  4PA7 A;  2XAQ A;  1B6Q A;  4G2K A;  3AG1 C;  1EZJ A;  2DWD C;  2ZQM A;  1ZWI C;  2Q68 A;  2IH3 C;  4PA3 A;  3CCQ V;  4BIZ A;  1WLE A;  1QVG U;  3CCL V;  5LHG A;  5B3S B;  4PDR A;  1IXM A;  3E8B A;  3JD3 A;  4ZKI A;  1VQ9 V;  3OMA B;  1QLN A;  4UV8 A;  3AG4 B;  2HR3 A;  4WFH A;  2JK5 C;  1M57 C;  3SYC A;  2AHY A;  3LDE A;  5H6Q A;  5LGN A;  1CEZ A;  4WF9 V;  3G71 V;  1FXH A;  1K5S A;  4DXW A;  3P30 A;  4L87 A;  5CN0 A;  2Q69 A;  2ITC C;  2P7T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...