3ZSCA

Catalytic function and substrate recognition of the pectate lyase from thermotoga maritima
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
329
structure length
329
Chain Sequence
DKPVGFASVPTADLPEGTVGGLGGEIVFVRTAEELEKYTTAEGKYVIVVDGTIVFEPKREIKVLSDKTIVGINDAKIVGGGLVIKDAQNVIIRNIHFEGFYMEDDPRGKKYDFDYINVENSHHIWIDHITFVNGNDGAVDIKKYSNYITVSWNKFVDHDKVSLVGSSDKEDPEQAGQAYKVTYHHNYFKNLIQRMPRIRFGMAHVFNNFYSMGLRTGVSGNVFPIYGVASAMGAKVHVEGNYFMGYGAVMAEAGIAFLPTRIMGPVEGYLTLGEGDAKNEFYYCKEPEVRPVEEGKPALDPREYYDYTLDPVQDVPKIVVDGAGAGKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PECTATE TRISACCHARIDE-LYASE
publication title Catalytic Function and Substrate Recognition of the Pectate Lyase from Thermotoga Maritima
rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 132
structure length 329
sequence length 329
ec nomenclature ec 4.2.2.22: Pectate trisaccharide-lyase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3zscA00
2O17A 4XN3A 1NHCA 1RWRA 4OJLA 3EQOA 3EQNA 1JRGA 2QX3A 4Z06A 1O88A 3GRHA 1KCCA 1PE9A 3ZPPA 4YEJA 2NT9A 2VBMA 4XLFA 2IQ7A 3LMWA 1QCXA 4XL9A 3VSUA 3GQ8A 4XMYA 1O8MA 1CZFA 2PECA 1X0CA 3T9GA 4OJ5A 4XLAA 4W8RA 4W8QA 1O8KA 3B90A 4YZ0A 1O8DA 2BSPA 4NK6A 1OOCA 2EWEA 4NK8A 1IDJA 1OFLA 2PYGA 2INVA 2VJJA 2INUA 1IDKA 4U49A 4XOPA 4XKVA 1JTAA 3GQ9A 4AVZA 5C1CA 2O1DA 2O0VA 2X6YA 4YELA 2X6WA 4XM3A 1DBOA 1O8JA 2VBEA 3SUCA 4OJPA 1AIRA 1DBGA 3UW0A 2O04A 3ZSCA 3B4NA 1O8IA 4HWVA 4MR0A 1KCDA 3JURA 3VMWA 2NT6A 2UVFA 3GQAA 3VMVA 3VSVA 4OJOA 4MXNA 1O8HA 3GQ7A 3VSTA 1IB4A 4XLEA 2UVEA 2QXZA 4W8SA 1HG8A 4OJ6A 4W8TA 1GQ8A 2NSPA 2NTBA 2VBKA 1KTWA 5AMVA 2Z8GA 1RU4A 1K5CA 4U4BA 4OZYA 1H80A 1EE6A 1OFMA 4OZZA 1IA5A 1XG2A 1O8LA 1VBLA 2VJIA 4EW9A 2X3HA 4XLCA 1O8GA 2NTQA 2PYHA 4YZAA 3KRGA 1PXZA 1BN8A 1O8EA 4XQFA 4YZQA 5C1EA 4XORA 1WMRA 4XLHA 4XR6A 2ODLA 1O8FA 2NSTA 4PMHA 1PLUA 1BHEA 2NZMA 3FY3A 4I84A 4XONA 4YZXA 4XOTA 2QY1A 3WWGA 4Z03A 4URRA 1RMGA 4XNFA 1OGOX 4C2LA 4XN0A 1QJVA 1OGMX 3B8YA 2NTPA 2X6XA 2O0WA 4Z05A 4XKWA 2X85A
chains in the Genus database with same CATH superfamily
2O17A 4XN3A 1K8FA 2IOUG 1NHCA 2BM4A 1RWRA 2G0YA 4OJLA 3EQOA 3EQNA 1JRGA 2QX3A 4Z06A 2YUHA 1O88A 3GRHA 1KCCA 2VFOA 1PE9A 3NAWA 3NB2A 3ZPPA 3AK5A 1L1IA 4YEJA 2V5IA 2NT9A 5JMCB 2VBMA 4XLFA 2IQ7A 3JX8A 3LMWA 1QCXA 4XL9A 4OPWA 4YEIA 3VSUA 2XTWA 3GQ8A 4XMYA 2VFNA 1O8MA 3P4GA 1CZFA 2PECA 1X0CA 3T9GA 1K4ZA 4OJ5A 4XLAA 4W8RA 4W8QA 1O8KA 3B90A 4YZ0A 1O8DA 1QA1A 2BSPA 4NK6A 1OOCA 2EWEA 4NK8A 1IDJA 1OFLA 3PETA 2BM5A 2PYGA 2INVA 2VJJA 2INUA 1IDKA 4U49A 4XOPA 4XKVA 2VFPA 2QZAA 1JTAA 3SZEA 1OFEA 3GQ9A 2W7ZA 1TYUA 4AVZA 5C1CA 2XT2A 2O1DA 1KQ5A 2O0VA 2X6YA 3ML3A 4KH3A 2X6WA 4YELA 4XM3A 1DBOA 1O8JA 2VBEA 1TYVA 3SUCA 4OJPA 3LYCA 1AIRA 1DBGA 1LLWA 3BH6B 1QRCA 3UW0A 2O04A 3RIQA 3ZSCA 3B4NA 1O8IA 4HWVA 3H09A 4MR0A 1CLWA 1KCDA 1DABA 3JURA 2O0WA 4YDTA 3VMWA 1LM1A 2BM7A 2NT6A 2UVFA 3SQVA 3GQAA 3SYJA 3VMVA 4OJOA 3VSVA 4MXNA 1O8HA 3GQ7A 3VSTA 1IB4A 1EZGA 3DU1X 4XLEA 1EA0A 2UVEA 1OFDA 2QXZA 4W8SA 2BX6A 5DNSA 3PSSA 4OJ6A 2O6WA 4W8TA 1TYWA 3TH0A 3BH7B 4OM9A 1GQ8A 3N6ZA 2NSPA 2NTBA 2VBKA 1KTWA 2VFMA 2Z8GA 5AMVA 1QA3A 1RU4A 1K5CA 4U4BA 4OZYA 1TSPA 1H80A 1EE6A 1OFMA 2XT4A 4OZZA 1IA5A 1XG2A 1O8LA 1VBLA 2VJIA 4EW9A 2X3HA 2B0RA 1O8GA 2NTQA 2PYHA 4XLCA 2F3LA 3KRGA 3N90A 4YZAA 1PXZA 1QQ1A 1BN8A 1O8EA 1LLZA 3PSZA 2J8IA 4XQFA 4YZQA 5C1EA 4XORA 1WMRA 4XLHA 1QA2A 4XR6A 2ODLA 3LJYA 4YFOA 4YCQA 1O8FA 1QRBA 2NSTA 3SY2A 4PMHA 4YC5A 1PLUA 1BHEA 2NZMA 3FY3A 4I84A 4XONA 2BM6A 4YZXA 4XOTA 1HF2A 2QY1A 3WWGA 4V02C 4Z03A 1TYXA 2VFQA 2XTYA 1WXRA 5JLVC 2QYUA 4URRA 1RMGA 4XNFA 1OGOX 2XC1A 2XTXA 4C2LA 4XN0A 1QJVA 1OGMX 3B8YA 2J8KA 2NTPA 2X6XA 4JRAC 1HG8A 4Z05A 4XKWA 2X85A
chains in the Genus database with same CATH topology
2O17A 4XN3A 1NHCA 1RWRA 4OJLA 3EQOA 3EQNA 1JRGA 2QX3A 4Z06A 1O88A 3GRHA 1KCCA 1PE9A 3ZPPA 4YEJA 2NT9A 2VBMA 4XLFA 2IQ7A 3LMWA 1QCXA 4XL9A 3VSUA 3GQ8A 4XMYA 1O8MA 1CZFA 2PECA 1X0CA 3T9GA 4OJ5A 4XLAA 4W8RA 4W8QA 1O8KA 3B90A 4YZ0A 1O8DA 2BSPA 4NK6A 1OOCA 2EWEA 4NK8A 1IDJA 1OFLA 2PYGA 2INVA 2VJJA 2INUA 1IDKA 4U49A 4XOPA 4XKVA 1JTAA 3GQ9A 4AVZA 5C1CA 2O1DA 2O0VA 2X6YA 4YELA 2X6WA 4XM3A 1DBOA 1O8JA 2VBEA 3SUCA 4OJPA 1AIRA 1DBGA 3UW0A 2O04A 3ZSCA 3B4NA 1O8IA 4HWVA 4MR0A 1KCDA 3JURA 3VMWA 2NT6A 2UVFA 3GQAA 3VMVA 3VSVA 4OJOA 4MXNA 1O8HA 3GQ7A 3VSTA 1IB4A 4XLEA 2UVEA 2QXZA 4W8SA 1HG8A 4OJ6A 4W8TA 1GQ8A 2NSPA 2NTBA 2VBKA 1KTWA 5AMVA 2Z8GA 1RU4A 1K5CA 4U4BA 4OZYA 1H80A 1EE6A 1OFMA 4OZZA 1IA5A 1XG2A 1O8LA 1VBLA 2VJIA 4EW9A 2X3HA 4XLCA 1O8GA 2NTQA 2PYHA 4YZAA 3KRGA 1PXZA 1BN8A 1O8EA 4XQFA 4YZQA 5C1EA 4XORA 1WMRA 4XLHA 4XR6A 2ODLA 1O8FA 2NSTA 4PMHA 1PLUA 1BHEA 2NZMA 3FY3A 4I84A 4XONA 4YZXA 4XOTA 2QY1A 3WWGA 4Z03A 4URRA 1RMGA 4XNFA 1OGOX 4C2LA 4XN0A 1QJVA 1OGMX 3B8YA 2NTPA 2X6XA 2O0WA 4Z05A 4XKWA 2X85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O17 A;  4XN3 A;  1NHC A;  1RWR A;  4OJL A;  3EQO A;  3EQN A;  1JRG A;  2QX3 A;  4Z06 A;  1O88 A;  3GRH A;  1KCC A;  1PE9 A;  3ZPP A;  4YEJ A;  2NT9 A;  2VBM A;  4XLF A;  2IQ7 A;  3LMW A;  1QCX A;  4XL9 A;  3VSU A;  3GQ8 A;  4XMY A;  1O8M A;  1CZF A;  2PEC A;  1X0C A;  3T9G A;  4OJ5 A;  4XLA A;  4W8R A;  4W8Q A;  1O8K A;  3B90 A;  4YZ0 A;  1O8D A;  2BSP A;  4NK6 A;  1OOC A;  2EWE A;  4NK8 A;  1IDJ A;  1OFL A;  2PYG A;  2INV A;  2VJJ A;  2INU A;  1IDK A;  4U49 A;  4XOP A;  4XKV A;  1JTA A;  3GQ9 A;  4AVZ A;  5C1C A;  2O1D A;  2O0V A;  2X6Y A;  4YEL A;  2X6W A;  4XM3 A;  1DBO A;  1O8J A;  2VBE A;  3SUC A;  4OJP A;  1AIR A;  1DBG A;  3UW0 A;  2O04 A;  3ZSC A;  3B4N A;  1O8I A;  4HWV A;  4MR0 A;  1KCD A;  3JUR A;  3VMW A;  2NT6 A;  2UVF A;  3GQA A;  3VMV A;  3VSV A;  4OJO A;  4MXN A;  1O8H A;  3GQ7 A;  3VST A;  1IB4 A;  4XLE A;  2UVE A;  2QXZ A;  4W8S A;  1HG8 A;  4OJ6 A;  4W8T A;  1GQ8 A;  2NSP A;  2NTB A;  2VBK A;  1KTW A;  5AMV A;  2Z8G A;  1RU4 A;  1K5C A;  4U4B A;  4OZY A;  1H80 A;  1EE6 A;  1OFM A;  4OZZ A;  1IA5 A;  1XG2 A;  1O8L A;  1VBL A;  2VJI A;  4EW9 A;  2X3H A;  4XLC A;  1O8G A;  2NTQ A;  2PYH A;  4YZA A;  3KRG A;  1PXZ A;  1BN8 A;  1O8E A;  4XQF A;  4YZQ A;  5C1E A;  4XOR A;  1WMR A;  4XLH A;  4XR6 A;  2ODL A;  1O8F A;  2NST A;  4PMH A;  1PLU A;  1BHE A;  2NZM A;  3FY3 A;  4I84 A;  4XON A;  4YZX A;  4XOT A;  2QY1 A;  3WWG A;  4Z03 A;  4URR A;  1RMG A;  4XNF A;  1OGO X;  4C2L A;  4XN0 A;  1QJV A;  1OGM X;  3B8Y A;  2NTP A;  2X6X A;  2O0W A;  4Z05 A;  4XKW A;  2X85 A; 
#chains in the Genus database with same CATH topology
 2O17 A;  4XN3 A;  1K8F A;  2IOU G;  1NHC A;  2BM4 A;  1RWR A;  2G0Y A;  4OJL A;  3EQO A;  3EQN A;  1JRG A;  2QX3 A;  4Z06 A;  2YUH A;  1O88 A;  3GRH A;  1KCC A;  2VFO A;  1PE9 A;  3NAW A;  3NB2 A;  3ZPP A;  3AK5 A;  1L1I A;  4YEJ A;  2V5I A;  2NT9 A;  5JMC B;  2VBM A;  4XLF A;  2IQ7 A;  3JX8 A;  3LMW A;  1QCX A;  4XL9 A;  4OPW A;  4YEI A;  3VSU A;  2XTW A;  3GQ8 A;  4XMY A;  2VFN A;  1O8M A;  3P4G A;  1CZF A;  2PEC A;  1X0C A;  3T9G A;  1K4Z A;  4OJ5 A;  4XLA A;  4W8R A;  4W8Q A;  1O8K A;  3B90 A;  4YZ0 A;  1O8D A;  1QA1 A;  2BSP A;  4NK6 A;  1OOC A;  2EWE A;  4NK8 A;  1IDJ A;  1OFL A;  3PET A;  2BM5 A;  2PYG A;  2INV A;  2VJJ A;  2INU A;  1IDK A;  4U49 A;  4XOP A;  4XKV A;  2VFP A;  2QZA A;  1JTA A;  3SZE A;  1OFE A;  3GQ9 A;  2W7Z A;  1TYU A;  4AVZ A;  5C1C A;  2XT2 A;  2O1D A;  1KQ5 A;  2O0V A;  2X6Y A;  3ML3 A;  4KH3 A;  2X6W A;  4YEL A;  4XM3 A;  1DBO A;  1O8J A;  2VBE A;  1TYV A;  3SUC A;  4OJP A;  3LYC A;  1AIR A;  1DBG A;  1LLW A;  3BH6 B;  1QRC A;  3UW0 A;  2O04 A;  3RIQ A;  3ZSC A;  3B4N A;  1O8I A;  4HWV A;  3H09 A;  4MR0 A;  1CLW A;  1KCD A;  1DAB A;  3JUR A;  2O0W A;  4YDT A;  3VMW A;  1LM1 A;  2BM7 A;  2NT6 A;  2UVF A;  3SQV A;  3GQA A;  3SYJ A;  3VMV A;  4OJO A;  3VSV A;  4MXN A;  1O8H A;  3GQ7 A;  3VST A;  1IB4 A;  1EZG A;  3DU1 X;  4XLE A;  1EA0 A;  2UVE A;  1OFD A;  2QXZ A;  4W8S A;  2BX6 A;  5DNS A;  3PSS A;  4OJ6 A;  2O6W A;  4W8T A;  1TYW A;  3TH0 A;  3BH7 B;  4OM9 A;  1GQ8 A;  3N6Z A;  2NSP A;  2NTB A;  2VBK A;  1KTW A;  2VFM A;  2Z8G A;  5AMV A;  1QA3 A;  1RU4 A;  1K5C A;  4U4B A;  4OZY A;  1TSP A;  1H80 A;  1EE6 A;  1OFM A;  2XT4 A;  4OZZ A;  1IA5 A;  1XG2 A;  1O8L A;  1VBL A;  2VJI A;  4EW9 A;  2X3H A;  2B0R A;  1O8G A;  2NTQ A;  2PYH A;  4XLC A;  2F3L A;  3KRG A;  3N90 A;  4YZA A;  1PXZ A;  1QQ1 A;  1BN8 A;  1O8E A;  1LLZ A;  3PSZ A;  2J8I A;  4XQF A;  4YZQ A;  5C1E A;  4XOR A;  1WMR A;  4XLH A;  1QA2 A;  4XR6 A;  2ODL A;  3LJY A;  4YFO A;  4YCQ A;  1O8F A;  1QRB A;  2NST A;  3SY2 A;  4PMH A;  4YC5 A;  1PLU A;  1BHE A;  2NZM A;  3FY3 A;  4I84 A;  4XON A;  2BM6 A;  4YZX A;  4XOT A;  1HF2 A;  2QY1 A;  3WWG A;  4V02 C;  4Z03 A;  1TYX A;  2VFQ A;  2XTY A;  1WXR A;  5JLV C;  2QYU A;  4URR A;  1RMG A;  4XNF A;  1OGO X;  2XC1 A;  2XTX A;  4C2L A;  4XN0 A;  1QJV A;  1OGM X;  3B8Y A;  2J8K A;  2NTP A;  2X6X A;  4JRA C;  1HG8 A;  4Z05 A;  4XKW A;  2X85 A; 
#chains in the Genus database with same CATH homology
 2O17 A;  4XN3 A;  1NHC A;  1RWR A;  4OJL A;  3EQO A;  3EQN A;  1JRG A;  2QX3 A;  4Z06 A;  1O88 A;  3GRH A;  1KCC A;  1PE9 A;  3ZPP A;  4YEJ A;  2NT9 A;  2VBM A;  4XLF A;  2IQ7 A;  3LMW A;  1QCX A;  4XL9 A;  3VSU A;  3GQ8 A;  4XMY A;  1O8M A;  1CZF A;  2PEC A;  1X0C A;  3T9G A;  4OJ5 A;  4XLA A;  4W8R A;  4W8Q A;  1O8K A;  3B90 A;  4YZ0 A;  1O8D A;  2BSP A;  4NK6 A;  1OOC A;  2EWE A;  4NK8 A;  1IDJ A;  1OFL A;  2PYG A;  2INV A;  2VJJ A;  2INU A;  1IDK A;  4U49 A;  4XOP A;  4XKV A;  1JTA A;  3GQ9 A;  4AVZ A;  5C1C A;  2O1D A;  2O0V A;  2X6Y A;  4YEL A;  2X6W A;  4XM3 A;  1DBO A;  1O8J A;  2VBE A;  3SUC A;  4OJP A;  1AIR A;  1DBG A;  3UW0 A;  2O04 A;  3ZSC A;  3B4N A;  1O8I A;  4HWV A;  4MR0 A;  1KCD A;  3JUR A;  3VMW A;  2NT6 A;  2UVF A;  3GQA A;  3VMV A;  3VSV A;  4OJO A;  4MXN A;  1O8H A;  3GQ7 A;  3VST A;  1IB4 A;  4XLE A;  2UVE A;  2QXZ A;  4W8S A;  1HG8 A;  4OJ6 A;  4W8T A;  1GQ8 A;  2NSP A;  2NTB A;  2VBK A;  1KTW A;  5AMV A;  2Z8G A;  1RU4 A;  1K5C A;  4U4B A;  4OZY A;  1H80 A;  1EE6 A;  1OFM A;  4OZZ A;  1IA5 A;  1XG2 A;  1O8L A;  1VBL A;  2VJI A;  4EW9 A;  2X3H A;  4XLC A;  1O8G A;  2NTQ A;  2PYH A;  4YZA A;  3KRG A;  1PXZ A;  1BN8 A;  1O8E A;  4XQF A;  4YZQ A;  5C1E A;  4XOR A;  1WMR A;  4XLH A;  4XR6 A;  2ODL A;  1O8F A;  2NST A;  4PMH A;  1PLU A;  1BHE A;  2NZM A;  3FY3 A;  4I84 A;  4XON A;  4YZX A;  4XOT A;  2QY1 A;  3WWG A;  4Z03 A;  4URR A;  1RMG A;  4XNF A;  1OGO X;  4C2L A;  4XN0 A;  1QJV A;  1OGM X;  3B8Y A;  2NTP A;  2X6X A;  2O0W A;  4Z05 A;  4XKW A;  2X85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...