3ZSCA

Catalytic function and substrate recognition of the pectate lyase from thermotoga maritima
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
329
structure length
329
Chain Sequence
DKPVGFASVPTADLPEGTVGGLGGEIVFVRTAEELEKYTTAEGKYVIVVDGTIVFEPKREIKVLSDKTIVGINDAKIVGGGLVIKDAQNVIIRNIHFEGFYMEDDPRGKKYDFDYINVENSHHIWIDHITFVNGNDGAVDIKKYSNYITVSWNKFVDHDKVSLVGSSDKEDPEQAGQAYKVTYHHNYFKNLIQRMPRIRFGMAHVFNNFYSMGLRTGVSGNVFPIYGVASAMGAKVHVEGNYFMGYGAVMAEAGIAFLPTRIMGPVEGYLTLGEGDAKNEFYYCKEPEVRPVEEGKPALDPREYYDYTLDPVQDVPKIVVDGAGAGKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic Function and Substrate Recognition of the Pectate Lyase from Thermotoga Maritima
rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords PECTATE TRISACCHARIDE-LYASE
total genus 132
structure length 329
sequence length 329
ec nomenclature ec 4.2.2.22: Pectate trisaccharide-lyase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3zscA00
1VBLA 4XL9A 2PYGA 3GQ8A 1CZFA 4XOPA 2INVA 4XN0A 1O8JA 2O1DA 1OFMA 4I84A 1BN8A 2X6XA 1PXZA 4W8RA 4YELA 1IB4A 3GRHA 4U4BA 2VBEA 1RU4A 2PECA 1OGMX 4URRA 2QXZA 4W8QA 2IQ7A 3KRGA 2NZMA 4OJLA 1QJVA 1IDJA 2PYHA 3GQAA 4YZXA 1O8GA 1RWRA 4XLCA 1NHCA 4OJ6A 1O8MA 4XONA 4Z03A 1WMRA 4YZAA 2X6YA 4XQFA 4MXNA 4W8SA 2O0VA 2X3HA 2NTPA 1PLUA 1O8KA 3ZSCA 4YZ0A 3B4NA 4Z05A 1QCXA 5C1CA 3GQ9A 3JURA 1JTAA 4XLAA 4AVZA 4XMYA 3VSUA 4XN3A 1PE9A 2NSTA 2UVFA 2UVEA 3EQNA 4XR6A 4XKWA 2BSPA 4NK6A 4OJ5A 1K5CA 4XNFA 1DBOA 3EQOA 4EW9A 2X6WA 1H80A 1KTWA 5AMVA 3ZPPA 4YZQA 4XORA 4PMHA 4OJOA 1BHEA 1O8DA 1XG2A 3GQ7A 4YEJA 4XLFA 1KCCA 3B8YA 1JRGA 4U49A 2O04A 1OOCA 3VSVA 1IDKA 1GQ8A 2X85A 4XKVA 1O88A 1KCDA 3B90A 5C1EA 1DBGA 1O8IA 4MR0A 4C2LA 4XLHA 3VMWA 1IA5A 4HWVA 1AIRA 2EWEA 4OJPA 3T9GA 3FY3A 1O8FA 4OZZA 2QX3A 1RMGA 3UW0A 2ODLA 1O8EA 4OZYA 1O8LA 4XOTA 1O8HA 2O17A 4Z06A 2VJIA 3WWGA 2Z8GA 2NTBA 3LMWA 2VBKA 3VSTA 4NK8A 2VJJA 4W8TA 4XM3A 1HG8A 1EE6A 1OGOX 2NT6A 3VMVA 1OFLA 4XLEA 2VBMA 1X0CA 2QY1A 3SUCA 2NT9A 2NSPA 2O0WA 2INUA 2NTQA
chains in the Genus database with same CATH superfamily
2BX6A 1VBLA 4XL9A 2PYGA 4JRAC 3RIQA 3SY2A 3GQ8A 1CZFA 4XOPA 2INVA 1EZGA 4XN0A 2XTXA 1O8JA 2O1DA 4YC5A 1OFMA 1CLWA 4I84A 1BN8A 2X6XA 4YEIA 1PXZA 2XTYA 3BH7B 4W8RA 1TYWA 4YELA 1IB4A 1OFEA 3GRHA 2VFQA 2VBEA 1RU4A 4U4BA 2PECA 1OGMX 4URRA 2QXZA 4W8QA 2IQ7A 2XC1A 4OM9A 4V02C 2BM6A 2V5IA 4YFOA 3PETA 3PSSA 3KRGA 2NZMA 4OJLA 1QJVA 1IDJA 2PYHA 2QZAA 3GQAA 4OPWA 4YZXA 1WXRA 1TSPA 1O8GA 1RWRA 4XLCA 1NHCA 4OJ6A 1O8MA 2XT2A 4XONA 4Z03A 2B0RA 1WMRA 4YZAA 2X6YA 3TH0A 4XQFA 1K4ZA 4MXNA 1TYUA 1TYXA 2BM4A 2BM5A 2O0VA 2W7ZA 4W8SA 3SZEA 5JLVC 2X3HA 2NTPA 1PLUA 1O8KA 1LM1A 1OFDA 2QYUA 3N90A 3ZSCA 3SQVA 4YZ0A 3B4NA 3LJYA 4Z05A 1QCXA 5C1CA 1QA3A 3GQ9A 3JURA 4YDTA 1JTAA 4YCQA 4XLAA 4AVZA 4XMYA 3VSUA 4XN3A 1PE9A 2NSTA 2UVFA 2J8KA 2UVEA 3EQNA 4XR6A 2YUHA 4XKWA 2BSPA 4NK6A 3H09A 4OJ5A 1K5CA 4XNFA 3ML3A 1DBOA 3EQOA 4EW9A 2X6WA 2F3LA 1H80A 1KTWA 3NAWA 5AMVA 3ZPPA 4YZQA 3BH6B 4XORA 1QQ1A 4PMHA 4OJOA 1BHEA 1O8DA 4KH3A 1XG2A 3GQ7A 1K8FA 4XLFA 4YEJA 2VFOA 1KCCA 3B8YA 1JRGA 4U49A 2O04A 1OOCA 3VSVA 1L1IA 1IDKA 1GQ8A 2X85A 4XKVA 1O88A 1KCDA 3B90A 5C1EA 1DBGA 1O8IA 2O6WA 4MR0A 4C2LA 4XLHA 3VMWA 1IA5A 1KQ5A 4HWVA 1AIRA 2EWEA 5JMCB 4OJPA 3T9GA 3FY3A 1O8FA 3AK5A 4OZZA 2QX3A 1HF2A 1RMGA 3UW0A 2ODLA 1O8EA 2G0YA 4OZYA 1O8LA 2J8IA 4XOTA 2XTWA 3JX8A 1O8HA 1QRBA 3LYCA 1DABA 1LLZA 3PSZA 2VFNA 3NB2A 2O17A 4Z06A 2VJIA 3WWGA 2XT4A 2Z8GA 5DNSA 3DU1X 2NTBA 2VFMA 2VBKA 3LMWA 3VSTA 3N6ZA 4NK8A 2VJJA 4W8TA 4XM3A 1HG8A 1EE6A 1OGOX 1QRCA 2NT6A 2BM7A 3SYJA 3VMVA 1OFLA 4XLEA 1QA2A 2VBMA 1X0CA 2QY1A 3SUCA 2NT9A 1LLWA 1QA1A 2NSPA 3P4GA 1TYVA 2O0WA 1EA0A 2INUA 2IOUG 2NTQA 2VFPA
chains in the Genus database with same CATH topology
1VBLA 4XL9A 2PYGA 3GQ8A 1CZFA 4XOPA 2INVA 4XN0A 1O8JA 2O1DA 1OFMA 4I84A 1BN8A 2X6XA 1PXZA 4W8RA 4YELA 1IB4A 3GRHA 4U4BA 2VBEA 1RU4A 2PECA 1OGMX 4URRA 2QXZA 4W8QA 2IQ7A 3KRGA 2NZMA 4OJLA 1QJVA 1IDJA 2PYHA 3GQAA 4YZXA 1O8GA 1RWRA 4XLCA 1NHCA 4OJ6A 1O8MA 4XONA 4Z03A 1WMRA 4YZAA 2X6YA 4XQFA 4MXNA 4W8SA 2O0VA 2X3HA 2NTPA 1PLUA 1O8KA 3ZSCA 4YZ0A 3B4NA 4Z05A 1QCXA 5C1CA 3GQ9A 3JURA 1JTAA 4XLAA 4AVZA 4XMYA 3VSUA 4XN3A 1PE9A 2NSTA 2UVFA 2UVEA 3EQNA 4XR6A 4XKWA 2BSPA 4NK6A 4OJ5A 1K5CA 4XNFA 1DBOA 3EQOA 4EW9A 2X6WA 1H80A 1KTWA 5AMVA 3ZPPA 4YZQA 4XORA 4PMHA 4OJOA 1BHEA 1O8DA 1XG2A 3GQ7A 4YEJA 4XLFA 1KCCA 3B8YA 1JRGA 4U49A 2O04A 1OOCA 3VSVA 1IDKA 1GQ8A 2X85A 4XKVA 1O88A 1KCDA 3B90A 5C1EA 1DBGA 1O8IA 4MR0A 4C2LA 4XLHA 3VMWA 1IA5A 4HWVA 1AIRA 2EWEA 4OJPA 3T9GA 3FY3A 1O8FA 4OZZA 2QX3A 1RMGA 3UW0A 2ODLA 1O8EA 4OZYA 1O8LA 4XOTA 1O8HA 2O17A 4Z06A 2VJIA 3WWGA 2Z8GA 2NTBA 3LMWA 2VBKA 3VSTA 4NK8A 2VJJA 4W8TA 4XM3A 1HG8A 1EE6A 1OGOX 2NT6A 3VMVA 1OFLA 4XLEA 2VBMA 1X0CA 2QY1A 3SUCA 2NT9A 2NSPA 2O0WA 2INUA 2NTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBL A;  4XL9 A;  2PYG A;  3GQ8 A;  1CZF A;  4XOP A;  2INV A;  4XN0 A;  1O8J A;  2O1D A;  1OFM A;  4I84 A;  1BN8 A;  2X6X A;  1PXZ A;  4W8R A;  4YEL A;  1IB4 A;  3GRH A;  4U4B A;  2VBE A;  1RU4 A;  2PEC A;  1OGM X;  4URR A;  2QXZ A;  4W8Q A;  2IQ7 A;  3KRG A;  2NZM A;  4OJL A;  1QJV A;  1IDJ A;  2PYH A;  3GQA A;  4YZX A;  1O8G A;  1RWR A;  4XLC A;  1NHC A;  4OJ6 A;  1O8M A;  4XON A;  4Z03 A;  1WMR A;  4YZA A;  2X6Y A;  4XQF A;  4MXN A;  4W8S A;  2O0V A;  2X3H A;  2NTP A;  1PLU A;  1O8K A;  3ZSC A;  4YZ0 A;  3B4N A;  4Z05 A;  1QCX A;  5C1C A;  3GQ9 A;  3JUR A;  1JTA A;  4XLA A;  4AVZ A;  4XMY A;  3VSU A;  4XN3 A;  1PE9 A;  2NST A;  2UVF A;  2UVE A;  3EQN A;  4XR6 A;  4XKW A;  2BSP A;  4NK6 A;  4OJ5 A;  1K5C A;  4XNF A;  1DBO A;  3EQO A;  4EW9 A;  2X6W A;  1H80 A;  1KTW A;  5AMV A;  3ZPP A;  4YZQ A;  4XOR A;  4PMH A;  4OJO A;  1BHE A;  1O8D A;  1XG2 A;  3GQ7 A;  4YEJ A;  4XLF A;  1KCC A;  3B8Y A;  1JRG A;  4U49 A;  2O04 A;  1OOC A;  3VSV A;  1IDK A;  1GQ8 A;  2X85 A;  4XKV A;  1O88 A;  1KCD A;  3B90 A;  5C1E A;  1DBG A;  1O8I A;  4MR0 A;  4C2L A;  4XLH A;  3VMW A;  1IA5 A;  4HWV A;  1AIR A;  2EWE A;  4OJP A;  3T9G A;  3FY3 A;  1O8F A;  4OZZ A;  2QX3 A;  1RMG A;  3UW0 A;  2ODL A;  1O8E A;  4OZY A;  1O8L A;  4XOT A;  1O8H A;  2O17 A;  4Z06 A;  2VJI A;  3WWG A;  2Z8G A;  2NTB A;  3LMW A;  2VBK A;  3VST A;  4NK8 A;  2VJJ A;  4W8T A;  4XM3 A;  1HG8 A;  1EE6 A;  1OGO X;  2NT6 A;  3VMV A;  1OFL A;  4XLE A;  2VBM A;  1X0C A;  2QY1 A;  3SUC A;  2NT9 A;  2NSP A;  2O0W A;  2INU A;  2NTQ A; 
#chains in the Genus database with same CATH topology
 2BX6 A;  1VBL A;  4XL9 A;  2PYG A;  4JRA C;  3RIQ A;  3SY2 A;  3GQ8 A;  1CZF A;  4XOP A;  2INV A;  1EZG A;  4XN0 A;  2XTX A;  1O8J A;  2O1D A;  4YC5 A;  1OFM A;  1CLW A;  4I84 A;  1BN8 A;  2X6X A;  4YEI A;  1PXZ A;  2XTY A;  3BH7 B;  4W8R A;  1TYW A;  4YEL A;  1IB4 A;  1OFE A;  3GRH A;  2VFQ A;  2VBE A;  1RU4 A;  4U4B A;  2PEC A;  1OGM X;  4URR A;  2QXZ A;  4W8Q A;  2IQ7 A;  2XC1 A;  4OM9 A;  4V02 C;  2BM6 A;  2V5I A;  4YFO A;  3PET A;  3PSS A;  3KRG A;  2NZM A;  4OJL A;  1QJV A;  1IDJ A;  2PYH A;  2QZA A;  3GQA A;  4OPW A;  4YZX A;  1WXR A;  1TSP A;  1O8G A;  1RWR A;  4XLC A;  1NHC A;  4OJ6 A;  1O8M A;  2XT2 A;  4XON A;  4Z03 A;  2B0R A;  1WMR A;  4YZA A;  2X6Y A;  3TH0 A;  4XQF A;  1K4Z A;  4MXN A;  1TYU A;  1TYX A;  2BM4 A;  2BM5 A;  2O0V A;  2W7Z A;  4W8S A;  3SZE A;  5JLV C;  2X3H A;  2NTP A;  1PLU A;  1O8K A;  1LM1 A;  1OFD A;  2QYU A;  3N90 A;  3ZSC A;  3SQV A;  4YZ0 A;  3B4N A;  3LJY A;  4Z05 A;  1QCX A;  5C1C A;  1QA3 A;  3GQ9 A;  3JUR A;  4YDT A;  1JTA A;  4YCQ A;  4XLA A;  4AVZ A;  4XMY A;  3VSU A;  4XN3 A;  1PE9 A;  2NST A;  2UVF A;  2J8K A;  2UVE A;  3EQN A;  4XR6 A;  2YUH A;  4XKW A;  2BSP A;  4NK6 A;  3H09 A;  4OJ5 A;  1K5C A;  4XNF A;  3ML3 A;  1DBO A;  3EQO A;  4EW9 A;  2X6W A;  2F3L A;  1H80 A;  1KTW A;  3NAW A;  5AMV A;  3ZPP A;  4YZQ A;  3BH6 B;  4XOR A;  1QQ1 A;  4PMH A;  4OJO A;  1BHE A;  1O8D A;  4KH3 A;  1XG2 A;  3GQ7 A;  1K8F A;  4XLF A;  4YEJ A;  2VFO A;  1KCC A;  3B8Y A;  1JRG A;  4U49 A;  2O04 A;  1OOC A;  3VSV A;  1L1I A;  1IDK A;  1GQ8 A;  2X85 A;  4XKV A;  1O88 A;  1KCD A;  3B90 A;  5C1E A;  1DBG A;  1O8I A;  2O6W A;  4MR0 A;  4C2L A;  4XLH A;  3VMW A;  1IA5 A;  1KQ5 A;  4HWV A;  1AIR A;  2EWE A;  5JMC B;  4OJP A;  3T9G A;  3FY3 A;  1O8F A;  3AK5 A;  4OZZ A;  2QX3 A;  1HF2 A;  1RMG A;  3UW0 A;  2ODL A;  1O8E A;  2G0Y A;  4OZY A;  1O8L A;  2J8I A;  4XOT A;  2XTW A;  3JX8 A;  1O8H A;  1QRB A;  3LYC A;  1DAB A;  1LLZ A;  3PSZ A;  2VFN A;  3NB2 A;  2O17 A;  4Z06 A;  2VJI A;  3WWG A;  2XT4 A;  2Z8G A;  5DNS A;  3DU1 X;  2NTB A;  2VFM A;  2VBK A;  3LMW A;  3VST A;  3N6Z A;  4NK8 A;  2VJJ A;  4W8T A;  4XM3 A;  1HG8 A;  1EE6 A;  1OGO X;  1QRC A;  2NT6 A;  2BM7 A;  3SYJ A;  3VMV A;  1OFL A;  4XLE A;  1QA2 A;  2VBM A;  1X0C A;  2QY1 A;  3SUC A;  2NT9 A;  1LLW A;  1QA1 A;  2NSP A;  3P4G A;  1TYV A;  2O0W A;  1EA0 A;  2INU A;  2IOU G;  2NTQ A;  2VFP A; 
#chains in the Genus database with same CATH homology
 1VBL A;  4XL9 A;  2PYG A;  3GQ8 A;  1CZF A;  4XOP A;  2INV A;  4XN0 A;  1O8J A;  2O1D A;  1OFM A;  4I84 A;  1BN8 A;  2X6X A;  1PXZ A;  4W8R A;  4YEL A;  1IB4 A;  3GRH A;  4U4B A;  2VBE A;  1RU4 A;  2PEC A;  1OGM X;  4URR A;  2QXZ A;  4W8Q A;  2IQ7 A;  3KRG A;  2NZM A;  4OJL A;  1QJV A;  1IDJ A;  2PYH A;  3GQA A;  4YZX A;  1O8G A;  1RWR A;  4XLC A;  1NHC A;  4OJ6 A;  1O8M A;  4XON A;  4Z03 A;  1WMR A;  4YZA A;  2X6Y A;  4XQF A;  4MXN A;  4W8S A;  2O0V A;  2X3H A;  2NTP A;  1PLU A;  1O8K A;  3ZSC A;  4YZ0 A;  3B4N A;  4Z05 A;  1QCX A;  5C1C A;  3GQ9 A;  3JUR A;  1JTA A;  4XLA A;  4AVZ A;  4XMY A;  3VSU A;  4XN3 A;  1PE9 A;  2NST A;  2UVF A;  2UVE A;  3EQN A;  4XR6 A;  4XKW A;  2BSP A;  4NK6 A;  4OJ5 A;  1K5C A;  4XNF A;  1DBO A;  3EQO A;  4EW9 A;  2X6W A;  1H80 A;  1KTW A;  5AMV A;  3ZPP A;  4YZQ A;  4XOR A;  4PMH A;  4OJO A;  1BHE A;  1O8D A;  1XG2 A;  3GQ7 A;  4YEJ A;  4XLF A;  1KCC A;  3B8Y A;  1JRG A;  4U49 A;  2O04 A;  1OOC A;  3VSV A;  1IDK A;  1GQ8 A;  2X85 A;  4XKV A;  1O88 A;  1KCD A;  3B90 A;  5C1E A;  1DBG A;  1O8I A;  4MR0 A;  4C2L A;  4XLH A;  3VMW A;  1IA5 A;  4HWV A;  1AIR A;  2EWE A;  4OJP A;  3T9G A;  3FY3 A;  1O8F A;  4OZZ A;  2QX3 A;  1RMG A;  3UW0 A;  2ODL A;  1O8E A;  4OZY A;  1O8L A;  4XOT A;  1O8H A;  2O17 A;  4Z06 A;  2VJI A;  3WWG A;  2Z8G A;  2NTB A;  3LMW A;  2VBK A;  3VST A;  4NK8 A;  2VJJ A;  4W8T A;  4XM3 A;  1HG8 A;  1EE6 A;  1OGO X;  2NT6 A;  3VMV A;  1OFL A;  4XLE A;  2VBM A;  1X0C A;  2QY1 A;  3SUC A;  2NT9 A;  2NSP A;  2O0W A;  2INU A;  2NTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...