3ZRZA

Crystal structure of the second and third fibronectin f1 modules in complex with a fragment of streptococcus pyogenes sfbi-5
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title Structural and Functional Analysis of the Tandem Beta-Zipper Interaction of a Streptococcal Protein with Human Fibronectin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 18
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3zrzA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3zrzA02
3KZJA 2W80A 1FBRA 2RLPA 4LOTA 1H04P 1QO6A 3ZD1A 4ONTD 4A5WB 3INBC 3O8EB 3ZD2A 4DJZA 1OK9A 4K12A 1OK2A 1GKNA 4AYDA 2KRIA 1HFHA 4C16A 1MD7A 1MD8A 1ELVA 1H2PP 2JGWA 1QGBA 3OXUD 3ZRZA 5JPMG 3OEDC 1NWVA 4AYIA 1E5GA 1GHQB 4F4OC 2V8EA 1O9AA 3IU3I 1UOTP 1TPMA 2YRAA 1LY2A 2CG7A 1CKLA 2QY0A 4MUCA 4ZH1D 1GPZA 5HYTB 4B2RA 1E8BA 4PZ5A 2WIIC 5FO8C 1OJYA 1U5MA 3RJ3D 1OJWA 3GOVA 3T5OA 2EC3A 3EJHA 1H2QP 5HYUB 2EHFA 2IZ4A 2BZMA 3L89M 1SRZA 2W81A 2MCZA 2MCYA 3CALA 2ERJA 2JRAA 4B2SA 4YNXA 2JGXA 1G4GA 1VVCA 1OK3A 1OJVA 4J38B 1C1ZA 2G7IA 4JHSA 4AYEA 2XRBA 5HYPA 1HFIA 1HCCA 3M7PA 2RL0A 2B5ID 4LOSA 2RLQA 2XQWC 3OP8A 2CKUA 1TPNA 2O39C 2RKYA 1H03P 3KXVA 2A55A 4FXGG 1QUBA 1Z92B 2XWJI 2KMSA 1VVDA 3GXEA 3MQLA 2IZ3A 3SW0X 4KKDA 3NFPI 1G4FA 1TPGA 1GKGA 1SS2A 1OK1A 2RKZA 2UWNA 3ERBA 5HZPB 1E88A 1Q3XA 2XWBF 3TVJA 1PPQA 4WJG2 2XRDA 4CSYA 5I0QB 2LOJA 1ZJKA 2YBYA 3IX0A 4AYMA 3R62A 2CG6A 4IGDA
chains in the Genus database with same CATH superfamily
3KZJA 2W80A 1FBRA 2RLPA 4LOTA 4MSLA 1H04P 1QO6A 3ZD1A 4ONTD 4A5WB 3INBC 3O8EB 3ZD2A 4DJZA 1OK9A 4K12A 1OK2A 2ZYCA 1GKNA 4AYDA 2KRIA 1HFHA 4APLA 4C16A 1MD7A 3FGTA 1MD8A 1ELVA 1H2PP 2JGWA 1QGBA 3ZLEA 2Y8SA 3OXUD 3ZRZA 5JPMG 3OEDC 1NWVA 4YIZA 4AYIA 1E5GA 1GHQB 2X2ZA 4F4OC 5DN5A 2V8EA 1O9AA 3IU3I 3NJAA 1UOTP 1TPMA 2YRAA 1LY2A 2CG7A 1CKLA 2QY0A 4MUCA 4ZH1D 1GPZA 3WSXA 5HYTB 4B2RA 1E8BA 4PZ5A 2WIIC 5FO8C 1OJYA 1U5MA 3RJ3D 1OJWA 3GOVA 3T5OA 2EC3A 3EJHA 5DN4A 1H2QP 2I2LA 3ZLDA 5HYUB 2EHFA 2IZ4A 2BZMA 3L89M 1SRZA 4BWCA 3CI0J 2W81A 2MCZA 2MCYA 3CALA 2Y8TA 2ERJA 2JRAA 4B2SA 4YNXA 2JGXA 1G4GA 1VVCA 1OK3A 3VWOA 1OJVA 4J38B 1C1ZA 2G7IA 4JHSA 4AYEA 2XRBA 1RLHA 5HYPA 1HFIA 4PO7A 1HCCA 3M7PA 2RL0A 2B5ID 4LOSA 2RLQA 2XQWC 3OP8A 2CKUA 3FGRA 1TPNA 2O39C 2RKYA 1H03P 3KXVA 2A55A 4FXGG 1QUBA 1Z92B 2XWJI 2KMSA 1VVDA 3K3TA 3GXEA 3MQLA 2IZ3A 3SW0X 4KKDA 3NFPI 1G4FA 1TPGA 2Y8RA 3F6KA 1GKGA 1SS2A 1OK1A 2RKZA 2UWNA 3ERBA 3WSYA 5HZPB 1E88A 1Q3XA 2XWBF 4N7EA 1PPQA 4WJG2 3TVJA 2XRDA 4CSYA 5I0QB 2LOJA 1ZJKA 2YBYA 3IX0A 4AYMA 3R62A 2CG6A 4IGDA
chains in the Genus database with same CATH topology
3KZJA 2W80A 1FBRA 2RLPA 4LOTA 1H04P 1QO6A 3ZD1A 4ONTD 4A5WB 3INBC 3O8EB 3ZD2A 4DJZA 1OK9A 4K12A 1OK2A 1GKNA 4AYDA 2KRIA 1HFHA 4C16A 1MD7A 1MD8A 1ELVA 1H2PP 2JGWA 1QGBA 3OXUD 3ZRZA 5JPMG 3OEDC 1NWVA 4AYIA 1E5GA 1GHQB 4F4OC 2V8EA 1O9AA 3IU3I 1UOTP 1TPMA 2YRAA 1LY2A 2CG7A 1CKLA 2QY0A 4MUCA 4ZH1D 1GPZA 5HYTB 4B2RA 1E8BA 4PZ5A 2WIIC 5FO8C 1OJYA 1U5MA 3RJ3D 1OJWA 3GOVA 3T5OA 2EC3A 3EJHA 1H2QP 5HYUB 2EHFA 2IZ4A 2BZMA 3L89M 1SRZA 2W81A 2MCZA 2MCYA 3CALA 2ERJA 2JRAA 4B2SA 4YNXA 2JGXA 1G4GA 1VVCA 1OK3A 1OJVA 4J38B 1C1ZA 2G7IA 4JHSA 4AYEA 2XRBA 5HYPA 1HFIA 1HCCA 3M7PA 2RL0A 2B5ID 4LOSA 2RLQA 2XQWC 3OP8A 2CKUA 1TPNA 2O39C 2RKYA 1H03P 3KXVA 2A55A 4FXGG 1QUBA 1Z92B 2XWJI 2KMSA 1VVDA 3GXEA 3MQLA 2IZ3A 3SW0X 4KKDA 3NFPI 1G4FA 1TPGA 1GKGA 1SS2A 1OK1A 2RKZA 2UWNA 3ERBA 5HZPB 1E88A 1Q3XA 2XWBF 3TVJA 1PPQA 4WJG2 2XRDA 4CSYA 5I0QB 2LOJA 1ZJKA 2YBYA 3IX0A 4AYMA 3R62A 2CG6A 4IGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZJ A;  2W80 A;  1FBR A;  2RLP A;  4LOT A;  1H04 P;  1QO6 A;  3ZD1 A;  4ONT D;  4A5W B;  3INB C;  3O8E B;  3ZD2 A;  4DJZ A;  1OK9 A;  4K12 A;  1OK2 A;  1GKN A;  4AYD A;  2KRI A;  1HFH A;  4C16 A;  1MD7 A;  1MD8 A;  1ELV A;  1H2P P;  2JGW A;  1QGB A;  3OXU D;  3ZRZ A;  5JPM G;  3OED C;  1NWV A;  4AYI A;  1E5G A;  1GHQ B;  4F4O C;  2V8E A;  1O9A A;  3IU3 I;  1UOT P;  1TPM A;  2YRA A;  1LY2 A;  2CG7 A;  1CKL A;  2QY0 A;  4MUC A;  4ZH1 D;  1GPZ A;  5HYT B;  4B2R A;  1E8B A;  4PZ5 A;  2WII C;  5FO8 C;  1OJY A;  1U5M A;  3RJ3 D;  1OJW A;  3GOV A;  3T5O A;  2EC3 A;  3EJH A;  1H2Q P;  5HYU B;  2EHF A;  2IZ4 A;  2BZM A;  3L89 M;  1SRZ A;  2W81 A;  2MCZ A;  2MCY A;  3CAL A;  2ERJ A;  2JRA A;  4B2S A;  4YNX A;  2JGX A;  1G4G A;  1VVC A;  1OK3 A;  1OJV A;  4J38 B;  1C1Z A;  2G7I A;  4JHS A;  4AYE A;  2XRB A;  5HYP A;  1HFI A;  1HCC A;  3M7P A;  2RL0 A;  2B5I D;  4LOS A;  2RLQ A;  2XQW C;  3OP8 A;  2CKU A;  1TPN A;  2O39 C;  2RKY A;  1H03 P;  3KXV A;  2A55 A;  4FXG G;  1QUB A;  1Z92 B;  2XWJ I;  2KMS A;  1VVD A;  3GXE A;  3MQL A;  2IZ3 A;  3SW0 X;  4KKD A;  3NFP I;  1G4F A;  1TPG A;  1GKG A;  1SS2 A;  1OK1 A;  2RKZ A;  2UWN A;  3ERB A;  5HZP B;  1E88 A;  1Q3X A;  2XWB F;  3TVJ A;  1PPQ A;  4WJG 2;  2XRD A;  4CSY A;  5I0Q B;  2LOJ A;  1ZJK A;  2YBY A;  3IX0 A;  4AYM A;  3R62 A;  2CG6 A;  4IGD A; 
#chains in the Genus database with same CATH topology
 3KZJ A;  2W80 A;  1FBR A;  2RLP A;  4LOT A;  4MSL A;  1H04 P;  1QO6 A;  3ZD1 A;  4ONT D;  4A5W B;  3INB C;  3O8E B;  3ZD2 A;  4DJZ A;  1OK9 A;  4K12 A;  1OK2 A;  2ZYC A;  1GKN A;  4AYD A;  2KRI A;  1HFH A;  4APL A;  4C16 A;  1MD7 A;  3FGT A;  1MD8 A;  1ELV A;  1H2P P;  2JGW A;  1QGB A;  3ZLE A;  2Y8S A;  3OXU D;  3ZRZ A;  5JPM G;  3OED C;  1NWV A;  4YIZ A;  4AYI A;  1E5G A;  1GHQ B;  2X2Z A;  4F4O C;  5DN5 A;  2V8E A;  1O9A A;  3IU3 I;  3NJA A;  1UOT P;  1TPM A;  2YRA A;  1LY2 A;  2CG7 A;  1CKL A;  2QY0 A;  4MUC A;  4ZH1 D;  1GPZ A;  3WSX A;  5HYT B;  4B2R A;  1E8B A;  4PZ5 A;  2WII C;  5FO8 C;  1OJY A;  1U5M A;  3RJ3 D;  1OJW A;  3GOV A;  3T5O A;  2EC3 A;  3EJH A;  5DN4 A;  1H2Q P;  2I2L A;  3ZLD A;  5HYU B;  2EHF A;  2IZ4 A;  2BZM A;  3L89 M;  1SRZ A;  4BWC A;  3CI0 J;  2W81 A;  2MCZ A;  2MCY A;  3CAL A;  2Y8T A;  2ERJ A;  2JRA A;  4B2S A;  4YNX A;  2JGX A;  1G4G A;  1VVC A;  1OK3 A;  3VWO A;  1OJV A;  4J38 B;  1C1Z A;  2G7I A;  4JHS A;  4AYE A;  2XRB A;  1RLH A;  5HYP A;  1HFI A;  4PO7 A;  1HCC A;  3M7P A;  2RL0 A;  2B5I D;  4LOS A;  2RLQ A;  2XQW C;  3OP8 A;  2CKU A;  3FGR A;  1TPN A;  2O39 C;  2RKY A;  1H03 P;  3KXV A;  2A55 A;  4FXG G;  1QUB A;  1Z92 B;  2XWJ I;  2KMS A;  1VVD A;  3K3T A;  3GXE A;  3MQL A;  2IZ3 A;  3SW0 X;  4KKD A;  3NFP I;  1G4F A;  1TPG A;  2Y8R A;  3F6K A;  1GKG A;  1SS2 A;  1OK1 A;  2RKZ A;  2UWN A;  3ERB A;  3WSY A;  5HZP B;  1E88 A;  1Q3X A;  2XWB F;  4N7E A;  1PPQ A;  4WJG 2;  3TVJ A;  2XRD A;  4CSY A;  5I0Q B;  2LOJ A;  1ZJK A;  2YBY A;  3IX0 A;  4AYM A;  3R62 A;  2CG6 A;  4IGD A; 
#chains in the Genus database with same CATH homology
 3KZJ A;  2W80 A;  1FBR A;  2RLP A;  4LOT A;  1H04 P;  1QO6 A;  3ZD1 A;  4ONT D;  4A5W B;  3INB C;  3O8E B;  3ZD2 A;  4DJZ A;  1OK9 A;  4K12 A;  1OK2 A;  1GKN A;  4AYD A;  2KRI A;  1HFH A;  4C16 A;  1MD7 A;  1MD8 A;  1ELV A;  1H2P P;  2JGW A;  1QGB A;  3OXU D;  3ZRZ A;  5JPM G;  3OED C;  1NWV A;  4AYI A;  1E5G A;  1GHQ B;  4F4O C;  2V8E A;  1O9A A;  3IU3 I;  1UOT P;  1TPM A;  2YRA A;  1LY2 A;  2CG7 A;  1CKL A;  2QY0 A;  4MUC A;  4ZH1 D;  1GPZ A;  5HYT B;  4B2R A;  1E8B A;  4PZ5 A;  2WII C;  5FO8 C;  1OJY A;  1U5M A;  3RJ3 D;  1OJW A;  3GOV A;  3T5O A;  2EC3 A;  3EJH A;  1H2Q P;  5HYU B;  2EHF A;  2IZ4 A;  2BZM A;  3L89 M;  1SRZ A;  2W81 A;  2MCZ A;  2MCY A;  3CAL A;  2ERJ A;  2JRA A;  4B2S A;  4YNX A;  2JGX A;  1G4G A;  1VVC A;  1OK3 A;  1OJV A;  4J38 B;  1C1Z A;  2G7I A;  4JHS A;  4AYE A;  2XRB A;  5HYP A;  1HFI A;  1HCC A;  3M7P A;  2RL0 A;  2B5I D;  4LOS A;  2RLQ A;  2XQW C;  3OP8 A;  2CKU A;  1TPN A;  2O39 C;  2RKY A;  1H03 P;  3KXV A;  2A55 A;  4FXG G;  1QUB A;  1Z92 B;  2XWJ I;  2KMS A;  1VVD A;  3GXE A;  3MQL A;  2IZ3 A;  3SW0 X;  4KKD A;  3NFP I;  1G4F A;  1TPG A;  1GKG A;  1SS2 A;  1OK1 A;  2RKZ A;  2UWN A;  3ERB A;  5HZP B;  1E88 A;  1Q3X A;  2XWB F;  3TVJ A;  1PPQ A;  4WJG 2;  2XRD A;  4CSY A;  5I0Q B;  2LOJ A;  1ZJK A;  2YBY A;  3IX0 A;  4AYM A;  3R62 A;  2CG6 A;  4IGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...