3ZSCA

Catalytic function and substrate recognition of the pectate lyase from thermotoga maritima
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
329
structure length
329
Chain Sequence
b'DKPVGFASVPTADLPEGTVGGLGGEIVFVRTAEELEKYTTAEGKYVIVVDGTIVFEPKREIKVLSDKTIVGINDAKIVGGGLVIKDAQNVIIRNIHFEGFYMEDDPRGKKYDFDYINVENSHHIWIDHITFVNGNDGAVDIKKYSNYITVSWNKFVDHDKVSLVGSSDKEDPEQAGQAYKVTYHHNYFKNLIQRMPRIRFGMAHVFNNFYSMGLRTGVSGNVFPIYGVASAMGAKVHVEGNYFMGYGAVMAEAGIAFLPTRIMGPVEGYLTLGEGDAKNEFYYCKEPEVRPVEEGKPALDPREYYDYTLDPVQDVPKIVVDGAGAGKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PECTATE TRISACCHARIDE-LYASE
publication title Catalytic Function and Substrate Recognition of the Pectate Lyase from Thermotoga Maritima
rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 132
structure length 329
sequence length 329
ec nomenclature ec 4.2.2.22: Pectate trisaccharide-lyase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3zscA00
3GRHA 4MXNA 4AVZA 1RU4A 4OJPA 1DBGA 1BHEA 1IDJA 4Z03A 1GQ8A 2O04A 4W8RA 4XOTA 2INVA 2VBMA 2NT9A 2X6XA 2QX3A 4Z06A 3JURA 4XONA 1O8KA 4XLCA 2X3HA 3VMVA 2X85A 4XN0A 1IDKA 3VSVA 1PXZA 3SUCA 4NK6A 4OJLA 4URRA 4OJ5A 3GQAA 4XQFA 4XMYA 2EWEA 5AMVA 1JTAA 3EQNA 4XLEA 4XOPA 4XLAA 4W8SA 3ZSCA 1KCCA 3ZPPA 3VSTA 1OGMX 2X6YA 1O8LA 2PYGA 3FY3A 2PECA 2Z8GA 3KRGA 1O8EA 2UVEA 4YZ0A 2IQ7A 4OJ6A 2VBEA 2X6WA 1WMRA 4XKVA 1OFLA 1HG8A 1KTWA 2O0VA 1H80A 4I84A 1EE6A 2O17A 1BN8A 1O8FA 1IB4A 1IA5A 4NK8A 4YEJA 1AIRA 1X0CA 4U4BA 4W8TA 1NHCA 4EW9A 4YZAA 3B4NA 3GQ8A 2O1DA 3VSUA 2QXZA 1PE9A 4XORA 2PYHA 2NT6A 2NTPA 2NSPA 3GQ9A 4YZQA 4OZYA 4YELA 1O8DA 4YZXA 2NSTA 3T9GA 3B90A 4XN3A 2NTQA 2NZMA 1O8JA 4XKWA 4MR0A 1XG2A 1O8IA 1O8HA 1O88A 4W8QA 2O0WA 1QJVA 1OGOX 3VMWA 5C1CA 1QCXA 1CZFA 1JRGA 2INUA 4OZZA 4OJOA 3EQOA 4XL9A 1KCDA 4C2LA 4XR6A 1VBLA 1O8MA 2BSPA 3B8YA 1DBOA 1K5CA 2NTBA 1RWRA 5C1EA 4XLHA 3WWGA 1O8GA 2ODLA 4PMHA 4HWVA 4Z05A 1OOCA 3UW0A 4XLFA 2VBKA 2QY1A 4XNFA 1PLUA 4U49A 1RMGA 3GQ7A 2VJJA 4XM3A 1OFMA 2VJIA 2UVFA 3LMWA
chains in the Genus database with same CATH superfamily
3GRHA 4MXNA 2VFNA 4AVZA 1TSPA 1RU4A 4YCQA 4OJPA 5DNSA 1DBGA 1BHEA 1IDJA 4Z03A 1GQ8A 2VFQA 2O04A 4W8RA 4XOTA 2INVA 1QA2A 5JLVC 2VBMA 2NT9A 1WXRA 2X6XA 2QX3A 1TYWA 4Z06A 3JURA 4XONA 2VFPA 2VFOA 3PETA 1O8KA 4XLCA 2X3HA 3VMVA 2X85A 2IOUG 1DABA 4XN0A 3NB2A 2QYUA 1IDKA 3VSVA 1PXZA 3RIQA 4NK6A 4KH3A 4OJLA 4URRA 2W7ZA 3GQAA 4OJ5A 1OFDA 2EWEA 4XMYA 4XQFA 5AMVA 1JTAA 3EQNA 4XLEA 4XOPA 4XLAA 4W8SA 2BM4A 3ZSCA 1KCCA 3ZPPA 3VSTA 1OGMX 2X6YA 1O8LA 1HF2A 2O6WA 2PYGA 2XTWA 3FY3A 2PECA 4YEIA 1LM1A 2Z8GA 2QZAA 3KRGA 1OFEA 1O8EA 2UVEA 4YZ0A 2IQ7A 4OJ6A 1KQ5A 2VBEA 2X6WA 1WMRA 4OPWA 4XKVA 4YDTA 1OFLA 3LYCA 5JMCB 1HG8A 1QA1A 1KTWA 2O0VA 1H80A 4I84A 1EE6A 2O17A 2XC1A 1BN8A 1O8FA 1IB4A 3DU1X 1IA5A 4NK8A 4YEJA 1AIRA 1X0CA 4U4BA 1TYXA 2BM5A 4W8TA 3BH7B 1NHCA 4EW9A 4YZAA 2YUHA 3B4NA 3GQ8A 2O1DA 3VSUA 2QXZA 2V5IA 3NAWA 2BM7A 3JX8A 2XTXA 1PE9A 4XORA 2PYHA 2NT6A 2NTPA 2NSPA 3GQ9A 4YZQA 1L1IA 4OZYA 4YELA 1O8DA 1QRBA 4YZXA 2NSTA 3T9GA 3B90A 3LJYA 4XN3A 1CLWA 2NTQA 2NZMA 4OM9A 1O8JA 4V02C 2J8IA 3SYJA 4XKWA 3SUCA 1EZGA 2G0YA 3N6ZA 2J8KA 2VFMA 4MR0A 1XG2A 3PSSA 1LLZA 2BX6A 2XTYA 1O8IA 1O8HA 4YFOA 1O88A 4W8QA 2O0WA 1QJVA 1OGOX 3VMWA 5C1CA 1QCXA 1CZFA 1QRCA 2XT2A 1JRGA 2B0RA 2INUA 3N90A 4OZZA 4OJOA 3EQOA 4XL9A 3TH0A 1KCDA 3H09A 4C2LA 1QQ1A 4XR6A 1VBLA 1O8MA 2BSPA 4YC5A 3B8YA 1DBOA 3P4GA 1K5CA 1TYUA 2NTBA 2BM6A 1RWRA 1TYVA 5C1EA 4XLHA 2F3LA 3WWGA 1O8GA 2ODLA 4PMHA 3BH6B 4HWVA 4Z05A 1OOCA 3SY2A 3UW0A 4XLFA 2VBKA 3SQVA 3ML3A 1K4ZA 2QY1A 4XNFA 1PLUA 1K8FA 4U49A 3SZEA 1RMGA 3GQ7A 1EA0A 1QA3A 2VJJA 4XM3A 3AK5A 4JRAC 1OFMA 2VJIA 3PSZA 1LLWA 2XT4A 2UVFA 3LMWA
chains in the Genus database with same CATH topology
3GRHA 4MXNA 4AVZA 1RU4A 4OJPA 1DBGA 1BHEA 1IDJA 4Z03A 1GQ8A 2O04A 4W8RA 4XOTA 2INVA 2VBMA 2NT9A 2X6XA 2QX3A 4Z06A 3JURA 4XONA 1O8KA 4XLCA 2X3HA 3VMVA 2X85A 4XN0A 1IDKA 3VSVA 1PXZA 3SUCA 4NK6A 4OJLA 4URRA 4OJ5A 3GQAA 4XQFA 4XMYA 2EWEA 5AMVA 1JTAA 3EQNA 4XLEA 4XOPA 4XLAA 4W8SA 3ZSCA 1KCCA 3ZPPA 3VSTA 1OGMX 2X6YA 1O8LA 2PYGA 3FY3A 2PECA 2Z8GA 3KRGA 1O8EA 2UVEA 4YZ0A 2IQ7A 4OJ6A 2VBEA 2X6WA 1WMRA 4XKVA 1OFLA 1HG8A 1KTWA 2O0VA 1H80A 4I84A 1EE6A 2O17A 1BN8A 1O8FA 1IB4A 1IA5A 4NK8A 4YEJA 1AIRA 1X0CA 4U4BA 4W8TA 1NHCA 4EW9A 4YZAA 3B4NA 3GQ8A 2O1DA 3VSUA 2QXZA 1PE9A 4XORA 2PYHA 2NT6A 2NTPA 2NSPA 3GQ9A 4YZQA 4OZYA 4YELA 1O8DA 4YZXA 2NSTA 3T9GA 3B90A 4XN3A 2NTQA 2NZMA 1O8JA 4XKWA 4MR0A 1XG2A 1O8IA 1O8HA 1O88A 4W8QA 2O0WA 1QJVA 1OGOX 3VMWA 5C1CA 1QCXA 1CZFA 1JRGA 2INUA 4OZZA 4OJOA 3EQOA 4XL9A 1KCDA 4C2LA 4XR6A 1VBLA 1O8MA 2BSPA 3B8YA 1DBOA 1K5CA 2NTBA 1RWRA 5C1EA 4XLHA 3WWGA 1O8GA 2ODLA 4PMHA 4HWVA 4Z05A 1OOCA 3UW0A 4XLFA 2VBKA 2QY1A 4XNFA 1PLUA 4U49A 1RMGA 3GQ7A 2VJJA 4XM3A 1OFMA 2VJIA 2UVFA 3LMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRH A;  4MXN A;  4AVZ A;  1RU4 A;  4OJP A;  1DBG A;  1BHE A;  1IDJ A;  4Z03 A;  1GQ8 A;  2O04 A;  4W8R A;  4XOT A;  2INV A;  2VBM A;  2NT9 A;  2X6X A;  2QX3 A;  4Z06 A;  3JUR A;  4XON A;  1O8K A;  4XLC A;  2X3H A;  3VMV A;  2X85 A;  4XN0 A;  1IDK A;  3VSV A;  1PXZ A;  3SUC A;  4NK6 A;  4OJL A;  4URR A;  4OJ5 A;  3GQA A;  4XQF A;  4XMY A;  2EWE A;  5AMV A;  1JTA A;  3EQN A;  4XLE A;  4XOP A;  4XLA A;  4W8S A;  3ZSC A;  1KCC A;  3ZPP A;  3VST A;  1OGM X;  2X6Y A;  1O8L A;  2PYG A;  3FY3 A;  2PEC A;  2Z8G A;  3KRG A;  1O8E A;  2UVE A;  4YZ0 A;  2IQ7 A;  4OJ6 A;  2VBE A;  2X6W A;  1WMR A;  4XKV A;  1OFL A;  1HG8 A;  1KTW A;  2O0V A;  1H80 A;  4I84 A;  1EE6 A;  2O17 A;  1BN8 A;  1O8F A;  1IB4 A;  1IA5 A;  4NK8 A;  4YEJ A;  1AIR A;  1X0C A;  4U4B A;  4W8T A;  1NHC A;  4EW9 A;  4YZA A;  3B4N A;  3GQ8 A;  2O1D A;  3VSU A;  2QXZ A;  1PE9 A;  4XOR A;  2PYH A;  2NT6 A;  2NTP A;  2NSP A;  3GQ9 A;  4YZQ A;  4OZY A;  4YEL A;  1O8D A;  4YZX A;  2NST A;  3T9G A;  3B90 A;  4XN3 A;  2NTQ A;  2NZM A;  1O8J A;  4XKW A;  4MR0 A;  1XG2 A;  1O8I A;  1O8H A;  1O88 A;  4W8Q A;  2O0W A;  1QJV A;  1OGO X;  3VMW A;  5C1C A;  1QCX A;  1CZF A;  1JRG A;  2INU A;  4OZZ A;  4OJO A;  3EQO A;  4XL9 A;  1KCD A;  4C2L A;  4XR6 A;  1VBL A;  1O8M A;  2BSP A;  3B8Y A;  1DBO A;  1K5C A;  2NTB A;  1RWR A;  5C1E A;  4XLH A;  3WWG A;  1O8G A;  2ODL A;  4PMH A;  4HWV A;  4Z05 A;  1OOC A;  3UW0 A;  4XLF A;  2VBK A;  2QY1 A;  4XNF A;  1PLU A;  4U49 A;  1RMG A;  3GQ7 A;  2VJJ A;  4XM3 A;  1OFM A;  2VJI A;  2UVF A;  3LMW A; 
#chains in the Genus database with same CATH topology
 3GRH A;  4MXN A;  2VFN A;  4AVZ A;  1TSP A;  1RU4 A;  4YCQ A;  4OJP A;  5DNS A;  1DBG A;  1BHE A;  1IDJ A;  4Z03 A;  1GQ8 A;  2VFQ A;  2O04 A;  4W8R A;  4XOT A;  2INV A;  1QA2 A;  5JLV C;  2VBM A;  2NT9 A;  1WXR A;  2X6X A;  2QX3 A;  1TYW A;  4Z06 A;  3JUR A;  4XON A;  2VFP A;  2VFO A;  3PET A;  1O8K A;  4XLC A;  2X3H A;  3VMV A;  2X85 A;  2IOU G;  1DAB A;  4XN0 A;  3NB2 A;  2QYU A;  1IDK A;  3VSV A;  1PXZ A;  3RIQ A;  4NK6 A;  4KH3 A;  4OJL A;  4URR A;  2W7Z A;  3GQA A;  4OJ5 A;  1OFD A;  2EWE A;  4XMY A;  4XQF A;  5AMV A;  1JTA A;  3EQN A;  4XLE A;  4XOP A;  4XLA A;  4W8S A;  2BM4 A;  3ZSC A;  1KCC A;  3ZPP A;  3VST A;  1OGM X;  2X6Y A;  1O8L A;  1HF2 A;  2O6W A;  2PYG A;  2XTW A;  3FY3 A;  2PEC A;  4YEI A;  1LM1 A;  2Z8G A;  2QZA A;  3KRG A;  1OFE A;  1O8E A;  2UVE A;  4YZ0 A;  2IQ7 A;  4OJ6 A;  1KQ5 A;  2VBE A;  2X6W A;  1WMR A;  4OPW A;  4XKV A;  4YDT A;  1OFL A;  3LYC A;  5JMC B;  1HG8 A;  1QA1 A;  1KTW A;  2O0V A;  1H80 A;  4I84 A;  1EE6 A;  2O17 A;  2XC1 A;  1BN8 A;  1O8F A;  1IB4 A;  3DU1 X;  1IA5 A;  4NK8 A;  4YEJ A;  1AIR A;  1X0C A;  4U4B A;  1TYX A;  2BM5 A;  4W8T A;  3BH7 B;  1NHC A;  4EW9 A;  4YZA A;  2YUH A;  3B4N A;  3GQ8 A;  2O1D A;  3VSU A;  2QXZ A;  2V5I A;  3NAW A;  2BM7 A;  3JX8 A;  2XTX A;  1PE9 A;  4XOR A;  2PYH A;  2NT6 A;  2NTP A;  2NSP A;  3GQ9 A;  4YZQ A;  1L1I A;  4OZY A;  4YEL A;  1O8D A;  1QRB A;  4YZX A;  2NST A;  3T9G A;  3B90 A;  3LJY A;  4XN3 A;  1CLW A;  2NTQ A;  2NZM A;  4OM9 A;  1O8J A;  4V02 C;  2J8I A;  3SYJ A;  4XKW A;  3SUC A;  1EZG A;  2G0Y A;  3N6Z A;  2J8K A;  2VFM A;  4MR0 A;  1XG2 A;  3PSS A;  1LLZ A;  2BX6 A;  2XTY A;  1O8I A;  1O8H A;  4YFO A;  1O88 A;  4W8Q A;  2O0W A;  1QJV A;  1OGO X;  3VMW A;  5C1C A;  1QCX A;  1CZF A;  1QRC A;  2XT2 A;  1JRG A;  2B0R A;  2INU A;  3N90 A;  4OZZ A;  4OJO A;  3EQO A;  4XL9 A;  3TH0 A;  1KCD A;  3H09 A;  4C2L A;  1QQ1 A;  4XR6 A;  1VBL A;  1O8M A;  2BSP A;  4YC5 A;  3B8Y A;  1DBO A;  3P4G A;  1K5C A;  1TYU A;  2NTB A;  2BM6 A;  1RWR A;  1TYV A;  5C1E A;  4XLH A;  2F3L A;  3WWG A;  1O8G A;  2ODL A;  4PMH A;  3BH6 B;  4HWV A;  4Z05 A;  1OOC A;  3SY2 A;  3UW0 A;  4XLF A;  2VBK A;  3SQV A;  3ML3 A;  1K4Z A;  2QY1 A;  4XNF A;  1PLU A;  1K8F A;  4U49 A;  3SZE A;  1RMG A;  3GQ7 A;  1EA0 A;  1QA3 A;  2VJJ A;  4XM3 A;  3AK5 A;  4JRA C;  1OFM A;  2VJI A;  3PSZ A;  1LLW A;  2XT4 A;  2UVF A;  3LMW A; 
#chains in the Genus database with same CATH homology
 3GRH A;  4MXN A;  4AVZ A;  1RU4 A;  4OJP A;  1DBG A;  1BHE A;  1IDJ A;  4Z03 A;  1GQ8 A;  2O04 A;  4W8R A;  4XOT A;  2INV A;  2VBM A;  2NT9 A;  2X6X A;  2QX3 A;  4Z06 A;  3JUR A;  4XON A;  1O8K A;  4XLC A;  2X3H A;  3VMV A;  2X85 A;  4XN0 A;  1IDK A;  3VSV A;  1PXZ A;  3SUC A;  4NK6 A;  4OJL A;  4URR A;  4OJ5 A;  3GQA A;  4XQF A;  4XMY A;  2EWE A;  5AMV A;  1JTA A;  3EQN A;  4XLE A;  4XOP A;  4XLA A;  4W8S A;  3ZSC A;  1KCC A;  3ZPP A;  3VST A;  1OGM X;  2X6Y A;  1O8L A;  2PYG A;  3FY3 A;  2PEC A;  2Z8G A;  3KRG A;  1O8E A;  2UVE A;  4YZ0 A;  2IQ7 A;  4OJ6 A;  2VBE A;  2X6W A;  1WMR A;  4XKV A;  1OFL A;  1HG8 A;  1KTW A;  2O0V A;  1H80 A;  4I84 A;  1EE6 A;  2O17 A;  1BN8 A;  1O8F A;  1IB4 A;  1IA5 A;  4NK8 A;  4YEJ A;  1AIR A;  1X0C A;  4U4B A;  4W8T A;  1NHC A;  4EW9 A;  4YZA A;  3B4N A;  3GQ8 A;  2O1D A;  3VSU A;  2QXZ A;  1PE9 A;  4XOR A;  2PYH A;  2NT6 A;  2NTP A;  2NSP A;  3GQ9 A;  4YZQ A;  4OZY A;  4YEL A;  1O8D A;  4YZX A;  2NST A;  3T9G A;  3B90 A;  4XN3 A;  2NTQ A;  2NZM A;  1O8J A;  4XKW A;  4MR0 A;  1XG2 A;  1O8I A;  1O8H A;  1O88 A;  4W8Q A;  2O0W A;  1QJV A;  1OGO X;  3VMW A;  5C1C A;  1QCX A;  1CZF A;  1JRG A;  2INU A;  4OZZ A;  4OJO A;  3EQO A;  4XL9 A;  1KCD A;  4C2L A;  4XR6 A;  1VBL A;  1O8M A;  2BSP A;  3B8Y A;  1DBO A;  1K5C A;  2NTB A;  1RWR A;  5C1E A;  4XLH A;  3WWG A;  1O8G A;  2ODL A;  4PMH A;  4HWV A;  4Z05 A;  1OOC A;  3UW0 A;  4XLF A;  2VBK A;  2QY1 A;  4XNF A;  1PLU A;  4U49 A;  1RMG A;  3GQ7 A;  2VJJ A;  4XM3 A;  1OFM A;  2VJI A;  2UVF A;  3LMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...