3ZRWB

The structure of the dimeric hamp-dhp fusion a291v mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
110
structure length
110
Chain Sequence
STITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQQADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords AF1503 PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ
total genus 42
structure length 110
sequence length 110
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrwB00
4MTXA 3ZRXA 2LFSA 4GCZA 4LC1A 4ZKIA 1JOYA 2C2AA 5B1OA 3DGEA 4BIUA 3A0RA 1IXMA 2QM7A 2WWWA 3NXSA 3P32A 4U7OA 2QM8A 4Q20A 3ZRWB 3D36A 3TK1A 5C93A 4QPKA 4KP4A 4GT1A 4I5SA 4JAUA 4FMTA 2FTKA 4FPPA 1F51A 4BIZA 3ZRWA 5B1NA 3MD0A 4U7NA 5IDJA 2LFRA 4JASA 4MT8A 3ZCCA 3ZRVA 4JYBA 4JYCA 4QPJA 2P67A 4JAVA
chains in the Genus database with same CATH superfamily
2A9HA 3WU2Z 1JR9A 2CTWA 4UFZA 1J5EO 1SKVA 1BE3H 2RJZA 2VQEB 4DR3O 3BA8A 4FLZA 4DR4B 2Z0AA 1I94B 3T1YO 2JS3A 3AG2C 1TGOA 1VP7A 1MA1A 5LGNA 2XAFA 2PGGA 3T1HO 3EVKA 4LF9B 1CEZA 1H8EG 3OM3B 5JQGA 3RW0A 1YEWA 4CS2A 2QKCA 1N8RW 4AQYB 2ZDIA 4UCRA 1NT2B 1X59A 1XEQA 4AHCA 4UXNA 3D36C 3EHBB 5A9GA 1VQ9V 1VQ8V 3ZHSA 3GWKC 4B3MO 1HNWO 1EFRG 1GN6A 1PNMA 2Q8VA 4I4TB 3QVNA 5LBQA 3G6EV 4JYYA 4IYHA 1Q86W 2LJ2A 4DR7O 3ZHQA 3ZRSA 4O4LB 4EEQA 3G80A 4WF9V 3JD1A 3LSQA 1CXZB 2MK3A 4H44B 3CX5F 3H1LH 4YHHO 2YIAA 1Q82W 5IYCO 1GRJA 2UXBO 3NR7A 5IE9A 4DR3B 4DV5O 5HFLA 2QWRB 3LNMB 2IH1C 4XDLA 1YJWV 3I55V 1FAFA 3ZIAG 5FLXN 3CRRA 4U3JB 4JV5O 3TXSA 5FNVA 1SA0A 4UVCA 2F23A 2EIKC 1ZTEA 4MW3A 4B7KA 1NVPD 5KX5A 5GONB 4LBEC 1HNZO 2IJIA 3AG4C 1KP2A 4RO2A 2LGQA 2ZM6O 4WFEA 3ETGA 3SJBC 3H1JH 3QO8A 1FXKC 3B8NA 4YIPA 3E2EA 1P7GA 3ML0A 3T4ZA 4DO2A 2V1DA 4BW9A 4ZKIA 5KHHA 4BIUA 4EFEA 4UVBA 4RQFA 1TUEB 2MW2B 3ZN1A 2RCVA 3CCQV 4IT5A 4JV5B 2ZE6A 4WBNA 2UXCO 4O4IB 2E76B 3RYFA 5LHGA 2PI4A 5BR8O 1D5AA 4WFAV 3W7TA 2KSDA 2DQ3A 2O57A 2DMXA 4J7JA 1I0HA 3VQXA 1N0JA 5IWAB 3JAKA 5F2VO 1NS1A 2PYJA 1JQ0A 3JYCA 4JTDB 1QCEA 5IJ0A 3BCCH 4JASA 2ZM6B 4JI8O 4XDJA 2QKAA 1H2MA 2WAMA 1QNMA 1SQBH 3CXCU 4CH5A 4CZZA 2CGNA 1KYOF 5IY5C 3D3IA 1RP3B 3JASA 3B2EE 4NXNO 1NVPB 5D5QA 3CCLV 3OTFA 1JA8A 2N74A 2HVKC 3H9VA 2QWNB 3ZRXA 4NXNB 2WLIB 4X20B 4LF8O 1U96A 3OD4A 1G4YB 4DV3B 3AG4B 4RUEA 1LUWA 4DUYO 2CGOA 2YI9A 2UXBB 4FFKA 1GTOA 3BABA 2AZ2A 3W7SA 3A2FA 1W59A 1OZ0A 3OMIB 3RYCB 1XMOO 3K57A 2XNDG 4ICGA 5EBLC 2GDSA 4DV0O 1B6QA 4LC1A 4L8JA 3VQWA 4DR6O 4DR2B 2EJRA 4DR4O 2LP7A 4MTOA 4YY3B 4YJ3B 2P90A 1AR1B 3VQVA 2YIBD 2XASA 3CCSV 1NJIW 5BR8B 3OFNG 3CCEV 4JI1O 4G28B 1N36B 3AK3A 4UCUA 5CB4A 2IM9A 2WA3A 3J81N 4MTGA 1HW7A 1N34O 3U10A 1VF6A 3T1HB 3HKDA 1PNKA 4F6RB 1JVMA 1I5XA 4LFCO 4Z2WA 1EN4A 1NTMH 3QNEA 1SQQH 1VEWA 5CA1A 1GK9A 2R72A 1THZA 2QWQB 1Q8IA 1US6A 5JCOC 2B1IA 3K9AA 1K3EA 4O2AA 4DK1A 1FJGB 3CJHB 1NR1A 4EB6A 1O9GA 2KQXA 3WB0A 2GUZA 1GM7A 3UT5B 3G67A 3ZN0A 3HKBB 2YIDA 5B1BC 4I55B 1HNXB 4DYLA 3ABKB 4K8ZA 2H94A 1GM9A 2IU0A 3RYIA 1PKXA 3W7UA 1W2BU 4I7ZB 3K58A 5BY1A 1YSCA 4X64O 1ZAUA 3W7XA 4FK5C 1RPOA 1ZL8B 4DR1O 1YXBA 2WLLA 5LXTA 4KP4A 4RQEA 1L0LH 2P4KA 3CYOA 1AB3A 2WLKA 5CBFA 1RPRA 5CA0B 3DTUB 3G4SV 4R6ZA 1COWG 2QWPB 1ZLZA 3JCZA 3H1IH 2GHYA 3B4SA 1BZKA 1FXHA 4UV9A 1Z2GA 1WPBA 3LNNA 4JAAA 5IT9N 2ZE7A 2P22C 2Z5UA 3ZHTA 1VMGA 2YSUB 5EZYB 4LF7O 2X6AA 1BT8A 1XBLA 2IU3A 2HP8A 4JYAO 2Z3YA 4FVMA 1R73A 4LNUA 2PF4E 1NH2D 3SYQA 1S72V 1HDJA 1BSMA 1OJHA 1N32O 3LSUA 4UCSA 3ASNC 1XMOB 1L8DA 2BTQB 2W0FC 4MVMA 1V54C 4NB5A 5J2TB 1XREA 4FLTA 3ZBHA 1MZFA 4R50A 1XQ8A 3ETDA 1AI5A 2QM4A 4X64B 2P7TC 1RSOA 4UCOA 4X89A 1X4TA 2F66C 1WA8A 4O2BB 1P84F 1FFTB 4PDLA 2UXCB 3A0BZ 2DYSC 1Q6UA 5L3FA 5JH7A 4D7SA 3CC2V 1SA0B 5IY5B 1TVKB 2OCHA 1GN4A 1BHBA 3RBZA 3KCYA 2N05A 1EBOA 3O65A 4JTCB 3TGUH 5KHIA 5IJ9B 3TJTA 1R3LC 2YEVB 4L87A 2HVJC 4JI6B 4DK0A 4X1IB 1VQKV 3N27A 1AP6A 5IYBO 2YXYA 2D2CB 4W4KA 5CBHA 4B3SO 4IYIA 3SYAA 1FFXA 1QR8A 1GH6A 2DOSA 4FPPA 2EINC 4H0LB 4PDVA 4IHJB 2IH3C 5L3CA 3WG7B 4QGPA 1BL8A 4B3RB 2JEXA 4X1IA 2QEXV 3GWOA 2YS8A 3D36A 1NKDA 3E22B 1YITV 1OCZB 3K06A 3FFQA 4TV8B 4BIZA 1IX9A 3SPIA 2UU9B 2ZNIA 2Q0OC 4O4JB 1XNRO 1KUQA 4KUMA 4TQFA 1GAXA 2VRZA 1N32B 1XDCA 1KBHA 4G27B 2NR5A 1OCRC 2WLHA 5K1PA 1IBLO 1S5JA 5B5EZ 4DR7B 5TISZ 3OMNB 2CTPA 1BCCH 4GX2A 4ZI7A 2UUCB 2RDCA 4TV9A 4LF7B 2VQFO 3OUFA 3JAMN 2CE4A 4X1KA 4B3MB 1VQNV 3KG2A 1K7DA 1RFYA 4NYKA 1E1QG 2W0XA 4GCZA 2HHHO 5EZYA 3MDSA 3O9OA 3BFRA 2GV9A 2ZQMA 4DV7O 1VQ6V 2ATKC 2E3CA 3FB8C 1SC5B 3CP1A 2Q7EA 3J7AU 1Q7YW 1YIJV 5EYPB 4O4HA 1Y67A 2EIJC 3FX7A 1YTFB 4X1YA 5E1AC 3CMAV 2OTJV 2R70A 1VQPV 3AG3C 5LHIA 2A79B 5B1BB 4JAUA 1G6UA 3N2GB 1F51A 3OEHG 3ABKC 3ZJZA 5B3SC 3X2QB 5DEDA 5LOVB 4LP8A 4BW5A 1E1RG 5JQGB 4PV1B 1P49A 1JFFB 3I56V 4MS2A 1B04A 3P3PA 3P32A 1AJPA 1S5HC 3BVOA 3B77A 3C90A 1AI4A 1NI8A 5ITZB 2NLJC 4JI2B 2ILMA 3ASOC 1UJWB 4X66O 4YXWG 5CBGA 4JZ2A 1QLNA 3T1YB 4WFBV 5JJEB 2Y48A 3A0RA 1V9PA 1MSDA 2JGDA 4P9OA 1SZXA 3R65A 1WJZA 3LDCA 4GX5A 3FB7C 4PI2A 3SR2C 5JVDA 1XNQB 5D5PA 4GYCB 3CJHA 1RSOB 5GTIZ 1S3JA 5EIBC 2EILC 3K5LA 3ABTA 3CCMV 4JI5O 4XBFA 1SF9A 4DUZO 3FB5C 3JARA 4X1YB 1MOFA 2PTMA 2Y69C 5LMUO 2R9AA 4YY3O 2X7RB 4GZRB 4MVRA 4DR6B 3B8MA 1S77D 4AILC 2JVDA 2KG7B 5L3BA 3CCVV 3QG5A 3W7WA 3EXAA 1OCOC 1WP7A 3N2GA 1K5QA 1V54B 2BCCH 3ZMZA 2E5LO 3EFFK 2UXNA 5KA5A 2QTSA 1DGSA 5BMVA 5B1AC 3ABMC 2FB5A 3L71H 3ZMUA 1YTFD 1P7BA 4J11A 3E8BA 5EIBD 4DUYB 1N33B 1V55B 1M4UA 1M57C 3ZX6A 4NXMO 3OUSA 1ENVA 4MVOA 3KKYA 1KECA 4CC5A 3C3TA 5KX5B 2UUCO 1JCHA 1KP3A 4HZ3A 2C2AA 2DYRC 1ORQC 3FB6C 3CS5A 3CCRV 3B40A 3E35A 2CUGA 2AHZA 2ODMA 5LA6B 1MMMA 2PYLA 1JMKC 4JI8B 3Q4HB 3OEEG 2N04A 5JVDB 2K1EA 4PELA 4YIOA 1QLEB 2IJJA 4LFAO 2Q0AA 3E8GA 2UU9O 1R3IC 3APOA 5H6QA 1W0JG 2E74B 4IIJA 4J9YB 4WBNB 4Z1MG 3OT7A 3UO3A 2B1GA 5LMUB 3RYCA 2P4VA 3CC4V 4LF6O 4E4EA 4R8CA 3CRCA 4GT1A 2ZDIC 3F7VC 2W6JG 2OTLV 2KG7A 4FZ0A 4PA3A 1UPGA 2F95B 1M90W 1MG1A 4KL1A 1M9NA 1I08A 2WLJA 2ZIOA 1K4DC 2Q73A 1DK1A 4DV2O 1GMGA 5H9CA 2NNUA 3MHSC 3ETEA 4N21A 4O2BA 4F6RA 1XILA 4J80A 3FAVA 2HLDG 2AZ0A 1XUQA 3WFVA 3P3NA 2ARHA 1EM1A 3N2KA 3E83A 1EN5A 4RAIA 4MVQA 5LMNO 5HFMA 2HJDA 5B1AB 2YI8A 2QM8A 4UCVA 2PI5A 3OAAG 2EIKB 2UUBO 4X62B 4MVUA 5IJ0B 4OX9O 2EZOA 1SQGA 5KMGA 1K92A 2OT5A 3M99B 2Q9LA 4TWKA 4IGGA 4UV8A 2ZR3A 2ITDC 4P30A 1Y74B 4DRXB 3JAWA 2Q68A 5B3SB 2GSMB 1NH2B 4DXWA 3APQA 3CCJV 1F4NA 4DV1B 1SQVH 4NKGB 1M93A 4P9PA 2ETNA 3RT3C 1GM8A 1VQ4V 2P6JA 2WLIA 4X20A 2XUMA 1YJ9V 1TA8A 1F4MA 4ZBMA 4YJ2A 3HKEA 4X1KB 2PUSA 2EIMC 2BTQA 4O4JA 5EBWC 1LNQA 2EZPA 2HR3A 1Y6XA 1XOUA 4JYAB 5KMGB 3U11A 4Q6GA 3ZRWA 4CH4A 2EJ7A 1QHTA 4QNHB 1YF2A 1JJ2U 3VOUA 1R6TA 4NVPA 1K33A 1N0NA 3ZMSA 1JPXA 3OR7C 1K9MW 4FLYA 1MNGA 1EN6A 2YICA 5C8YA 2R9IA 3UT5A 1XMQO 1ZSPA 4G2KA 4I5SA 1AI7A 4LFBB 2FTKA 4LF9O 1LUVA 1XHZA 3JSNA 1JX9A 1AP5A 1XL6A 3SJCC 3RYIB 3UKMA 2RQ6A 4JAVA 4LWSB 2ZKOA 2OCCB 3MAQA 4X65O 2F93B 2KB1A 3QTCA 3ICXA 4I55A 3FKSG 1G8MA 3HKDB 3R66A 3CRQA 4Z1VA 5KHGA 1K4CC 3TXQA 3SGIA 2ZIMA 4WFGA 2VS0A 2L35A 1N4CA 2YC0A 4DW1A 1KB9F 4U3FH 3BHPA 1EZJA 4B3TB 1DLBA 2QWOB 3K08A 4ZOLA 3K59A 1KQSU 5C93A 1K5SA 2XAHA 4JI0B 5KHKA 3LDEA 3WB2A 3IC7A 4JI7O 4B7EA 4A5UB 4OPAA 1KMIZ 3TCUA 4U3JA 1KD1W 4PA4A 3TETA 1WN7A 2DWDC 4I9WA 4MW8A 3OMAB 4DV4B 1TUBA 4BIOA 5K1XA 4PDRA 3ABUA 2A7WA 3QF7A 1QBZA 1VQMV 1NQTA 1J95A 3RN4A 3JATB 4I50A 1N36O 1O9HA 2WLMA 1IXBA 3H1HH 4PA7A 1VARA 4JI1B 2CTRA 3OTOB 4B08A 4LNUB 2P67A 1DF4A 2YXHA 3N2KB 2UXDO 3JALA 4N23A 2F4VO 4ABMA 2UUAO 3HPLC 1HP8A 2F43G 4FFBA 4K0KO 2XAJA 3K9SA 1MSWD 2FYUH 2X6BA 2BSKA 4X65B 5KUMA 3FAVB 3SPCA 4ZOLB 5H5NA 5CA3A 4YHHB 2XAGA 4ASUG 3RFRA 2XHBA 4GKKB 3E89A 1QVGU 4DV1O 3F5TA 2OCCC 2Q7GA 4AI8A 3CPWU 2DN9A 3VQYA 3LSSA 1R1BA 2QTOA 1H38A 4X9QA 5H6RA 4EB6B 2HHHB 4WFFA 3HKCB 1FXKA 4PA9A 1SS3A 2CH7A 2WPDG 2RNBA 4PHZA 3JAWB 3FYEB 1Q6IA 3OGCC 3SYCA 4MVSA 3BY6A 1SQFA 2CK3G 3A8TA 2AW9A 3NXSA 2ZD9A 4DR5O 4Q20A 1NZ6A 2EX3A 2H8PC 3K79A 4PI0A 1FD9A 4RUFA 2VWJA 2YEVA 3A0HZ 2E75B 2LGWA 2YDEA 4CC6A 3ZHVA 1VQ7V 4EKWA 1M56C 2GUZB 2WSSG 4NTXA 3RYHA 1IBKB 4JI2O 3QO7A 3U0ZA 3JD3A 1MABG 2RN9A 5KAFZ 1EZVH 4X88A 4ZHQA 1HR0B 3H1KH 4FZ1A 2F1MA 1E79G 1Q43A 1R3JC 1QVFU 3BA9A 2AGAA 4DR1B 1IXMA 1F23A 1H2NA 4EFBA 1DTOA 3DXRA 5LOVA 3HKBA 4MTFA 1K97A 3K3WA 2XOKG 1XI1A 3HKCA 5LP6A 2LQTA 2BOCC 1QLEC 4JI5B 4FLWA 3RWRD 1TVKA 1IDSA 2YUAA 3CC7V 5J2UB 1VF7A 4I0XA 5B1OA 4C7UA 4GX1A 1ROPA 2UXXA 3SYPA 5KLVH 1KU9A 5EC1C 4BAYA 1F7YA 5LMNB 1WLEA 4NTWA 2BTOA 1VIBA 1FXKB 1SQPH 4LFAB 1UFIA 3QO5A 4D6TH 1FXVA 4JI6O 1GKFA 2LO1A 3JCUZ 4JYBA 1VF6C 1WAZA 5FNVB 5E79Z 4DV6O 1PM9A 3K5NA 1W0KG 3CRMA 5L3GA 4TV9B 2V4DA 2D3OW 4TUYA 1YVWA 4PDMA 4B3TO 4TV8A 3S3WA 2YXLA 2OIGA 2DJVA 1AI6A 4WFHA 4UCTA 2GTAA 2G38A 3F7YC 5EC2C 2A06H 2QDOA 4HYOA 2QJ1A 4KHPO 1Y76B 2ZE5A 3OE7G 1BQ0A 2JS5A 1GN2A 5LHHA 4F4LA 2ADQB 4GKKO 2EINB 1S5LZ 2DE0X 3IGAC 2PZSA 4I4TA 1OCCB 3RVYA 3BRCA 3CHXA 3VBBA 2XAQA 4KXRA 4OXSA 1G1XB 2KKWA 4FLVA 1NTKH 3E8HA 2IJKA 2Q4PA 4TT3G 2VWKA 4IHJA 3J80N 2F4VB 1SESA 5FL7G 3AG1B 3PJSK 1Q81W 1WPXA 5B66Z 1QQCA 4IIJB 2GTSA 3OTOO 4MSWC 3ZCCA 4JYCA 1MZEA 5CA1B 1BHAA 1RM1C 2LFSA 5CA0A 2WA4A 1OHHG 4NR1A 4K35A 2CTQA 1N33O 3CMEV 5IJ9A 1Q90D 1AJNA 3ETQA 2ZR2A 2FL4A 5J9PC 4X66B 3JD0A 1H2LA 3HB3B 1K8AW 1YDXA 3CSXA 5LL6Y 2JGDB 4HAMA 2OYQA 1B3QA 1XL4A 1OV9A 2X0LA 2VQEO 4R7CA 1FYJA 2XTAA 1M56B 3L74H 1J5EB 5H2FZ 1YCIA 4JGSA 3IAYA 4FMTA 4DV2B 2UXDB 2FMLA 2HFEC 1Q6HA 4FM0A 4BWAA 1RM1B 3WB1A 4JPRA 3STLC 1VQLV 1H8HG 1ZX3A 4CH6A 3M8AA 2QKSA 4OPHA 3DGEA 3S3XA 1Q5OA 5L3DA 4TQDA 3STZC 4ZI7B 4CH3A 5GONA 1HR0O 3AG3B 1D5NA 4LFCB 1OCCC 3KZIZ 3LUTB 2JRIA 4HNAB 4CS3A 1IBKO 4ZIBA 4J9ZB 5GTHZ 4QE7A 4FM2A 1SQXH 3CCUV 4W4LA 3L70H 3B09A 1PL4A 2HJFC 1CP9A 3OR6C 4FJCC 1Z5WA 4KFMA 3ZMTA 1BS3A 3DXRB 4DRXA 3DSQA 2X6CA 2P06A 3SPJA 2DQ0A 5BZBA 5IDJA 2BSKB 4O4LA 2Q7HA 3ZMVA 4JI4B 4TOIA 2WLNA 2P5OA 4LF6B 4JI3B 5J2UA 2HKOA 4DV5B 1SRYA 2QR4A 1Q3EA 1U97A 5IYZB 1FPOA 4QE9A 3K5MA 2QA4V 2RMKB 1A32A 2HEPA 2ZXWC 3BEHA 1P4RA 1LR1A 3KCXA 1H2SB 5KA6A 3G6BA 2E5LB 1WB8A 2A3QA 1ZUQA 1BGYH 2EILB 2JK5C 1JFFA 4H37A 2DYSB 3CWBH 3DC5A 1B06A 1T5EA 3UO2A 3HR0A 3K5OA 3ZRWB 1IBMB 4DV3O 3Q4HA 4QPKA 3CEIA 3CD6V 4O2AB 3ZHRA 3JASB 1S76D 2Q5ZA 1WP8A 2JEUA 3JAKB 2Y0PA 1PL0A 5LXTB 2IBZH 3L75H 1H2KA 1IBLB 2BE3A 1WB7A 1FKAO 1PP9H 2QGNA 3SPHA 3ABLB 4QJFB 2Y0IA 4GKJO 4MT8A 4LF5B 2AHYA 1SZTA 1PPJH 2ITCC 3RVZA 3WG7C 5JJJB 2ZINA 5KUKA 4JI7B 2YIBA 4CS4A 1WNSA 3IFXA 4P2ZA 5J2TA 2WWWA 4O4IA 2M7WA 4K0KB 3E86A 1KKDA 5LYJB 4LCUC 3RGBA 3T4DA 1K73W 2EIJB 1VF5B 5JJNB 3CXHF 4GLXA 5IYDO 3JARB 5BXZA 3GB7C 2K9PA 4DW0A 4X62O 5CB4B 4OX9B 1NU1H 3JD2A 5JH7B 5KAIZ 3AK2A 3AG1C 2ZXWB 4NTYA 2DW4A 2ZNJA 5DN6G 4K8XA 4GX0A 4FLUA 4DV0B 3X2QC 2R9RB 1NR7A 4LR3A 2Q69A 1OCOB 4GKJB 1TUBB 4LFBO 1XHXA 1H2GA 1S0VA 4E2LA 2Y4UA 4DR5B 1AROP 4UVAA 1YZBA 2EIMB 2PY5A 4PA6A 5LP6C 1R6KA 1ZL8A 4U7NA 2JDIG 2W6IG 3ASOB 3AEIA 3ZS8C 1Y74A 2GBOA 2ZE8A 1L0NH 3IJ4A 3UM7A 4FM1A 1R6NA 3C3SA 1JOYA 1FS0G 4FLXA 4LF4O 3SDLA 4H13B 1IURA 1GO3F 3T1CA 1IVSA 3L73H 1PD3A 4J42A 5DECA 3BPZA 4J7KA 2DWEC 1JJOA 4J41A 1D2DA 5IWAO 1YHQV 1XMQB 2HG5C 1ZWIC 4DV7B 4ZHQB 1OCZC 4LF4B 1QU7A 4JI3O 4FIPC 4LF8B 4IL6Z 4JI4O 5A2QN 1PV0A 4YJ3A 3F5WC 3CRAA 4QIWF 2JGUA 5C8YB 1SERA 5IYZA 5GW7A 3IC9A 5L3EA 4NXMB 3CB2A 1AJQA 3G71V 4OGQB 5JCOA 1Y66A 1M5IA 1BQZA 1VQOV 5CN0A 1I5YA 3SJQC 5EBMC 3K04A 2Y69B 4LH7A 4YJ2B 4MTXA 3HKEB 3LDDA 3FD9A 4MVZA 1YJNV 1N34B 5FPRA 5LP6B 1YI2V 2IJHA 1AVMA 1IZ3A 2DYRB 2V7QG 3L72H 3UCSC 3GVMA 2Q67A 4B3RO 3D8CA 3SJAC 2JJ1G 4TUYB 3DC6A 1NBMG 4FFBB 3JALB 1KKCA 1BMFG 1XNQO 2UUBB 2QE7G 3I5DA 2Q6AA 1L1FA 4UUJC 4B3SB 1K34A 3K0GA 2H3OA 1M1KW 3SPGA 5LYJA 4RWUA 2WLLB 4LF5O 2JIZG 4K3AA 5KHJA 2NN4A 1AR5A 4J10A 4XDKA 2CH7B 4U7OA 3PN1A 3E22A 5JWPA 3JD4A 5B1NA 3OW2U 4BR6A 1HNWB 2VQFB 2CAZC 4UB8Z 4GUNA 5CMUA 4LWSA 5ITZA 1VQ5V 3L9DA 4AQYO 2EULA 3RYHB 1IBMO 4X8AA 3ABLC 4F6EA 2A0LA 3TK1A 4DR2O 3OGIB 5AG2A 4LH6A 3UQ8A 4H33A 2EBOA 1URFA 2FKXA 5LGUA 3ZEDA 2B5UA 2BOBC 1KC8W 2OWOA 1Y76A 4TSFG 3E8FA 5LGTA 1NTZH 3CE2A 1TAEA 3AG2B 3M7MX 1AILA 4QPJA 3BAAA 4WCEV 3SYOA 3JSLA 1I94O 3D3QA 3FYIB 1M57B 3ZHUA 1WA8B 2AXTZ 4KHPB 1QR9A 4O4HB 4UB6Z 3H01A 3T2MA 4JTAB 1Z5VA 2UUAB 2QSAA 5EK0A 4DUZB 2LW7A 3K0DA 1PNLA 2CDYA 2Y4TA 1R3KC 2ZCEA 2L6LA 2LW1A 1HNXO 5BMVB 4PD4F 2OIEA 1HWYA 2ADPA 1SETA 2XT9A 1V55C 5EYPA 1FJGO 2QM7A 3RYFB 2IW5A 4DV4O 4JZGA 3AG7A 5LA6A 3JATA 4I50B 4DV6B 5FPOA 3K03A 4JF3A 1I7FA 3MHHC 2LFRA 4J7ZA 1XNRB 1Y4MA 1OCRB 1CPYA 4I0XB 4D7TA 2JJ2G 1AR4A 4JI0O 3AK1A 1HNZB 4HBNA 4PJ0Z 3THOA 2B9ZA 3P30A 4HNAA 4I9QA 2M6YA 1FFXB 5DM6V 1GN3A 3MD0A 3ABMB 2ZT9B 3ZRVA 4CBCA 1DF5A 3ASNB
chains in the Genus database with same CATH topology
2A9HA 2DYSC 3ZMSA 1JPXA 3ZMVA 5L3FA 3OR7C 2WLNA 1K9MW 3CC2V 5IY5B 2HKOA 1SRYA 2R9IA 1BHBA 3RBZA 1EBOA 4JTCB 4G2KA 4QE9A 4I5SA 1AI7A 2FTKA 2QA4V 3AG2C 2ZXWC 1JX9A 1R3LC 2YEVB 3BEHA 1P4RA 2HVJC 1XL6A 4L87A 5LGNA 5KA6A 3UKMA 4JAVA 1VQKV 2XAFA 2OCCB 5IYBO 2EILB 2JK5C 4H37A 1CEZA 1H8EG 3OM3B 2DYSB 2KB1A 5CBHA 3RW0A 3SYAA 3FKSG 3ZRWB 1G8MA 1N8RW 1QR8A 2ZDIA 4QPKA 3CD6V 1K4CC 4FPPA 2EINC 4PDVA 4UXNA 1S76D 2IH3C 2JEUA 3EHBB 1VQ9V 1PL0A 1VQ8V 5L3CA 3WG7B 4WFGA 1BL8A 1EFRG 1PNMA 5LBQA 2JEXA 3G6EV 2QEXV 3GWOA 1Q86W 1EZJA 1DLBA 3K08A 3ZRSA 3D36A 1KQSU 5C93A 1K5SA 1NKDA 2XAHA 1YITV 3LDEA 1OCZB 4WF9V 3K06A 3SPHA 3IC7A 3ABLB 4BIZA 3SPIA 4QJFB 3JD1A 3LSQA 2MK3A 4MT8A 2AHYA 4KUMA 1SZTA 2ITCC 3RVZA 3TCUA 3WG7C 5KUKA 1KD1W 1Q82W 4PA4A 3TETA 5IYCO 2DWDC 4I9WA 4MW8A 3OMAB 3IFXA 4P2ZA 4G27B 4PDRA 1OCRC 2WLHA 3ABUA 2WWWA 2M7WA 1QBZA 5HFLA 1VQMV 1NQTA 3LNMB 3OMNB 4GX2A 3E86A 1J95A 2IH1C 4XDLA 1KKDA 1YJWV 3I55V 3ZIAG 2WLMA 3OUFA 4LCUC 3T4DA 1K73W 4PA7A 1VQNV 2EIJB 3KG2A 2P67A 1K7DA 5IYDO 1DF4A 3GB7C 1E1QG 4N23A 4GCZA 4UVCA 3HPLC 2EIKC 4MW3A 1NVPD 2F43G 3JD2A 2XAJA 2ZQMA 1MSWD 4LBEC 3AG1C 2X6BA 2ZXWB 1VQ6V 2ATKC 2DW4A 5DN6G 2IJIA 4GX0A 3FB8C 3X2QC 3AG4C 5KUMA 1KP2A 4RO2A 2R9RB 3CP1A 1NR7A 3SPCA 4WFEA 3ETGA 5CA3A 1Q7YW 3QO8A 1YIJV 2Q69A 2XAGA 1FXKC 1OCOB 3B8NA 4ASUG 3E89A 3E2EA 1QVGU 2EIJC 1YTFB 5E1AC 3ML0A 3T4ZA 4DO2A 3CMAV 2V1DA 2OTJV 4ZKIA 2OCCC 3CPWU 1H2GA 4BIUA 1VQPV 4E2LA 1S0VA 4UVBA 3LSSA 2QTOA 4RQFA 1AROP 1H38A 4UVAA 3AG3C 5H6RA 1TUEB 5LHIA 2A79B 5B1BB 2EIMB 3ZN1A 4WFFA 4JAUA 3CCQV 1FXKA 3OEHG 1F51A 4PA6A 3ABKC 3ZJZA 1R6KA 4PA9A 5B3SC 3X2QB 2WPDG 4U7NA 2JDIG 2W6IG 3ASOB 4LP8A 5LHGA 4BW5A 3FYEB 2PI4A 3AEIA 1E1RG 3OGCC 3SYCA 4MVSA 3BY6A 3UM7A 4WFAV 3W7TA 1R6NA 2CK3G 3I56V 4MS2A 1JOYA 2DQ3A 1FS0G 3NXSA 3P32A 2ZD9A 1AJPA 1S5HC 3K79A 2H8PC 4Q20A 4RUFA 2YEVA 1VQ7V 1GO3F 3B77A 3T1CA 4EKWA 1M56C 1AI4A 1JQ0A 1PD3A 3JYCA 4JTDB 2WSSG 1QCEA 3QO7A 3JD3A 1MABG 4JASA 2NLJC 4X88A 2DWEC 3ASOC 1UJWB 1E79G 1R3JC 4YXWG 5CBGA 1QVFU 1YHQV 4XDJA 1QLNA 2HG5C 4WFBV 1ZWIC 2Y48A 3A0RA 1IXMA 2WAMA 1F23A 1OCZC 4P9OA 1DTOA 3R65A 3CXCU 4FIPC 4CZZA 3LDCA 5IY5C 4GX5A 3D3IA 3FB7C 4MTFA 1K97A 3K3WA 2XOKG 1NVPB 3F5WC 2BOCC 1QLEC 1S3JA 2EILC 3CCLV 3ABTA 4QIWF 1SERA 3CCMV 2HVKC 4XBFA 5GW7A 3CC7V 3FB5C 3ZRXA 2WLIB 5L3EA 1AJQA 3G71V 1MOFA 5B1OA 1Y66A 1G4YB 2Y69C 4GX1A 1ROPA 3AG4B 2UXXA 3SYPA 2X7RB 4RUEA 4MVRA 1VQOV 3B8MA 5CN0A 5EC1C 1S77D 1I5YA 4BAYA 5L3BA 1GTOA 3CCVV 1WLEA 3W7SA 3W7WA 3SJQC 5EBMC 1FXKB 1OCOC 1K5QA 1V54B 3QO5A 3ZMZA 3EFFK 1FXVA 1OZ0A 1GKFA 2UXNA 3K04A 3OMIB 4JYBA 5KA5A 2Y69B 2XNDG 5EBLC 4MTXA 5B1AC 3ABMC 1B6QA 3LDDA 4LC1A 4MVZA 3ZMUA 1W0KG 1YTFD 1P7BA 3E8BA 2EJRA 1V55B 5L3GA 1YJNV 2LP7A 4MTOA 2D3OW 1YI2V 2P90A 4PDMA 1M57C 1AR1B 2IJHA 2DYRB 2V7QG 3OUSA 2XASA 2Q67A 3CCSV 1NJIW 1ENVA 4MVOA 1KECA 1AI6A 2JJ1G 3OFNG 3CCEV 1NBMG 4WFHA 4G28B 3F7YC 5EC2C 1JCHA 1KP3A 1BMFG 4HZ3A 2C2AA 4HYOA 2QE7G 2DYRC 1L1FA 2Q6AA 1ORQC 3FB6C 4MTGA 3OE7G 4UUJC 3CCRV 1K34A 3K0GA 3E35A 2AHZA 1M1KW 3SPGA 5LHHA 4F4LA 1PNKA 3OEEG 1JVMA 1I5XA 2WLLB 2K1EA 2JIZG 4PELA 2EINB 1QLEB 3QNEA 2IJJA 3IGAC 3E8GA 1R3IC 1GK9A 5H6QA 1THZA 1OCCB 1W0JG 3RVYA 3VBBA 4XDKA 2XAQA 4J9YB 4OXSA 4U7OA 4Z1MG 2B1GA 2B1IA 3K9AA 1K3EA 3E8HA 3CC4V 4R8CA 2IJKA 4GT1A 4TT3G 1NR1A 2ZDIC 3F7VC 1SESA 1GM7A 2W6JG 2OTLV 5FL7G 3ZN0A 3AG1B 3PJSK 3JD4A 1Q81W 1WPXA 5B1BC 4PA3A 5B1NA 3OW2U 4MSWC 3ZCCA 1M90W 1MG1A 1M9NA 3ABKB 4JYCA 2WLJA 1K4DC 2H94A 5CMUA 1BHAA 1GM9A 2IU0A 1RM1C 2LFSA 1OHHG 1GMGA 1PKXA 5H9CA 2NNUA 3W7UA 1W2BU 1VQ5V 3MHSC 3ETEA 4N21A 1YSCA 3W7XA 4X8AA 3ABLC 4FK5C 2A0LA 1RPOA 3TK1A 3CMEV 2HLDG 2WLLA 1AJNA 4KP4A 2ZR2A 4H33A 5J9PC 2EBOA 3JD0A 4RQEA 3WFVA 3CYOA 3HB3B 5LGUA 1KC8W 2B5UA 2BOBC 1K8AW 2WLKA 4TSFG 3E8FA 5LGTA 3AG2B 4QPJA 4WCEV 3E83A 5CBFA 4HAMA 1RPRA 1XL4A 4RAIA 4MVQA 3DTUB 3G4SV 4R6ZA 5HFMA 3SYOA 1COWG 3FYIB 1M57B 5B1AB 1QR9A 2QM8A 2X0LA 4R7CA 2PI5A 3JCZA 3OAAG 2EIKB 3H01A 3T2MA 4JTAB 1M56B 2GHYA 4MVUA 4JGSA 2EZOA 4FMTA 1FXHA 4UV9A 5EK0A 1K92A 3K0DA 1PNLA 2OT5A 2HFEC 3M99B 1R3KC 2Z5UA 1RM1B 2YSUB 4TWKA 2X6AA 4JPRA 3STLC 1HWYA 1VQLV 1H8HG 1SETA 2IU3A 1V55C 2QKSA 2Z3YA 1R73A 3DGEA 4UV8A 1NH2D 2QM7A 2ZR3A 2ITDC 3SYQA 4P30A 1S72V 2Q68A 5B3SB 2IW5A 2GSMB 5L3DA 1NH2B 4DXWA 3STZC 3CCJV 1F4NA 3ASNC 3AG3B 3K03A 4JF3A 3MHHC 1OCCC 2LFRA 2W0FC 3LUTB 4P9PA 4MVMA 1GM8A 1VQ4V 2P6JA 2WLIA 1Y4MA 1OCRB 1YJ9V 1CPYA 1V54C 2JJ2G 1F4MA 4J9ZB 4ZBMA 4QE7A 4R50A 3CCUV 3ETDA 2EIMC 1AI5A 3P30A 5EBWC 1LNQA 2HJFC 2P7TC 1CP9A 2EZPA 2HR3A 3OR6C 4FJCC 4KFMA 4X89A 3ZMTA 3ZRWA 5DM6V 4QNHB 2X6CA 1JJ2U 3MD0A 3SPJA 2DQ0A 3ABMB 1FFTB 4PDLA 5BZBA 5IDJA 3ZRVA 4CBCA 1DF5A 3VOUA 3ASNB 1K33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTX A;  3ZRX A;  2LFS A;  4GCZ A;  4LC1 A;  4ZKI A;  1JOY A;  2C2A A;  5B1O A;  3DGE A;  4BIU A;  3A0R A;  1IXM A;  2QM7 A;  2WWW A;  3NXS A;  3P32 A;  4U7O A;  2QM8 A;  4Q20 A;  3ZRW B;  3D36 A;  3TK1 A;  5C93 A;  4QPK A;  4KP4 A;  4GT1 A;  4I5S A;  4JAU A;  4FMT A;  2FTK A;  4FPP A;  1F51 A;  4BIZ A;  3ZRW A;  5B1N A;  3MD0 A;  4U7N A;  5IDJ A;  2LFR A;  4JAS A;  4MT8 A;  3ZCC A;  3ZRV A;  4JYB A;  4JYC A;  4QPJ A;  2P67 A;  4JAV A; 
#chains in the Genus database with same CATH topology
 2A9H A;  3WU2 Z;  1JR9 A;  2CTW A;  4UFZ A;  1J5E O;  1SKV A;  1BE3 H;  2RJZ A;  2VQE B;  4DR3 O;  3BA8 A;  4FLZ A;  4DR4 B;  2Z0A A;  1I94 B;  3T1Y O;  2JS3 A;  3AG2 C;  1TGO A;  1VP7 A;  1MA1 A;  5LGN A;  2XAF A;  2PGG A;  3T1H O;  3EVK A;  4LF9 B;  1CEZ A;  1H8E G;  3OM3 B;  5JQG A;  3RW0 A;  1YEW A;  4CS2 A;  2QKC A;  1N8R W;  4AQY B;  2ZDI A;  4UCR A;  1NT2 B;  1X59 A;  1XEQ A;  4AHC A;  4UXN A;  3D36 C;  3EHB B;  5A9G A;  1VQ9 V;  1VQ8 V;  3ZHS A;  3GWK C;  4B3M O;  1HNW O;  1EFR G;  1GN6 A;  1PNM A;  2Q8V A;  4I4T B;  3QVN A;  5LBQ A;  3G6E V;  4JYY A;  4IYH A;  1Q86 W;  2LJ2 A;  4DR7 O;  3ZHQ A;  3ZRS A;  4O4L B;  4EEQ A;  3G80 A;  4WF9 V;  3JD1 A;  3LSQ A;  1CXZ B;  2MK3 A;  4H44 B;  3CX5 F;  3H1L H;  4YHH O;  2YIA A;  1Q82 W;  5IYC O;  1GRJ A;  2UXB O;  3NR7 A;  5IE9 A;  4DR3 B;  4DV5 O;  5HFL A;  2QWR B;  3LNM B;  2IH1 C;  4XDL A;  1YJW V;  3I55 V;  1FAF A;  3ZIA G;  5FLX N;  3CRR A;  4U3J B;  4JV5 O;  3TXS A;  5FNV A;  1SA0 A;  4UVC A;  2F23 A;  2EIK C;  1ZTE A;  4MW3 A;  4B7K A;  1NVP D;  5KX5 A;  5GON B;  4LBE C;  1HNZ O;  2IJI A;  3AG4 C;  1KP2 A;  4RO2 A;  2LGQ A;  2ZM6 O;  4WFE A;  3ETG A;  3SJB C;  3H1J H;  3QO8 A;  1FXK C;  3B8N A;  4YIP A;  3E2E A;  1P7G A;  3ML0 A;  3T4Z A;  4DO2 A;  2V1D A;  4BW9 A;  4ZKI A;  5KHH A;  4BIU A;  4EFE A;  4UVB A;  4RQF A;  1TUE B;  2MW2 B;  3ZN1 A;  2RCV A;  3CCQ V;  4IT5 A;  4JV5 B;  2ZE6 A;  4WBN A;  2UXC O;  4O4I B;  2E76 B;  3RYF A;  5LHG A;  2PI4 A;  5BR8 O;  1D5A A;  4WFA V;  3W7T A;  2KSD A;  2DQ3 A;  2O57 A;  2DMX A;  4J7J A;  1I0H A;  3VQX A;  1N0J A;  5IWA B;  3JAK A;  5F2V O;  1NS1 A;  2PYJ A;  1JQ0 A;  3JYC A;  4JTD B;  1QCE A;  5IJ0 A;  3BCC H;  4JAS A;  2ZM6 B;  4JI8 O;  4XDJ A;  2QKA A;  1H2M A;  2WAM A;  1QNM A;  1SQB H;  3CXC U;  4CH5 A;  4CZZ A;  2CGN A;  1KYO F;  5IY5 C;  3D3I A;  1RP3 B;  3JAS A;  3B2E E;  4NXN O;  1NVP B;  5D5Q A;  3CCL V;  3OTF A;  1JA8 A;  2N74 A;  2HVK C;  3H9V A;  2QWN B;  3ZRX A;  4NXN B;  2WLI B;  4X20 B;  4LF8 O;  1U96 A;  3OD4 A;  1G4Y B;  4DV3 B;  3AG4 B;  4RUE A;  1LUW A;  4DUY O;  2CGO A;  2YI9 A;  2UXB B;  4FFK A;  1GTO A;  3BAB A;  2AZ2 A;  3W7S A;  3A2F A;  1W59 A;  1OZ0 A;  3OMI B;  3RYC B;  1XMO O;  3K57 A;  2XND G;  4ICG A;  5EBL C;  2GDS A;  4DV0 O;  1B6Q A;  4LC1 A;  4L8J A;  3VQW A;  4DR6 O;  4DR2 B;  2EJR A;  4DR4 O;  2LP7 A;  4MTO A;  4YY3 B;  4YJ3 B;  2P90 A;  1AR1 B;  3VQV A;  2YIB D;  2XAS A;  3CCS V;  1NJI W;  5BR8 B;  3OFN G;  3CCE V;  4JI1 O;  4G28 B;  1N36 B;  3AK3 A;  4UCU A;  5CB4 A;  2IM9 A;  2WA3 A;  3J81 N;  4MTG A;  1HW7 A;  1N34 O;  3U10 A;  1VF6 A;  3T1H B;  3HKD A;  1PNK A;  4F6R B;  1JVM A;  1I5X A;  4LFC O;  4Z2W A;  1EN4 A;  1NTM H;  3QNE A;  1SQQ H;  1VEW A;  5CA1 A;  1GK9 A;  2R72 A;  1THZ A;  2QWQ B;  1Q8I A;  1US6 A;  5JCO C;  2B1I A;  3K9A A;  1K3E A;  4O2A A;  4DK1 A;  1FJG B;  3CJH B;  1NR1 A;  4EB6 A;  1O9G A;  2KQX A;  3WB0 A;  2GUZ A;  1GM7 A;  3UT5 B;  3G67 A;  3ZN0 A;  3HKB B;  2YID A;  5B1B C;  4I55 B;  1HNX B;  4DYL A;  3ABK B;  4K8Z A;  2H94 A;  1GM9 A;  2IU0 A;  3RYI A;  1PKX A;  3W7U A;  1W2B U;  4I7Z B;  3K58 A;  5BY1 A;  1YSC A;  4X64 O;  1ZAU A;  3W7X A;  4FK5 C;  1RPO A;  1ZL8 B;  4DR1 O;  1YXB A;  2WLL A;  5LXT A;  4KP4 A;  4RQE A;  1L0L H;  2P4K A;  3CYO A;  1AB3 A;  2WLK A;  5CBF A;  1RPR A;  5CA0 B;  3DTU B;  3G4S V;  4R6Z A;  1COW G;  2QWP B;  1ZLZ A;  3JCZ A;  3H1I H;  2GHY A;  3B4S A;  1BZK A;  1FXH A;  4UV9 A;  1Z2G A;  1WPB A;  3LNN A;  4JAA A;  5IT9 N;  2ZE7 A;  2P22 C;  2Z5U A;  3ZHT A;  1VMG A;  2YSU B;  5EZY B;  4LF7 O;  2X6A A;  1BT8 A;  1XBL A;  2IU3 A;  2HP8 A;  4JYA O;  2Z3Y A;  4FVM A;  1R73 A;  4LNU A;  2PF4 E;  1NH2 D;  3SYQ A;  1S72 V;  1HDJ A;  1BSM A;  1OJH A;  1N32 O;  3LSU A;  4UCS A;  3ASN C;  1XMO B;  1L8D A;  2BTQ B;  2W0F C;  4MVM A;  1V54 C;  4NB5 A;  5J2T B;  1XRE A;  4FLT A;  3ZBH A;  1MZF A;  4R50 A;  1XQ8 A;  3ETD A;  1AI5 A;  2QM4 A;  4X64 B;  2P7T C;  1RSO A;  4UCO A;  4X89 A;  1X4T A;  2F66 C;  1WA8 A;  4O2B B;  1P84 F;  1FFT B;  4PDL A;  2UXC B;  3A0B Z;  2DYS C;  1Q6U A;  5L3F A;  5JH7 A;  4D7S A;  3CC2 V;  1SA0 B;  5IY5 B;  1TVK B;  2OCH A;  1GN4 A;  1BHB A;  3RBZ A;  3KCY A;  2N05 A;  1EBO A;  3O65 A;  4JTC B;  3TGU H;  5KHI A;  5IJ9 B;  3TJT A;  1R3L C;  2YEV B;  4L87 A;  2HVJ C;  4JI6 B;  4DK0 A;  4X1I B;  1VQK V;  3N27 A;  1AP6 A;  5IYB O;  2YXY A;  2D2C B;  4W4K A;  5CBH A;  4B3S O;  4IYI A;  3SYA A;  1FFX A;  1QR8 A;  1GH6 A;  2DOS A;  4FPP A;  2EIN C;  4H0L B;  4PDV A;  4IHJ B;  2IH3 C;  5L3C A;  3WG7 B;  4QGP A;  1BL8 A;  4B3R B;  2JEX A;  4X1I A;  2QEX V;  3GWO A;  2YS8 A;  3D36 A;  1NKD A;  3E22 B;  1YIT V;  1OCZ B;  3K06 A;  3FFQ A;  4TV8 B;  4BIZ A;  1IX9 A;  3SPI A;  2UU9 B;  2ZNI A;  2Q0O C;  4O4J B;  1XNR O;  1KUQ A;  4KUM A;  4TQF A;  1GAX A;  2VRZ A;  1N32 B;  1XDC A;  1KBH A;  4G27 B;  2NR5 A;  1OCR C;  2WLH A;  5K1P A;  1IBL O;  1S5J A;  5B5E Z;  4DR7 B;  5TIS Z;  3OMN B;  2CTP A;  1BCC H;  4GX2 A;  4ZI7 A;  2UUC B;  2RDC A;  4TV9 A;  4LF7 B;  2VQF O;  3OUF A;  3JAM N;  2CE4 A;  4X1K A;  4B3M B;  1VQN V;  3KG2 A;  1K7D A;  1RFY A;  4NYK A;  1E1Q G;  2W0X A;  4GCZ A;  2HHH O;  5EZY A;  3MDS A;  3O9O A;  3BFR A;  2GV9 A;  2ZQM A;  4DV7 O;  1VQ6 V;  2ATK C;  2E3C A;  3FB8 C;  1SC5 B;  3CP1 A;  2Q7E A;  3J7A U;  1Q7Y W;  1YIJ V;  5EYP B;  4O4H A;  1Y67 A;  2EIJ C;  3FX7 A;  1YTF B;  4X1Y A;  5E1A C;  3CMA V;  2OTJ V;  2R70 A;  1VQP V;  3AG3 C;  5LHI A;  2A79 B;  5B1B B;  4JAU A;  1G6U A;  3N2G B;  1F51 A;  3OEH G;  3ABK C;  3ZJZ A;  5B3S C;  3X2Q B;  5DED A;  5LOV B;  4LP8 A;  4BW5 A;  1E1R G;  5JQG B;  4PV1 B;  1P49 A;  1JFF B;  3I56 V;  4MS2 A;  1B04 A;  3P3P A;  3P32 A;  1AJP A;  1S5H C;  3BVO A;  3B77 A;  3C90 A;  1AI4 A;  1NI8 A;  5ITZ B;  2NLJ C;  4JI2 B;  2ILM A;  3ASO C;  1UJW B;  4X66 O;  4YXW G;  5CBG A;  4JZ2 A;  1QLN A;  3T1Y B;  4WFB V;  5JJE B;  2Y48 A;  3A0R A;  1V9P A;  1MSD A;  2JGD A;  4P9O A;  1SZX A;  3R65 A;  1WJZ A;  3LDC A;  4GX5 A;  3FB7 C;  4PI2 A;  3SR2 C;  5JVD A;  1XNQ B;  5D5P A;  4GYC B;  3CJH A;  1RSO B;  5GTI Z;  1S3J A;  5EIB C;  2EIL C;  3K5L A;  3ABT A;  3CCM V;  4JI5 O;  4XBF A;  1SF9 A;  4DUZ O;  3FB5 C;  3JAR A;  4X1Y B;  1MOF A;  2PTM A;  2Y69 C;  5LMU O;  2R9A A;  4YY3 O;  2X7R B;  4GZR B;  4MVR A;  4DR6 B;  3B8M A;  1S77 D;  4AIL C;  2JVD A;  2KG7 B;  5L3B A;  3CCV V;  3QG5 A;  3W7W A;  3EXA A;  1OCO C;  1WP7 A;  3N2G A;  1K5Q A;  1V54 B;  2BCC H;  3ZMZ A;  2E5L O;  3EFF K;  2UXN A;  5KA5 A;  2QTS A;  1DGS A;  5BMV A;  5B1A C;  3ABM C;  2FB5 A;  3L71 H;  3ZMU A;  1YTF D;  1P7B A;  4J11 A;  3E8B A;  5EIB D;  4DUY B;  1N33 B;  1V55 B;  1M4U A;  1M57 C;  3ZX6 A;  4NXM O;  3OUS A;  1ENV A;  4MVO A;  3KKY A;  1KEC A;  4CC5 A;  3C3T A;  5KX5 B;  2UUC O;  1JCH A;  1KP3 A;  4HZ3 A;  2C2A A;  2DYR C;  1ORQ C;  3FB6 C;  3CS5 A;  3CCR V;  3B40 A;  3E35 A;  2CUG A;  2AHZ A;  2ODM A;  5LA6 B;  1MMM A;  2PYL A;  1JMK C;  4JI8 B;  3Q4H B;  3OEE G;  2N04 A;  5JVD B;  2K1E A;  4PEL A;  4YIO A;  1QLE B;  2IJJ A;  4LFA O;  2Q0A A;  3E8G A;  2UU9 O;  1R3I C;  3APO A;  5H6Q A;  1W0J G;  2E74 B;  4IIJ A;  4J9Y B;  4WBN B;  4Z1M G;  3OT7 A;  3UO3 A;  2B1G A;  5LMU B;  3RYC A;  2P4V A;  3CC4 V;  4LF6 O;  4E4E A;  4R8C A;  3CRC A;  4GT1 A;  2ZDI C;  3F7V C;  2W6J G;  2OTL V;  2KG7 A;  4FZ0 A;  4PA3 A;  1UPG A;  2F95 B;  1M90 W;  1MG1 A;  4KL1 A;  1M9N A;  1I08 A;  2WLJ A;  2ZIO A;  1K4D C;  2Q73 A;  1DK1 A;  4DV2 O;  1GMG A;  5H9C A;  2NNU A;  3MHS C;  3ETE A;  4N21 A;  4O2B A;  4F6R A;  1XIL A;  4J80 A;  3FAV A;  2HLD G;  2AZ0 A;  1XUQ A;  3WFV A;  3P3N A;  2ARH A;  1EM1 A;  3N2K A;  3E83 A;  1EN5 A;  4RAI A;  4MVQ A;  5LMN O;  5HFM A;  2HJD A;  5B1A B;  2YI8 A;  2QM8 A;  4UCV A;  2PI5 A;  3OAA G;  2EIK B;  2UUB O;  4X62 B;  4MVU A;  5IJ0 B;  4OX9 O;  2EZO A;  1SQG A;  5KMG A;  1K92 A;  2OT5 A;  3M99 B;  2Q9L A;  4TWK A;  4IGG A;  4UV8 A;  2ZR3 A;  2ITD C;  4P30 A;  1Y74 B;  4DRX B;  3JAW A;  2Q68 A;  5B3S B;  2GSM B;  1NH2 B;  4DXW A;  3APQ A;  3CCJ V;  1F4N A;  4DV1 B;  1SQV H;  4NKG B;  1M93 A;  4P9P A;  2ETN A;  3RT3 C;  1GM8 A;  1VQ4 V;  2P6J A;  2WLI A;  4X20 A;  2XUM A;  1YJ9 V;  1TA8 A;  1F4M A;  4ZBM A;  4YJ2 A;  3HKE A;  4X1K B;  2PUS A;  2EIM C;  2BTQ A;  4O4J A;  5EBW C;  1LNQ A;  2EZP A;  2HR3 A;  1Y6X A;  1XOU A;  4JYA B;  5KMG B;  3U11 A;  4Q6G A;  3ZRW A;  4CH4 A;  2EJ7 A;  1QHT A;  4QNH B;  1YF2 A;  1JJ2 U;  3VOU A;  1R6T A;  4NVP A;  1K33 A;  1N0N A;  3ZMS A;  1JPX A;  3OR7 C;  1K9M W;  4FLY A;  1MNG A;  1EN6 A;  2YIC A;  5C8Y A;  2R9I A;  3UT5 A;  1XMQ O;  1ZSP A;  4G2K A;  4I5S A;  1AI7 A;  4LFB B;  2FTK A;  4LF9 O;  1LUV A;  1XHZ A;  3JSN A;  1JX9 A;  1AP5 A;  1XL6 A;  3SJC C;  3RYI B;  3UKM A;  2RQ6 A;  4JAV A;  4LWS B;  2ZKO A;  2OCC B;  3MAQ A;  4X65 O;  2F93 B;  2KB1 A;  3QTC A;  3ICX A;  4I55 A;  3FKS G;  1G8M A;  3HKD B;  3R66 A;  3CRQ A;  4Z1V A;  5KHG A;  1K4C C;  3TXQ A;  3SGI A;  2ZIM A;  4WFG A;  2VS0 A;  2L35 A;  1N4C A;  2YC0 A;  4DW1 A;  1KB9 F;  4U3F H;  3BHP A;  1EZJ A;  4B3T B;  1DLB A;  2QWO B;  3K08 A;  4ZOL A;  3K59 A;  1KQS U;  5C93 A;  1K5S A;  2XAH A;  4JI0 B;  5KHK A;  3LDE A;  3WB2 A;  3IC7 A;  4JI7 O;  4B7E A;  4A5U B;  4OPA A;  1KMI Z;  3TCU A;  4U3J A;  1KD1 W;  4PA4 A;  3TET A;  1WN7 A;  2DWD C;  4I9W A;  4MW8 A;  3OMA B;  4DV4 B;  1TUB A;  4BIO A;  5K1X A;  4PDR A;  3ABU A;  2A7W A;  3QF7 A;  1QBZ A;  1VQM V;  1NQT A;  1J95 A;  3RN4 A;  3JAT B;  4I50 A;  1N36 O;  1O9H A;  2WLM A;  1IXB A;  3H1H H;  4PA7 A;  1VAR A;  4JI1 B;  2CTR A;  3OTO B;  4B08 A;  4LNU B;  2P67 A;  1DF4 A;  2YXH A;  3N2K B;  2UXD O;  3JAL A;  4N23 A;  2F4V O;  4ABM A;  2UUA O;  3HPL C;  1HP8 A;  2F43 G;  4FFB A;  4K0K O;  2XAJ A;  3K9S A;  1MSW D;  2FYU H;  2X6B A;  2BSK A;  4X65 B;  5KUM A;  3FAV B;  3SPC A;  4ZOL B;  5H5N A;  5CA3 A;  4YHH B;  2XAG A;  4ASU G;  3RFR A;  2XHB A;  4GKK B;  3E89 A;  1QVG U;  4DV1 O;  3F5T A;  2OCC C;  2Q7G A;  4AI8 A;  3CPW U;  2DN9 A;  3VQY A;  3LSS A;  1R1B A;  2QTO A;  1H38 A;  4X9Q A;  5H6R A;  4EB6 B;  2HHH B;  4WFF A;  3HKC B;  1FXK A;  4PA9 A;  1SS3 A;  2CH7 A;  2WPD G;  2RNB A;  4PHZ A;  3JAW B;  3FYE B;  1Q6I A;  3OGC C;  3SYC A;  4MVS A;  3BY6 A;  1SQF A;  2CK3 G;  3A8T A;  2AW9 A;  3NXS A;  2ZD9 A;  4DR5 O;  4Q20 A;  1NZ6 A;  2EX3 A;  2H8P C;  3K79 A;  4PI0 A;  1FD9 A;  4RUF A;  2VWJ A;  2YEV A;  3A0H Z;  2E75 B;  2LGW A;  2YDE A;  4CC6 A;  3ZHV A;  1VQ7 V;  4EKW A;  1M56 C;  2GUZ B;  2WSS G;  4NTX A;  3RYH A;  1IBK B;  4JI2 O;  3QO7 A;  3U0Z A;  3JD3 A;  1MAB G;  2RN9 A;  5KAF Z;  1EZV H;  4X88 A;  4ZHQ A;  1HR0 B;  3H1K H;  4FZ1 A;  2F1M A;  1E79 G;  1Q43 A;  1R3J C;  1QVF U;  3BA9 A;  2AGA A;  4DR1 B;  1IXM A;  1F23 A;  1H2N A;  4EFB A;  1DTO A;  3DXR A;  5LOV A;  3HKB A;  4MTF A;  1K97 A;  3K3W A;  2XOK G;  1XI1 A;  3HKC A;  5LP6 A;  2LQT A;  2BOC C;  1QLE C;  4JI5 B;  4FLW A;  3RWR D;  1TVK A;  1IDS A;  2YUA A;  3CC7 V;  5J2U B;  1VF7 A;  4I0X A;  5B1O A;  4C7U A;  4GX1 A;  1ROP A;  2UXX A;  3SYP A;  5KLV H;  1KU9 A;  5EC1 C;  4BAY A;  1F7Y A;  5LMN B;  1WLE A;  4NTW A;  2BTO A;  1VIB A;  1FXK B;  1SQP H;  4LFA B;  1UFI A;  3QO5 A;  4D6T H;  1FXV A;  4JI6 O;  1GKF A;  2LO1 A;  3JCU Z;  4JYB A;  1VF6 C;  1WAZ A;  5FNV B;  5E79 Z;  4DV6 O;  1PM9 A;  3K5N A;  1W0K G;  3CRM A;  5L3G A;  4TV9 B;  2V4D A;  2D3O W;  4TUY A;  1YVW A;  4PDM A;  4B3T O;  4TV8 A;  3S3W A;  2YXL A;  2OIG A;  2DJV A;  1AI6 A;  4WFH A;  4UCT A;  2GTA A;  2G38 A;  3F7Y C;  5EC2 C;  2A06 H;  2QDO A;  4HYO A;  2QJ1 A;  4KHP O;  1Y76 B;  2ZE5 A;  3OE7 G;  1BQ0 A;  2JS5 A;  1GN2 A;  5LHH A;  4F4L A;  2ADQ B;  4GKK O;  2EIN B;  1S5L Z;  2DE0 X;  3IGA C;  2PZS A;  4I4T A;  1OCC B;  3RVY A;  3BRC A;  3CHX A;  3VBB A;  2XAQ A;  4KXR A;  4OXS A;  1G1X B;  2KKW A;  4FLV A;  1NTK H;  3E8H A;  2IJK A;  2Q4P A;  4TT3 G;  2VWK A;  4IHJ A;  3J80 N;  2F4V B;  1SES A;  5FL7 G;  3AG1 B;  3PJS K;  1Q81 W;  1WPX A;  5B66 Z;  1QQC A;  4IIJ B;  2GTS A;  3OTO O;  4MSW C;  3ZCC A;  4JYC A;  1MZE A;  5CA1 B;  1BHA A;  1RM1 C;  2LFS A;  5CA0 A;  2WA4 A;  1OHH G;  4NR1 A;  4K35 A;  2CTQ A;  1N33 O;  3CME V;  5IJ9 A;  1Q90 D;  1AJN A;  3ETQ A;  2ZR2 A;  2FL4 A;  5J9P C;  4X66 B;  3JD0 A;  1H2L A;  3HB3 B;  1K8A W;  1YDX A;  3CSX A;  5LL6 Y;  2JGD B;  4HAM A;  2OYQ A;  1B3Q A;  1XL4 A;  1OV9 A;  2X0L A;  2VQE O;  4R7C A;  1FYJ A;  2XTA A;  1M56 B;  3L74 H;  1J5E B;  5H2F Z;  1YCI A;  4JGS A;  3IAY A;  4FMT A;  4DV2 B;  2UXD B;  2FML A;  2HFE C;  1Q6H A;  4FM0 A;  4BWA A;  1RM1 B;  3WB1 A;  4JPR A;  3STL C;  1VQL V;  1H8H G;  1ZX3 A;  4CH6 A;  3M8A A;  2QKS A;  4OPH A;  3DGE A;  3S3X A;  1Q5O A;  5L3D A;  4TQD A;  3STZ C;  4ZI7 B;  4CH3 A;  5GON A;  1HR0 O;  3AG3 B;  1D5N A;  4LFC B;  1OCC C;  3KZI Z;  3LUT B;  2JRI A;  4HNA B;  4CS3 A;  1IBK O;  4ZIB A;  4J9Z B;  5GTH Z;  4QE7 A;  4FM2 A;  1SQX H;  3CCU V;  4W4L A;  3L70 H;  3B09 A;  1PL4 A;  2HJF C;  1CP9 A;  3OR6 C;  4FJC C;  1Z5W A;  4KFM A;  3ZMT A;  1BS3 A;  3DXR B;  4DRX A;  3DSQ A;  2X6C A;  2P06 A;  3SPJ A;  2DQ0 A;  5BZB A;  5IDJ A;  2BSK B;  4O4L A;  2Q7H A;  3ZMV A;  4JI4 B;  4TOI A;  2WLN A;  2P5O A;  4LF6 B;  4JI3 B;  5J2U A;  2HKO A;  4DV5 B;  1SRY A;  2QR4 A;  1Q3E A;  1U97 A;  5IYZ B;  1FPO A;  4QE9 A;  3K5M A;  2QA4 V;  2RMK B;  1A32 A;  2HEP A;  2ZXW C;  3BEH A;  1P4R A;  1LR1 A;  3KCX A;  1H2S B;  5KA6 A;  3G6B A;  2E5L B;  1WB8 A;  2A3Q A;  1ZUQ A;  1BGY H;  2EIL B;  2JK5 C;  1JFF A;  4H37 A;  2DYS B;  3CWB H;  3DC5 A;  1B06 A;  1T5E A;  3UO2 A;  3HR0 A;  3K5O A;  3ZRW B;  1IBM B;  4DV3 O;  3Q4H A;  4QPK A;  3CEI A;  3CD6 V;  4O2A B;  3ZHR A;  3JAS B;  1S76 D;  2Q5Z A;  1WP8 A;  2JEU A;  3JAK B;  2Y0P A;  1PL0 A;  5LXT B;  2IBZ H;  3L75 H;  1H2K A;  1IBL B;  2BE3 A;  1WB7 A;  1FKA O;  1PP9 H;  2QGN A;  3SPH A;  3ABL B;  4QJF B;  2Y0I A;  4GKJ O;  4MT8 A;  4LF5 B;  2AHY A;  1SZT A;  1PPJ H;  2ITC C;  3RVZ A;  3WG7 C;  5JJJ B;  2ZIN A;  5KUK A;  4JI7 B;  2YIB A;  4CS4 A;  1WNS A;  3IFX A;  4P2Z A;  5J2T A;  2WWW A;  4O4I A;  2M7W A;  4K0K B;  3E86 A;  1KKD A;  5LYJ B;  4LCU C;  3RGB A;  3T4D A;  1K73 W;  2EIJ B;  1VF5 B;  5JJN B;  3CXH F;  4GLX A;  5IYD O;  3JAR B;  5BXZ A;  3GB7 C;  2K9P A;  4DW0 A;  4X62 O;  5CB4 B;  4OX9 B;  1NU1 H;  3JD2 A;  5JH7 B;  5KAI Z;  3AK2 A;  3AG1 C;  2ZXW B;  4NTY A;  2DW4 A;  2ZNJ A;  5DN6 G;  4K8X A;  4GX0 A;  4FLU A;  4DV0 B;  3X2Q C;  2R9R B;  1NR7 A;  4LR3 A;  2Q69 A;  1OCO B;  4GKJ B;  1TUB B;  4LFB O;  1XHX A;  1H2G A;  1S0V A;  4E2L A;  2Y4U A;  4DR5 B;  1ARO P;  4UVA A;  1YZB A;  2EIM B;  2PY5 A;  4PA6 A;  5LP6 C;  1R6K A;  1ZL8 A;  4U7N A;  2JDI G;  2W6I G;  3ASO B;  3AEI A;  3ZS8 C;  1Y74 A;  2GBO A;  2ZE8 A;  1L0N H;  3IJ4 A;  3UM7 A;  4FM1 A;  1R6N A;  3C3S A;  1JOY A;  1FS0 G;  4FLX A;  4LF4 O;  3SDL A;  4H13 B;  1IUR A;  1GO3 F;  3T1C A;  1IVS A;  3L73 H;  1PD3 A;  4J42 A;  5DEC A;  3BPZ A;  4J7K A;  2DWE C;  1JJO A;  4J41 A;  1D2D A;  5IWA O;  1YHQ V;  1XMQ B;  2HG5 C;  1ZWI C;  4DV7 B;  4ZHQ B;  1OCZ C;  4LF4 B;  1QU7 A;  4JI3 O;  4FIP C;  4LF8 B;  4IL6 Z;  4JI4 O;  5A2Q N;  1PV0 A;  4YJ3 A;  3F5W C;  3CRA A;  4QIW F;  2JGU A;  5C8Y B;  1SER A;  5IYZ A;  5GW7 A;  3IC9 A;  5L3E A;  4NXM B;  3CB2 A;  1AJQ A;  3G71 V;  4OGQ B;  5JCO A;  1Y66 A;  1M5I A;  1BQZ A;  1VQO V;  5CN0 A;  1I5Y A;  3SJQ C;  5EBM C;  3K04 A;  2Y69 B;  4LH7 A;  4YJ2 B;  4MTX A;  3HKE B;  3LDD A;  3FD9 A;  4MVZ A;  1YJN V;  1N34 B;  5FPR A;  5LP6 B;  1YI2 V;  2IJH A;  1AVM A;  1IZ3 A;  2DYR B;  2V7Q G;  3L72 H;  3UCS C;  3GVM A;  2Q67 A;  4B3R O;  3D8C A;  3SJA C;  2JJ1 G;  4TUY B;  3DC6 A;  1NBM G;  4FFB B;  3JAL B;  1KKC A;  1BMF G;  1XNQ O;  2UUB B;  2QE7 G;  3I5D A;  2Q6A A;  1L1F A;  4UUJ C;  4B3S B;  1K34 A;  3K0G A;  2H3O A;  1M1K W;  3SPG A;  5LYJ A;  4RWU A;  2WLL B;  4LF5 O;  2JIZ G;  4K3A A;  5KHJ A;  2NN4 A;  1AR5 A;  4J10 A;  4XDK A;  2CH7 B;  4U7O A;  3PN1 A;  3E22 A;  5JWP A;  3JD4 A;  5B1N A;  3OW2 U;  4BR6 A;  1HNW B;  2VQF B;  2CAZ C;  4UB8 Z;  4GUN A;  5CMU A;  4LWS A;  5ITZ A;  1VQ5 V;  3L9D A;  4AQY O;  2EUL A;  3RYH B;  1IBM O;  4X8A A;  3ABL C;  4F6E A;  2A0L A;  3TK1 A;  4DR2 O;  3OGI B;  5AG2 A;  4LH6 A;  3UQ8 A;  4H33 A;  2EBO A;  1URF A;  2FKX A;  5LGU A;  3ZED A;  2B5U A;  2BOB C;  1KC8 W;  2OWO A;  1Y76 A;  4TSF G;  3E8F A;  5LGT A;  1NTZ H;  3CE2 A;  1TAE A;  3AG2 B;  3M7M X;  1AIL A;  4QPJ A;  3BAA A;  4WCE V;  3SYO A;  3JSL A;  1I94 O;  3D3Q A;  3FYI B;  1M57 B;  3ZHU A;  1WA8 B;  2AXT Z;  4KHP B;  1QR9 A;  4O4H B;  4UB6 Z;  3H01 A;  3T2M A;  4JTA B;  1Z5V A;  2UUA B;  2QSA A;  5EK0 A;  4DUZ B;  2LW7 A;  3K0D A;  1PNL A;  2CDY A;  2Y4T A;  1R3K C;  2ZCE A;  2L6L A;  2LW1 A;  1HNX O;  5BMV B;  4PD4 F;  2OIE A;  1HWY A;  2ADP A;  1SET A;  2XT9 A;  1V55 C;  5EYP A;  1FJG O;  2QM7 A;  3RYF B;  2IW5 A;  4DV4 O;  4JZG A;  3AG7 A;  5LA6 A;  3JAT A;  4I50 B;  4DV6 B;  5FPO A;  3K03 A;  4JF3 A;  1I7F A;  3MHH C;  2LFR A;  4J7Z A;  1XNR B;  1Y4M A;  1OCR B;  1CPY A;  4I0X B;  4D7T A;  2JJ2 G;  1AR4 A;  4JI0 O;  3AK1 A;  1HNZ B;  4HBN A;  4PJ0 Z;  3THO A;  2B9Z A;  3P30 A;  4HNA A;  4I9Q A;  2M6Y A;  1FFX B;  5DM6 V;  1GN3 A;  3MD0 A;  3ABM B;  2ZT9 B;  3ZRV A;  4CBC A;  1DF5 A;  3ASN B; 
#chains in the Genus database with same CATH homology
 2A9H A;  2DYS C;  3ZMS A;  1JPX A;  3ZMV A;  5L3F A;  3OR7 C;  2WLN A;  1K9M W;  3CC2 V;  5IY5 B;  2HKO A;  1SRY A;  2R9I A;  1BHB A;  3RBZ A;  1EBO A;  4JTC B;  4G2K A;  4QE9 A;  4I5S A;  1AI7 A;  2FTK A;  2QA4 V;  3AG2 C;  2ZXW C;  1JX9 A;  1R3L C;  2YEV B;  3BEH A;  1P4R A;  2HVJ C;  1XL6 A;  4L87 A;  5LGN A;  5KA6 A;  3UKM A;  4JAV A;  1VQK V;  2XAF A;  2OCC B;  5IYB O;  2EIL B;  2JK5 C;  4H37 A;  1CEZ A;  1H8E G;  3OM3 B;  2DYS B;  2KB1 A;  5CBH A;  3RW0 A;  3SYA A;  3FKS G;  3ZRW B;  1G8M A;  1N8R W;  1QR8 A;  2ZDI A;  4QPK A;  3CD6 V;  1K4C C;  4FPP A;  2EIN C;  4PDV A;  4UXN A;  1S76 D;  2IH3 C;  2JEU A;  3EHB B;  1VQ9 V;  1PL0 A;  1VQ8 V;  5L3C A;  3WG7 B;  4WFG A;  1BL8 A;  1EFR G;  1PNM A;  5LBQ A;  2JEX A;  3G6E V;  2QEX V;  3GWO A;  1Q86 W;  1EZJ A;  1DLB A;  3K08 A;  3ZRS A;  3D36 A;  1KQS U;  5C93 A;  1K5S A;  1NKD A;  2XAH A;  1YIT V;  3LDE A;  1OCZ B;  4WF9 V;  3K06 A;  3SPH A;  3IC7 A;  3ABL B;  4BIZ A;  3SPI A;  4QJF B;  3JD1 A;  3LSQ A;  2MK3 A;  4MT8 A;  2AHY A;  4KUM A;  1SZT A;  2ITC C;  3RVZ A;  3TCU A;  3WG7 C;  5KUK A;  1KD1 W;  1Q82 W;  4PA4 A;  3TET A;  5IYC O;  2DWD C;  4I9W A;  4MW8 A;  3OMA B;  3IFX A;  4P2Z A;  4G27 B;  4PDR A;  1OCR C;  2WLH A;  3ABU A;  2WWW A;  2M7W A;  1QBZ A;  5HFL A;  1VQM V;  1NQT A;  3LNM B;  3OMN B;  4GX2 A;  3E86 A;  1J95 A;  2IH1 C;  4XDL A;  1KKD A;  1YJW V;  3I55 V;  3ZIA G;  2WLM A;  3OUF A;  4LCU C;  3T4D A;  1K73 W;  4PA7 A;  1VQN V;  2EIJ B;  3KG2 A;  2P67 A;  1K7D A;  5IYD O;  1DF4 A;  3GB7 C;  1E1Q G;  4N23 A;  4GCZ A;  4UVC A;  3HPL C;  2EIK C;  4MW3 A;  1NVP D;  2F43 G;  3JD2 A;  2XAJ A;  2ZQM A;  1MSW D;  4LBE C;  3AG1 C;  2X6B A;  2ZXW B;  1VQ6 V;  2ATK C;  2DW4 A;  5DN6 G;  2IJI A;  4GX0 A;  3FB8 C;  3X2Q C;  3AG4 C;  5KUM A;  1KP2 A;  4RO2 A;  2R9R B;  3CP1 A;  1NR7 A;  3SPC A;  4WFE A;  3ETG A;  5CA3 A;  1Q7Y W;  3QO8 A;  1YIJ V;  2Q69 A;  2XAG A;  1FXK C;  1OCO B;  3B8N A;  4ASU G;  3E89 A;  3E2E A;  1QVG U;  2EIJ C;  1YTF B;  5E1A C;  3ML0 A;  3T4Z A;  4DO2 A;  3CMA V;  2V1D A;  2OTJ V;  4ZKI A;  2OCC C;  3CPW U;  1H2G A;  4BIU A;  1VQP V;  4E2L A;  1S0V A;  4UVB A;  3LSS A;  2QTO A;  4RQF A;  1ARO P;  1H38 A;  4UVA A;  3AG3 C;  5H6R A;  1TUE B;  5LHI A;  2A79 B;  5B1B B;  2EIM B;  3ZN1 A;  4WFF A;  4JAU A;  3CCQ V;  1FXK A;  3OEH G;  1F51 A;  4PA6 A;  3ABK C;  3ZJZ A;  1R6K A;  4PA9 A;  5B3S C;  3X2Q B;  2WPD G;  4U7N A;  2JDI G;  2W6I G;  3ASO B;  4LP8 A;  5LHG A;  4BW5 A;  3FYE B;  2PI4 A;  3AEI A;  1E1R G;  3OGC C;  3SYC A;  4MVS A;  3BY6 A;  3UM7 A;  4WFA V;  3W7T A;  1R6N A;  2CK3 G;  3I56 V;  4MS2 A;  1JOY A;  2DQ3 A;  1FS0 G;  3NXS A;  3P32 A;  2ZD9 A;  1AJP A;  1S5H C;  3K79 A;  2H8P C;  4Q20 A;  4RUF A;  2YEV A;  1VQ7 V;  1GO3 F;  3B77 A;  3T1C A;  4EKW A;  1M56 C;  1AI4 A;  1JQ0 A;  1PD3 A;  3JYC A;  4JTD B;  2WSS G;  1QCE A;  3QO7 A;  3JD3 A;  1MAB G;  4JAS A;  2NLJ C;  4X88 A;  2DWE C;  3ASO C;  1UJW B;  1E79 G;  1R3J C;  4YXW G;  5CBG A;  1QVF U;  1YHQ V;  4XDJ A;  1QLN A;  2HG5 C;  4WFB V;  1ZWI C;  2Y48 A;  3A0R A;  1IXM A;  2WAM A;  1F23 A;  1OCZ C;  4P9O A;  1DTO A;  3R65 A;  3CXC U;  4FIP C;  4CZZ A;  3LDC A;  5IY5 C;  4GX5 A;  3D3I A;  3FB7 C;  4MTF A;  1K97 A;  3K3W A;  2XOK G;  1NVP B;  3F5W C;  2BOC C;  1QLE C;  1S3J A;  2EIL C;  3CCL V;  3ABT A;  4QIW F;  1SER A;  3CCM V;  2HVK C;  4XBF A;  5GW7 A;  3CC7 V;  3FB5 C;  3ZRX A;  2WLI B;  5L3E A;  1AJQ A;  3G71 V;  1MOF A;  5B1O A;  1Y66 A;  1G4Y B;  2Y69 C;  4GX1 A;  1ROP A;  3AG4 B;  2UXX A;  3SYP A;  2X7R B;  4RUE A;  4MVR A;  1VQO V;  3B8M A;  5CN0 A;  5EC1 C;  1S77 D;  1I5Y A;  4BAY A;  5L3B A;  1GTO A;  3CCV V;  1WLE A;  3W7S A;  3W7W A;  3SJQ C;  5EBM C;  1FXK B;  1OCO C;  1K5Q A;  1V54 B;  3QO5 A;  3ZMZ A;  3EFF K;  1FXV A;  1OZ0 A;  1GKF A;  2UXN A;  3K04 A;  3OMI B;  4JYB A;  5KA5 A;  2Y69 B;  2XND G;  5EBL C;  4MTX A;  5B1A C;  3ABM C;  1B6Q A;  3LDD A;  4LC1 A;  4MVZ A;  3ZMU A;  1W0K G;  1YTF D;  1P7B A;  3E8B A;  2EJR A;  1V55 B;  5L3G A;  1YJN V;  2LP7 A;  4MTO A;  2D3O W;  1YI2 V;  2P90 A;  4PDM A;  1M57 C;  1AR1 B;  2IJH A;  2DYR B;  2V7Q G;  3OUS A;  2XAS A;  2Q67 A;  3CCS V;  1NJI W;  1ENV A;  4MVO A;  1KEC A;  1AI6 A;  2JJ1 G;  3OFN G;  3CCE V;  1NBM G;  4WFH A;  4G28 B;  3F7Y C;  5EC2 C;  1JCH A;  1KP3 A;  1BMF G;  4HZ3 A;  2C2A A;  4HYO A;  2QE7 G;  2DYR C;  1L1F A;  2Q6A A;  1ORQ C;  3FB6 C;  4MTG A;  3OE7 G;  4UUJ C;  3CCR V;  1K34 A;  3K0G A;  3E35 A;  2AHZ A;  1M1K W;  3SPG A;  5LHH A;  4F4L A;  1PNK A;  3OEE G;  1JVM A;  1I5X A;  2WLL B;  2K1E A;  2JIZ G;  4PEL A;  2EIN B;  1QLE B;  3QNE A;  2IJJ A;  3IGA C;  3E8G A;  1R3I C;  1GK9 A;  5H6Q A;  1THZ A;  1OCC B;  1W0J G;  3RVY A;  3VBB A;  4XDK A;  2XAQ A;  4J9Y B;  4OXS A;  4U7O A;  4Z1M G;  2B1G A;  2B1I A;  3K9A A;  1K3E A;  3E8H A;  3CC4 V;  4R8C A;  2IJK A;  4GT1 A;  4TT3 G;  1NR1 A;  2ZDI C;  3F7V C;  1SES A;  1GM7 A;  2W6J G;  2OTL V;  5FL7 G;  3ZN0 A;  3AG1 B;  3PJS K;  3JD4 A;  1Q81 W;  1WPX A;  5B1B C;  4PA3 A;  5B1N A;  3OW2 U;  4MSW C;  3ZCC A;  1M90 W;  1MG1 A;  1M9N A;  3ABK B;  4JYC A;  2WLJ A;  1K4D C;  2H94 A;  5CMU A;  1BHA A;  1GM9 A;  2IU0 A;  1RM1 C;  2LFS A;  1OHH G;  1GMG A;  1PKX A;  5H9C A;  2NNU A;  3W7U A;  1W2B U;  1VQ5 V;  3MHS C;  3ETE A;  4N21 A;  1YSC A;  3W7X A;  4X8A A;  3ABL C;  4FK5 C;  2A0L A;  1RPO A;  3TK1 A;  3CME V;  2HLD G;  2WLL A;  1AJN A;  4KP4 A;  2ZR2 A;  4H33 A;  5J9P C;  2EBO A;  3JD0 A;  4RQE A;  3WFV A;  3CYO A;  3HB3 B;  5LGU A;  1KC8 W;  2B5U A;  2BOB C;  1K8A W;  2WLK A;  4TSF G;  3E8F A;  5LGT A;  3AG2 B;  4QPJ A;  4WCE V;  3E83 A;  5CBF A;  4HAM A;  1RPR A;  1XL4 A;  4RAI A;  4MVQ A;  3DTU B;  3G4S V;  4R6Z A;  5HFM A;  3SYO A;  1COW G;  3FYI B;  1M57 B;  5B1A B;  1QR9 A;  2QM8 A;  2X0L A;  4R7C A;  2PI5 A;  3JCZ A;  3OAA G;  2EIK B;  3H01 A;  3T2M A;  4JTA B;  1M56 B;  2GHY A;  4MVU A;  4JGS A;  2EZO A;  4FMT A;  1FXH A;  4UV9 A;  5EK0 A;  1K92 A;  3K0D A;  1PNL A;  2OT5 A;  2HFE C;  3M99 B;  1R3K C;  2Z5U A;  1RM1 B;  2YSU B;  4TWK A;  2X6A A;  4JPR A;  3STL C;  1HWY A;  1VQL V;  1H8H G;  1SET A;  2IU3 A;  1V55 C;  2QKS A;  2Z3Y A;  1R73 A;  3DGE A;  4UV8 A;  1NH2 D;  2QM7 A;  2ZR3 A;  2ITD C;  3SYQ A;  4P30 A;  1S72 V;  2Q68 A;  5B3S B;  2IW5 A;  2GSM B;  5L3D A;  1NH2 B;  4DXW A;  3STZ C;  3CCJ V;  1F4N A;  3ASN C;  3AG3 B;  3K03 A;  4JF3 A;  3MHH C;  1OCC C;  2LFR A;  2W0F C;  3LUT B;  4P9P A;  4MVM A;  1GM8 A;  1VQ4 V;  2P6J A;  2WLI A;  1Y4M A;  1OCR B;  1YJ9 V;  1CPY A;  1V54 C;  2JJ2 G;  1F4M A;  4J9Z B;  4ZBM A;  4QE7 A;  4R50 A;  3CCU V;  3ETD A;  2EIM C;  1AI5 A;  3P30 A;  5EBW C;  1LNQ A;  2HJF C;  2P7T C;  1CP9 A;  2EZP A;  2HR3 A;  3OR6 C;  4FJC C;  4KFM A;  4X89 A;  3ZMT A;  3ZRW A;  5DM6 V;  4QNH B;  2X6C A;  1JJ2 U;  3MD0 A;  3SPJ A;  2DQ0 A;  3ABM B;  1FFT B;  4PDL A;  5BZB A;  5IDJ A;  3ZRV A;  4CBC A;  1DF5 A;  3VOU A;  3ASN B;  1K33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...