3ZSCA

Catalytic function and substrate recognition of the pectate lyase from thermotoga maritima
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
329
structure length
329
Chain Sequence
DKPVGFASVPTADLPEGTVGGLGGEIVFVRTAEELEKYTTAEGKYVIVVDGTIVFEPKREIKVLSDKTIVGINDAKIVGGGLVIKDAQNVIIRNIHFEGFYMEDDPRGKKYDFDYINVENSHHIWIDHITFVNGNDGAVDIKKYSNYITVSWNKFVDHDKVSLVGSSDKEDPEQAGQAYKVTYHHNYFKNLIQRMPRIRFGMAHVFNNFYSMGLRTGVSGNVFPIYGVASAMGAKVHVEGNYFMGYGAVMAEAGIAFLPTRIMGPVEGYLTLGEGDAKNEFYYCKEPEVRPVEEGKPALDPREYYDYTLDPVQDVPKIVVDGAGAGKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic Function and Substrate Recognition of the Pectate Lyase from Thermotoga Maritima
rcsb
molecule keywords PECTATE TRISACCHARIDE-LYASE
molecule tags Lyase
source organism Thermotoga maritima
total genus 132
structure length 329
sequence length 329
ec nomenclature ec 4.2.2.22: Pectate trisaccharide-lyase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3zscA00
3JURA 1KTWA 1DBOA 2X3HA 1OFLA 3WWGA 2NZMA 2NTPA 4OJ6A 4XL9A 2X85A 1DBGA 1RMGA 4U49A 1PE9A 1CZFA 4XOPA 2QY1A 2VJIA 1KCDA 3EQOA 1OOCA 1O8GA 4XN0A 1OGOX 3UW0A 4OJLA 1X0CA 1O88A 4OJ5A 4YEJA 1EE6A 3B4NA 2PYGA 3GQAA 2O0WA 4PMHA 4YELA 2PECA 4U4BA 2O0VA 3EQNA 4C2LA 3ZPPA 2Z8GA 1XG2A 4XLEA 5C1EA 4W8RA 4W8QA 1OGMX 4OJOA 2VBKA 4YZQA 4W8TA 3VSTA 3VMVA 1O8FA 2EWEA 2VBEA 1JTAA 1PXZA 4XOTA 1BHEA 2NTBA 4XR6A 1O8EA 1RWRA 1O8JA 4XORA 1QJVA 2BSPA 3GRHA 4XN3A 4MR0A 4XNFA 1NHCA 1WMRA 1QCXA 2NT6A 2VJJA 3VSUA 4XLHA 4URRA 3VMWA 4XKVA 3FY3A 4OZZA 4Z03A 5C1CA 3KRGA 1K5CA 1PLUA 4YZ0A 2INUA 2NT9A 1JRGA 2IQ7A 2X6WA 2O1DA 1RU4A 4I84A 1HG8A 4XLAA 3T9GA 4XLCA 2QXZA 3LMWA 4HWVA 3B90A 1IB4A 1BN8A 1O8IA 2NSTA 3VSVA 2O17A 2VBMA 4OZYA 4XONA 2PYHA 2ODLA 1H80A 5AMVA 2O04A 3SUCA 1O8DA 4Z05A 2UVEA 4NK6A 1O8MA 2NSPA 1O8KA 1OFMA 4XLFA 4Z06A 3GQ8A 4NK8A 4XM3A 4XMYA 1GQ8A 2X6XA 2INVA 4EW9A 2QX3A 1IDJA 1IA5A 4AVZA 3ZSCA 4W8SA 1O8HA 3GQ7A 4MXNA 1KCCA 4YZAA 3B8YA 4XQFA 4XKWA 2NTQA 4OJPA 1IDKA 3GQ9A 1O8LA 2UVFA 1AIRA 1VBLA 2X6YA 4YZXA
chains in the Genus database with same CATH superfamily
1TSPA 1KTWA 3JURA 1DBOA 2X3HA 1OFLA 3LYCA 3WWGA 2V5IA 2NZMA 2NTPA 4OJ6A 4XL9A 5DNSA 2X85A 1DBGA 1RMGA 4U49A 1PE9A 1CZFA 4XOPA 2QY1A 2VJIA 4V02C 1KCDA 3EQOA 1OOCA 1O8GA 2IOUG 2W7ZA 4XMYA 4XN0A 1OGOX 3UW0A 3BH7B 4OJLA 1LLWA 1EA0A 1X0CA 1O88A 4OJ5A 3SYJA 4YEJA 1EE6A 3B4NA 2PYGA 2YUHA 2O0WA 3GQAA 4PMHA 1QRCA 4YELA 4JRAC 3SZEA 2PECA 4U4BA 2O0VA 3EQNA 4KH3A 3ZPPA 2Z8GA 1K4ZA 1XG2A 1QRBA 4C2LA 4XLEA 5C1EA 4W8RA 4YEIA 1QA1A 3H09A 4W8QA 1OGMX 4OJOA 1HF2A 2VBKA 4YZQA 1QQ1A 3PETA 4W8TA 3VSTA 3N90A 3VMVA 1O8FA 4YDTA 2VFMA 2VFQA 2EWEA 2VBEA 3SQVA 1QA2A 2VFPA 2XT2A 1JTAA 1WXRA 1PXZA 1LLZA 4XOTA 2QZAA 1BHEA 2NTBA 4XR6A 2XT4A 1O8EA 1CLWA 1RWRA 1O8JA 3NB2A 3AK5A 4XORA 1QJVA 2BSPA 2G0YA 3GRHA 4XN3A 4MR0A 4XNFA 2QYUA 1NHCA 1WMRA 1QCXA 2NT6A 2VJJA 3VSUA 4XLHA 4URRA 3VMWA 4XKVA 2F3LA 2BM6A 3N6ZA 3FY3A 4OZZA 3BH6B 4Z03A 5C1CA 3KRGA 1DABA 2O6WA 1K5CA 1PLUA 4YZ0A 2INUA 2NT9A 1JRGA 2IQ7A 3NAWA 4OM9A 2X6WA 2O1DA 1RU4A 2X6YA 4I84A 1HG8A 4XLAA 2J8KA 3T9GA 5JLVC 4XLCA 2QXZA 3LMWA 4HWVA 3B90A 3SY2A 1TYWA 1IB4A 1BN8A 1O8IA 3TH0A 2NSTA 3VSVA 2O17A 2VBMA 4OZYA 2VFOA 3RIQA 4XONA 2PYHA 2BM4A 2ODLA 3PSZA 1H80A 1L1IA 5AMVA 1K8FA 2J8IA 2O04A 3SUCA 3P4GA 4YCQA 1O8DA 4Z05A 1EZGA 2VFNA 2UVEA 4NK6A 5JMCB 3JX8A 1O8MA 2NSPA 1O8KA 4YFOA 1OFMA 4XLFA 1OFEA 2XC1A 4Z06A 1OFDA 3GQ8A 4NK8A 4XM3A 2XTXA 1KQ5A 1GQ8A 2B0RA 1LM1A 2INVA 2X6XA 2QX3A 4OPWA 1IDJA 4EW9A 1IA5A 3LJYA 4AVZA 3ZSCA 2BM5A 4W8SA 3ML3A 4YC5A 1O8HA 1TYVA 3GQ7A 1QA3A 4MXNA 1TYXA 2XTYA 1KCCA 4YZAA 3B8YA 4XQFA 3DU1X 4XKWA 3PSSA 2NTQA 4OJPA 2BX6A 2BM7A 2XTWA 3GQ9A 1O8LA 2UVFA 1AIRA 1TYUA 1VBLA 1IDKA 4YZXA
chains in the Genus database with same CATH topology
3JURA 1KTWA 1DBOA 2X3HA 1OFLA 3WWGA 2NZMA 2NTPA 4OJ6A 4XL9A 2X85A 1DBGA 1RMGA 4U49A 1PE9A 1CZFA 4XOPA 2QY1A 2VJIA 1KCDA 3EQOA 1OOCA 1O8GA 4XN0A 1OGOX 3UW0A 4OJLA 1X0CA 1O88A 4OJ5A 4YEJA 1EE6A 3B4NA 2PYGA 3GQAA 2O0WA 4PMHA 4YELA 2PECA 4U4BA 2O0VA 3EQNA 4C2LA 3ZPPA 2Z8GA 1XG2A 4XLEA 5C1EA 4W8RA 4W8QA 1OGMX 4OJOA 2VBKA 4YZQA 4W8TA 3VSTA 3VMVA 1O8FA 2EWEA 2VBEA 1JTAA 1PXZA 4XOTA 1BHEA 2NTBA 4XR6A 1O8EA 1RWRA 1O8JA 4XORA 1QJVA 2BSPA 3GRHA 4XN3A 4MR0A 4XNFA 1NHCA 1WMRA 1QCXA 2NT6A 2VJJA 3VSUA 4XLHA 4URRA 3VMWA 4XKVA 3FY3A 4OZZA 4Z03A 5C1CA 3KRGA 1K5CA 1PLUA 4YZ0A 2INUA 2NT9A 1JRGA 2IQ7A 2X6WA 2O1DA 1RU4A 4I84A 1HG8A 4XLAA 3T9GA 4XLCA 2QXZA 3LMWA 4HWVA 3B90A 1IB4A 1BN8A 1O8IA 2NSTA 3VSVA 2O17A 2VBMA 4OZYA 4XONA 2PYHA 2ODLA 1H80A 5AMVA 2O04A 3SUCA 1O8DA 4Z05A 2UVEA 4NK6A 1O8MA 2NSPA 1O8KA 1OFMA 4XLFA 4Z06A 3GQ8A 4NK8A 4XM3A 4XMYA 1GQ8A 2X6XA 2INVA 4EW9A 2QX3A 1IDJA 1IA5A 4AVZA 3ZSCA 4W8SA 1O8HA 3GQ7A 4MXNA 1KCCA 4YZAA 3B8YA 4XQFA 4XKWA 2NTQA 4OJPA 1IDKA 3GQ9A 1O8LA 2UVFA 1AIRA 1VBLA 2X6YA 4YZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUR A;  1KTW A;  1DBO A;  2X3H A;  1OFL A;  3WWG A;  2NZM A;  2NTP A;  4OJ6 A;  4XL9 A;  2X85 A;  1DBG A;  1RMG A;  4U49 A;  1PE9 A;  1CZF A;  4XOP A;  2QY1 A;  2VJI A;  1KCD A;  3EQO A;  1OOC A;  1O8G A;  4XN0 A;  1OGO X;  3UW0 A;  4OJL A;  1X0C A;  1O88 A;  4OJ5 A;  4YEJ A;  1EE6 A;  3B4N A;  2PYG A;  3GQA A;  2O0W A;  4PMH A;  4YEL A;  2PEC A;  4U4B A;  2O0V A;  3EQN A;  4C2L A;  3ZPP A;  2Z8G A;  1XG2 A;  4XLE A;  5C1E A;  4W8R A;  4W8Q A;  1OGM X;  4OJO A;  2VBK A;  4YZQ A;  4W8T A;  3VST A;  3VMV A;  1O8F A;  2EWE A;  2VBE A;  1JTA A;  1PXZ A;  4XOT A;  1BHE A;  2NTB A;  4XR6 A;  1O8E A;  1RWR A;  1O8J A;  4XOR A;  1QJV A;  2BSP A;  3GRH A;  4XN3 A;  4MR0 A;  4XNF A;  1NHC A;  1WMR A;  1QCX A;  2NT6 A;  2VJJ A;  3VSU A;  4XLH A;  4URR A;  3VMW A;  4XKV A;  3FY3 A;  4OZZ A;  4Z03 A;  5C1C A;  3KRG A;  1K5C A;  1PLU A;  4YZ0 A;  2INU A;  2NT9 A;  1JRG A;  2IQ7 A;  2X6W A;  2O1D A;  1RU4 A;  4I84 A;  1HG8 A;  4XLA A;  3T9G A;  4XLC A;  2QXZ A;  3LMW A;  4HWV A;  3B90 A;  1IB4 A;  1BN8 A;  1O8I A;  2NST A;  3VSV A;  2O17 A;  2VBM A;  4OZY A;  4XON A;  2PYH A;  2ODL A;  1H80 A;  5AMV A;  2O04 A;  3SUC A;  1O8D A;  4Z05 A;  2UVE A;  4NK6 A;  1O8M A;  2NSP A;  1O8K A;  1OFM A;  4XLF A;  4Z06 A;  3GQ8 A;  4NK8 A;  4XM3 A;  4XMY A;  1GQ8 A;  2X6X A;  2INV A;  4EW9 A;  2QX3 A;  1IDJ A;  1IA5 A;  4AVZ A;  3ZSC A;  4W8S A;  1O8H A;  3GQ7 A;  4MXN A;  1KCC A;  4YZA A;  3B8Y A;  4XQF A;  4XKW A;  2NTQ A;  4OJP A;  1IDK A;  3GQ9 A;  1O8L A;  2UVF A;  1AIR A;  1VBL A;  2X6Y A;  4YZX A; 
#chains in the Genus database with same CATH topology
 1TSP A;  1KTW A;  3JUR A;  1DBO A;  2X3H A;  1OFL A;  3LYC A;  3WWG A;  2V5I A;  2NZM A;  2NTP A;  4OJ6 A;  4XL9 A;  5DNS A;  2X85 A;  1DBG A;  1RMG A;  4U49 A;  1PE9 A;  1CZF A;  4XOP A;  2QY1 A;  2VJI A;  4V02 C;  1KCD A;  3EQO A;  1OOC A;  1O8G A;  2IOU G;  2W7Z A;  4XMY A;  4XN0 A;  1OGO X;  3UW0 A;  3BH7 B;  4OJL A;  1LLW A;  1EA0 A;  1X0C A;  1O88 A;  4OJ5 A;  3SYJ A;  4YEJ A;  1EE6 A;  3B4N A;  2PYG A;  2YUH A;  2O0W A;  3GQA A;  4PMH A;  1QRC A;  4YEL A;  4JRA C;  3SZE A;  2PEC A;  4U4B A;  2O0V A;  3EQN A;  4KH3 A;  3ZPP A;  2Z8G A;  1K4Z A;  1XG2 A;  1QRB A;  4C2L A;  4XLE A;  5C1E A;  4W8R A;  4YEI A;  1QA1 A;  3H09 A;  4W8Q A;  1OGM X;  4OJO A;  1HF2 A;  2VBK A;  4YZQ A;  1QQ1 A;  3PET A;  4W8T A;  3VST A;  3N90 A;  3VMV A;  1O8F A;  4YDT A;  2VFM A;  2VFQ A;  2EWE A;  2VBE A;  3SQV A;  1QA2 A;  2VFP A;  2XT2 A;  1JTA A;  1WXR A;  1PXZ A;  1LLZ A;  4XOT A;  2QZA A;  1BHE A;  2NTB A;  4XR6 A;  2XT4 A;  1O8E A;  1CLW A;  1RWR A;  1O8J A;  3NB2 A;  3AK5 A;  4XOR A;  1QJV A;  2BSP A;  2G0Y A;  3GRH A;  4XN3 A;  4MR0 A;  4XNF A;  2QYU A;  1NHC A;  1WMR A;  1QCX A;  2NT6 A;  2VJJ A;  3VSU A;  4XLH A;  4URR A;  3VMW A;  4XKV A;  2F3L A;  2BM6 A;  3N6Z A;  3FY3 A;  4OZZ A;  3BH6 B;  4Z03 A;  5C1C A;  3KRG A;  1DAB A;  2O6W A;  1K5C A;  1PLU A;  4YZ0 A;  2INU A;  2NT9 A;  1JRG A;  2IQ7 A;  3NAW A;  4OM9 A;  2X6W A;  2O1D A;  1RU4 A;  2X6Y A;  4I84 A;  1HG8 A;  4XLA A;  2J8K A;  3T9G A;  5JLV C;  4XLC A;  2QXZ A;  3LMW A;  4HWV A;  3B90 A;  3SY2 A;  1TYW A;  1IB4 A;  1BN8 A;  1O8I A;  3TH0 A;  2NST A;  3VSV A;  2O17 A;  2VBM A;  4OZY A;  2VFO A;  3RIQ A;  4XON A;  2PYH A;  2BM4 A;  2ODL A;  3PSZ A;  1H80 A;  1L1I A;  5AMV A;  1K8F A;  2J8I A;  2O04 A;  3SUC A;  3P4G A;  4YCQ A;  1O8D A;  4Z05 A;  1EZG A;  2VFN A;  2UVE A;  4NK6 A;  5JMC B;  3JX8 A;  1O8M A;  2NSP A;  1O8K A;  4YFO A;  1OFM A;  4XLF A;  1OFE A;  2XC1 A;  4Z06 A;  1OFD A;  3GQ8 A;  4NK8 A;  4XM3 A;  2XTX A;  1KQ5 A;  1GQ8 A;  2B0R A;  1LM1 A;  2INV A;  2X6X A;  2QX3 A;  4OPW A;  1IDJ A;  4EW9 A;  1IA5 A;  3LJY A;  4AVZ A;  3ZSC A;  2BM5 A;  4W8S A;  3ML3 A;  4YC5 A;  1O8H A;  1TYV A;  3GQ7 A;  1QA3 A;  4MXN A;  1TYX A;  2XTY A;  1KCC A;  4YZA A;  3B8Y A;  4XQF A;  3DU1 X;  4XKW A;  3PSS A;  2NTQ A;  4OJP A;  2BX6 A;  2BM7 A;  2XTW A;  3GQ9 A;  1O8L A;  2UVF A;  1AIR A;  1TYU A;  1VBL A;  1IDK A;  4YZX A; 
#chains in the Genus database with same CATH homology
 3JUR A;  1KTW A;  1DBO A;  2X3H A;  1OFL A;  3WWG A;  2NZM A;  2NTP A;  4OJ6 A;  4XL9 A;  2X85 A;  1DBG A;  1RMG A;  4U49 A;  1PE9 A;  1CZF A;  4XOP A;  2QY1 A;  2VJI A;  1KCD A;  3EQO A;  1OOC A;  1O8G A;  4XN0 A;  1OGO X;  3UW0 A;  4OJL A;  1X0C A;  1O88 A;  4OJ5 A;  4YEJ A;  1EE6 A;  3B4N A;  2PYG A;  3GQA A;  2O0W A;  4PMH A;  4YEL A;  2PEC A;  4U4B A;  2O0V A;  3EQN A;  4C2L A;  3ZPP A;  2Z8G A;  1XG2 A;  4XLE A;  5C1E A;  4W8R A;  4W8Q A;  1OGM X;  4OJO A;  2VBK A;  4YZQ A;  4W8T A;  3VST A;  3VMV A;  1O8F A;  2EWE A;  2VBE A;  1JTA A;  1PXZ A;  4XOT A;  1BHE A;  2NTB A;  4XR6 A;  1O8E A;  1RWR A;  1O8J A;  4XOR A;  1QJV A;  2BSP A;  3GRH A;  4XN3 A;  4MR0 A;  4XNF A;  1NHC A;  1WMR A;  1QCX A;  2NT6 A;  2VJJ A;  3VSU A;  4XLH A;  4URR A;  3VMW A;  4XKV A;  3FY3 A;  4OZZ A;  4Z03 A;  5C1C A;  3KRG A;  1K5C A;  1PLU A;  4YZ0 A;  2INU A;  2NT9 A;  1JRG A;  2IQ7 A;  2X6W A;  2O1D A;  1RU4 A;  4I84 A;  1HG8 A;  4XLA A;  3T9G A;  4XLC A;  2QXZ A;  3LMW A;  4HWV A;  3B90 A;  1IB4 A;  1BN8 A;  1O8I A;  2NST A;  3VSV A;  2O17 A;  2VBM A;  4OZY A;  4XON A;  2PYH A;  2ODL A;  1H80 A;  5AMV A;  2O04 A;  3SUC A;  1O8D A;  4Z05 A;  2UVE A;  4NK6 A;  1O8M A;  2NSP A;  1O8K A;  1OFM A;  4XLF A;  4Z06 A;  3GQ8 A;  4NK8 A;  4XM3 A;  4XMY A;  1GQ8 A;  2X6X A;  2INV A;  4EW9 A;  2QX3 A;  1IDJ A;  1IA5 A;  4AVZ A;  3ZSC A;  4W8S A;  1O8H A;  3GQ7 A;  4MXN A;  1KCC A;  4YZA A;  3B8Y A;  4XQF A;  4XKW A;  2NTQ A;  4OJP A;  1IDK A;  3GQ9 A;  1O8L A;  2UVF A;  1AIR A;  1VBL A;  2X6Y A;  4YZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...