3ZSMA

Crystal structure of apo human galectin-3 crd at 1.25 angstrom resolution, at room temperature
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Carbohydrate-Binding Site in Galectin-3 is Pre-Organized to Recognize a Sugar-Like Framework of Oxygens: Ultra-High Resolution Structures and Water Dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords GALECTIN-3
total genus 31
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zsmA00
1LOGA 2ZZJA 4YZ2A 1DLLA 2GNDA 2YXSA 3ILFA 2EXJA 2EF6A 1N1VA 2D6LX 2TEPA 2ZGNA 5GLVA 2G4IA 3RMYA 3LCPA 5DG2A 3OYWA 1KJLA 3OGGA 3WDYA 3USUA 3B3QE 5E88A 2UU8A 2GNMA 1MACA 1VALA 1AXYA 4XJUA 3WDXA 4YZ1A 2ZACA 3JUUA 3BOPA 4DFSA 4YM2A 2A75A 1LHNA 1JOJA 1DHKB 1GBGA 5CB7A 1LOCA 3IPVB 1WUVA 2W52A 1CPNA 1WLCA 4R9AA 1BQPA 2LALA 1FATA 1H9PA 2GDFA 1DGLA 1G9AA 3PVNA 3HN1A 1RINA 1AF9A 2CY6A 5DXDA 2E51A 5DUWA 1AVBA 4XIKA 2EXHA 1C1FA 4HANA 1YXWA 3SISA 1JYIA 1DQ1A 4FPOB 4BPZA 1JW6A 1LESA 4XJ9A 3U4XA 5H9QA 4P9WA 3MPPG 3M3CA 1BZWA 1JYCA 3NV4A 4Q2FA 3L2YA 4XHXA 3IPVA 3RQ0A 2ZGSA 3D5OA 1N1SA 2B7YA 1LJ7A 4L8QA 4LBNA 5EYYA 2E7QA 3RG0A 2JECA 2R16A 4Q26A 4AVVA 3WHUA 1FV2A 1GZCA 2AYHA 5CAZA 3WUCA 4XJAA 1YIFA 4BLIA 2XB6C 2ZMKA 4FP2A 4BLJA 3KQRA 2A6XA 5GLZA 3WCRA 2GMMA 2A6WA 5JMCA 1W6QA 2ZGRA 1W6PB 2NZ9A 1QGLA 2R1DA 2WT1A 2AGSA 2W08A 2CTVA 2A6ZA 1LHVA 4FPLA 1DIWA 4FPJA 1S1AA 1ULDA 1ENSA 3WLUA 4P14A 2SLIA 4F83A 2A3WA 2D43A 2UWBA 2R0HA 4U36A 4AWDA 4FP3A 3WV6A 1S0FA 3AX4A 3C2UA 3NV2A 4Y1ZA 4YGCA 3W58A 1QKQA 2AUYA 3NV3A 1I3HA 2ZMNA 4FPGA 2ZABA 3ENRA 4I30A 5CBLA 2P37A 4XXPA 5F5QA 5GZFA 1PZ9A 1LOAA 1LECA 2ARBA 1QDCA 1J1TA 1W6MA 3UJQA 1QNYA 2CL2A 2WLQA 3D4KA 1BKZA 3TB0A 3VKMA 1MS8A 4C1WA 2WJSA 3FBYA 3ZSKA 4YM1A 5DG1A 5DUXA 1H30A 1SBDA 2A5ZA 1C4RA 2DVFA 1ENRA 4U2AA 4ASMB 2E53A 2DURA 3AXDA 5F9TA 1QOTA 1I1EA 3AJZA 1AX2A 3LSDA 1WBFA 1APNA 1EPWA 1UPSA 2PHFA 5E8AA 5IK7A 1A3KA 3AYAA 3O12A 2CWSA 3ZVXA 1D0HA 3O0VA 5GLTA 5KXDA 2NYYA 1LEDA 1CONA 2NMNA 2D3PA 3ILRA 3VKOA 2PELA 1LOFC 1GNHA 4BOWA 2YV8A 4JCKA 1HQWA 2A71A 5H9RA 3UL2A 3OPZA 2UWCA 2ES3A 2GMEA 2WSVA 4PBPA 1Z78A 1AX0A 5CA6A 5KXEA 3NWKA 2DYCA 4XBQA 2VXRA 3GALA 4YFWA 2C5DA 2VUAA 2ENRA 5IT6A 4XTPA 4Q1RA 1WLDA 3VKLA 4ZKTB 3UJOA 3AZXA 5HCFA 2OUHA 2OUJA 2UURA 3FUQA 1GZWA 2ZGLA 5EWSA 5HCBA 1V6IA 4DPNA 4XZPA 3GNEA 2P3IA 1CESA 3ZSJA 1WD3A 4XE9A 3FUOA 1PZ8A 3R4UA 3WCSA 1VAMA 3ILNA 4FOVA 3WG2A 4D69A 1RIRA 3SH5A 3POWA 2ZHLA 4GALA 5CNAA 2VY0A 1O4ZA 4GA9A 2D6NA 5GLUA 1CQ9A 3AXEA 4YGEA 1F31A 4K21A 1S0DA 1W0OA 4PBOA 4XMAA 3DGTA 3M2MA 4DQAA 1LU2A 5FREA 3NV1A 4R9BA 3WZ1A 2EIGA 3IKWA 5JLVA 3D6EA 1LOBA 4Y22B 4BMEA 3N7JA 1F9KA 1WCSA 2A3XA 1GICA 4XJ8A 4C1XA 1LGBA 1G9DA 1MS9A 1BYHA 3IN9A 1KJRA 3MEPA 1BXHA 2GN7A 1DFQA 5L73A 3AZWA 2DUOA 1ZM1A 2YZ4A 3ZXEA 4AGRA 4YZ5A 4AGGA 1VIWB 2R1BA 1A8DA 3KM5A 2P34A 1HDKA 1LOFA 4YW2A 3N36A 3T2TA 1G9CA 2PHUA 3WG3A 2WQZC 1X50A 1WW7A 2D44A 3AZZA 1BJQA 1LCLA 1S0GA 3AP6A 3WDWA 2JJ6A 4Y1YA 2ZHKA 1W6OB 4LBQA 2CWMA 3M1HA 4M01A 1OQ1A 3ZPYA 4WVWA 2D3RA 1HKDA 1LOEA 3PVOA 5T52A 1UAIA 4TZDA 3A0NA 1TEIA 4Y26A 1G8WA 1AX1A 2ZGUA 5T54A 4YGBA 1W6QB 2Q5TA 4Y1UA 5JOYA 4IQPA 2DV9A 1C1LA 3R4SA 1UL9A 1Q8QA 1LHWA 1VAVA 4BM8A 2XG3A 3HR9A 4LBQB 1IS6A 1SLTA 1MS1A 2ARXA 2D7FA 3WNXA 3N7KA 3B00A 1V6OA 2NM1A 1U0AA 4YZ4A 3O0XA 4CZSA 1URXA 1IKQA 4DRRA 3O0WA 2V5YA 3QLQA 4HL0A 4XTMA 4ISRA 2DUPA 1G9BA 1SFYA 1G9FA 1FNZA 1N1YA 1Y7BA 5GZCA 3I8TA 1PZ7A 2ZBJA 3AP4A 1N3OA 3BODA 2PHXA 2VH9A 2GMPA 3DUIA 1ULEA 4Y1XA 4XMIA 4AGVA 1GZWB 4GWMA 4PCRA 1QDOA 3OBTA 1W6MB 4FPKA 4YG6A 3SITA 1KQRA 1YRZA 2H0BA 5GZDA 5GZEA 2GALA 2DTWA 2AH2A 3QCWA 3APBA 4DRVA 2FMDA 2NP0A 4Y1VA 1W6NB 1S0IA 1UZZA 4DS0A 1SCSA 4YGDA 2JE7A 2ZGTA 4AVTA 2ZAAA 2AREA 1G86A 1V6MA 1JXNA 1V6LA 1SLLA 2CYFA 2EALA 4ITCA 4R9DA 4SLIA 1IS5A 1UZYA 4NOTA 4YM3A 4Q27A 1SLIA 2PHWA 4Y24A 3AZYA 5IK8A 4LBJA 4RL7A 2GNBA 2YMZA 3ZXKA 1AXKA 4FPYA 4M00A 4XOGA 1SLCA 1LTEA 1UX6A 3RSJA 5T55A 4LBQD 4UW4A 2D6PA 2OW4A 3M3OA 5AVAA 5T5OA 2LTNA 1MS5A 2UWAA 1VLNA 1DQ2A 2C9AA 3ZYRA 3ZSMA 1GYKA 3INAA 2JD4A 5GM0A 4FOQA 5H9PA 1AJOA 1MVEA 1WLWA 3V65A 4YM0A 4ZXKA 4PQ9A 2OVUA 1W0PA 3FLTA 1S0EA 4FOYA 3N3HA 4FOWA 4XHBA 3AFKA 3BTAA 2ZGKA 5GJ6A 3SNMA 3V0AA 1DYKA 3SLIA 2ZGPA 3B69A 1MZ6A 3ZXLA 2I2SA 5SV8A 1GZ9A 3BIWE 1MZ5A 2EAKA 3LSEA 1H9WA 1R1ZA 5JVVA 2DUQA 1AZDA 2DTYA 4YG3A 3V0BB 5DZFA 3MW4A 2A6VA 2DU1A 1WBLA 3B9CA 3WG4A 2AR6A 4P9YA 3OJBA 4R9CA 1Q56A 4W65A 1GNZA 2WSUA 1KDKA 3WDVA 3TAYA 4M3CA 3POYA 4UW6A 1SBFA 5JOXA 1JUIA 1LHOA 2P2KA 3PVEA 4XDQA 3I4IA 1F5FA 3MW3A 1KDMA 2JDZA 1LODA 5DZEA 5BYNA 4YW4A 5DZGA 5KXCA 1NXD1 2E7TA 3POSA 3W59A 1C57A 1LENA 3OY8A 1IS3A 1G7YA 1W6OA 2VU9A 5T5PA 4MYEA 1DZQA 4XIOA 2HYKA 1Q8SA 2WT2A 1OKQA 4M3CB 4YW5A 1N3PA 3AYCA 3OYWB 3WDTA 1XQNA 1YO8A 5JDBA 3WOGA 1V6NA 1LU1A 2ZGMA 5EXOA 4Q8KA 5T5JA 2ZGOA 4UW3A 2KM2A 4PF5A 4Q1PA 4JC1A 1QOOA 4FQZA 5DUVA 1SBEA 3OBRA 2E6VA 5JOZA 2DVBA 4GKXA 3RRDA 1ULFA 4BMBA 3M3EA 2WNEA 2PHTA 4FVVA 1GSLA 1YI7A 1UKGA 3AP5A 2SBAA 5T50A 2GNTA 2D6MA 2WT0A 4UW5A 1LGNA 1SLAA 2ZGQA 4XBNA 4Q8LA 4YFZA 1LHUA 3ZYPA 3VKFC 3O5SA 2DU0A 1S0CA 3WUDA 4YW1A 4XBLA 1SCRA 4NO4A 4Y20A 1QOSA 3ZXJA 3JU9A 5LK5A 1DQ4A 2ZMLA 1FV3A 4M3CE 4TYSA 1ULGA 1NLSA 4FPEA 4ATEA 3HMYA 1V6JA 4LBMA 4OZXA 1MS3A 1QF3A 1S0BA 3AP7A 3AP9A 3CNAA 4XILA 1GKBA 2VW1A 1SLBA 1Q8PA 2A7AA 3WHTA 2D3SA 1WW5A 3A4UA 2R0FA 3ATGA 1WW6A 1DQ6A 4P9XA 3IMNA 5EYXA 1CJPA 4Y22A 4YZ3A 3N7MA 2D6OX 4XJZA 4Y20B 2ZHNA 1JHNA 3T1MA 1Q8VA 1HLCA 1GLHA 2FHRA 3AK0A 1CN1A 3H0OA 1JN2P 5GLWA 1MS4A 4JRAA 1DYPA 1GV9A 3V0AB 1ENQA 1IKPA 1IS4A 5IK4A 1W6PA 4WV8A 5KXBA 4LBKA 5JOWA 4CRQA 1N3QA 1OFSA 1MR5A 1QMJA 2A70A 3WVJA 3V0BA 1N47A 1GANA 2ZA9A 1MVQA 2ZKNA 4LBLA 1CIWA 4CTEA 1V00A 4H55A 5H9SA 1W6NA 2BQPA 4GXLA 3IM0A 2V73A 2D6KA 4KBBA 5HCAA 4ISQA 3ZXFA 1LULA 1S0JA 4WZFA 1FYUA 3OY8B 1AXZA 3VUOA 1KITA 2GN3A 4FPCA 1LGCA 1RITA 2ERFA 3RMXA 3AJYA 3SH3A 3UK9A 3FLRA 2DVAA 4AVSA 2R49A 2W68A 1UMZA 3PJQA 4FPHA 1CVNA 4RA0A 3PMEA 1HQLA 1FX5A 2NMOA 3WG1A 2EXKA 4YW3A 3A0KA 5GALA 1ZA4A 3SH4A 3RS6A 1DQ0A 3FLPA 4K1YA 1DQ5A 2EXIA 2P3JA 2P3KA 2W39A 1AJKA 2ZHMA 1QU0A 2JKBA 3AYDA 4GWNA 4K1ZA 3WDUA 1FNYA 1FAYA 1N1TA 2WKKA 4FPFA 1CR7A 3N35A 2PHRA 3T1LA 2A3YA 1SACA 3AYEA 4BQ1A 4YLZA 2A6YA 3V64A 4XXAA 4XJWA 4YG0A 2YROA 5E89A 2DVGA 3VV1A 2NN8A 3MW2A 1A78A 1O4YA 5T5LA 2CNAA 1QNWA 3ASIA 1UN1A 2AENA 3B01A 5IK5A 3AZVA 1JBCA 5DUUA 4AYUA 3FFZA 1ONAA 5GZGA 3N7LA 1D2SA 1DBNA 2YY1A 2JE9A 1IOAA 4K20A 2VW0A 3ZSLA 1Z0HA 2Z42A 3M3QA 5FRAA 4Z8BA 1CPMA 1KRIA 3USUB 2DVDA 4LBOA 4XYXA 3R05A 1WW4A 2RHPA 4M3CF 1MS0A 1V6KA 4GKYA 1LEMA 4ATFA 4WVVA 1Q8OA 3Q9OA 5IUQA 1WD4A 4FQ4A 3VKNA 2DWRA 2VW2A 1B09A 1ULCA 1YYNA
chains in the Genus database with same CATH superfamily
2RV9A 2VVDA 1E57A 4OLLA 3QH6A 2QDNA 1DLLA 4LEJA 2VL4A 2EF6A 3IWZA 5EP9A 5JR7B 2Y38A 5TSWA 5LRSA 3RMYA 5AC93 1CWPA 4AXOA 1KJLA 3OUJA 4JGZB 2VBPA 4CCCA 4F3JA 1TMF1 4ZY9A 3ACHA 1BMV1 4YZ1A 1MACA 1PVC1 1TG7A 2IUWA 5FJKA 3WDXA 4NVPA 4A7ZA 2VMDA 2JXAA 5F7UA 2VC9A 4YM2A 4BB3A 3ALQA 1IPJA 1QH7A 2W94A 4FBFA 1WUVA 4E2SA 4LK7A 4COZA 1CPNA 4R9AA 1UYXA 3KHCA 1H9PA 5J96B 1AF9A 1QH6A 2J22A 5DXDA 3KS7A 2QQUA 5DUWA 4PQQA 4K6BA 3AMQA 4RS5C 2LRPA 4HANA 4W6WA 4E8DA 3I3MA 4JGYB 1LB2A 2R061 2E63A 1JYIA 4P02B 4EQVA 3J7HA 1LESA 1RGSA 5H9QA 1QQP3 3MPPG 4J1WA 4XUTA 1JYCA 2ZX4A 3NV4A 4CDXC 4CP9A 3RQ0A 4FSJA 3IPVA 2YHJA 3J7LA 2B7YA 3LOIA 4L8QA 2MNGA 4A6OA 4OYUA 2ZZQA 2ETEA 3RG0A 2JECA 1PO23 1B35B 4B4RA 1IG3A 5KHKA 2X05A 4RHV1 1SDDB 5CAZA 2FD8A 1YIFA 1RHI3 4NAOA 3POBA 5E6HA 4GWJA 2CGPA 3O1PA 2ADEA 1R092 3MUZ1 3MUY1 2BYVE 5C3OA 4Q4X1 5DAQA 1MZFA 4XETA 1W6QA 4CU9A 2NZ9A 4RS5B 4Z2AA 2R1DA 4Z1VA 3FC0A 3TNQA 3E5XA 3POGA 2CTVA 2Z69A 2HWE1 2A6ZA 1NCQB 1LHVA 3FWEA 4JDOA 1RUE1 4YVWA 2XOMA 4F83A 1J1LA 2A3WA 4COVA 1QJX2 4FP3A 4IV1A 2OYZA 3SKVA 3RZHA 2YC0A 2Q30A 4Y1ZA 5DPNA 2HWD1 3GCWA 1QKQA 2AUYA 1PM4A 3OEAA 1RL3A 1TZOA 2RDQA 3ENRA 4UFJA 3VBSC 5CBLA 2JB4A 2YBPA 1HV0A 3EO6A 4XF9A 3VBRA 2YBKA 2PTMA 1J1TA 3UJQA 1UW8A 4PIXA 3T08A 4IV1C 5L7OB 1QNYA 1CAXB 3ES4A 2N7GA 3K4AA 4DXRA 4NRPA 1W8OA 1BKZA 2WIIB 3DKWA 1IPSA 3C8XA 1XB9A 2WJSA 5FYZA 4C1WA 4A4AA 1VRBA 1NAEA 1VB2A 3DPRA 4PIZA 4U2AA 4EE2A 2ZEZA 3G7DA 3T2PA 4LNVA 4QDSA 1TNFA 1QEXA 1K5MB 3H3ZA 3MV01 1BBT3 4DO0A 3O12A 4MXWA 2Y6GA 3P5BA 3ZVXA 2VM9A 4HKOA 3ON7A 1TMF3 1GFF2 4XW3A 3ILRA 3E6CC 1R082 2WNUA 3JB8A 1VBE1 2A71A 4I2OA 1I9RA 4S2HA 1ZBE1 2ES3A 3WF1A 5CA6A 3VBSB 4CDUB 3AKSA 3VZOA 5JSRA 1K3IA 4GZ9A 2DYCA 5KXEA 4LKFA 4TWTA 1VBD2 3ZFGA 3GALA 3VDAA 3GBFA 5BUVA 5IT6A 2VUAA 3C7EA 3BTZA 4XTPA 4IV1B 5L7OC 2ZAHA 2BBAA 2HJIA 3JBG3 2ZX0A 5EWSA 2OUJA 1B35A 5HCBA 1POV3 2ZGLA 4E4DX 1V6IA 1VBA2 2MEV1 3KCYA 4XZPA 4DPNA 2JE8A 2P3IA 2Y33A 1CESA 3GNEA 5A3NA 2BFUL 3FUOA 2FQPA 2BVBA 1W0NA 1HRI3 4I3PA 3NSTA 1QIQA 2IFRA 2XGXA 3KV4A 1VBE3 4XFBA 2Q1MA 1RUNA 4LOTA 2Q0AA 3WG2A 4E9KA 5IWFA 3SXWA 5CNAA 3J8F3 1O4ZA 1OLRA 2D6NA 4K21A 3HEIA 4FFHA 5JSPA 4DQAA 3THPA 4RYDA 5FZ8A 4URAA 1ZBA1 2PQQA 3KWVA 2VTXJ 1U5YA 4N43A 2EIGA 3IKWA 4MX3A 3AMPA 4Y22B 3N7JA 3URFA 4CCKA 4GB32 2JG8C 4FI9A 2C9KA 4EZ4A 3N9LA 4RR3A 2IWGB 4P9IA 2QQIA 1DFQA 2VOVA 3AZWA 3A21A 4Q0VA 1PK6C 3U78A 4YZ5A 1VIWB 2R1BA 3KM5A 4CEYC 3RDIA 1JZ4A 1LOFA 3TN91 1ZZCA 2FZ1A 2PHUA 3D0JA 4KWJA 3WG3A 4QB6A 4RFT0 3VZMA 4EN7B 1GUIA 1RUE2 2BOIA 3FE5A 4QPWA 3U37A 2FCUA 1W6OB 4CU6A 4LBQA 4LUKA 2CWMA 4RR3C 1PO22 4OQ8A 2V72A 1LOEA 1O59A 2BGOA 3SMHA 1UAIA 1NUKA 4QWNA 1NCRB 4HLTA 2VZTA 5FXXA 4DEVA 2XVGA 3AMHA 2VNVA 2ILMA 2R043 4FCAA 3H1YA 3EB7A 4KBZA 4FAHA 1NOVA 4WM7B 3R4SA 5FP7A 1DZRA 2Y60A 4BM8A 4AEDA 1WCKA 3HR9A 1SLTA 3HBKA 2VOTA 3WNXA 1HB2A 2NM1A 2GP5A 3O0XA 3I2FA 4HVQA 1S55A 1W8HA 2HWF3 3IDBB 1R1A1 3QLQA 3O7OA 4ISRA 4XTMA 4DRRA 4DZGA 1SFYA 4I0BA 1NY71 4N53A 1WA4A 1PO21 4WVZA 3DEMA 3U14A 3RVHA 3AP4A 1O8PA 3I2JA 3BODA 4RR3B 4R52A 1ULEA 2D97A 4Y1XA 3UGGA 2YB7A 2QQOA 1QDOA 3PUIA 5ERLA 4IE5A 1WCQA 3MICA 1OH3A 2C26A 5F5AA 5I0TA 2RJLA 2VZ3A 1YRZA 1JHJA 1UY3A 4QGMA 4AF9A 5GZEA 1Y9MA 2CDOA 2RMU2 3RZGA 3RYKA 4NIGA 4BQ2A 1W9FA 4ZU5A 4N53C 2NP0A 4QKBA 5LCWL 4QX3A 4FTSA 2J1VA 1SCSA 4QGLA 4YGDA 3N9NA 4YVSB 2AREA 4AVCA 1G86A 2EALA 2KXLA 4SLIA 2W9XA 4Y5Z0 2WNOA 4YM3A 4ES9A 3K4ZA 4Q27A 1SLIA 3H8RA 2G1MA 4LBJA 3U1XA 4COUA 5FZBA 4A3XA 3OF1A 3ZXKA 4FPYA 5FZ4A 5FZ6A 3WQ7A 3ZDSA 4M00A 4XOGA 1U5XA 1SLCA 1LTEA 3I2OA 3KT7A 2FCTA 2D6PA 3WNPA 5T5OA 4AFMA 3P1IA 3PTRB 2LTNA 3LPFA 1XNAA 3VBRC 1DQ2A 2VZUA 2C9AA 1PVXA 4X8PA 4DOUA 5H9PA 1DYOA 4KGGA 1AJOA 4UFKA 4AQ2A 1WLWA 3B93A 2B9UA 4TTGA 2OVUA 1W0PA 4LIVA 4ZONA 1S0EA 2XBO3 4FOWA 3W5MA 1XNBA 4MGKE 5FY5A 1UXZA 1C3HA 1NCRA 5GJ6A 2VBDA 4ZPIA 1K5JA 1YQ6A 3G6JB 2ZGPA 3I97A 1AYN1 3BGAA 3FMGA 1HV1A 3ZXLA 4ORFA 4QQHA 3D0SA 3BIWE 4LLOA 1G6NA 3ACGA 3THCA 1VMFA 1V9U1 1GQGA 2RS52 3B9CA 5FYMA 3T4HB 3S0MA 1GOHA 1HB3A 1RUG3 3PU3A 2RR12 4P9YA 4XF0A 1AR63 3VBRB 4EYUA 3I2KA 4R9CA 4UF0B 1WZXA 3AKRA 1QHDA 2W0XA 2WDBA 3VHRA 5K8SA 3ZXDA 3HNBM 3VL9A 3PVBB 3ZKUA 1F5FA 3MW3A 4FTEA 1PK6A 2Z79A 3DPRB 4UYBA 5DZGA 1Y4WA 3BTYA 3POSA 3MYXA 1LENA 1JU4A 2BNMA 3UV9A 4RD7A 3VDDA 3I2GA 4QPIC 1VR3A 1MEC2 1NQDA 4LHKA 4XDPA 4UAPA 4KU7A 4L97A 1N3PA 1UOGA 3AYCA 1OLME 3WDTA 2X8KA 2WNUB 1O7FA 5JDBA 2YUEA 3C3VA 3WOGA 5FP3A 1LRHA 1V6NA 2OZJA 4Q4W1 4Q4Y1 5GKAC 4Q8KA 2TNFA 4LO5B 4UW3A 4D6SA 2HKXA 1AR71 2B5HA 5HV4A 5F3EA 4GMP1 2FDFA 5FQ0B 4B4QA 1KS4A 4GKXA 3SHRA 1XNDA 1UKGA 2ZX3A 5T50A 3KV5A 5DAWA 4QHZA 2ZGQA 3IMMA 3LEGA 4AI1A 5FUNA 5LBEA 1UQXA 2HWB1 4AI8A 1SPPB 2DU0A 3WUDA 3PLQA 3ZN5A 1YFUA 4MV2A 1YJLA 2V4AA 4QXKA 3JU9A 1VBA1 4JGZA 1UMHA 3WY6A 3VB9A 1JYWA 1NLSA 5BV6A 1OT5A 4ZU7A 3B9IA 4UFMA 1S0BA 3GZEA 4QKNA 1OOPB 3CNAA 2P4EA 4J6GA 1GKBA 2UYBA 4QPGB 1W2NA 4BCUA 3CMGA 1SLBA 1QY4A 1Q8PA 1YQCA 4FT8A 2D3SA 3B7MA 3S7EA 3WHTA 4I0WB 2Q8DA 3KLSA 5EYXA 4Y22A 2P1BA 4HKWA 2WYSA 3I2IA 2QTWB 4XJZA 5LA0A 3CJIA 2ZHNA 3RFRA 2QQVA 2FHRA 3CEWA 2RR11 5D21A 2Y0IA 1CN1A 4PJYA 3C7FA 4CCJA 4XEZA 3VL8A 5CADA 3ETQA 1IQAA 2K9ZA 3WQBA 4CYDA 4LLFA 2XVKA 1CX1A 1AR93 1H1MA 1YHFA 4IGPA 5JOWA 1PMIA 3SKJE 1D4VB 2ID4A 4YYOA 2QQJA 1QXPA 2A70A 1K45A 2QQKA 2XVLA 2ZA9A 2ZKNA 4LBLA 4CTEA 1FMD1 4CXXA 4H55A 1K42A 1OOPC 2JICA 3QD6A 2GZWA 4GXLA 3IM0A 2DCZA 2V73A 2D6KA 2ZEYA 4Q5OA 4ISQA 5FY1A 3NAPC 5F8PA 1JTZX 2QBXA 4QU1A 3TEXA 3VUOA 1JMUB 2ZEXA 2PA7A 1RITA 2ERFA 5EZWA 3SH3A 3AJYA 3ZN6A 3C7HA 4AI2A 2DVAA 2BJSA 2R49A 5FZOA 1Y9GA 1UMZA 2ARAA 4FPHA 2DCJA 4RS5A 1OOPA 4RA0A 4A42A 4XAAA 2NMOA 1UU5A 4YW3A 5GALA 3H7JA 4RFRB 1FT9A 1XYPA 4A7KA 4XBLA 3AYDA 1AJKA 2JKBA 1ZZ8A 4QKDA 1XNCA 2WKKA 2HLEA 4NR1A 1CR7A 4CE8A 2PHRA 1RTVA 2HWE3 3I3BA 4TLFA 1SACA 4MGSA 1REEA 3T1LA 4CDWC 4NRQA 3AYEA 4QX8A 3OBAA 2P6CA 3ZN4A 4M0NA 1OQDA 2CV6A 3AB0A 5E89A 2DVGA 2Q1FA 1DGRA 5FYHA 3Q8FA 2YDEA 2K2SA 3ASIA 4MGYE 2O0OA 2VUDA 1VP6A 1JH5A 4RHV3 4EWDA 1UPIA 1W2UA 5IFPA 5A32A 1RUI1 2J7MA 3Q8BA 4MGZE 4CDUC 1HB4A 3MBWA 4AQSA 2CGNA 3VBOA 3POFA 3WP3A 3CIHA 1FOD2 1UXXX 2DBNA 1W03A 3EHKA 4NPLA 1IOAA 3CJIB 3N9QA 4K20A 1STMA 1Z0HA 5FV3A 3ZSLA 4CUGA 2PFWA 1KRIA 3USUB 2DVDA 2BTVC 5F6KA 3O1OA 4K40A 2QQPA 2JDNA 4QKFA 3ZX7A 1V6KA 1UOJA 4CDUA 4WVVA 1ALYA 2WA4A 4FQ4A 2VCBA 2XUMA 2YXSA 2JDHA 3POIA 1B09A 4OCTA 3ZFGB 1UZWA 4BQXA 4OHYA 1W2TA 1YI9A 2WZR1 2ZZJA 4YZ2A 4FAGA 3ILFA 2W47A 3UKNA 2D6LX 5JZGA 5GLVA 3OUHA 3J8F2 4AI3A 2FMYA 2DFBA 5DG2A 2D40A 3OYWA 3SC7X 2QQNA 3ZPOA 2VMCA 2R6QA 3WQ0A 4XCAA 2PQSA 4XJUA 2GNMA 1VALA 3T0AA 2ZJCA 3JUUA 1K5MA 2XJTA 5LY1A 1ZRCA 2ORZA 1LR5A 1AR91 4HVRA 2EAAA 1LHNA 1JOJA 4Q4X3 1GBGA 5CB7A 3ZN6B 4RGAA 1AL21 4HVOA 4Q4V3 3UNPA 2VZRA 1VPHA 5EPAA 1RUF3 1WKYA 1BQPA 2GDFA 5FO9B 3CO2A 3DXTA 3ZLIA 4A2UA 4CEYB 3GBWA 1H2KA 1RINA 3VBSA 4GULA 2ZPXA 1HRV3 2ORXA 4IUGA 5D1IA 2E51A 4CCDA 2EXHA 1C1FA 4XQWA 1YXWA 4Q0QA 1X8MA 2PHDA 3SISA 1JZ7A 4BPZA 3KGLA 4YNIA 5FLHA 1KFUL 2Z4FA 2HEYF 3N4MA 4XHXA 3VZNA 1OH4A 2ZGSA 5BNQA 3D5OA 4LO7A 1DG6A 4HK8A 4K8RB 4LBNA 2E7QA 1JODA 1YQ2A 1GOGA 3KT4A 2WN2A 2R16A 1H6XA 1UY1A 4OQ9A 3DKQA 2CAVA 3KT1A 3NRUA 4NUBA 2P3YA 4BDVB 3WUCA 1CZTA 1JZ6A 4BLIA 2ZMKA 1A8MA 4PLNA 4DUXA 2L9LA 3KQRA 4BYYA 4RQPB 4B8EA 2WINB 4LO6B 1ST8A 4BXSV 2FDGA 1D0GA 2BGPA 4X6QB 3VZLA 4WM8A 5JMCA 3HIFA 2ZGRA 1W6PB 2GH2A 5FZ1A 4LPLA 4G3YC 4HONA 4EN6B 1PGSA 2W08A 1JOPA 3M70A 4CCOA 1ULDA 2PYTA 4N8MA 4JX0A 3D3AA 1L3JA 1QJFA 2WZ8A 3OGVA 4L11A 2D43A 2UWBA 1GOFA 2WZR2 2C24A 5J1XA 2R0HA 1V9U2 3WNLA 2JD9A 4WBBA 2P17A 3HNMA 3I7DA 3HD8B 4YGCA 4N53B 2OT7A 3W58A 2VZQA 3NV3A 3EYPA 1I3HA 1OVPA 1ND3A 2D93A 2W1WA 4ET7A 4QX1A 1OSGA 4AG4A 1ZRIA 3EQEA 5F5QA 5GZFA 1LECA 5FDBA 1F5JA 1QDCA 1R093 4RQPC 5BXXA 3BUCA 2TBVA 3UYJA 2K46A 3BN6A 3D4KA 4YARA 5J7MA 5A3WA 3CLPA 3V0BB 3SCFA 5LK7B 3ELNA 2BEOA 4YM1A 5DG1A 5A70A 4K7JA 1R1A3 1W04A 3MLKA 1C4RA 1XYOA 4ASMB 5AFEA 5F9TA 3PNAA 1QOTA 4JZRA 4Q0UA 3AJZA 1AX2A 3J7MA 4BQYA 1V70A 1EPWA 2F4PA 2PHFA 2RDNA 4JV4A 2VVEA 2WR9A 5CZKA 3MIFA 2W3JA 3VBOC 1W3XA 2CWSA 2NYYA 1LEDA 1CONA 2NMNA 4R4XA 3DYOA 1I6XA 1K12A 4Y5SA 3VKOA 4BOWA 5JWPA 3R0RA 1HQWA 2WBKA 3UL2A 3OPZA 4PBPA 3TEZA 2RS13 3RWKX 3LQCA 4MZUA 1DGWA 2Q1ZB 5CISA 1OLQA 1FMD2 2ENRA 2GU9A 2K0GA 4GAZA 2ET7A 4Q1RA 1QQP2 3VKLA 4BA6A 5K7PA 3AZXA 4IEPA 5HCFA 2OUHA 2WAAA 1GZWA 3H50A 1EPZA 2XLFA 3OGSA 5FP9A 1W8TA 4XE9A 1UCXA 2YGLA 3OTFA 5A3UA 3WCSA 4UWDA 2WWUA 2R32A 1H6YA 3HPNA 5LBBA 3OGJA 3BYWA 1PM7A 3MIGA 3POWA 4GALA 1X82A 3ZR6A 5CEHA 4WVMB 1CAUB 4YGEA 2YYOA 2CGOA 4NHLA 5K4LA 5A6YA 1AR62 3J26N 2QE3A 3DGTA 4XFCA 2JIGA 1IPKA 2EIEA 2JWPA 5A3TA 3NV1A 5FMBA 3MO4A 1LNSA 3DPRC 1RUD1 3HVDA 3D6EA 1LOBA 4BMEA 4OFGA 1VBE2 4XJ8A 5AVPA 1GICA 4C1XA 3O1VA 3O1TA 2C4XA 4QPIB 1EYBA 3ACLA 1MS9A 3E5UA 3IN9A 1KJRA 3MEPA 1BXHA 3O1SA 1PX4A 1ZM1A 1EUUA 5C9AC 3Q8EA 3K4DA 2P34A 5CG9A 1CJDA 1HDKA 1ND3B 2WNUC 4AAPA 3S57A 1RUH3 3HJRA 1A34A 1ZRRA 3DN7A 5A32B 3T2TA 1IZ3A 1J58A 3K77A 1PNGA 3K46A 3AZZA 1WW7A 1BJQA 1LCLA 1S0GA 3WDWA 4A3ZA 4Y1YA 1ULPA 2BOJA 3VBHA 4M01A 1COV3 1OQ1A 2VO5A 3IDAA 1RUI2 2J1UA 4QMAA 4TZDA 1EV11 3RGBA 3A0NA 1SEFA 1TME1 4EWAA 1Y9QA 1UKRA 1AX1A 5FWEA 5T54A 3NW4A 2Q5TA 3LD8A 1H8VA 1W8WA 2BW8A 2DV9A 4FTBA 5LRRA 3JB4C 4NRMA 1C1LA 3GDBA 1AYM1 4PDWB 4C0HA 5C7GA 3VBHC 3S7IA 1LHWA 2B4KA 1V0AA 3MLJA 4LBQB 5JSOA 1J59A 4F8AA 4QPGC 2RJ2A 2DUPA 1NY72 4F7ZA 1G9BA 1G9FA 3WX5A 1SPPA 1FNZA 2FCVA 1N1YA 1QXRA 2UY9A 1TME3 2R062 5FXWA 4A7YA 4BQWA 3MIEA 1SZBA 1F4AA 3MF6A 3VDDB 3Q8AA 1SFPA 5FO7B 3NNJA 2PHXA 2GMPA 3DUIA 3PDQA 4XMIA 4AGVA 1GZWB 3MFCA 5CYYA 5EJ3A 2IXHA 2ADDA 1W6MB 5F6LB 2WFF1 1KQRA 5F39A 2W5FA 1D2QA 2AH2A 1NCQA 2DTWA 1UYZA 3WNOA 1PMHX 1Z7S2 1PX3A 1W6NB 2JIJA 4WM8C 4Y5TA 4PDWC 4AVTA 4IV3A 4CDQA 1RUD2 2CYFA 1GQHA 1REDA 1UYYA 3DECA 1FOD1 4IEWA 1PIV1 5FOBB 1IS5A 3UKVA 1M06G 1JUHA 4Y24A 5FZAA 5CKNA 1XE7A 5IK8A 5A3LA 1ZYBA 2GNBA 2YMZA 3JD72 3KCXA 1NZIA 2G19A 3B5LB 4GB33 5FLJA 3RJ2X 5F5CA 3RSJA 1X36A 3VDDC 4M4PA 2DCYA 1X7NA 1BK1A 5T55A 2GC3A 3B94A 4I01A 2VG9A 3I59A 4JHZA 3WINE 2XJQA 2UWAA 3MDPA 5F32A 5A80A 1QJX1 2Q8OA 5FY8A 5I0SA 4LJHA 1JZ8A 4QDQA 2XPJA 4OZOA 1XNKA 3JBG1 4RQPA 5APAA 3VN4A 3ZYJB 1GYKA 1VMHA 2D98A 3INAA 5GM0A 5A7WB 4FOQA 3M7AA 3U07A 2X5IC 1F2NA 3VGIA 4XC9A 5DQ0A 5C4WC 2LM3A 3V65A 2RDRA 4JAAA 5A7OA 3ZDVA 1WGPA 3FLTA 4LE3A 5F37A 1XYNA 4KWKA 2ZGKA 1DYKA 1OXCA 3A22A 3SLIA 3H3LA 2E7AA 1XRUA 4CDXA 2IZWA 4B7KA 1FI2A 4W6YA 2Y8KA 1ULOA 4K9SA 3VBFA 5KC5A 1BEV2 1GQPA 3LSEA 1H9WA 1R1ZA 5JVVA 4QB1A 1AZDA 2DFCA 3ECQA 2EA7A 3JQWA 5DN2A 4AHWA 4AEMA 2VXJA 2JDPA 1Q56A 4CEWB 4CCEA 2W1QA 3WDVA 3TAYA 4M3CA 1RUJ1 3ST7A 2WQ8A 4UW6A 4LT5A 1LHOA 3PVEA 4KQ7A 3HT2A 2G9FA 2E26A 4NHMA 1W90A 1RYYA 4AFAA 1ZBE2 3CHXA 3LDBA 1NG0A 4N90A 1J3RA 3KB5A 3L9JT 4DUVA 3O1UA 2E7TA 1UZVA 2O14A 3FBMA 2OIIA 1C57A 4D94A 5L9VA 3OY8A 2BV4A 4AHZA 2RR13 5T5PA 2HWC2 4IETA 4N9HA 2VUCA 3BVCA 2X29A 1E5HA 1OKQA 4FFFA 4IEZA 3PUSA 1WCDJ 5A3OA 4EN8B 1DGWX 5JUVA 4IEQA 5KHHA 4QX0A 1YO8A 2LW8A 4XF4A 1LU1A 1AYN2 5T5JA 2C1FA 2KM2A 4KU8A 4PF5A 3MZHA 4KL1A 1W2OA 4CPBA 5DUVA 1L7LA 4CEWC 2WNVC 2E6VA 4UXAA 3SCHA 5JOZA 3O14A 5LA9A 4CDXB 4YW7A 1GSLA 4E4ZA 2VCAA 3S30A 1EAH3 4OI4A 3NNLA 2GNTA 2D6MA 2WT0A 1LGNA 1B35C 2KD7A 1DGRN 2EIBA 3RNSA 5LEJA 3MGUA 2W1SA 3UESA 3O5SA 1S0CA 5JZGB 1H8TB 5A3PA 1SCRA 4Y20A 1MEC1 2YPDA 3LEMA 5L9RA 1OPMA 1DQ4A 1MEC3 3PU8A 1Q43A 2IXKA 5LK5A 4FFGA 3BU0A 4M3CE 5F5IA 2WZR3 4TYSA 5LB6A 5EJ1B 2XJUA 4FPEA 5FTTC 2I07B 3HMYA 4GMP3 4Y4RA 1QF3A 2A73B 2AEZA 3AP7A 1ND2C 1QQP1 4D7SA 5C8CB 4ES8A 4BIOA 3I2HA 3A4UA 1DQ6A 1NCQC 4P9XA 1MPXA 3IMNA 4IEVA 4CCNA 4OUSA 3PIGA 4O7XA 4LO4B 4QB2A 4QPIA 1Q8VA 2PHLA 1GLHA 3AK0A 3GM8A 4XPVA 1CAWB 5GLWA 1JN2P 4LIUA 5JR2A 1DYPA 1GV9A 5FFOC 3QBQA 3V0AB 1ENQA 2BVVA 2XLAA 2F4LA 2BP6A 1IKPA 1IS4A 4LULA 5IK4A 5IVVA 5LZ6A 3VHOA 3S5QA 4LBKA 1Q3EA 1AL22 2B42B 3I3EA 4CRQA 1XU2A 3WVJA 5CFDA 4OMCA 4FFIA 1GANA 5SV5A 4CXWA 5A3MA 1AL0G 1CIWA 2F6BA 2Y64A 4BK4A 4E8CA 4LORA 1ND2B 5JIAA 2WZPP 2BQPA 1PGL1 2YFZA 4MSVA 4Q4X2 2Z2SB 3ZXFA 1LULA 1S0JA 1H8TA 2VTXA 3CBNA 4CXYA 1XC6A 1FYUA 2FDJA 3OY8B 4HOOA 4N43C 4Q0PA 1KITA 4DIQA 4MGTA 2WZEA 4Q4W2 4FPCA 4P00B 4IE0A 4KWUA 2YC4A 3ZFFC 5KBFA 3ZYIB 4GD4A 2VOXA 3GJBA 3MHZA 4OVEA 1HQLA 1FX5A 3BALA 3E97A 2EXKA 4R4ZA 5D8AC 4OHZA 3SH4A 1WLTA 3RS6A 1AR92 2Q8EA 1O5UA 5BNPC 2VZVA 1DQ5A 1FPN2 1MQTA 2P3JA 3H8UA 3LAGA 4EV0A 4HSLA 1FNYA 4IL7A 2VMFA 2XKPA 4OI0A 1CIYA 2A3YA 5FZOB 1W8UA 5FPXA 3WP5A 3E1F1 5LBFA 2RJKA 4BQ1A 3KF5A 1U5ZA 2YROA 4L92A 5A7PA 4ZZ8A 2YPJA 4K8FA 3MW2A 2WABA 3N9OA 3TWIA 5CFDB 3M4FA 2UYAA 4IV3C 4CDQC 4W8JA 5FYSA 2HEVF 2Y6KA 2BZDA 5IK5A 5E1RA 3ZFEC 3BOWA 4BQ3A 2XQXA 2VZPA 3FFZA 1ONAA 1VBD3 1OLMA 1D2SA 1RUG1 1Z7S3 1C8M2 2VMGA 2RS33 4ZS2A 1JYNA 4JQTA 4ZU4A 1CAWA 3TEYA 4B29A 2QCSB 4HK9A 1UOBA 3UETA 4ZXEA 4ZZ5A 2B46X 2J42A 3GCXA 4M4RA 5I93A 4QGNA 3PL0A 4PT6A 3Q9OA 3NO8A 5EQUA 3USSA 3OG2A 2VQTA 3VKNA 2DWRA 2D5FA 2VW2A 4J1XA 4RGGA 5IVYA 1YYNA 5A7WA 1MQTC 5LATA 3WW1A 1LOGA 2AEYA 4CSWA 4W6XA 2GNDA 1W8ZA 2EXJA 1N1VA 3LFIA 3VD7A 2TEPA 1T2XA 2JDUA 4H3WA 5FWJA 1ODMA 2QZ2A 3OGRA 2YBSA 3WDYA 5I91A 3TEWA 3LA2A 5A7QA 1O5LA 2PMWB 3GF6A 3VD3A 3U4SA 1AXYA 1R081 3LEKA 4NROA 1PMJX 4DFSA 2A75A 2VCCA 3LF7A 4JTOA 1C8M3 5CIRA 4AI0A 1LOCA 3U10A 2XJSA 3IPVB 4AFBA 1HXS1 1YFXA 3ZO0B 3MF9A 2W52A 3DF0A 4D3WA 1YJKA 1WLCA 2R072 5A1AA 3I49A 2FDKA 2XKOA 2HWC1 1VBC2 1AYM3 3PVNA 4MHRA 2XMLA 2AC1A 3WF4A 3ZMNA 4CEWA 4Q4W3 2CY6A 4XFIA 2WRAA 1BEV3 2VOWA 3DCQA 2BU9A 1AVBA 1HJGA 2RM21 2J1EA 1GZTA 1ZRDA 1DQ1A 3THTA 4FPOB 4PF1A 4UFLA 4XAEA 4XJ9A 3U4XA 4AW7A 3AFGA 4Y3OA 3M3CA 1AR72 3CZJA 1L7QA 1QJZA 4BISA 5IVEA 5I0RA 3JCIA 1A6CA 1N1SA 1H2MA 1LJ7A 4I3GA 4OUEA 3BIEA 3ACIA 4QT6A 1M4WA 3FHIB 4QDRA 1ZNPA 4D6QA 2EVXA 1X9TA 5FYTA 1GZCA 2AYHA 4WVMA 3ZSEA 4DXZA 2ARCA 3VBHB 4IE7A 1RB8G 4YVSC 2XB6C 2Z5WA 1O3TA 4FP2A 4JGYA 1CAVB 1UY2A 4GB31 2Y6LA 5FK7A 4W4ZA 2VMHA 3GZTB 5HPOA 2GMMA 4GWIA 1HW5A 5FYVA 2CSGA 2A6WA 5FZKA 2XUEA 4Y4YA 1AYN3 4NPRA 1I5PA 4S2DA 1JOBA 1DIWA 5IHRA 1HRI1 1ENSA 1ENXA 3WLUA 3WNKA 1ZREA 5FZ3A 4XQ4A 4AR2A 4JRLA 3HQUA 3HAGA 4AWDA 2Q8CA 3WV6A 1AR73 4QM9A 1NCRC 1RHI2 2VQAA 4CU7A 3AKQA 3NV2A 4NIAA 3IIAA 3T2OA 2X10A 1YFYA 4IDZA 5CG8A 5FOJB 4WM8B 2VNOA 3K75B 2ZMNA 1BCXA 1J84A 4CUAA 4OMDA 1RUOA 1CGPA 3JD71 1ODNA 1GWKA 1VBD1 2ARBA 3LDKA 2IVJA 1W6MA 2WO7A 4JKKA 3ITQA 5LWBA 1BK0A 4V2WA 2CL2A 1POV0 1US2A 2WLQA 4YWAA 3EBRA 3AMMA 3WF2A 1MS8A 2B45X 2AZ5A 3HQRA 1H30A 4L99A 4P9GA 4UT5A 2DVFA 3AVRA 4FXKB 1ACCA 2E53A 3AXDA 1SQ4A 1JU3A 1OF3A 1YCIA 1I1EA 2RS51 4QD2A 3LSDA 3OD4A 3FN9A 1WBFA 5FZLA 1UPSA 5E8AA 5IK7A 3AYAA 3O0VA 2VNGA 3LEIA 2PELA 4XFAA 5T3NA 2YV8A 4JCKA 5C4WB 2PLV1 3WT3A 2QFEA 1XSQA 2B39A 1Z78A 1AX0A 1AUYA 3NWKA 4XBQA 2VXRA 1DZTA 5I0UA 2C6SA 2P6HA 3H7YA 4R8HA 3U0ZA 4ZKTB 2QQLA 1POV1 4XVHA 2IFWA 2UURA 1UZ0A 2GC2A 2WQ4A 3FUQA 3ZXAC 4IERA 3H1MA 1AR82 2HBUA 1WD3A 3QACA 4LA3A 1QWRA 5FPAA 1RUE3 1OI6A 4P5YA 4BK5A 1DDLA 4QXCA 1NE6A 4D69A 2PXJA 2RS31 1RIRA 5C70A 4KMQA 4S2GA 2WWJA 3EJKA 4GA9A 1QJU2 1GP5A 4IGOA 3AXEA 3WD5A 1S0DA 1PVC2 1Y3TA 1W0OA 1OURA 4LHSA 2J1SA 5F3GA 3I3QA 1UO9A 2RS53 1LU2A 1TVGA 3O1MA 5FREA 1RUG2 4R9BA 2RS12 4I0AA 1OA3A 4LITA 4B1LA 5FZEA 5JLVA 1BVVA 4CDWA 1VRH1 4XZUG 1WCSA 2A3XA 5F2WA 3RJRA 2RVAA 3WR0A 2KA3A 4HKLA 3NAPA 5FBZA 1G9DA 2IXJA 1BYHA 3K3NA 4MHUA 5L73A 2VJXA 4AGRA 2DUOA 1CAUA 2LUWA 2P5BA 2CHHA 1DCSA 1A8DA 3ZFEA 4YW2A 4IESA 3X29B 3TN93 3OPWA 4AEDB 1X50A 2D44A 1HRI2 1QJEA 4LKDA 4CEYA 5JPNB 3M1HA 2DCTA 3K2OA 4XUNA 3OCPA 2BWCA 3FHQA 4WVWA 1RXFA 1W06A 3NNGA 5ISLA 4N7IA 4JQRA 5T52A 4XDOA 4BWOA 3VLBB 4AEJA 3AKTA 2CDPA 4Y26A 1VMJA 4NMIA 3PIJA 4QX7A 4Y1UA 2LROA 4KH9A 2GAUA 2YU2A 3NJVA 3OPTA 4HXCA 4KGQA 4BXFA 2XHNA 1UL9A 1W8NA 2HWB2 1J3QA 2XONA 2XG3A 1DU3D 4HBNA 4EN9B 2ARXA 2D7FA 5C4WA 3B00A 4AK3A 1V6OA 4DXTA 1U0AA 1UF2C 5C8CC 4DINB 2GP3A 1X9PA 1KEXA 1W39A 4GJYA 4DY5A 1E5IA 3KF3A 4AEDC 2W95A 5FP8A 4Q4V2 2RG4A 4K3UA 4LO8A 2VAUA 2ZBJA 4D7YA 1N3OA 1YIPA 1RJ7A 4I02A 4D0QA 1K5MC 3E6BA 1JZ2A 4Z07A 3CU7A 3WSOA 3NL1A 4GWMA 2FDIA 4AFDA 3U75A 4FPKA 2ZX2A 4EN0A 5CFCA 3T0DA 2GALA 2WL1A 3AL5A 4DB5A 4LXLA 5FYIA 1HXS2 3OSDA 4Y1VA 5A1LA 4DS0A 5F3CA 5JCTA 1TME2 2R063 2JE7A 1VRH2 2ZGTA 3H9AA 4JDNA 5HBAA 1JXNA 2ZTNA 2XXZA 4ITCA 4R9DA 2E9QA 5FZIA 4AFCA 4DUWA 1JZ5A 1UZYA 2OZ6A 3Q8CA 3ZOIA 4JKMA 4RL7A 2BBVA 1O3SA 3VD5A 2B8MA 4JTNA 2RM22 4CDWB 1GP4A 3WQ1A 4ZS3A 1ZBA3 4E2GA 3AVSA 4META 4LBQD 4XUPA 2OW4A 2RS32 2RMU3 3M3OA 3ZFFB 4TLGA 2VBBA 1MS5A 2VQUA 3AM2A 1KFXL 4LA2A 4D8MA 1ND2A 4EZHA 5C8CA 5IVBA 1CAVA 3CJXA 3ZYRA 3CZUA 3ZSMA 5IFTA 2VTFA 1H4HA 3NNFA 2JD4A 3OUIA 1MVEA 2W2IA 1EV12 5FZ7A 2RDSA 5BNPB 3GZAA 4YM0A 1O4TA 5FAXA 1WA6X 4XHBA 4AVAA 3AFKA 3I59B 4PHZA 3AC0A 3ACFA 3SNMA 1Q5OA 1C5HA 3V0AA 4JDMA 2ET1A 3B69A 1PK6B 4NHYA 4NN0A 1W9TA 4O61A 3PJYA 3ZR5A 1R64A 5FLIA 4CPBD 2I2SA 3VBUA 3E5QA 2EAKA 1ZBE3 3ETPA 5L19A 2DUQA 3ZYGA 1S2EA 3ZFGC 5CFDC 5HCHA 2A6VA 2DU1A 3AMNA 2AR6A 3NJYA 5FKCA 2VPVA 3OJBA 4IEUA 1OD5A 1GNZA 2WSUA 4AI9A 2QZ3A 5LA2A 2VVFA 1KDKA 1RUJ3 1GR3A 2HYXA 2VR4A 3NMBA 3POYA 5DAXA 5ANQA 5FK8A 4CP1A 1FOD3 1SBFA 1FXZA 4UFHA 5JOXA 2DCKA 2W92A 4UBGA 5FKBA 1OA2A 1BMV2 3P6BA 4XFHA 4AL9A 3LWCA 1LODA 5DZEA 5BYNA 3IBMA 3ZFFA 1HN0A 4YW4A 5FY4A 2HWF2 1OQEA 5KXCA 4WM7C 5BNOB 1RUC2 4OI2A 5FUPA 1IS3A 3T09A 1LAJA 1ZZ6A 2DBIA 3MLLA 4HMZA 1Q8SA 4J25A 2WT2A 1HIXA 5CKQA 3RWNA 1RXGA 4M3CB 3HOBA 4UF0A 3A7QA 4YW5A 5J36A 1US3A 1MQTB 4MLOA 2ZGMA 2ZGOA 2RM23 3KD4A 3IDCB 2C0ZA 2HWE2 4JC1A 1SDWA 4KI5M 5FIXA 1O3QA 2YFUA 3VHPA 2WA3A 4URTA 3PHMA 1TMF2 1O3RA 3F95A 1J83A 1XJAA 3RRDA 4FVVA 1YI7A 4CCLA 3AP5A 3NJXA 2J1TA 2NPIA 3OBZA 4O65A 4XQDA 1IHMA 4NWWA 1W28A 2QUOA 3ZYPA 5IW0A 2JG8B 3IZOA 2GH8A 1QXJA 4RHV2 3VKFC 3VDCA 4RGKA 4YW1A 5BNOC 2VMIA 1VBA3 1UOFA 2BFUS 1V9U3 4MGQA 4MOAA 3QH7A 1FV3A 5EJZB 1QJU3 5DMYA 1HB1A 1RUC1 1V6JA 2HWB3 4LBMA 1MS3A 3ME2A 1NYWA 4N9IA 2GSYA 2X5IA 4GH4B 3LFMA 2VW1A 3HNYM 4PDWA 5LY2A 4QQPA 5A1FA 2PAEA 3ATGA 4BH9A 2R0FA 1HX6A 3H8XA 2X09A 2V4VA 1R1A2 4XURA 3WEZA 4YZ3A 4G9SB 3KHBA 3N7MA 5A7NA 1Y43B 4Y20B 5AFBA 2PLV2 1JHNA 3T1MA 1HLCA 3BPZA 1X33A 3T3YA 3UT0A 1E5RA 5DAPA 1MS4A 3HN3A 4JRAA 1F8VA 1VBB2 2V09A 1PO13 1RMU1 5K0UC 2Y0OA 3H1WA 2Y6JA 4LQRA 4A44A 5HV0A 4WV8A 2DF7A 3FL7A 5FZGA 1TE1B 3K3OA 5LASA 5A6QA 3ZYBA 2D5HA 1QMJA 1W05A 4HG6B 4PLOA 4QXHA 3V0BA 1N47A 1XE0A 1V00A 2ZOEB 1FMD3 4IE4A 1W6NA 1REFA 5FUIA 1E5SA 4O9GA 1OA4A 1X8EA 1YC61 2XL9A 5CFCC 1GNYA 1H4GA 3KV9A 3P3NA 2BWAA 4C90A 3BB6A 4QX5A 4CP2A 2GN3A 4SBVA 5CKMA 5A7SA 3WF0A 1LGCA 2F17A 3RMXA 4AVSA 3E6DA 4LKSA 3FLRA 2W68A 4IEYA 3VD9A 2ZCWA 3MV11 4V2VA 1CAXA 2DDUA 2WFF2 1UU4A 2WLPA 1COV1 3A0KA 1ZA4A 1DQ0A 3FLPA 4TXWA 4C91A 3C7GA 5FY0A 1PO12 4K1YA 1C5IA 2RS11 3J7NA 2Y6HA 4FXGB 2W39A 2P3KA 3WDUA 2NQYA 1QU0A 1CZSA 2IXCA 5J98B 1RUH1 1FAYA 4MG2A 1GU3A 4X6RB 3VD4A 1YNAA 1KGYA 3N35A 1EUTA 2XBO1 4MXWB 4A41A 4C0BA 1AHSA 1UMIA 1D7PM 5FY9A 1NZCA 3LPGA 4OUMA 1NA1B 4Q4Y2 2A6YA 2I74A 4YLZA 3V64A 4M0HA 2XWBB 4XJWA 4AHYA 4IW3A 3RPQA 1OKOA 1GWMA 1O4YA 3NNMA 4ZHNA 2XR4A 4AQ6A 2BGCA 2CNAA 4V1PA 5FMDA 3TBDA 2AENA 4BZ4A 5AC92 3AZVA 2R041 3CL1A 5KHIA 5GZGA 5C9AA 3N7LA 1ASJ2 5B4XA 1W8FA 1F4HA 2VOKA 3JZVA 2WO1A 4B3NA 1AR83 3L2HA 2QQMA 4Q4Y3 1QJY1 2QVSB 4Z8BA 1CPMA 1RVF2 1JZ3A 4XYXA 3R05A 2RHPA 4GMP0 3IAPA 1MS0A 5FYUA 3HWJA 2OPKA 3WXPA 4GKYA 1LEMA 1NA1C 4PI0A 5IUQA 1BEV1 1CX4A 1WD4A 5LA1A 2P37A 2J1RA 4XFFA 1ULCA 3KQ4B 1GWLA 3M3IA 4WZCA 3POJA 4E4HA 5BNPA 2HWC3 2JKXA 2BERA 1UU6A 1IGOA 1VBB3 3UKTA 2FDHA 2ZGNA 1VBC3 2G4IA 3LCPA 5G05L 1C8M1 4QM8A 5FPUA 3OGGA 5KHJA 3WW4A 5C3QA 4Z82A 3USUA 1NA1A 3B3QE 5E88A 2UU8A 5IJRA 1AR61 2ZACA 4DY3A 3MI8A 3A23A 3BOPA 3GJAA 3ROUA 3MIDA 4NJ4A 4P08A 3V56A 1XSRA 1DHKB 4IEOA 3TRSB 3IAQA 2NLRA 2YC2A 1EAH1 2XH6A 3B02A 1ZVFA 1UYPA 2WAOA 2LALA 4H7MA 1OUXA 5FMOS 1FATA 3IT8A 3TYJA 1DGLA 1G9AA 5I8SA 3HN1A 4Q29A 5E16A 2ZS6B 4NIHA 4MADA 4NIDA 5HI0A 3IB3A 4XIKA 2VGDA 1XU1A 3NAPB 5IYYA 2WFF3 1JW6A 5A6XA 1W2AX 4P9WA 5EFUA 1BZWA 5K0UA 4AVBA 3PUQA 1NX9A 4Q2FA 1I5ZA 2R073 2WS93 3GYDA 4WM7A 1RUJ2 2IXLA 3L2YA 5BNOA 5K0UB 1QJU1 1YEWA 5EYYA 5JI9A 1W9SA 4P5HA 5BNNC 1Z7S1 1COV2 5F1RA 3JQXA 2H6CA 2PN5A 4Q26A 4AVVA 1BLZA 1NQJA 4YPJA 3LOBA 1D4M1 4L0PA 4QXBA 4ARYA 3FZ3A 3WHUA 4E27A 1FV2A 1H1AA 4XJAA 5FZ9A 2J1AA 4XF1A 2XDVA 3RYPA 2QKDA 4KNCA 4BLJA 5FPLA 4HPKB 2A6XA 4P9LA 2BDRA 5GLZA 1RUF2 2CAUA 4DMIA 3WCRA 5C9AB 1NKGA 3LGRA 2O8QA 5DDJ1 5J48A 4EJRA 3BCWA 5LEKA 1QGLA 2O8OA 3AKPA 2WT1A 4XACA 2AGSA 1RJ8A 3KGZA 1XBFA 4FPLA 3VZJA 4FPJA 1EV13 1S1AA 1WMEA 2W87A 2WFPA 1LKNA 4UI9L 3TOJA 4P14A 2SLIA 2JG8A 3VHNA 3P3PA 2BUKA 3MPBA 4U36A 4OHXA 3O1RA 1S0FA 3LIGA 1D4M2 1GMMA 5I8YA 2BRTA 3AX4A 3C2UA 1KD7A 4NE9A 5FBJA 1ZX5A 3RZJA 3GZUC 5JIUA 1YFWA 2GC0A 3ORJA 4BHPA 5EV7A 3EXUA 2YGMA 3DXUA 4FPGA 2WC2A 2MEV3 3NVCA 2ZABA 3H3UA 4IGQA 1F15A 4I30A 4E2QA 3U11A 1IQDC 5FO8B 4OHVA 4RN5A 5KC6A 4XXPA 1QJY2 3C7OA 4COYA 1PZ9A 1LOAA 4PIYA 1YLLA 2JENA 1HRV1 4BIFA 2XJPA 3W5NA 4XUQA 1UD1A 3TB0A 3VKMA 4C8DA 3FBYA 1PIV2 5DUXA 3HQXA 2TUNA 1UY0A 5HXVA 2EICA 5FYCA 3ZSKA 2VNRA 5IATA 1RUF1 1SBDA 2A5ZA 1ENRA 2JEMA 4JKLA 2DURA 3CDZB 4MVTA 4EROA 2VD7A 2BNNA 3DYMA 4IXLA 1APNA 4JVAA 4KG8A 5JPMB 1A3KA 4QQ2A 3R4DB 1RHI1 1D0HA 5GLTA 5KXDA 5C3PA 3SCGA 2D3PA 3BU7A 3HBZA 2YU1A 1O8SA 1LOFC 1GNHA 5LW9A 5H9RA 3I54A 5KWRA 5BPXA 2UWCA 2WSVA 2GMEA 1H2NA 5CU1A 2ZXQA 2WUHA 2RE9A 1HRV2 1FPN1 2XJRA 1NLRA 2C5DA 4YFWA 1F35A 3LZZA 4QU2A 3BKZA 1WLDA 4B7EA 4BQ4A 1SMVA 5DAVA 1W99A 3GHMA 3UJOA 4W50A 3IIIA 4YSFA 2G9GA 5JAXA 2JB8A 3ZSJA 4H14A 4XF3A 1PZ8A 5FZ0A 2JDMA 3OD0A 5FZCA 2HWD3 3R4UA 4HZFA 3H8OA 1VAMA 2ZEWA 3ILNA 5JXIA 4FOVA 4HPKA 3T4VA 3SH5A 5D8AA 3DYPA 2ZHLA 3N9MA 5DDJ3 3S5AA 1PHMA 2VY0A 4H7LA 1OUSA 3WW3A 2JDAA 5GLUA 1CQ9A 1RUI3 1F31A 1BVP1 5FZFA 1VRH3 4D6RA 3ZYFA 1EP0A 4PBOA 4XMAA 3M2MA 3J9SA 4QAWA 1WWYA 2W1UA 4PI2A 1ASJ1 4Y33A 5DABA 3LA7A 3WZ1A 3J8F1 4AHXA 4PLMA 2XQRA 3CJIC 2XHKA 4LE4A 1J3PA 2MPFA 1F9KA 1KXGA 2VCMA 4AQTA 3FX3A 3OOXA 2Y26A 4HN1A 4Q0SA 1LGBA 1H8TC 1AYM2 5FJHA 1OPOA 2WNVA 2GN7A 3ZXEA 2YZ4A 1UNBA 4QQOA 5C8WA 4HN0A 3WNMA 2R071 4AGGA 4S2FA 5FQ0A 3FHAA 1NXMA 1YQ8A 3N36A 5FXVA 4MGIE 4NAMA 1G9CA 4BE3A 2XBO2 3ZIWA 2WQZC 4NPMA 2BPA2 3AP6A 5FPVA 4UBHA 1NT0A 3MIHA 2JJ6A 1OFNA 1OD3A 4JGYC 5JI7A 2ZHKA 3ZKYA 3ZM8A 4CA9A 5ACA3 3ZPYA 4GIQA 4NHXA 2D3RA 2WYFA 3VBUB 1HKDA 5M0TA 3PVOA 5G04L 2E33A 1H2LA 1TEIA 2O1QA 1G8WA 4DXSA 4I09A 1WMXA 2ZGUA 5ABJB 2PAKA 4YGBA 1W6QB 2ZX1A 3RYRA 2RMU1 5J37A 1W9YA 2W46A 1OC1A 3GHNA 4IQPA 2B9VA 4KWLA 4MH0E 4ASLA 5JOYA 2OQ6A 4QPGA 4YW6A 1EAH2 5C6CA 1Q8QA 5FR3A 1VAVA 1S2KA 3ZXGA 2IC1A 1BBT2 3UGFA 2BNOA 4COWA 1IS6A 1MS1A 2XWJB 3N7KA 2E32A 4Z2WA 2G9ZA 4YZ4A 4CZSA 3ZMOA 4GH4C 1URXA 1IKQA 2PAMA 3F2ZA 3O0WA 2V5YA 4HL0A 4UOJA 4NIIA 2VUJA 1W3VA 1Y7BA 1S4CA 3PMSA 4AZZA 3I8TA 5GZCA 1PZ7A 5L36A 4L9BA 2KR2A 1D4M3 2GC1A 4LTAA 1XOYA 2VH9A 5AC91 3W21A 2WNVB 3JD73 2I45A 3VBUC 5ACA1 1PGW2 4PCRA 3ABZA 3D82A 3OBTA 3PUAA 2IXIA 4YG6A 4IE6A 3SITA 5L7OA 4O9EA 2VZSA 2H0BA 3CKHA 3NKTA 2WS91 5D2AA 5GZDA 3CF6E 4AEKA 4YRDA 1QJY3 3QCWA 5ABJC 3APBA 5C5UA 5B2GB 2X53S 4DRVA 2FMDA 2IVIB 3M8LA 5D8AB 1S0IA 2ZKLA 1UZZA 2A1XA 5EIYB 5JZGC 1QJX3 2ZAAA 3PUHA 2VULA 1DF0A 1V6LA 1V6MA 1SLLA 2JG9A 2R7EB 5FZMA 3T0BA 2JDYA 2VE1A 3WW2A 4Z92B 1PGL2 4NOTA 4QHOA 1UWWA 2PHWA 3AZYA 3T30A 3LDRA 1AL23 3NJZA 4Q4V1 5F3IA 5DDJ2 5ABJA 1AXKA 5IAXA 4QHBA 1H0BA 1WMDA 5CFCB 2WN3A 1CZVA 4CUCA 4TSVA 5CVRA 1UX6A 1ASJ3 2OPWA 1U12A 2V5DA 4UW4A 5FZDA 5AVAA 1TNRA 1OMIA 5I0DA 5FZHA 2WS92 5BY5A 3ES1A 1SHWB 4IV3B 4CDQB 1VLNA 3NKGA 1C28A 4GH4A 5HXMA 5ACA2 1PGW1 1T6GC 3ZYHA 5A33B 2Y6FA 1P8JA 4LMFA 1RC6A 3KSCA 4ZXKA 5B4NA 4PQ9A 1XNTA 4FOYA 3SQOA 3N3HA 5FYBA 3VBFC 1XPWA 3CQOA 2PLV3 1W9WA 4H2AA 4QPYA 3BTAA 4INDA 1SFNA 3SEPA 5I8TA 2QQWA 3POEA 4HFSA 3GGLA 5IVJA 1FPN3 5C33A 1MZ6A 1S2BA 5FPZA 5KR7A 4LK6A 5SV8A 1O6UA 1ZZBA 1HN1A 1CD3G 1GZ9A 2WWSA 4LHNA 1MZ5A 3NQHA 4LUMA 4OHWA 4B1MA 1AR81 4CCMA 4N43B 2MEV2 2DTYA 2OA2A 1SG3A 2JG9C 4YG3A 1VE0A 3MW4A 5DZFA 1WBLA 3VBOB 3J4UH 3WG4A 5FYYA 4BU2A 4A6SA 3SEEA 4ASKA 1PVC3 2CU5A 4W65A 4LOSA 1YQ5A 1L7RA 5FPBA 3I3DA 1JUIA 4XDQA 2P2KA 2OX0A 3I4IA 1UIKA 5FP4A 1KDMA 1JI6A 2VZ1A 2W91A 2JDZA 3RZMA 1NE4A 1PO11 1RMU3 3PURA 3VBFB 4DNYA 3LKJA 5A6ZA 1NXD1 3W20A 4DEQA 4NHKA 3W59A 1PIV3 5FY7A 3T2QA 1G7YA 1W6OA 1RVF3 2VU9A 4MYEA 1DZQA 4XIOA 5FMCA 5J09A 2HYKA 2MHFA 4AAXA 4ARXA 2OQ7A 2WO3A 2LS6A 1H1IA 4E4SA 5A33A 2QDRA 1ZA7A 4CP0A 3OYWB 1XQNA 1YWKA 2H0VA 5C71A 4XCBA 5EXOA 2JG9B 2VMEA 1WCUA 2XL7A 3EMRA 4G4FA 1WMFA 4Q1PA 5JXHA 1QOOA 3VZKA 4FQZA 3I2DA 1SBEA 3OBRA 1RUC3 4YVSA 1JYXA 2DVBA 3ZFEB 4AOCA 1ULFA 5FCCA 3M3EA 2WNEA 4BMBA 5IVFA 2PHTA 3MFAA 3GXUA 3RI9A 1RUD3 1ZRFA 2SBAA 5JXGA 3OEBA 2R042 4UW5A 4YVWB 1SLAA 2UY8A 3JXSA 4N7UA 4Q8LA 4XBNA 4YFZA 3KZ4C 1LHUA 2OKXA 2HWD2 1VJ2A 3AL6A 4BQ5A 3BI3A 1UY4A 4FO9A 1TQ5A 3K48A 3ZXJA 1VBC1 4MXVA 1QOSA 4NO4A 4D7TA 2AACA 1YUDA 1POQA 3WP4A 1JYTA 1DP0A 1T6BX 2ZMLA 2EIDA 2OXBA 5J3UA 1ND3C 1ULGA 4ATEA 4OZXA 2YG0A 4GQ7A 3AP9A 1OF4A 4XILA 4B4PA 1OVSA 1VB4A 3DL3A 2HEWF 3RI8A 1PNFA 4HSJA 2A7AA 2H6BA 3MIBA 1WW5A 3VDBA 1WW6A 3W9AA 2HBTA 1CJPA 5JXJA 2WO2A 4AE2A 2D6OX 5C3SA 4OULA 3FFQA 2R30A 4GJZA 5BNNB 4JHTA 3H0OA 1U5IA 4YVWC 1XXNA 1HXS3 5JMOA 3GBGA 2X5IB 3KCCA 1ZZ7A 4MUVA 3RZKA 1W6PA 2E31A 3D8CA 4TN7A 5KXBA 1NLQA 4LR4A 1HQNA 2OS2A 4XFGA 1RVF1 4UFIA 1VAKA 1N3QA 1OFSA 1MR5A 5LBCA 2HWF1 1MVQA 5ANNA 4QX2A 4NWVA 3THDA 4LHLA 5H9SA 3S6PA 4XABA 2XLGA 1C8NA 1O91A 1UX7A 2QNKA 4KBBA 4ONUA 5HCAA 2FBEA 3HT1A 4WZFA 1AXZA 1IG0A 4L2NA 1HJFA 5FXZA 1OHFA 2FZ2A 4RSUA 2ATFA 2HH9A 4IEXA 3JBG2 1MZEA 3UK9A 3PTYA 1VBB1 5K9YA 3PJQA 1RMU2 1XE8A 3H42B 1CVNA 3KVAA 3PMEA 3RZLA 1KS5A 3WG1A 5IAVA 4HT1T 2JDKA 3K51A 4QQLA 3KV6A 4BJ0A 5L9BA 3LB9A 2EXIA 2ZHMA 4P9JA 4GWNA 4K1ZA 4HETA 1GP6A 1N1TA 3DV8A 4FPFA 2VQ0A 2Y34A 3UGHA 4KG0A 4CP9B 4A45A 4XUOA 4CUBA 1BBT1 3WF3A 1EY2A 5C3RA 3R6SA 3TN92 2VZOA 3LIHA 4X8NA 4XXAA 4YG0A 3BPSA 3KVBA 3VV1A 4MO3M 2NN8A 4EWEA 4CU8A 1A78A 5C5TA 5T5LA 1R083 5KHGA 1BHGA 1QNWA 5F2SA 1UN1A 4CVUA 3B01A 3N9PA 4OI1A 2XJVA 2Q4SA 3WNNA 5EHDA 3ZIXA 1JBCA 4JGZC 3LE0A 3FJSA 5DUUA 3WP6A 4AYUA 3IDEA 5FMOL 2VECA 1ZBA2 3OB8A 3BTXA 1DBNA 1RUH2 1JS9A 2YY1A 2JE9A 3LA3A 5IVCA 2VW0A 1JYVA 2Z42A 3M3QA 5FRAA 5BNNA 1R091 1OBNA 4LKEA 4LBOA 1WW4A 3KMHA 4M3CF 2JX9A 1UIJA 3QOPA 4ATFA 3RZZA 1Q8OA 1ZZ9A 3TNPB 1DLCA 2QJVA
chains in the Genus database with same CATH topology
2VVDA 1E57A 4OLLA 3QH6A 2QDNA 1DLLA 4LEJA 2EF6A 3IWZA 5TSWA 5JR7B 2Y38A 5LRSA 3RMYA 5AC93 4AXOA 1KJLA 4JGZB 4F3JA 1TMF1 1BMV1 4YZ1A 1MACA 1PVC1 3WDXA 4NVPA 4A7ZA 2JXAA 4YM2A 3ALQA 1IPJA 1QH7A 4FBFA 1WUVA 4E2SA 4COZA 1CPNA 4R9AA 1H9PA 5J96B 1AF9A 1QH6A 5DXDA 3KS7A 5DUWA 4K6BA 3AMQA 4RS5C 4HANA 4W6WA 4JGYB 1LB2A 2R061 2E63A 1JYIA 1LESA 1RGSA 5H9QA 1QQP3 3MPPG 4J1WA 1JYCA 2ZX4A 3NV4A 4CDXC 3RQ0A 3IPVA 2YHJA 3LOIA 2B7YA 4L8QA 2MNGA 2ZZQA 2ETEA 3RG0A 2JECA 1PO23 1B35B 4B4RA 5KHKA 4RHV1 5CAZA 1YIFA 1RHI3 2CGPA 1R092 2BYVE 4Q4X1 1MZFA 4XETA 1W6QA 2NZ9A 4RS5B 2R1DA 4Z1VA 3FC0A 3TNQA 3E5XA 2CTVA 2Z69A 2HWE1 1NCQB 1LHVA 2A6ZA 3FWEA 4JDOA 1RUE1 4YVWA 4F83A 1J1LA 2A3WA 4COVA 1QJX2 4FP3A 4IV1A 2OYZA 2YC0A 2Q30A 4Y1ZA 2HWD1 1QKQA 2AUYA 1RL3A 3ENRA 3VBSC 5CBLA 1HV0A 3EO6A 4XF9A 3VBRA 2PTMA 1J1TA 3UJQA 1UW8A 4PIXA 4IV1C 5L7OB 1QNYA 1CAXB 3ES4A 2N7GA 3DKWA 1BKZA 2WIIB 4C1WA 2WJSA 1VB2A 3DPRA 4PIZA 4U2AA 3G7DA 4LNVA 1TNFA 1K5MB 3H3ZA 1BBT3 3O12A 4MXWA 3ZVXA 4HKOA 1TMF3 1GFF2 4XW3A 3ILRA 3E6CC 1R082 2WNUA 3JB8A 1VBE1 2A71A 4I2OA 1I9RA 4S2HA 1ZBE1 2ES3A 5CA6A 3VBSB 4CDUB 3AKSA 3VZOA 5JSRA 5KXEA 2DYCA 4TWTA 1VBD2 3ZFGA 3GALA 5BUVA 3GBFA 5IT6A 2VUAA 4XTPA 4IV1B 5L7OC 2ZAHA 2HJIA 3JBG3 2ZX0A 5EWSA 1B35A 2OUJA 5HCBA 1POV3 2ZGLA 4E4DX 1V6IA 1VBA2 2MEV1 3KCYA 4XZPA 4DPNA 3GNEA 2P3IA 3LOBA 1CESA 2BFUL 3FUOA 2FQPA 2BVBA 4I3PA 1HRI3 3NSTA 2IFRA 2XGXA 1RUNA 1VBE3 4XFBA 2Q1MA 2Q0AA 3WG2A 4E9KA 3SXWA 5CNAA 3J8F3 1O4ZA 1OLRA 2D6NA 4K21A 5JSPA 4DQAA 3THPA 1ZBA1 2PQQA 1U5YA 4N43A 2EIGA 3IKWA 4MX3A 3AMPA 4Y22B 3N7JA 3URFA 4GB32 2JG8C 4RR3A 2IWGB 4P9IA 1DFQA 2VOVA 3AZWA 4Q0VA 1PK6C 4YZ5A 1VIWB 2R1BA 3KM5A 4CEYC 3RDIA 1LOFA 3TN91 1ZZCA 2FZ1A 2PHUA 3D0JA 4KWJA 3WG3A 4RFT0 3VZMA 4EN7B 1RUE2 3FE5A 1W6OB 4LBQA 4LUKA 2CWMA 4RR3C 1PO22 1LOEA 3SMHA 1UAIA 1NCRB 4HLTA 2XVGA 3AMHA 2ILMA 2R043 4FCAA 3H1YA 4FAHA 1NOVA 4WM7B 3R4SA 1DZRA 4BM8A 4AEDA 1WCKA 3HR9A 1SLTA 3WNXA 2NM1A 3O0XA 4HVQA 1S55A 4DRRA 2HWF3 3IDBB 1R1A1 3QLQA 3O7OA 4ISRA 4XTMA 4DZGA 1SFYA 4I0BA 1NY71 4N53A 1WA4A 1PO21 4WVZA 3AP4A 3BODA 4RR3B 4R52A 1ULEA 2D97A 4Y1XA 1QDOA 3MICA 5I0TA 2RJLA 1YRZA 4QGMA 4AF9A 5GZEA 2RMU2 3RYKA 4ZU5A 4N53C 2NP0A 4FTSA 1SCSA 4QGLA 4YGDA 4YVSB 2AREA 4AVCA 1G86A 2EALA 2KXLA 4SLIA 4Y5Z0 4YM3A 4ES9A 4Q27A 1SLIA 4LBJA 4COUA 4A3XA 3OF1A 3ZXKA 4FPYA 3WQ7A 3ZDSA 4M00A 4XOGA 1U5XA 1SLCA 1LTEA 3KT7A 2D6PA 5T5OA 4AFMA 2LTNA 3VBRC 1DQ2A 2C9AA 1PVXA 4X8PA 4DOUA 5H9PA 4KGGA 4AQ2A 1AJOA 1WLWA 3B93A 2B9UA 2OVUA 1W0PA 1S0EA 2XBO3 4FOWA 1XNBA 4MGKE 1C3HA 1NCRA 5GJ6A 3G6JB 2ZGPA 1AYN1 3FMGA 1HV1A 3ZXLA 4ORFA 4QQHA 3D0SA 3BIWE 4LLOA 1G6NA 1V9U1 1GQGA 2RS52 3B9CA 3S0MA 4P9YA 1RUG3 2RR12 4XF0A 1AR63 3VBRB 4R9CA 3AKRA 1QHDA 2W0XA 3VHRA 5K8SA 3ZXDA 3VL9A 3PVBB 1F5FA 3MW3A 4FTEA 1PK6A 2Z79A 3DPRB 5DZGA 3POSA 3MYXA 1LENA 2BNMA 3UV9A 4RD7A 3VDDA 4QPIC 1VR3A 1MEC2 1NQDA 4LHKA 4KU7A 4L97A 1N3PA 3AYCA 3WDTA 2X8KA 2WNUB 1O7FA 5JDBA 2YUEA 3C3VA 3WOGA 5GKAC 1LRHA 1V6NA 2OZJA 4Q4W1 4Q4Y1 4Q8KA 2TNFA 4LO5B 4UW3A 2HKXA 1AR71 2B5HA 4GMP1 5FQ0B 4B4QA 1KS4A 4GKXA 3SHRA 1XNDA 1UKGA 2ZX3A 5T50A 2ZGQA 4AI1A 2HWB1 4AI8A 2DU0A 3WUDA 3PLQA 3ZN5A 1YFUA 4MV2A 1YJLA 4QXKA 3JU9A 1VBA1 4JGZA 3WY6A 1NLSA 5BV6A 4ZU7A 3B9IA 1S0BA 1OOPB 3CNAA 4J6GA 1GKBA 2UYBA 4QPGB 4BCUA 1SLBA 1QY4A 1Q8PA 4FT8A 2D3SA 3B7MA 3S7EA 3WHTA 4I0WB 3KLSA 5EYXA 4Y22A 4HKWA 4XJZA 3CJIA 2ZHNA 2FHRA 3CEWA 2RR11 2Y0IA 1CN1A 4PJYA 4XEZA 3VL8A 5CADA 3ETQA 1IQAA 2K9ZA 4CYDA 4LLFA 2XVKA 1AR93 1H1MA 1YHFA 5JOWA 1PMIA 1D4VB 4YYOA 1QXPA 2A70A 2ZA9A 2XVLA 2ZKNA 4LBLA 4CTEA 1FMD1 4H55A 1OOPC 2JICA 3QD6A 2GZWA 4GXLA 3IM0A 2DCZA 2V73A 2D6KA 4ISQA 3NAPC 1JTZX 3VUOA 2PA7A 1RITA 2ERFA 5EZWA 3SH3A 3AJYA 3ZN6A 4AI2A 2DVAA 2R49A 1UMZA 4FPHA 2DCJA 4RS5A 1OOPA 4RA0A 2NMOA 1UU5A 4YW3A 5GALA 3H7JA 1FT9A 1XYPA 4A7KA 4XBLA 3AYDA 1AJKA 2JKBA 1ZZ8A 1XNCA 2WKKA 4NR1A 1CR7A 2PHRA 1RTVA 2HWE3 3T1LA 4TLFA 1SACA 4CDWC 1REEA 3AYEA 3ZN4A 4M0NA 1OQDA 2CV6A 3AB0A 5E89A 2DVGA 1DGRA 2YDEA 2K2SA 3ASIA 4MGYE 2O0OA 1VP6A 1JH5A 4RHV3 4EWDA 1UPIA 1W2UA 5A32A 1RUI1 4MGZE 4CDUC 4AQSA 2CGNA 3VBOA 3WP3A 1FOD2 3EHKA 1IOAA 3CJIB 4K20A 3ZSLA 1Z0HA 2PFWA 1KRIA 3USUB 2DVDA 2BTVC 5F6KA 4K40A 2QQPA 3ZX7A 1V6KA 4CDUA 4WVVA 1ALYA 2WA4A 4FQ4A 2XUMA 2YXSA 1B09A 3ZFGB 4OHYA 1YI9A 2WZR1 2ZZJA 4YZ2A 4FAGA 3ILFA 3UKNA 2D6LX 5JZGA 5GLVA 3J8F2 4AI3A 2FMYA 2DFBA 5DG2A 2D40A 3OYWA 2R6QA 3WQ0A 4XJUA 2GNMA 1VALA 2ZJCA 3JUUA 1K5MA 2XJTA 1ZRCA 4HVRA 1LR5A 1AR91 5K0UB 2EAAA 1LHNA 1JOJA 4Q4X3 1GBGA 5CB7A 3ZN6B 4RGAA 1AL21 4HVOA 4Q4V3 1RUF3 1BQPA 2GDFA 5FO9B 3CO2A 4A2UA 4CEYB 3GBWA 1H2KA 1RINA 3VBSA 4GULA 2ZPXA 1HRV3 5D1IA 2E51A 2EXHA 1C1FA 4XQWA 1YXWA 4Q0QA 1X8MA 2PHDA 3SISA 4BPZA 3KGLA 4YNIA 5FLHA 1KFUL 2HEYF 4XHXA 3VZNA 2ZGSA 5BNQA 3D5OA 4LO7A 1DG6A 4HK8A 4LBNA 2E7QA 3KT4A 2R16A 2CAVA 3KT1A 3WUCA 4BLIA 2ZMKA 1A8MA 4PLNA 3KQRA 4BYYA 4RQPB 4B8EA 2WINB 4LO6B 1D0GA 4X6QB 3VZLA 4WM8A 5JMCA 3HIFA 2ZGRA 1W6PB 2GH2A 4G3YC 4EN6B 1PGSA 2W08A 3M70A 1ULDA 2PYTA 4L11A 1L3JA 2D43A 2UWBA 2WZR2 2R0HA 1V9U2 4WBBA 2P17A 3I7DA 3HD8B 4YGCA 4N53B 3W58A 3NV3A 1I3HA 1ND3A 2D93A 1OSGA 4AG4A 3EQEA 5F5QA 5GZFA 1LECA 5FDBA 1F5JA 1QDCA 1R093 4RQPC 5BXXA 2TBVA 5J7MA 3D4KA 4YARA 3CLPA 3SCFA 5LK7B 3ELNA 2BEOA 4YM1A 5DG1A 4K7JA 1R1A3 3MLKA 1C4RA 1XYOA 4ASMB 5AFEA 5F9TA 3PNAA 1QOTA 4Q0UA 3AJZA 1AX2A 1V70A 1EPWA 2F4PA 2PHFA 4JV4A 2VVEA 3MIFA 3VBOC 2CWSA 2NYYA 1LEDA 1CONA 2NMNA 4R4XA 1I6XA 3VKOA 5JWPA 4BOWA 3R0RA 1HQWA 3UL2A 3OPZA 4PBPA 2RS13 4MZUA 1DGWA 2Q1ZB 1OLQA 1FMD2 2ENRA 2GU9A 2K0GA 2ET7A 4Q1RA 1QQP2 3VKLA 4BA6A 5K7PA 3AZXA 4IEPA 5HCFA 2OUHA 1GZWA 3H50A 1EPZA 2XLFA 4XE9A 1UCXA 2YGLA 3OTFA 3WCSA 2R32A 3OGJA 1PM7A 3MIGA 3POWA 4GALA 1X82A 4WVMB 1CAUB 4YGEA 2YYOA 2CGOA 4NHLA 1AR62 3J26N 2QE3A 3DGTA 4XFCA 1IPKA 3NV1A 3DPRC 1RUD1 3D6EA 1LOBA 4BMEA 4OFGA 1VBE2 4XJ8A 5AVPA 1GICA 4C1XA 4QPIB 1EYBA 3ACLA 1MS9A 3E5UA 3IN9A 1KJRA 3MEPA 1BXHA 1ZM1A 5C9AC 5CG9A 2P34A 1CJDA 1HDKA 1ND3B 2WNUC 1RUH3 1ZRRA 3DN7A 5A32B 3T2TA 1IZ3A 1J58A 1PNGA 3AZZA 1WW7A 1BJQA 1LCLA 1S0GA 3WDWA 4Y1YA 3VBHA 4M01A 1COV3 1OQ1A 1RUI2 4QMAA 4TZDA 1EV11 3A0NA 1SEFA 1TME1 4EWAA 1Y9QA 1UKRA 1AX1A 5T54A 3NW4A 2Q5TA 1H8VA 2BW8A 2DV9A 4FTBA 5LRRA 3JB4C 1C1LA 4PDWB 1AYM1 4C0HA 3VBHC 3S7IA 1LHWA 3MLJA 4LBQB 5JSOA 1J59A 4F8AA 4QPGC 2DUPA 1NY72 4F7ZA 1G9BA 1G9FA 3WX5A 2UY9A 1FNZA 1N1YA 4FSJA 1QXRA 4A7YA 1TME3 2R062 3MIEA 3VDDB 3MF6A 5FO7B 2PHXA 2GMPA 3DUIA 4XMIA 4AGVA 1GZWB 3MFCA 5EJ3A 2IXHA 1W6MB 5F6LB 2WFF1 1KQRA 1D2QA 2AH2A 1NCQA 2DTWA 1Z7S2 1W6NB 4WM8C 4PDWC 4AVTA 4IV3A 4CDQA 1RUD2 2CYFA 1GQHA 1REDA 5FOBB 1FOD1 4IEWA 1PIV1 1IS5A 3UKVA 1M06G 1JUHA 4Y24A 5IK8A 1XE7A 5A3LA 1ZYBA 2GNBA 2YMZA 3JD72 3KCXA 3B5LB 4GB33 5FLJA 3RJ2X 3RSJA 1X36A 3VDDC 2DCYA 1X7NA 1BK1A 5T55A 2GC3A 3B94A 4I01A 2VG9A 3I59A 3WINE 2XJQA 2UWAA 3MDPA 1QJX1 2Q8OA 5I0SA 2XPJA 1XNKA 3JBG1 4RQPA 3VN4A 3ZYJB 1GYKA 2D98A 3INAA 3U07A 5GM0A 4FOQA 3M7AA 2X5IC 1F2NA 3VGIA 5C4WC 2LM3A 3V65A 4JAAA 1WGPA 3FLTA 4LE3A 1XYNA 4KWKA 2ZGKA 1DYKA 3SLIA 2E7AA 1XRUA 4CDXA 2IZWA 4B7KA 1FI2A 4W6YA 4K9SA 3VBFA 5KC5A 1BEV2 3LSEA 1H9WA 1R1ZA 5JVVA 1AZDA 2DFCA 3ECQA 2EA7A 3JQWA 4AHWA 4AEMA 1Q56A 4CEWB 3WDVA 3TAYA 4M3CA 1RUJ1 3ST7A 4UW6A 4LT5A 1LHOA 3PVEA 4KQ7A 3HT2A 2G9FA 4NHMA 4AFAA 1ZBE2 1NG0A 4N90A 1J3RA 3KB5A 3L9JT 2E7TA 3FBMA 4D94A 2OIIA 1C57A 3OY8A 4AHZA 2RR13 5T5PA 2HWC2 4IETA 4N9HA 2X29A 1OKQA 4IEZA 4EN8B 1WCDJ 1DGWX 4IEQA 5KHHA 1YO8A 4XF4A 1LU1A 1AYN2 5T5JA 2C1FA 2KM2A 4KU8A 4PF5A 3MZHA 4KL1A 5DUVA 4CEWC 2WNVC 2E6VA 4UXAA 3SCHA 5JOZA 3O14A 4CDXB 1GSLA 4E4ZA 3S30A 1EAH3 4OI4A 2GNTA 2D6MA 2WT0A 1LGNA 1B35C 1DGRN 3RNSA 5LEJA 3MGUA 3O5SA 1S0CA 5JZGB 1H8TB 1SCRA 4Y20A 1MEC1 1OPMA 1DQ4A 1MEC3 5LK5A 1Q43A 2IXKA 4M3CE