3ZSQA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsqA00
4ELUA 4H4MA 3NF6A 3NF9A 1RDDA 3SV3A 5J1EA 1YT3A 4EP4A 1WAJA 1ASUA 2G8FA 1JLBA 3PY8A 4KHUA 1KSPA 3KKRA 2O4IA 1K6YA 1TKXA 3WNEA 4CEFA 3OYMA 1U47A 2HMIA 2HHWA 4E19A 4OGEA 3SUNA 1L3TA 1VSHA 4CIEA 3OS0A 1KVCA 1X9MA 4Z4GA 2HVHA 4DLGA 1NKCA 4FK2A 1UA0A 1RBRA 1RBTA 2ETJA 4ELVA 5I42A 4BDYA 4E3SA 3L2RA 1WLJA 3LP3A 3VQPA 4CJ3A 1ZBFA 4CJVA 3TANA 3AVJA 1TGOA 4BACA 3SJJA 2D0BA 1HMVA 2GV9A 1G15A 1NJYA 2PZSA 3V9UA 1HYVA 4N76A 1ZBIA 2F8SA 5CY4A 2HNYA 3T1AA 2GUIA 3SI6A 3I0SA 1Q9XA 4M3YA 2G8KA 1RT4A 4CFAA 4CFCA 3V9WA 1JLAA 3TAFA 3AVFA 3UIQA 3HYFA 3TAMA 4Y1CA 4JRQA 3DOLA 3ZT4A 3PV8A 2XO7A 1S1WA 1TL1A 4FJNA 3WNHA 3K2PA 2G8IA 4CJ5A 4YFUA 2ITGA 4FM0A 3FFIA 3HSTB 2IGIA 1NOYA 3RR8A 1TVRA 1O1WA 1RNHA 4CJPA 4KV8A 5CYQA 1RDBA 3RRHA 3QESA 4E0DA 4CECA 1TL3A 2BANA 3BGRA 1W9HA 4CJSA 1S1VA 4YNQA 3MAQA 1TAUA 1S1XA 3OYNA 4E7LA 4CFBA 3T19A 5KGWA 3VQ8A 1NKBA 4CE9A 5HRPA 4ZTJA 2WONA 3NF8A 3ZSWA 1QQCA 4I9LA 3L2VA 3SQ0A 2YV0X 3IG1A 2QXFA 4FM1A 1SL0A 4KTQA 3H08A 1XWLA 4TSXA 4BDZA 1LWCA 1EX4A 3LANA 3VQ4A 4B9UA 4BE0A 2PYJA 2HHXA 2AJQA 4CF0A 4FZYA 4H4OA 4Z0UA 1BI4A 1A5XA 3RMCA 2KFZA 3KJVA 4F3TA 1J5OA 1ZBHA 3V6DA 2DFHA 1BHLA 4M3UA 2ATQA 3KKSA 3SUOA 3AO5A 4PUOA 5T7BA 4GW6A 4DSIA 4HUGA 3MXJA 2O4GA 1LW2A 4O44A 4BWMA 5HRNA 3ASMA 4OJRA 4HHTA 4MFBA 1L5UA 1JXBA 3OYIA 4RW8A 1RT5A 1W0HA 1I39A 2RF2A 3G10A 2G8UA 3QNNA 1S9EA 5HRSA 1RBVA 4CGJA 4AHSA 3NF7A 2XY5A 4CJTA 1XI1A 5FDLA 5SZTA 2FBYA 2NUBA 1TKTA 4FJGA 1DTTA 3K59A 1FXXA 1LAWA 3QINA 2KTQA 1RDCA 4N56A 1ZBLA 4FLTA 3AVHA 1NJZA 5J2QA 3WNFA 5JS1A 1WSGA 1NOZA 4CHPA 1B92A 4CJRA 3ALYA 3PX6A 2OZMA 4EZ6A 4DMNA 1SKRA 1EKEA 3HPGA 4NYNA 4EZ9A 4KB0A 4FJ8A 1Z26A 2JLEA 3IAYA 2HW3A 4ELTA 3DLKA 1HQEA 3K58A 2D0CA 1S5JA 2HB5A 2VG5A 1YTAA 4M3TA 1Y97A 1LAVA 3QEVA 1NK0A 4E7IA 2XY7A 2YNGA 2X78A 4PWDA 5SWMA 2YHAA 4KHNA 5E41A 1WN7A 3LZIA 4DFKA 1IKXA 1SKWA 1TK5A 4F4KA 1KVAA 2KZZA 3AVKA 5J2MA 3ZSXA 2ZE2A 4DTXA 3AA4A 3MEDA 5HRRA 1LV5A 1NK9A 1UOCA 4I2QA 1RTDA 2ZQBA 1SKSA 5CZ2A 4CF8A 1IO2A 3SYZA 3CQ8A 3HP9A 4NCBA 3KK2A 3L2UA 3NGIA 1QSLA 4DFPA 4DSLA 1CLQA 2XY8A 4CEOA 3KK3A 1UA1A 1X9SA 4CHNA 2B4JA 4W5NA 3AO4A 4FJ9A 2HHTA 2VWKA 3QERA 3ZSQA 4M3RA 4M3ZA 3PO5A 4M45A 1EETA 1I3AA 4FJXA 3NFAA 3IRXA 2LSNA 1HNIA 1DLOA 3EY1A 3ZSVA 1JL2A 1N6QA 1VRUA 3SUPA 3RMDA 2P1JA 3OYHA 5HROA 1A5VA 2VWJA 3NBPA 3M8QA 4DTOA 2W42A 1X1PA 5KRTA 3SPZA 3QLHA 3VN5A 4FLWA 3A2FA 1DTQA 2KQ2A 3I8DA 1QHTA 4DG1A 3V1QA 4CJEA 3U3GA 1U04A 3K5MA 5EU7A 1C1AA 2E4LA 4AHTA 4FYDA 1N5YA 4RW6A 4CGGA 5KI6A 4KHWA 3ISNC 2IDOA 4RW7A 4B9NA 3B6PA 3LZJA 3CFPA 3SUQA 4CF1A 1NK6A 5KTQA 2E6MA 1NJXA 4NCAA 1WAFA 1L3VA 3EYZA 4UQGA 3KD5E 3S9HA 4PQUA 2OPRA 3AVBA 3V1RA 4CEBA 3KTQA 3AA5X 2OYQA 1RT3A 1KVBA 2F96A 3DRSA 3VQDA 3ZT2A 1NK4A 1ASWA 4QAGA 3AVMA 3KLHA 3V81A 2IAJA 1BCOA 1SL2A 1B9DA 4RG8A 3U6FA 3VQAA 3NCIA 1XHXA 1MU2A 4B8CA 4DTPA 3DI6A 4C8LA 4LH4A 5K14A 3K5NA 4B9TA 1HYSA 4C8KA 3OYFA 1VSEA 3RMAA 4LD0A 3JSMA 4BE1A 4R5PA 3TABA 1XHZA 1T05A 1WSIA 1LW0A 1GOCA 3HT3A 2YNFA 1KTQA 1JLFA 1VSJA 3D0PA 3DOKA 2HHUA 3K57A 1VSKA 4C8MA 4AILC 3RMBA 1IH7A 1JKHA 3P83D 4AHCA 4DTRA 4CGDA 1A5WA 4FJHA 3K5OA 3MECA 4CJQA 5HLFA 2GBZA 1TK8A 3AO1A 4NCGA 4O0IA 4K8XA 4DTMA 1ZBUA 2RN2A 3WNGA 3HVRA 3AVIA 3L3VA 3ZT0A 3VA3A 4DU3A 4I2PA 3TWHA 1XC9A 1KLNA 3NGYA 3HL8A 2X6NA 3MEEA 3L3UA 3VQ9A 4CCHA 4DQSA 3PX0A 4CESA 2JGUA 2X74A 1S6QA 2VG6A 1WSFA 4CJFA 1D5AA 4EP5A 3QNOA 4DQIA 3NE6A 1WSEA 1GOAA 4FLZA 4CHOA 2P51A 3K5LA 4E89A 1C0UA 4BE2A 2VG7A 4CEQA 4CJ4A 1RT2A 4CK1A 3O3GA 2Y1IA 2KZMA 1S1UA 3D45A 4OPJA 3SQ1A 3QEIA 3SNNA 2QK9A 4B9LA 2YNHA 3LPUA 3IS9A 4B8AB 4I7FA 4OKKA 4Y1DA 3DM2A 4LH5A 3ZCMA 3OYJA 2Z1GA 4GMJB 5JS2A 1LWFA 2B6AA 3CM5A 4FM2A 2A1SA 5J2PA 2A1RA 1YTUA 3OY9A 3NH1A 4ZTFA 3NHGA 4PY5A 2HVIA 4CGHA 4DLEA 2DTUA 2FBXA 1VSLA 4PA1A 3P5JA 5HBMA 4CF9A 1NK8A 4M42A 1HPZA 4KB1A 4C8OA 1B9FA 3AO3A 2X6SA 2FBTA 3NGZA 3SQ2A 3PO4A 4WE1A 4Z4EA 3DYAA 3HPHA 1QTMA 5CZ1A 4FJLA 3NH0A 1HJRA 4CK3A 3CFOA 1ZYQA 4OGCA 1EXQA 3MEGA 3QEPA 1RBUA 3LDSA 2G8HA 4OKJA 4M3WA 1TAQA 3L2WA 1RILA 3LP1A 4CJWA 4CF2A 1T03A 4HCCA 4IG3A 3V9SA 3AVLA 4JLHA 3OYLA 4JRPA 4OLBA 4B08A 4L8RB 3DLGA 4W5QA 3ZSYA 1IKWA 4CEZA 1L3UA 1SL1A 4DS4A 3ZT3A 1HRHA 4B9MA 4CHQA 3LWMA 1S9GA 1D8YA 3F9KA 3U3YA 2XY6A 3THVA 4IFYA 4FW2A 4Q0BA 4Q5VA 3LP2A 3O4QA 1X9WA 3KIOA 1IG9A 1VSMA 3QO9A 4CJKA 3NDKA 2D0AA 1UAXA 1GOBA 4GVMA 4H8KA 4E1MA 1WNSA 2FC0A 4O4GA 4HUEA 3TAEA 5I3UA 4DQQA 2DY4A 5C25A 2RKIA 3OYAA 4KI4A 3B6OA 1JLQA 2RPIA 3O3FA 3LWLA 2D5RA 4AH9A 1CXUA 3QIPA 1BGXT 2OPSA 3V1OA 2HHVA 4KKOA 5C42A 3QEXA 1FKOA 3OYKA 4DFMA 3SQ4A 2R7YA 3OVNA 3V9XA 3TR8A 1C0MA 4DSEA 3TAQA 4CGFA 3JYTA 3RR7A 4FXDA 4CJLA 4DSKA 4ZHRA 1RTHA 4E7KA 4G1QA 3CYMA 1Z25A 4Z4FA 3OYCA 4FJIA 2IS3A 3P1GA 2YKMA 3C6TA 4DQRA 4KHYA 4J2AA 1RBSA 3E01A 3DLHA 2YHBA 1J9AA 3O4NA 2OPQA 1J53A 2DFEA 4FJ5A 4FZXC 1KFSA 3OYDA 3BDPA 4KRFA 2Z1JA 2P5GA 4M3XA 2P5OA 4J2DA 3CM6A 4Z4CA 4HCBA 3AA3A 4W5TA 4DTJA 4LSLA 2OA8A 3KK1A 4E1NA 4CEEA 4F2RA 4OVLA 1WSHA 4DU1A 4MQ3A 1HYZA 2QKKA 1SV5A 1BL3A 4Z4IA 4JS4A 3MXIA 1IKVA 4OPKA 1UWBA 4FJJA 5KRSA 3PX4A 1T8EA 4DTUA 3HP6A 1TKZA 4DSJA 4N47A 3QEWA 4CHZA 1KFDA 4DSFA 2OZSA 3I0RA 3KLGA 4FZZA 1C1CA 3C6UA 1BISA 4FLXA 4FLVA 3L8BA 2YNIA 1YVUA 1REVA 3S3NA 2G8VA 4QOZB 2XHBA 3AVCA 3S3MA 1JLGA 3HO1A 4CIGA 5HP1A 1U49A 3OJSA 3RWUA 4DFJA 1RTIA 4ID5A 2OPPA 3KLFA 3LAKA 1S1TA 3ZT1A 3MXMA 1Q9YA 1EP4A 4AHRA 4F8RA 3HM9A 4LSNA 3V4IA 1QS4A 3CG7A 3DLRA 3DMJA 4RW9A 3OJUA 1QE1A 4DS5A 3RRGA 2HHSA 3VQQA 3VQEA 3M8SA 4FK0A 4CK2A 3TAPA 4ID1A 4DTSA 2ZD1A 4IG0A 3VA0A 4E7JA 4FCYA 3AVNA 1Q8IA 1CZBA 3VQBA 4KO0A 1TKDA 3V9ZA 1IKYA 2EX3A 1C0TA 1JL1A 1HQUA 1TV6A 1ITGA 2IOCA 4OKEA 1NJWA 1BQNA 1C1BA 2WOMA 3VQCA 3TI0A 3HVTA 3EZ5A 1RT6A 1J54A 3QETA 5FRNA 4FJ7A 3LALA 3ZSZA 4KAZA 4KREA 3AA2A 4DF8A 4AHUA 2FBVA 3HK2A 5CYMA 3SZ2A 1VSDA 4IBNA 4FVMA 2PY5A 3S3OA 1KCFA 2E6LA 3SCXA 4CFDA 4B9SA 4XIUA 4AHVA 3G0ZA 4KFBA 3KLEA 1RT1A 4BWJA 1CXQA 4F3OA 3NH2A 4HVJA 1NK5A 4J2EA 1FK9A 1RDAA 3PUFA 3DRRA 3ZSRA 4O0JA 4FLYA 1U45A 2EHGA 2XRIA 3SPYA 1F21A 1FKPA 4KTZA 3TARA 3L2QA 1JLCA 1S6PA 2Q3SA 4B9VA 5KGXA 4FLUA 3RTVA 4KPYA 5DMRA 4FJKA 3O3HA 3M8PA 4K8ZA 4KI6A 4E7HA 4JS5A 2BDPA 1VSIA 4NYFA 4CEDA 3LPTA 1L3SA 1RTJA 1R0AA 2PYLA 4RW4A 4CHYA 4FJMA 1BI4B 4BDPA 2KFNA 2DFFA 2I5JA 4HUFA 3CFRA 4DQPA 1BCMA 4KHSA 4FW1A 3C94A 4FK4A 2B5JA 1WSJA 2QKBA 1CZ9A 1ASVA 3C95A 3T3FA 3KLIA 2Y1JA 1D9FA 2IC3A 1LWEA 4O5BA 2BGGA 1VK0A 4F2SA 1SUQA 4I9QA 4N5SA 2BE2A 4N41A 1NK7A 5FRMA 4DF4A 1T7PA 4KHQA 2HHQA 3VQ7A 4M41A 3HPOA 5J2NA 4LY7A 3LP0A 4HTUA 1KRPA 3DLBA 4ICLA 3ULDA 4W5RA 2G8WA 5C24A 1TK0A 3DRPA 2HNZA 4CGIA 4CEAA 3TAGA 3KD1E 4QCLA 3F73A 3OS2A 3OYBA 4IKFA 1U4BA 3DLEA 2HNDA 4CIFA 1QSYA 1BIUA 3QIOA 1VRTA 3AVGA 4O55A 4W5OA 1NKEA 3VQ5A 4IDKA 3OS1A 1BQMA 4KTWA 1D9DA 1JLEA 4DU4A 2Z1HA 1JXEA 3AO2A 4OLAA 5DK5A 3LAMA 4C8NA 3VQ6A 3OYEA 3HJFA 5D3GA 2Z1IA 4J2BA 1QSSA 4DWIA 2F8TA 3HXMA 3ZSOA 3OYGA 5FROA 1U48A 3ITHA 4IFVA 4CJUA 1VSFA 1RT7A 2KW4A 1C6VA 1KLMA 3NAEA 3M8RA 4DTNA 1RCHA 4Z4HA 1BIZA 4CERA 4B3OA 3SV4A 3AVAA 3AV9A 2YKNA 1HNVA
chains in the Genus database with same CATH superfamily
4ELUA 1Y64A 5GIPA 4XH4A 3EEQA 4BY9C 2NRWA 1TKXA 3WNEA 1U47A 3B8AX 1T44A 3PSFA 3SUNA 4CIEA 3VMFB 1E4GT 3OS0A 4Z4GA 1VQPN 1UA0A 3PLAA 1RBRA 3VGLA 3LP3A 4CJ3A 1TGOA 3NVKA 3HM8A 1HMVA 1DEJA 1G15A 3GOIA 5AZJA 3V9UA 2PZSA 1NGGA 4N76A 4CBXA 4M3YA 1FJGK 2G8KA 4CFCA 3VERA 3TAMA 3DOLA 3ZT4A 3PV8A 1S1WA 1TL1A 4PKHA 3WNHA 2KLAA 4CJ5A 4YFUA 3DAWA 4I6MA 4CD3A 3J8AA 2IGIA 4O8UA 1NOYA 1O1WA 1RNHA 5B8HA 4YNQA 1TAUA 3MAQA 2HBJA 3T19A 4CFBA 5KGWA 1NGFA 2WONA 3TSPA 1P8ZA 1QQCA 4I9LA 2F7TA 3IUCA 4TSXA 3SAHA 2ASOA 1LWCA 3VQ4A 4BE0A 1K9MO 2PYJA 2HHXA 4CF0A 2YJEA 2NNWA 4Z0UA 3F2KA 2KFZA 2HF3A 3UKRA 4GV3A 4JD2B 3V6DA 2DFHA 3AO5A 4CZMA 4DQ8A 4HUGA 2BH1A 2E8AA 3MXJA 2O4GA 4OJRA 3FZHA 3OYIA 2RHKA 5AFUH 3G10A 1R59O 1OH8A 3QNNA 5HRSA 1RBVA 4CGJA 2XY5A 3U9DA 4B1YB 1TKTA 1GLFO 3MMVA 3K59A 4DUYK 4N56A 1NJZA 1XC3A 3WNFA 4DV7K 2QWQA 4YDUA 4CHPA 1B92A 3SK3A 4U7BA 2ZJQL 4DMNA 1SKRA 1EKEA 1KXPA 4NYNA 3CXCM 2ZJRL 1VQNN 4ELTA 4JI0K 1S5JA 4M3TA 5M1KA 1NK0A 5E41A 4LF5K 1WN7A 4IO8A 1XMOK 3OBWA 3FFKB 3AA4A 4O8KA 1WBBA 2W6LA 4BRNA 3CQ8A 3NGIA 1QSLA 3RSEA 4DSLA 1X9SA 3E66A 4CHNA 3AO4A 1HPMA 4BRMA 3H1QA 2VWKA 3HRGA 4CBUA 3PO5A 1EETA 4FJXA 4JI7K 1HNIA 3PIPL 1VRUA 1QVFM 4JHDA 5EY4A 1X1PA 5KRTA 3SPZA 3QLHA 2WUSA 3I8DA 4DG1A 3V1QA 2GELA 3ZYYX 3CCLN 4RW6A 4CGGA 4KHWA 3ISNC 2O8BB 3LZJA 3SUQA 1Q82O 3WXMB 1TYQB 3O1WA 3UE5A 4H0TB 3EKUA 5M1FA 4UQGA 3S9HA 3V1RA 3T7ZA 3EE9A 1RT3A 1N32K 5BRFA 3AVMA 4JKGA 3U6FA 3NCIA 2HF4A 2NZTA 3DI6A 4C8LA 4LH4A 4B9TA 3RVCA 2BTFA 2AA4A 4A62A 3PIOL 4C8KA 4BE1A 4R5PA 1KTQA 1Q18A 4DKWA 4DV3K 3DOKA 1IH7A 4DTRA 1NGBA 4JI5K 1A5WA 3K5OA 4U67L 3AO1A 4NCGA 4PL8A 2RE2A 3WNGA 3HVRA 3R8EA 4H5TA 1YITN 3QNOA 3WQUA 2P51A 2FSNA 4E89A 1GLDG 2GWJA 1ILYA 2VG7A 4WYBA 1S1UA 1K8AO 3E9OA 3QEIA 4KHPK 3SNNA 2ZWHA 2QK9A 3CQYA 3DM2A 4GMJB 5J2PA 4B1ZA 1U6ZA 2Q0UA 3VOVA 4ZTFA 2HVIA 4DLEA 1VQ8N 1VSLA 5JMVA 1HPZA 4KB1A 5LL6Z 4C8OA 3AO3A 3U4LA 2X6SA 2FBTA 3J81O 4WE1A 1YVNA 3HPHA 1QTMA 4FPAA 4FJLA 2Q0RA 2O8CA 2A40A 1HJRA 1BO5O 1XNQK 1EXQA 3QICA 1BA1A 4M3WA 4CJ7A 1T03A 1RILA 3MX2A 4CF2A 4YHHK 4OLBA 3OYLA 4AF1A 3DLGA 2J4RA 5AQVA 4CEZA 4QS8A 5AQTA 4B3MK 1S9GA 4PKGA 1YJ9N 2IIRA 3O9UA 4IFYA 3LP2A 1IG9A 3G71N 4CJKA 4CZIA 4CI6A 4GVMA 1WNSA 2FC0A 3MWTA 5I3UA 4DQQA 4KI4A 3B6OA 3VF4A 4WCEL 2D5RA 1CXUA 5FPMA 3OHRA 3OYKA 4X65K 3SQ4A 3V9XA 1C0MA 5AR0A 3M1FA 2QM1A 4CJLA 4AQYK 1Q81O 4E7KA 3CYMA 1Z25A 2V7YA 3C7NB 4FJIA 3MCPA 3TPQA 2YKMA 4DQRA 1IBLK 1J9AA 3CCSN 3BDPA 4KRFA 2Z1JA 4BC4A 5AQPA 3VEYA 4HCBA 3L0QA 4W5TA 3HBTA 2OA8A 3KK1A 4EHUA 2QI2A 3KWIA 1WSHA 3J7AP 2QKKA 4BRFA 2QA4N 4JS4A 4BQLA 4MDAA 3HP6A 4DSJA 4FZZA 5CE3A 5BPLA 5BREA 4FLVA 4QOZB 3AVCA 3HO1A 3L6QA 4CIGA 1U49A 5GAGP 1QVGM 5AQKA 4ID5A 3KLFA 3LAKA 3ZEUB 2OCEA 1EP4A 3V4IA 1QS4A 3DMJA 4CZJA 3JAMO 3OJUA 1EQYA 3RRGA 3G4SN 2W6KA 3VQQA 4FK0A 4ID1A 1NGEA 4FCYA 3AVNA 1Q8IA 1CZBA 1IKYA 1HQUA 1ZXOA 4H5RA 1C1BA 5AZJB 4PL7A 4FO0A 5FRNA 4DV2K 4KAZA 5E26A 4AHUA 3ZX3A 3SZ2A 4IBNA 1X9JA 4FVMA 2PY5A 3S3OA 3SCXA 4XIUA 4AHVA 3G0ZA 4KFBA 3WXIA 1RT1A 4F3OA 1IBKK 3D2EB 2A42A 1HJOA 3AAPA 1RDAA 4FWOA 4O0JA 2EHGA 5KGXA 5EX5A 3CCEN 5DMRA 4FJKA 1MA9B 3CMAN 4JNEA 4JN4A 2FXUA 4NYFA 3LPTA 4EHTA 4CHYA 3QBWA 4YOTA 2I5JA 4M7XA 1WOQA 3WT0A 3C94A 2PBDA 2HBMA 1CZ9A 2IC3A 4ILHA 3GDQA 4O5BA 4OPHA 2P9NB 1VK0A 5AQOA 4JAXA 3AGRA 4N5SA 5FRMA 3C65A 2O8DA 4LY7A 3FZKA 3L4IA 3LP0A 2IVPA 4WFNL 4HTUA 4LFBK 4ICLA 2JWKA 5C24A 3C0BA 1S22A 4CZLA 1HKBA 4IWVA 3DLLL 4R79A 5EVZA 4E1JA 1U4BA 3DLEA 2HNDA 3QIOA 4O55A 1BQMA 4KTWA 1JLEA 1JXEA 3AO2A 4OLAA 4C8NA 3VQ6A 3HJFA 4WQ5A 4DV0K 4F9OA 3SAGA 2ZJPL 5FPEA 5BRDA 2WFBA 3ZSOA 5CR4A 1U48A 4LF6K 4DTNA 1RCHA 3BZKA 1BIZA 3K9KA 4JK9A 3AVAA 3BP8A 3P5JA 4FW1A 5A2QO 3CHWA 1KAZA 4H4MA 3NF6A 5J1EA 1FW6A 1WAJA 4KHUA 1JLBA 1V4SA 3A5MC 1KSPA 3RSEB 3SMPA 2HMIA 4CEFA 3AARA 4E19A 4OGEA 1L3TA 1X9MA 2UUBK 2HVHA 4FK2A 1RBTA 2ETJA 4ELVA 4E3SA 3WEEA 3L2RA 1ZBFA 4FSVA 1VQ9N 3AVJA 2D0BA 4JHDB 2P9UA 3EL2A 4J8FA 2F8SA 1ZBIA 5CY4A 5AQSA 2GUIA 3I0SA 4HWIA 4BRQA 1KD1O 4JI1K 3V9WA 1JLAA 3UIQA 2XO7A 4FJNA 4CZKA 2G8IA 5BR8K 2CGLA 4FM0A 3HSTB 3NVMA 3RR8A 1TVRA 4KV8A 5CYQA 4A2BA 3QESA 3CD6N 5HOOA 4B3TK 1TL3A 1W9HA 4E7LA 3VQ8A 2W41A 4O5FA 3SQ0A 4FM1A 2QXFA 1SL0A 2KKZA 1XWLA 4X64K 1EX4A 4IO9L 4B9UA 2AJQA 4H4OA 1BI4A 1NG9A 1RGIA 3F9MA 1J5OA 3SUOA 5T7BA 3SMSA 5GADP 4DSIA 3CCJN 1YUWA 1LW2A 4BWMA 1JXBA 2E1YA 4RW8A 1RT5A 2RF2A 5M1OA 5BPNA 2FBYA 2NUBA 5C0YA 1FXXA 1RDCA 4CW7B 2PFUA 5AZIA 3THXA 1NOZA 3ALYA 2OZMA 4XH1A 4WF9L 2WC9A 2VYPA 4FJ8A 4EZ9A 4BRAA 4KB0A 3SBTA 2VCPA 2JLEA 3IAYA 3TTCA 3K58A 2D0CA 5JVGL 2ZM6K 1NWKA 3QEVA 4UY8O 5SWMA 4KHNA 4DFKA 1IKXA 3H6EA 3TSUA 1SKWA 2KZZA 5J2MA 4DTXA 3D6RA 5HRRA 1NK9A 1NMDA 1ZBSA 5CZ2A 3JS6A 2O8FA 3SYZA 2O8CB 3HP9A 4DFPA 5LJWA 4CEOA 3O9TA 3KK3A 4DR5K 3CMEN 3J7ZO 4M3ZA 4JI6K 1I3AA 3NFAA 2LSNA 1DLOA 1XNRK 3ZSVA 4CZFA 1N6QA 4DR7K 2P1JA 3OYHA 5JLFA 5HROA 3EN9A 3M8QA 4DTOA 1NMNA 3VN5A 2P9KA 4FLWA 3G25A 1DTQA 2KQ2A 4CJEA 1U04A 5LJVA 5EU7A 3VEOA 4AHTA 4WQ4A 1N5YA 5KI6A 3HOSA 1MWMA 1T6DA 2CGJA 4RW7A 3B6PA 5BR9A 3CFPA 4NCAA 1L3VA 3R9PA 3H46O 1WB9A 4NLBA 4IOXA 2OPRA 4CEBA 2OYQA 2F96A 1NK4A 4QAGA 5AQNA 1SL2A 1B9DA 4RG8A 4BG8A 1MU2A 4BQZA 3R3LA 1HYSA 3OYFA 3JSMA 1YIJN 1T05A 1VQKN 3D7EO 5AQRA 3HT3A 5LMNK 2YNFA 3TTFA 2UXCK 3D0PA 2HHUA 1J5EK 4A57A 3K57A 2YHYA 4C8MA 3P83D 4CGDA 2GBZA 3LM9A 3ENBA 1ATNA 3DXKA 4ILGB 4DU3A 1HKGA 4I2PA 1XC9A 5F2RA 2X6NA 2QWMA 4CCHA 3VETA 4CESA 3IMXA 2VG6A 4EP5A 2CH5A 1D5AA 4DQIA 1OH5A 4CHOA 4BE2A 4H0VB 1QQNA 4CK1A 3O3GA 3WXJA 1BU6O 2Y1IA 3WXLA 2KZMA 3J7YP 4FPBA 4OPJA 1HX1A 1H1VA 2YNHA 4I7FA 4Y1DA 4YOUA 3CCMN 3O80A 5JS2A 2B6AA 4FM2A 2A1RA 2A1SA 5C2FA 1TUYA 5AQZA 2E2QA 4B1VA 4GV6A 2DTUA 3O9SA 1RDUA 2QXLA 4A59A 4PA1A 5HBMA 3C6AA 4FWMA 5F1XA 3PO4A 4Z4EA 1MWKA 3DYAA 2ZF5O 5CZ1A 3A0IX 4CK3A 1ZYQA 1RBUA 3UKUA 4C23A 3CJBA 2YJFA 4JKDA 4CJWA 2NRVA 4JLHA 4JRPA 4C1NI 4W5QA 3IDHA 2GUPA 1L3UA 2OANA 4DS4A 2AP1A 2GX9A 2HMPA 4BRHA 4NXNK 3L4QA 3LWMA 1IJJA 3U3YA 2XY6A 3QFPA 3BF1A 5M1PA 1X9WA 1VSMA 3NDKA 3VF6A 2D0AA 4E1MA 4WFBL 3LDOA 1VQ5N 4H0PA 4A61A 5FLXO 2RPIA 3O3FA 4HTLA 3QIPA 4IOCL 3P31A 3TU5A 4NXMK 3CC7N 3O1BA 2R7YA 3TR8A 3JYTA 3MK6A 4BGBA 4DSKA 1RTHA 3MX5A 4Z4FA 5JLHA 3OYCA 3C6TA 4IEIA 1YJWN 2O8DB 3VF2A 3DLHA 3VGKA 1TUUA 2UUAK 4YY3K 2P5OA 3P4IA 4Z4CA 1DGKN 1IBMK 2E1ZA 2QWLA 3A8YA 3ATVA 2GWKA 4F2RA 3WUHA 2HOEA 1EO1A 3P39A 1SV5A 3KZBA 4Z4IA 3CF5L 2NRTA 4H0XB 1UWBA 4FJJA 1T8EA 3PX4A 4DTUA 3QEWA 3C6UA 1GLEG 2XHBA 1JLGA 1QZ5A 4RTFD 4DFJA 2OPPA 1Q9YA 4F8RA 3O5BA 5GIOA 1QE1A 4DS5A 2FSKA 3VA0A 1JCEA 4E7JA 4DB3A 3VQBA 1BDGA 3V9ZA 2EX3A 3WEEB 4OKEA 1GLBG 1NJWA 1Z05A 3VQCA 3TI0A 5LY3A 3EZ5A 3QETA 3ZSZA 4KREA 1T3VA 1C0FA 1SAZA 1MDUB 4K41A 1X3MA 4CFDA 3MWPA 3KLEA 3M6GA 3O08A 5KQ8A 4HVJA 4XEIA 3VPZA 1EWRA 4J2EA 4JKCA 2P9SA 5HL7L 4FLYA 2XRIA 3SPYA 1FKPA 4KTZA 4JKEA 4B9VA 4IEEA 4KPYA 2IVNA 3E1YA 4JS5A 1L3SA 1RTJA 3QMLA 2PYLA 4AM7A 4FJMA 1BI4B 5IT9O 4KHSA 4G9ZA 3GE1A 3N4PA 2B5JA 2Q1NA 5C12A 3C95A 3T3FA 3I56N 5JVHL 1LWEA 1T6CA 2BGGA 1NGJA 1SUQA 3CPWM 4N41A 1NK7A 1XQSC 3MDQA 3ID8A 1KRPA 3ULDA 4W5RA 4CGIA 4CEAA 4QCLA 2HBLA 3F73A 3THXB 3R6MA 3OS2A 3LDPA 4V19S 4IKFA 1QSYA 4CIFA 5BN8A 1VRTA 2VWBA 4KH4A 4DU4A 1D9DA 1YAGA 4DR2K 3IKMA 4QS9A 4ISFA 2Z1IA 4EIAA 4LF9K 4KH6A 1S72N 5TKYA 3HSCA 3CETA 5FROA 3ITHA 4IFVA 2ZGZA 3NAEA 4Z4HA 4B3OA 4CERA 3SV4A 1HNVA 3ULEB 3NF9A 1RDDA 2ASPA 4CD1A 3SV3A 1YT3A 2O8FB 4EP4A 2Q31A 2G8FA 3K9JA 3PY8A 3W3DA 3KKRA 1K6YA 2P9IA 4KH5A 1KVCA 3VEZA 4DLGA 1NKCA 1IV0A 3FZLA 4BR2A 4CJVA 4BACA 1NM1A 2GV9A 1NJYA 3AGKA 1HYVA 2FSJA 2NRXA 1Q9XA 2HNYA 2IVOA 3SI6A 2P9KB 1RT4A 4CFAA 4IXCA 3TAFA 4K43A 4JRQA 4K0KK 2CGKA 2D4WA 4A2AA 3K2PA 3O9RA 3FFIA 2P9LA 4CJPA 4JD2A 2WBNA 1RDBA 4CECA 3OYNA 4H5WA 3ZETA 3HTVA 4DV5K 1NKBA 4CE9A 5HRPA 4ZTJA 3L2VA 1ZC6A 3IG1A 4BDZA 1XMQK 3LANA 5C10A 3WXKA 4I6MB 2NLXA 1A5XA 4JI2K 3RMCA 1BG3A 3KWGA 3KJVA 1ZBHA 1BHLA 4M3UA 3KKSA 4XH5A 4GW6A 5HRNA 2H3GX 3W0LA 1L5UA 1VQ7N 4AHSA 3LM2A 3NMUA 3O4WA 4CJTA 3D2FA 5ELZA 5FDLA 5SZTA 3ZLJA 4MLHA 4JKHA 4FJGA 1DTTA 3VENA 1LAWA 3QINA 2KTQA 3GBTA 1ZBLA 3UKRB 4FLTA 5AQQA 2UXDK 5J2QA 5ADXA 5JS1A 4QS7A 5GAHP 4DV4K 4EZ6A 3PX6A 3HPGA 1Z26A 2HW3A 1HQEA 4FL9A 2HB5A 3BY5A 3H45C 1Y97A 1LAVA 4H0YB 4PWDA 5AQFA 3U9ZA 4Y0WA 1KVAA 3AVKA 3ZSXA 2ZE2A 5LMUK 1UOCA 4YOYA 2ZQBA 1BUPA 4CF8A 5DM7L 1KAYA 4A5AA 2E2NA 5AQIA 5KPRA 3THYA 3KVGA 3UKUB 4W5NA 4FJ9A 2HHTA 2YCHA 5EXWA 5I9EB 3CCVN 3KK7A 3LDLA 3IRXA 2E2OA 3EY1A 1JL2A 3C6HA 1A5VA 2VWJA 1YJNN 2W42A 2DPNA 3E9LA 3VEVA 1QHTA 3U3GA 5M1NA 1C1AA 3DWLA 1KC8O 4BVOA 3CC4N 2A3ZA 2FF6A 4FYDA 4BG9A 5AQLA 4CBWA 5GINA 4B9NA 4CF1A 1M90O 1NJXA 2E6MA 1S3XA 1WAFA 3AVBA 3VQDA 1KVBA 3DRSA 4ISGA 2E5LK 3KLHA 1OKJA 3V81A 3VQAA 1XHXA 3VESA 4DTPA 1NGCA 4FWKA 2YI1A 3K5NA 1BA0A 2F4VK 3TABA 1XHZA 5ADXH 2VQEK 5H1SQ 5C15A 1LOTB 4AILC 3RMBA 1JKHA 3MECA 4JKGB 5HLFA 1TK8A 2HBKA 4O0IA 4OPAA 4K8XA 1ZBUA 4FOIA 1HR0K 3AVIA 3ZT0A 3VA3A 3OBYA 1KLNA 3MN5A 5BRHA 3M5RA 4DQSA 3PX0A 4CJFA 3ZX2A 1WSEA 1GOAA 5C2DA 2NRHA 3K5LA 3FLCO 4L3QA 3D45A 4BVPA 3SQ1A 3F5TA 4FLUA 3CERA 4B8AB 3ZCMA 4OKKA 3SBGA 4LH5A 2E2PA 2Z1GA 4PY5A 3NHGA 3CJCA 3O9QA 4IDHA 4M42A 1B9FA 3NGZA 3EKSA 3SQ2A 4RCHA 3O6WA 3NH0A 1EWQA 3CFOA 4B1XB 3MEGA 3LDSA 4BRCA 4OKJA 3I33A 3OA9A 3L2WA 3LP1A 4IG3A 3AVLA 4FWLA 4JKBA 1SL1A 1HRHA 4B9MA 4CHQA 3CCQN 3THVA 2P9SB 4BC2A 4Q0BA 4Q5VA 2YHXA 3C7NA 1UAXA 4H8KA 3TAEA 1WBDA 4HUEA 2QWNA 1N33K 5C25A 1JLQA 3LWLA 4AH9A 3ENHA 1BGXT 2V51B 4DFMA 4OX9K 3RR7A 4FXDA 5TKWA 1N8RO 3CCUN 3P1GA 2D0PA 2D0OA 4KHYA 4J2AA 4YOVA 3E01A 1J53A 4FJ5A 4CZHA 4DCHA 1KFSA 4AM6A 3OYDA 2P5GA 4M3XA 1CZAN 3AA3A 4LSLA 1ATSA 4CEEA 4E1NA 1NGIA 4OVLA 3ZEUA 1HYZA 3VTHA 1HKCA 1BL3A 4BR7A 4OPKA 5KRSA 2QEXN 2QWOA 4N47A 4DSFA 2A41A 4NLCA 2OZSA 3KLGA 1C1CA 4FWSA 4WFAL 4FVUA 2YNIA 1YVUA 1REVA 2I7NA 2G8VA 1HLUA 3EZWA 1RFQA 3RWUA 2ITMA 3EO3A 1SZ2A 3LDQA 1S1TA 3MXMA 4LFAK 4LSNA 4BRPA 3VQEA 1LCUA 2P9IB 4CK2A 3TAPA 2ZD1A 1JCGA 4GKKK 1NU0A 2O8EA 4KO0A 3TSQA 1C0TA 1JL1A 1TV6A 3D2EA 2IOCA 3CIPA 1BQNA 2WOMA 1NBWA 1U2VA 1K8KA 2WTUA 1NLVA 4FJ7A 5F0XA 4DF8A 3J80O 3VEWA 2VGNA 4BRDA 1KCFA 2E6LA 5AQJA 4B9SA 1WUAA 4BWJA 1CXQA 2P9LB 3DXMA 3NH2A 1NK5A 3ZSRA 3BEXA 3PUFA 4IZ9A 1U45A 3O8MA 1V4TA 3BZCA 3TARA 5JICA 3L2QA 1JLCA 2Q3SA 3ZETB 1K73O 2P9NA 3FE1A 3G6EN 4K8ZA 3CC2N 1N36K 4DUZK 4A5BA 4E7HA 1C0GA 2BDPA 1VSIA 3UB5A 3HI0A 1YF5L 4MLEA 3ZX0A 4RW4A 4BDPA 2KFNA 3HOTA 4BRLA 2DFFA 2FLOA 4HUFA 4C1NK 4DQPA 4WQ4C 4DV1K 3BUZB 3FZMA 1WSJA 4NB4A 2QKBA 1ASVA 4CZGA 1D9FA 3M3ZA 4F2SA 2HHQA 1T7PA 2UUCK 3N4QA 3HPOA 3D2FB 4GV9A 2BUPA 3DLBA 2G8WA 2VGMA 3EE8A 4YORA 1HNZK 1DT9A 1SQKA 3OYBA 3CJ7A 4DHYA 4W5OA 3AVGA 2P9PA 1GLCG 4IDKA 4BGAA 1D4XA 5DK5A 3OYEA 1NNEA 5D3GA 4DWIA 2F8TA 4NO7A 3OYGA 4K25A 4LF7K 5FPNA 3S41A 5M1QA 4DR1K 1VSFA 3H3OB 1C6VA 1KLMA 3MCAB 3AV9A 4GVEA 4FOEA 1ASUA 3QDKA 3IFRA 2O4IA 2HHWA 3THYB 3OYMA 1E4FT 3U8XA 1VSHA 2V7ZA 4CVNE 5IWAK 5I42A 4H03B 5AQGA 2F9WA 4BDYA 1WLJA 3VQPA 2OTJN 4JKAA 3TANA 3SJJA 4H5VA 3HZ6A 1GLJO 3PSIA 3T1AA 2Q36A 4LC9B 2VQFK 4M7YA 3AVFA 1OH6A 3HYFA 4Y1CA 3DJCA 4YDUC 3QFUA 1QZ6A 1OVQA 2ITGA 4GNIA 4GKJK 1XUPO 4EAHD 4M63C 3RRHA 3ATUA 4E0DA 2BANA 4JKFA 3BGRA 4CJSA 1S1VA 1S1XA 2P9UB 3T69A 4DV6K 3NF8A 3ZSWA 4I9QA 2YV0X 4KTQA 4K42A 3H08A 5BPMA 3T1YK 4FZYA 4LF8K 4F3TA 2ATQA 4PUOA 4BREA 4ISEA 5EOYA 1NGAA 2A6AA 4O44A 2Q97A 3ASMA 4HHTA 4MFBA 1W0HA 1I39A 3FZFA 2G8UA 1S9EA 4BRIA 2V52B 3VGMA 3NF7A 3P38A 4DR3K 1XI1A 4B9QA 1BOTO 3AVHA 1W2BM 1O13A 1WSGA 4CJRA 1ATRA 3JXUA 2KHOA 4YOWA 3MN6A 2HSTA 4X66K 3DLKA 4IJNA 3CQXA 3THWA 4FWRA 4B1UB 2VG5A 1YTAA 3A5OC 1VQON 2ASMA 4E7IA 2XY7A 2X78A 2YNGA 2YHAA 1JJ2M 3ID6A 3Q7BA 3LZIA 4F4KA 1TK5A 5AZIB 4BR9A 3MEDA 1LV5A 4I2QA 4BC5A 1RTDA 1SKSA 1IO2A 2OTLN 1VQ4N 4NCBA 3KK2A 3L2UA 1CLQA 2XY8A 1UA1A 3AY9A 3E9PA 2B4JA 2E20A 1OVYA 3QERA 3ZSQA 4M3RA 4M45A 2NRRA 3SUPA 3RMDA 2FF3B 3I8BA 3NBPA 4JEPA 5E84A 4JI4K 5DM6L 5AJ3K 3A2FA 1IG8A 3K5MA 4B3SK 2E4LA 1HNXK 3ENOA 1KAXA 2EWSA 2QTDA 3WQTA 2IDOA 2UXBK 1NK6A 2QWRA 5KTQA 3VEXA 3SLCA 3TTDA 5AQUA 3EYZA 3KD5E 4PQUA 1QHAA 3KTQA 3AA5X 4JK7A 3ZT2A 3I55N 1ASWA 3CPEA 1M1KO 4FWNA 2IAJA 1BCOA 4B8CA 2YHWA 5K14A 2Q2RA 4RWTA 3RMAA 1VSEA 4LD0A 1WSIA 1LW0A 1VAZA 4FWQA 1GOCA 1NJIO 3VTIA 1JLFA 1VSJA 1X3NA 1VSKA 2D1KA 3FR0A 4H5NA 4AHCA 4FJHA 4CJQA 1VHXA 3AAQA 4DTMA 2RN2A 1NGDA 2QW9A 3L3VA 4BR5A 3T1HK 1HUXA 1N34K 5KPZA 3TWHA 3NGYA 3HL8A 3MEEA 3VQ9A 3L3UA 2JGUA 2X74A 1S6QA 1WSFA 2CH6A 3NE6A 5AQMA 3LL3A 4FLZA 1C0UA 1Q86O 2ZGYA 4CEQA 4CJ4A 1RT2A 1RDWX 3R1XA 4B9LA 3LPUA 3IS9A 3OYJA 1Q7YO 4FWPA 1LWFA 3CM5A 1YTUA 3DXKB 3OY9A 3NH1A 4CGHA 5GAEP 2FBXA 1ESVA 4LF4K 2O8EB 4CF9A 1NK8A 3H1VX 1E3MA 4MO4A 1U2VB 5MLCQ 1K8KB 2GTDA 4KBOA 3A5NC 4OGCA 3QEPA 2HHHK 3CI5A 2G8HA 3LDNA 1TAQA 4HCCA 3V9SA 4B08A 4L8RB 3ZSYA 1IKWA 3SAFA 3ZT3A 3DXMB 1D8YA 3F9KA 3CJ9A 3Q7CA 4BC3A 4FW2A 3O4QA 1JCFA 3KIOA 3QO9A 1GOBA 4O4GA 4B3RK 5FPDA 2DY4A 3OYAA 2RKIA 5AQXA 1YI2N 4PHTX 2O8BA 2NRZA 3V1OA 1DKGD 1TYQA 2OPSA 4KKOA 5C42A 3QEXA 2HHVA 1FKOA 3CCRN 3BF3A 3OVNA 4PKIA 4DSEA 3TAQA 4CGFA 5KQDA 4ZHRA 4OO1J 4YOXA 1W97L 4G1QA 4JI8K 3GL1A 2IS3A 3H3NO 2GEMA 1RBSA 2YHBA 3O4NA 2OPQA 2DFEA 3A5LC 4FZXC 3OTOK 1W7AA 4J2DA 3CM6A 4BR4A 4DTJA 1VQMN 3OW2M 1HNWK 4DU1A 2P9PB 4MQ3A 4B1WB 1YXQA 5AQWA 3MXIA 1IKVA 1BWFO 5CHIA 1TKZA 4CHZA 1KFDA 3I0RA 4FLXA 1BISA 1OH7A 3L8BA 3S3NA 3S3MA 4JV5K 5HP1A 3OJSA 1VQ6N 1RTIA 3ZT1A 3K0SA 4AHRA 3HM9A 3CG7A 3DLRA 4RW9A 2HHSA 2W40A 3KHYA 3M8SA 3MN7A 4DTSA 4IG0A 4JYAK 1TKDA 1ITGA 4GY2B 1I94K 2E88A 1GLLO 3HVTA 1G99A 5AQHA 1RT6A 1J54A 4JI3K 3LALA 4IJAA 1J6ZA 3AA2A 3FGUA 2FBVA 3HK2A 5CYMA 1VSDA 1Z6RA 1QQOA 2PAVA 4WQ5C 1FK9A 2F9TA 3DRRA 5KPTA 1F21A 1S6PA 4BRKA 4MDBA 3RTVA 1QQMA 4CZEA 1YHQN 3O3HA 3M8PA 4KI6A 2A5XA 4BR0A 2UU9K 4ILJA 4CEDA 4JK8A 1R0AA 3SJHA 2I7PA 4MO5A 3CFRA 1BCMA 3CJ1A 4X62K 3GG4A 4FK4A 1KQSM 5BN9A 5AQYA 3KLIA 2Y1JA 2JWLA 4BROA 1SS6A 2BE2A 4DF4A 4KHQA 3CJAA 4M41A 3VQ7A 1P90A 5J2NA 4DR4K 2YX6A 4IFEA 3DRPA 1TK0A 2HNZA 1GLAG 3TAGA 3KD1E 4BRGA 1QSSA 1BIUA 3ULEA 3QB0A 1NKEA 3VQ5A 3OS1A 1NGHA 2Z1HA 4EFHA 4H0OA 3MN9A 3LAMA 3THWB 1VQLN 5AFUA 3QBXA 4DR6K 4J2BA 3HXMA 2QWPA 4IOAL 4CJUA 1RT7A 2KW4A 4Z94A 3M8RA 4LFCK 2UYTA 2YKNA
chains in the Genus database with same CATH topology
4ELUA 4H4MA 3NF6A 3NF9A 1RDDA 3SV3A 5J1EA 1YT3A 4EP4A 1WAJA 1ASUA 2G8FA 1JLBA 3PY8A 4KHUA 1KSPA 3KKRA 2O4IA 1K6YA 1TKXA 3WNEA 4CEFA 3OYMA 1U47A 2HMIA 2HHWA 4E19A 4OGEA 3SUNA 1L3TA 1VSHA 4CIEA 3OS0A 1KVCA 1X9MA 4Z4GA 2HVHA 4DLGA 1NKCA 4FK2A 1UA0A 1RBRA 1RBTA 2ETJA 4ELVA 5I42A 4BDYA 4E3SA 3L2RA 1WLJA 3LP3A 3VQPA 4CJ3A 1ZBFA 4CJVA 3TANA 3AVJA 1TGOA 4BACA 3SJJA 2D0BA 1HMVA 2GV9A 1G15A 1NJYA 2PZSA 3V9UA 1HYVA 4N76A 1ZBIA 2F8SA 5CY4A 2HNYA 3T1AA 2GUIA 3SI6A 3I0SA 1Q9XA 4M3YA 2G8KA 1RT4A 4CFAA 4CFCA 3V9WA 1JLAA 3TAFA 3AVFA 3UIQA 3HYFA 3TAMA 4Y1CA 4JRQA 3DOLA 3ZT4A 3PV8A 2XO7A 1S1WA 1TL1A 4FJNA 3WNHA 3K2PA 2G8IA 4CJ5A 4YFUA 2ITGA 4FM0A 3FFIA 3HSTB 2IGIA 1NOYA 3RR8A 1TVRA 1O1WA 1RNHA 4CJPA 4KV8A 5CYQA 1RDBA 3RRHA 3QESA 4E0DA 4CECA 1TL3A 2BANA 3BGRA 1W9HA 4CJSA 1S1VA 4YNQA 3MAQA 1TAUA 1S1XA 3OYNA 4E7LA 4CFBA 3T19A 5KGWA 3VQ8A 1NKBA 4CE9A 5HRPA 4ZTJA 2WONA 3NF8A 3ZSWA 1QQCA 4I9LA 3L2VA 3SQ0A 2YV0X 3IG1A 2QXFA 4FM1A 1SL0A 4KTQA 3H08A 1XWLA 4TSXA 4BDZA 1LWCA 1EX4A 3LANA 3VQ4A 4B9UA 4BE0A 2PYJA 2HHXA 2AJQA 4CF0A 4FZYA 4H4OA 4Z0UA 1BI4A 1A5XA 3RMCA 2KFZA 3KJVA 4F3TA 1J5OA 1ZBHA 3V6DA 2DFHA 1BHLA 4M3UA 2ATQA 3KKSA 3SUOA 3AO5A 4PUOA 5T7BA 4GW6A 4DSIA 4HUGA 3MXJA 2O4GA 1LW2A 4O44A 4BWMA 5HRNA 3ASMA 4OJRA 4HHTA 4MFBA 1L5UA 1JXBA 3OYIA 4RW8A 1RT5A 1W0HA 1I39A 2RF2A 3G10A 2G8UA 3QNNA 1S9EA 5HRSA 1RBVA 4CGJA 4AHSA 3NF7A 2XY5A 4CJTA 1XI1A 5FDLA 5SZTA 2FBYA 2NUBA 1TKTA 4FJGA 1DTTA 3K59A 1FXXA 1LAWA 3QINA 2KTQA 1RDCA 4N56A 1ZBLA 4FLTA 3AVHA 1NJZA 5J2QA 3WNFA 5JS1A 1WSGA 1NOZA 4CHPA 1B92A 4CJRA 3ALYA 3PX6A 2OZMA 4EZ6A 4DMNA 1SKRA 1EKEA 3HPGA 4NYNA 4EZ9A 4KB0A 4FJ8A 1Z26A 2JLEA 3IAYA 2HW3A 4ELTA 3DLKA 1HQEA 3K58A 2D0CA 1S5JA 2HB5A 2VG5A 1YTAA 4M3TA 1Y97A 1LAVA 3QEVA 1NK0A 4E7IA 2XY7A 2YNGA 2X78A 4PWDA 5SWMA 2YHAA 4KHNA 5E41A 1WN7A 3LZIA 4DFKA 1IKXA 1SKWA 1TK5A 4F4KA 1KVAA 2KZZA 3AVKA 5J2MA 3ZSXA 2ZE2A 4DTXA 3AA4A 3MEDA 5HRRA 1LV5A 1NK9A 1UOCA 4I2QA 1RTDA 2ZQBA 1SKSA 5CZ2A 4CF8A 1IO2A 3SYZA 3CQ8A 3HP9A 4NCBA 3KK2A 3L2UA 3NGIA 1QSLA 4DFPA 4DSLA 1CLQA 2XY8A 4CEOA 3KK3A 1UA1A 1X9SA 4CHNA 2B4JA 4W5NA 3AO4A 4FJ9A 2HHTA 2VWKA 3QERA 3ZSQA 4M3RA 4M3ZA 3PO5A 4M45A 1EETA 1I3AA 4FJXA 3NFAA 3IRXA 2LSNA 1HNIA 1DLOA 3EY1A 3ZSVA 1JL2A 1N6QA 1VRUA 3SUPA 3RMDA 2P1JA 3OYHA 5HROA 1A5VA 2VWJA 3NBPA 3M8QA 4DTOA 2W42A 1X1PA 5KRTA 3SPZA 3QLHA 3VN5A 4FLWA 3A2FA 1DTQA 2KQ2A 3I8DA 1QHTA 4DG1A 3V1QA 4CJEA 3U3GA 1U04A 3K5MA 5EU7A 1C1AA 2E4LA 4AHTA 4FYDA 1N5YA 4RW6A 4CGGA 5KI6A 4KHWA 3ISNC 2IDOA 4RW7A 4B9NA 3B6PA 3LZJA 3CFPA 3SUQA 4CF1A 1NK6A 5KTQA 2E6MA 1NJXA 4NCAA 1WAFA 1L3VA 3EYZA 4UQGA 3KD5E 3S9HA 4PQUA 2OPRA 3AVBA 3V1RA 4CEBA 3KTQA 3AA5X 2OYQA 1RT3A 1KVBA 2F96A 3DRSA 3VQDA 3ZT2A 1NK4A 1ASWA 4QAGA 3AVMA 3KLHA 3V81A 2IAJA 1BCOA 1SL2A 1B9DA 4RG8A 3U6FA 3VQAA 3NCIA 1XHXA 1MU2A 4B8CA 4DTPA 3DI6A 4C8LA 4LH4A 5K14A 3K5NA 4B9TA 1HYSA 4C8KA 3OYFA 1VSEA 3RMAA 4LD0A 3JSMA 4BE1A 4R5PA 3TABA 1XHZA 1T05A 1WSIA 1LW0A 1GOCA 3HT3A 2YNFA 1KTQA 1JLFA 1VSJA 3D0PA 3DOKA 2HHUA 3K57A 1VSKA 4C8MA 4AILC 3RMBA 1IH7A 1JKHA 3P83D 4AHCA 4DTRA 4CGDA 1A5WA 4FJHA 3K5OA 3MECA 4CJQA 5HLFA 2GBZA 1TK8A 3AO1A 4NCGA 4O0IA 4K8XA 4DTMA 1ZBUA 2RN2A 3WNGA 3HVRA 3AVIA 3L3VA 3ZT0A 3VA3A 4DU3A 4I2PA 3TWHA 1XC9A 1KLNA 3NGYA 3HL8A 2X6NA 3MEEA 3L3UA 3VQ9A 4CCHA 4DQSA 3PX0A 4CESA 2JGUA 2X74A 1S6QA 2VG6A 1WSFA 4CJFA 1D5AA 4EP5A 3QNOA 4DQIA 3NE6A 1WSEA 1GOAA 4FLZA 4CHOA 2P51A 3K5LA 4E89A 1C0UA 4BE2A 2VG7A 4CEQA 4CJ4A 1RT2A 4CK1A 3O3GA 2Y1IA 2KZMA 1S1UA 3D45A 4OPJA 3SQ1A 3QEIA 3SNNA 2QK9A 4B9LA 2YNHA 3LPUA 3IS9A 4B8AB 4I7FA 4OKKA 4Y1DA 3DM2A 4LH5A 3ZCMA 3OYJA 2Z1GA 4GMJB 5JS2A 1LWFA 2B6AA 3CM5A 4FM2A 2A1SA 5J2PA 2A1RA 1YTUA 3OY9A 3NH1A 4ZTFA 3NHGA 4PY5A 2HVIA 4CGHA 4DLEA 2DTUA 2FBXA 1VSLA 4PA1A 3P5JA 5HBMA 4CF9A 1NK8A 4M42A 1HPZA 4KB1A 4C8OA 1B9FA 3AO3A 2X6SA 2FBTA 3NGZA 3SQ2A 3PO4A 4WE1A 4Z4EA 3DYAA 3HPHA 1QTMA 5CZ1A 4FJLA 3NH0A 1HJRA 4CK3A 3CFOA 1ZYQA 4OGCA 1EXQA 3MEGA 3QEPA 1RBUA 3LDSA 2G8HA 4OKJA 4M3WA 1TAQA 3L2WA 1RILA 3LP1A 4CJWA 4CF2A 1T03A 4HCCA 4IG3A 3V9SA 3AVLA 4JLHA 3OYLA 4JRPA 4OLBA 4B08A 4L8RB 3DLGA 4W5QA 3ZSYA 1IKWA 4CEZA 1L3UA 1SL1A 4DS4A 3ZT3A 1HRHA 4B9MA 4CHQA 3LWMA 1S9GA 1D8YA 3F9KA 3U3YA 2XY6A 3THVA 4IFYA 4FW2A 4Q0BA 4Q5VA 3LP2A 3O4QA 1X9WA 3KIOA 1IG9A 1VSMA 3QO9A 4CJKA 3NDKA 2D0AA 1UAXA 1GOBA 4GVMA 4H8KA 4E1MA 1WNSA 2FC0A 4O4GA 4HUEA 3TAEA 5I3UA 4DQQA 2DY4A 5C25A 2RKIA 3OYAA 4KI4A 3B6OA 1JLQA 2RPIA 3O3FA 3LWLA 2D5RA 4AH9A 1CXUA 3QIPA 1BGXT 2OPSA 3V1OA 2HHVA 4KKOA 5C42A 3QEXA 1FKOA 3OYKA 4DFMA 3SQ4A 2R7YA 3OVNA 3V9XA 3TR8A 1C0MA 4DSEA 3TAQA 4CGFA 3JYTA 3RR7A 4FXDA 4CJLA 4DSKA 4ZHRA 1RTHA 4E7KA 4G1QA 3CYMA 1Z25A 4Z4FA 3OYCA 4FJIA 2IS3A 3P1GA 2YKMA 3C6TA 4DQRA 4KHYA 4J2AA 1RBSA 3E01A 3DLHA 2YHBA 1J9AA 3O4NA 2OPQA 1J53A 2DFEA 4FJ5A 4FZXC 1KFSA 3OYDA 3BDPA 4KRFA 2Z1JA 2P5GA 4M3XA 2P5OA 4J2DA 3CM6A 4Z4CA 4HCBA 3AA3A 4W5TA 4DTJA 4LSLA 2OA8A 3KK1A 4E1NA 4CEEA 4F2RA 4OVLA 1WSHA 4DU1A 4MQ3A 1HYZA 2QKKA 1SV5A 1BL3A 4Z4IA 4JS4A 3MXIA 1IKVA 4OPKA 1UWBA 4FJJA 5KRSA 3PX4A 1T8EA 4DTUA 3HP6A 1TKZA 4DSJA 4N47A 3QEWA 4CHZA 1KFDA 4DSFA 2OZSA 3I0RA 3KLGA 4FZZA 1C1CA 3C6UA 1BISA 4FLXA 4FLVA 3L8BA 2YNIA 1YVUA 1REVA 3S3NA 2G8VA 4QOZB 2XHBA 3AVCA 3S3MA 1JLGA 3HO1A 4CIGA 5HP1A 1U49A 3OJSA 3RWUA 4DFJA 1RTIA 4ID5A 2OPPA 3KLFA 3LAKA 1S1TA 3ZT1A 3MXMA 1Q9YA 1EP4A 4AHRA 4F8RA 3HM9A 4LSNA 3V4IA 1QS4A 3CG7A 3DLRA 3DMJA 4RW9A 3OJUA 1QE1A 4DS5A 3RRGA 2HHSA 3VQQA 3VQEA 3M8SA 4FK0A 4CK2A 3TAPA 4ID1A 4DTSA 2ZD1A 4IG0A 3VA0A 4E7JA 4FCYA 3AVNA 1Q8IA 1CZBA 3VQBA 4KO0A 1TKDA 3V9ZA 1IKYA 2EX3A 1C0TA 1JL1A 1HQUA 1TV6A 1ITGA 2IOCA 4OKEA 1NJWA 1BQNA 1C1BA 2WOMA 3VQCA 3TI0A 3HVTA 3EZ5A 1RT6A 1J54A 3QETA 5FRNA 4FJ7A 3LALA 3ZSZA 4KAZA 4KREA 3AA2A 4DF8A 4AHUA 2FBVA 3HK2A 5CYMA 3SZ2A 1VSDA 4IBNA 4FVMA 2PY5A 3S3OA 1KCFA 2E6LA 3SCXA 4CFDA 4B9SA 4XIUA 4AHVA 3G0ZA 4KFBA 3KLEA 1RT1A 4BWJA 1CXQA 4F3OA 3NH2A 4HVJA 1NK5A 4J2EA 1FK9A 1RDAA 3PUFA 3DRRA 3ZSRA 4O0JA 4FLYA 1U45A 2EHGA 2XRIA 3SPYA 1F21A 1FKPA 4KTZA 3TARA 3L2QA 1JLCA 1S6PA 2Q3SA 4B9VA 5KGXA 4FLUA 3RTVA 4KPYA 5DMRA 4FJKA 3O3HA 3M8PA 4K8ZA 4KI6A 4E7HA 4JS5A 2BDPA 1VSIA 4NYFA 4CEDA 3LPTA 1L3SA 1RTJA 1R0AA 2PYLA 4RW4A 4CHYA 4FJMA 1BI4B 4BDPA 2KFNA 2DFFA 2I5JA 4HUFA 3CFRA 4DQPA 1BCMA 4KHSA 4FW1A 3C94A 4FK4A 2B5JA 1WSJA 2QKBA 1CZ9A 1ASVA 3C95A 3T3FA 3KLIA 2Y1JA 1D9FA 2IC3A 1LWEA 4O5BA 2BGGA 1VK0A 4F2SA 1SUQA 4I9QA 4N5SA 2BE2A 4N41A 1NK7A 5FRMA 4DF4A 1T7PA 4KHQA 2HHQA 3VQ7A 4M41A 3HPOA 5J2NA 4LY7A 3LP0A 4HTUA 1KRPA 3DLBA 4ICLA 3ULDA 4W5RA 2G8WA 5C24A 1TK0A 3DRPA 2HNZA 4CGIA 4CEAA 3TAGA 3KD1E 4QCLA 3F73A 3OS2A 3OYBA 4IKFA 1U4BA 3DLEA 2HNDA 4CIFA 1QSYA 1BIUA 3QIOA 1VRTA 3AVGA 4O55A 4W5OA 1NKEA 3VQ5A 4IDKA 3OS1A 1BQMA 4KTWA 1D9DA 1JLEA 4DU4A 2Z1HA 1JXEA 3AO2A 4OLAA 5DK5A 3LAMA 4C8NA 3VQ6A 3OYEA 3HJFA 5D3GA 2Z1IA 4J2BA 1QSSA 4DWIA 2F8TA 3HXMA 3ZSOA 3OYGA 5FROA 1U48A 3ITHA 4IFVA 4CJUA 1VSFA 1RT7A 2KW4A 1C6VA 1KLMA 3NAEA 3M8RA 4DTNA 1RCHA 4Z4HA 1BIZA 4CERA 4B3OA 3SV4A 3AVAA 3AV9A 2YKNA 1HNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELU A;  4H4M A;  3NF6 A;  3NF9 A;  1RDD A;  3SV3 A;  5J1E A;  1YT3 A;  4EP4 A;  1WAJ A;  1ASU A;  2G8F A;  1JLB A;  3PY8 A;  4KHU A;  1KSP A;  3KKR A;  2O4I A;  1K6Y A;  1TKX A;  3WNE A;  4CEF A;  3OYM A;  1U47 A;  2HMI A;  2HHW A;  4E19 A;  4OGE A;  3SUN A;  1L3T A;  1VSH A;  4CIE A;  3OS0 A;  1KVC A;  1X9M A;  4Z4G A;  2HVH A;  4DLG A;  1NKC A;  4FK2 A;  1UA0 A;  1RBR A;  1RBT A;  2ETJ A;  4ELV A;  5I42 A;  4BDY A;  4E3S A;  3L2R A;  1WLJ A;  3LP3 A;  3VQP A;  4CJ3 A;  1ZBF A;  4CJV A;  3TAN A;  3AVJ A;  1TGO A;  4BAC A;  3SJJ A;  2D0B A;  1HMV A;  2GV9 A;  1G15 A;  1NJY A;  2PZS A;  3V9U A;  1HYV A;  4N76 A;  1ZBI A;  2F8S A;  5CY4 A;  2HNY A;  3T1A A;  2GUI A;  3SI6 A;  3I0S A;  1Q9X A;  4M3Y A;  2G8K A;  1RT4 A;  4CFA A;  4CFC A;  3V9W A;  1JLA A;  3TAF A;  3AVF A;  3UIQ A;  3HYF A;  3TAM A;  4Y1C A;  4JRQ A;  3DOL A;  3ZT4 A;  3PV8 A;  2XO7 A;  1S1W A;  1TL1 A;  4FJN A;  3WNH A;  3K2P A;  2G8I A;  4CJ5 A;  4YFU A;  2ITG A;  4FM0 A;  3FFI A;  3HST B;  2IGI A;  1NOY A;  3RR8 A;  1TVR A;  1O1W A;  1RNH A;  4CJP A;  4KV8 A;  5CYQ A;  1RDB A;  3RRH A;  3QES A;  4E0D A;  4CEC A;  1TL3 A;  2BAN A;  3BGR A;  1W9H A;  4CJS A;  1S1V A;  4YNQ A;  3MAQ A;  1TAU A;  1S1X A;  3OYN A;  4E7L A;  4CFB A;  3T19 A;  5KGW A;  3VQ8 A;  1NKB A;  4CE9 A;  5HRP A;  4ZTJ A;  2WON A;  3NF8 A;  3ZSW A;  1QQC A;  4I9L A;  3L2V A;  3SQ0 A;  2YV0 X;  3IG1 A;  2QXF A;  4FM1 A;  1SL0 A;  4KTQ A;  3H08 A;  1XWL A;  4TSX A;  4BDZ A;  1LWC A;  1EX4 A;  3LAN A;  3VQ4 A;  4B9U A;  4BE0 A;  2PYJ A;  2HHX A;  2AJQ A;  4CF0 A;  4FZY A;  4H4O A;  4Z0U A;  1BI4 A;  1A5X A;  3RMC A;  2KFZ A;  3KJV A;  4F3T A;  1J5O A;  1ZBH A;  3V6D A;  2DFH A;  1BHL A;  4M3U A;  2ATQ A;  3KKS A;  3SUO A;  3AO5 A;  4PUO A;  5T7B A;  4GW6 A;  4DSI A;  4HUG A;  3MXJ A;  2O4G A;  1LW2 A;  4O44 A;  4BWM A;  5HRN A;  3ASM A;  4OJR A;  4HHT A;  4MFB A;  1L5U A;  1JXB A;  3OYI A;  4RW8 A;  1RT5 A;  1W0H A;  1I39 A;  2RF2 A;  3G10 A;  2G8U A;  3QNN A;  1S9E A;  5HRS A;  1RBV A;  4CGJ A;  4AHS A;  3NF7 A;  2XY5 A;  4CJT A;  1XI1 A;  5FDL A;  5SZT A;  2FBY A;  2NUB A;  1TKT A;  4FJG A;  1DTT A;  3K59 A;  1FXX A;  1LAW A;  3QIN A;  2KTQ A;  1RDC A;  4N56 A;  1ZBL A;  4FLT A;  3AVH A;  1NJZ A;  5J2Q A;  3WNF A;  5JS1 A;  1WSG A;  1NOZ A;  4CHP A;  1B92 A;  4CJR A;  3ALY A;  3PX6 A;  2OZM A;  4EZ6 A;  4DMN A;  1SKR A;  1EKE A;  3HPG A;  4NYN A;  4EZ9 A;  4KB0 A;  4FJ8 A;  1Z26 A;  2JLE A;  3IAY A;  2HW3 A;  4ELT A;  3DLK A;  1HQE A;  3K58 A;  2D0C A;  1S5J A;  2HB5 A;  2VG5 A;  1YTA A;  4M3T A;  1Y97 A;  1LAV A;  3QEV A;  1NK0 A;  4E7I A;  2XY7 A;  2YNG A;  2X78 A;  4PWD A;  5SWM A;  2YHA A;  4KHN A;  5E41 A;  1WN7 A;  3LZI A;  4DFK A;  1IKX A;  1SKW A;  1TK5 A;  4F4K A;  1KVA A;  2KZZ A;  3AVK A;  5J2M A;  3ZSX A;  2ZE2 A;  4DTX A;  3AA4 A;  3MED A;  5HRR A;  1LV5 A;  1NK9 A;  1UOC A;  4I2Q A;  1RTD A;  2ZQB A;  1SKS A;  5CZ2 A;  4CF8 A;  1IO2 A;  3SYZ A;  3CQ8 A;  3HP9 A;  4NCB A;  3KK2 A;  3L2U A;  3NGI A;  1QSL A;  4DFP A;  4DSL A;  1CLQ A;  2XY8 A;  4CEO A;  3KK3 A;  1UA1 A;  1X9S A;  4CHN A;  2B4J A;  4W5N A;  3AO4 A;  4FJ9 A;  2HHT A;  2VWK A;  3QER A;  3ZSQ A;  4M3R A;  4M3Z A;  3PO5 A;  4M45 A;  1EET A;  1I3A A;  4FJX A;  3NFA A;  3IRX A;  2LSN A;  1HNI A;  1DLO A;  3EY1 A;  3ZSV A;  1JL2 A;  1N6Q A;  1VRU A;  3SUP A;  3RMD A;  2P1J A;  3OYH A;  5HRO A;  1A5V A;  2VWJ A;  3NBP A;  3M8Q A;  4DTO A;  2W42 A;  1X1P A;  5KRT A;  3SPZ A;  3QLH A;  3VN5 A;  4FLW A;  3A2F A;  1DTQ A;  2KQ2 A;  3I8D A;  1QHT A;  4DG1 A;  3V1Q A;  4CJE A;  3U3G A;  1U04 A;  3K5M A;  5EU7 A;  1C1A A;  2E4L A;  4AHT A;  4FYD A;  1N5Y A;  4RW6 A;  4CGG A;  5KI6 A;  4KHW A;  3ISN C;  2IDO A;  4RW7 A;  4B9N A;  3B6P A;  3LZJ A;  3CFP A;  3SUQ A;  4CF1 A;  1NK6 A;  5KTQ A;  2E6M A;  1NJX A;  4NCA A;  1WAF A;  1L3V A;  3EYZ A;  4UQG A;  3KD5 E;  3S9H A;  4PQU A;  2OPR A;  3AVB A;  3V1R A;  4CEB A;  3KTQ A;  3AA5 X;  2OYQ A;  1RT3 A;  1KVB A;  2F96 A;  3DRS A;  3VQD A;  3ZT2 A;  1NK4 A;  1ASW A;  4QAG A;  3AVM A;  3KLH A;  3V81 A;  2IAJ A;  1BCO A;  1SL2 A;  1B9D A;  4RG8 A;  3U6F A;  3VQA A;  3NCI A;  1XHX A;  1MU2 A;  4B8C A;  4DTP A;  3DI6 A;  4C8L A;  4LH4 A;  5K14 A;  3K5N A;  4B9T A;  1HYS A;  4C8K A;  3OYF A;  1VSE A;  3RMA A;  4LD0 A;  3JSM A;  4BE1 A;  4R5P A;  3TAB A;  1XHZ A;  1T05 A;  1WSI A;  1LW0 A;  1GOC A;  3HT3 A;  2YNF A;  1KTQ A;  1JLF A;  1VSJ A;  3D0P A;  3DOK A;  2HHU A;  3K57 A;  1VSK A;  4C8M A;  4AIL C;  3RMB A;  1IH7 A;  1JKH A;  3P83 D;  4AHC A;  4DTR A;  4CGD A;  1A5W A;  4FJH A;  3K5O A;  3MEC A;  4CJQ A;  5HLF A;  2GBZ A;  1TK8 A;  3AO1 A;  4NCG A;  4O0I A;  4K8X A;  4DTM A;  1ZBU A;  2RN2 A;  3WNG A;  3HVR A;  3AVI A;  3L3V A;  3ZT0 A;  3VA3 A;  4DU3 A;  4I2P A;  3TWH A;  1XC9 A;  1KLN A;  3NGY A;  3HL8 A;  2X6N A;  3MEE A;  3L3U A;  3VQ9 A;  4CCH A;  4DQS A;  3PX0 A;  4CES A;  2JGU A;  2X74 A;  1S6Q A;  2VG6 A;  1WSF A;  4CJF A;  1D5A A;  4EP5 A;  3QNO A;  4DQI A;  3NE6 A;  1WSE A;  1GOA A;  4FLZ A;  4CHO A;  2P51 A;  3K5L A;  4E89 A;  1C0U A;  4BE2 A;  2VG7 A;  4CEQ A;  4CJ4 A;  1RT2 A;  4CK1 A;  3O3G A;  2Y1I A;  2KZM A;  1S1U A;  3D45 A;  4OPJ A;  3SQ1 A;  3QEI A;  3SNN A;  2QK9 A;  4B9L A;  2YNH A;  3LPU A;  3IS9 A;  4B8A B;  4I7F A;  4OKK A;  4Y1D A;  3DM2 A;  4LH5 A;  3ZCM A;  3OYJ A;  2Z1G A;  4GMJ B;  5JS2 A;  1LWF A;  2B6A A;  3CM5 A;  4FM2 A;  2A1S A;  5J2P A;  2A1R A;  1YTU A;  3OY9 A;  3NH1 A;  4ZTF A;  3NHG A;  4PY5 A;  2HVI A;  4CGH A;  4DLE A;  2DTU A;  2FBX A;  1VSL A;  4PA1 A;  3P5J A;  5HBM A;  4CF9 A;  1NK8 A;  4M42 A;  1HPZ A;  4KB1 A;  4C8O A;  1B9F A;  3AO3 A;  2X6S A;  2FBT A;  3NGZ A;  3SQ2 A;  3PO4 A;  4WE1 A;  4Z4E A;  3DYA A;  3HPH A;  1QTM A;  5CZ1 A;  4FJL A;  3NH0 A;  1HJR A;  4CK3 A;  3CFO A;  1ZYQ A;  4OGC A;  1EXQ A;  3MEG A;  3QEP A;  1RBU A;  3LDS A;  2G8H A;  4OKJ A;  4M3W A;  1TAQ A;  3L2W A;  1RIL A;  3LP1 A;  4CJW A;  4CF2 A;  1T03 A;  4HCC A;  4IG3 A;  3V9S A;  3AVL A;  4JLH A;  3OYL A;  4JRP A;  4OLB A;  4B08 A;  4L8R B;  3DLG A;  4W5Q A;  3ZSY A;  1IKW A;  4CEZ A;  1L3U A;  1SL1 A;  4DS4 A;  3ZT3 A;  1HRH A;  4B9M A;  4CHQ A;  3LWM A;  1S9G A;  1D8Y A;  3F9K A;  3U3Y A;  2XY6 A;  3THV A;  4IFY A;  4FW2 A;  4Q0B A;  4Q5V A;  3LP2 A;  3O4Q A;  1X9W A;  3KIO A;  1IG9 A;  1VSM A;  3QO9 A;  4CJK A;  3NDK A;  2D0A A;  1UAX A;  1GOB A;  4GVM A;  4H8K A;  4E1M A;  1WNS A;  2FC0 A;  4O4G A;  4HUE A;  3TAE A;  5I3U A;  4DQQ A;  2DY4 A;  5C25 A;  2RKI A;  3OYA A;  4KI4 A;  3B6O A;  1JLQ A;  2RPI A;  3O3F A;  3LWL A;  2D5R A;  4AH9 A;  1CXU A;  3QIP A;  1BGX T;  2OPS A;  3V1O A;  2HHV A;  4KKO A;  5C42 A;  3QEX A;  1FKO A;  3OYK A;  4DFM A;  3SQ4 A;  2R7Y A;  3OVN A;  3V9X A;  3TR8 A;  1C0M A;  4DSE A;  3TAQ A;  4CGF A;  3JYT A;  3RR7 A;  4FXD A;  4CJL A;  4DSK A;  4ZHR A;  1RTH A;  4E7K A;  4G1Q A;  3CYM A;  1Z25 A;  4Z4F A;  3OYC A;  4FJI A;  2IS3 A;  3P1G A;  2YKM A;  3C6T A;  4DQR A;  4KHY A;  4J2A A;  1RBS A;  3E01 A;  3DLH A;  2YHB A;  1J9A A;  3O4N A;  2OPQ A;  1J53 A;  2DFE A;  4FJ5 A;  4FZX C;  1KFS A;  3OYD A;  3BDP A;  4KRF A;  2Z1J A;  2P5G A;  4M3X A;  2P5O A;  4J2D A;  3CM6 A;  4Z4C A;  4HCB A;  3AA3 A;  4W5T A;  4DTJ A;  4LSL A;  2OA8 A;  3KK1 A;  4E1N A;  4CEE A;  4F2R A;  4OVL A;  1WSH A;  4DU1 A;  4MQ3 A;  1HYZ A;  2QKK A;  1SV5 A;  1BL3 A;  4Z4I A;  4JS4 A;  3MXI A;  1IKV A;  4OPK A;  1UWB A;  4FJJ A;  5KRS A;  3PX4 A;  1T8E A;  4DTU A;  3HP6 A;  1TKZ A;  4DSJ A;  4N47 A;  3QEW A;  4CHZ A;  1KFD A;  4DSF A;  2OZS A;  3I0R A;  3KLG A;  4FZZ A;  1C1C A;  3C6U A;  1BIS A;  4FLX A;  4FLV A;  3L8B A;  2YNI A;  1YVU A;  1REV A;  3S3N A;  2G8V A;  4QOZ B;  2XHB A;  3AVC A;  3S3M A;  1JLG A;  3HO1 A;  4CIG A;  5HP1 A;  1U49 A;  3OJS A;  3RWU A;  4DFJ A;  1RTI A;  4ID5 A;  2OPP A;  3KLF A;  3LAK A;  1S1T A;  3ZT1 A;  3MXM A;  1Q9Y A;  1EP4 A;  4AHR A;  4F8R A;  3HM9 A;  4LSN A;  3V4I A;  1QS4 A;  3CG7 A;  3DLR A;  3DMJ A;  4RW9 A;  3OJU A;  1QE1 A;  4DS5 A;  3RRG A;  2HHS A;  3VQQ A;  3VQE A;  3M8S A;  4FK0 A;  4CK2 A;  3TAP A;  4ID1 A;  4DTS A;  2ZD1 A;  4IG0 A;  3VA0 A;  4E7J A;  4FCY A;  3AVN A;  1Q8I A;  1CZB A;  3VQB A;  4KO0 A;  1TKD A;  3V9Z A;  1IKY A;  2EX3 A;  1C0T A;  1JL1 A;  1HQU A;  1TV6 A;  1ITG A;  2IOC A;  4OKE A;  1NJW A;  1BQN A;  1C1B A;  2WOM A;  3VQC A;  3TI0 A;  3HVT A;  3EZ5 A;  1RT6 A;  1J54 A;  3QET A;  5FRN A;  4FJ7 A;  3LAL A;  3ZSZ A;  4KAZ A;  4KRE A;  3AA2 A;  4DF8 A;  4AHU A;  2FBV A;  3HK2 A;  5CYM A;  3SZ2 A;  1VSD A;  4IBN A;  4FVM A;  2PY5 A;  3S3O A;  1KCF A;  2E6L A;  3SCX A;  4CFD A;  4B9S A;  4XIU A;  4AHV A;  3G0Z A;  4KFB A;  3KLE A;  1RT1 A;  4BWJ A;  1CXQ A;  4F3O A;  3NH2 A;  4HVJ A;  1NK5 A;  4J2E A;  1FK9 A;  1RDA A;  3PUF A;  3DRR A;  3ZSR A;  4O0J A;  4FLY A;  1U45 A;  2EHG A;  2XRI A;  3SPY A;  1F21 A;  1FKP A;  4KTZ A;  3TAR A;  3L2Q A;  1JLC A;  1S6P A;  2Q3S A;  4B9V A;  5KGX A;  4FLU A;  3RTV A;  4KPY A;  5DMR A;  4FJK A;  3O3H A;  3M8P A;  4K8Z A;  4KI6 A;  4E7H A;  4JS5 A;  2BDP A;  1VSI A;  4NYF A;  4CED A;  3LPT A;  1L3S A;  1RTJ A;  1R0A A;  2PYL A;  4RW4 A;  4CHY A;  4FJM A;  1BI4 B;  4BDP A;  2KFN A;  2DFF A;  2I5J A;  4HUF A;  3CFR A;  4DQP A;  1BCM A;  4KHS A;  4FW1 A;  3C94 A;  4FK4 A;  2B5J A;  1WSJ A;  2QKB A;  1CZ9 A;  1ASV A;  3C95 A;  3T3F A;  3KLI A;  2Y1J A;  1D9F A;  2IC3 A;  1LWE A;  4O5B A;  2BGG A;  1VK0 A;  4F2S A;  1SUQ A;  4I9Q A;  4N5S A;  2BE2 A;  4N41 A;  1NK7 A;  5FRM A;  4DF4 A;  1T7P A;  4KHQ A;  2HHQ A;  3VQ7 A;  4M41 A;  3HPO A;  5J2N A;  4LY7 A;  3LP0 A;  4HTU A;  1KRP A;  3DLB A;  4ICL A;  3ULD A;  4W5R A;  2G8W A;  5C24 A;  1TK0 A;  3DRP A;  2HNZ A;  4CGI A;  4CEA A;  3TAG A;  3KD1 E;  4QCL A;  3F73 A;  3OS2 A;  3OYB A;  4IKF A;  1U4B A;  3DLE A;  2HND A;  4CIF A;  1QSY A;  1BIU A;  3QIO A;  1VRT A;  3AVG A;  4O55 A;  4W5O A;  1NKE A;  3VQ5 A;  4IDK A;  3OS1 A;  1BQM A;  4KTW A;  1D9D A;  1JLE A;  4DU4 A;  2Z1H A;  1JXE A;  3AO2 A;  4OLA A;  5DK5 A;  3LAM A;  4C8N A;  3VQ6 A;  3OYE A;  3HJF A;  5D3G A;  2Z1I A;  4J2B A;  1QSS A;  4DWI A;  2F8T A;  3HXM A;  3ZSO A;  3OYG A;  5FRO A;  1U48 A;  3ITH A;  4IFV A;  4CJU A;  1VSF A;  1RT7 A;  2KW4 A;  1C6V A;  1KLM A;  3NAE A;  3M8R A;  4DTN A;  1RCH A;  4Z4H A;  1BIZ A;  4CER A;  4B3O A;  3SV4 A;  3AVA A;  3AV9 A;  2YKN A;  1HNV A; 
#chains in the Genus database with same CATH topology
 4ELU A;  1Y64 A;  5GIP A;  4XH4 A;  3EEQ A;  4BY9 C;  2NRW A;  1TKX A;  3WNE A;  1U47 A;  3B8A X;  1T44 A;  3PSF A;  3SUN A;  4CIE A;  3VMF B;  1E4G T;  3OS0 A;  4Z4G A;  1VQP N;  1UA0 A;  3PLA A;  1RBR A;  3VGL A;  3LP3 A;  4CJ3 A;  1TGO A;  3NVK A;  3HM8 A;  1HMV A;  1DEJ A;  1G15 A;  3GOI A;  5AZJ A;  3V9U A;  2PZS A;  1NGG A;  4N76 A;  4CBX A;  4M3Y A;  1FJG K;  2G8K A;  4CFC A;  3VER A;  3TAM A;  3DOL A;  3ZT4 A;  3PV8 A;  1S1W A;  1TL1 A;  4PKH A;  3WNH A;  2KLA A;  4CJ5 A;  4YFU A;  3DAW A;  4I6M A;  4CD3 A;  3J8A A;  2IGI A;  4O8U A;  1NOY A;  1O1W A;  1RNH A;  5B8H A;  4YNQ A;  1TAU A;  3MAQ A;  2HBJ A;  3T19 A;  4CFB A;  5KGW A;  1NGF A;  2WON A;  3TSP A;  1P8Z A;  1QQC A;  4I9L A;  2F7T A;  3IUC A;  4TSX A;  3SAH A;  2ASO A;  1LWC A;  3VQ4 A;  4BE0 A;  1K9M O;  2PYJ A;  2HHX A;  4CF0 A;  2YJE A;  2NNW A;  4Z0U A;  3F2K A;  2KFZ A;  2HF3 A;  3UKR A;  4GV3 A;  4JD2 B;  3V6D A;  2DFH A;  3AO5 A;  4CZM A;  4DQ8 A;  4HUG A;  2BH1 A;  2E8A A;  3MXJ A;  2O4G A;  4OJR A;  3FZH A;  3OYI A;  2RHK A;  5AFU H;  3G10 A;  1R59 O;  1OH8 A;  3QNN A;  5HRS A;  1RBV A;  4CGJ A;  2XY5 A;  3U9D A;  4B1Y B;  1TKT A;  1GLF O;  3MMV A;  3K59 A;  4DUY K;  4N56 A;  1NJZ A;  1XC3 A;  3WNF A;  4DV7 K;  2QWQ A;  4YDU A;  4CHP A;  1B92 A;  3SK3 A;  4U7B A;  2ZJQ L;  4DMN A;  1SKR A;  1EKE A;  1KXP A;  4NYN A;  3CXC M;  2ZJR L;  1VQN N;  4ELT A;  4JI0 K;  1S5J A;  4M3T A;  5M1K A;  1NK0 A;  5E41 A;  4LF5 K;  1WN7 A;  4IO8 A;  1XMO K;  3OBW A;  3FFK B;  3AA4 A;  4O8K A;  1WBB A;  2W6L A;  4BRN A;  3CQ8 A;  3NGI A;  1QSL A;  3RSE A;  4DSL A;  1X9S A;  3E66 A;  4CHN A;  3AO4 A;  1HPM A;  4BRM A;  3H1Q A;  2VWK A;  3HRG A;  4CBU A;  3PO5 A;  1EET A;  4FJX A;  4JI7 K;  1HNI A;  3PIP L;  1VRU A;  1QVF M;  4JHD A;  5EY4 A;  1X1P A;  5KRT A;  3SPZ A;  3QLH A;  2WUS A;  3I8D A;  4DG1 A;  3V1Q A;  2GEL A;  3ZYY X;  3CCL N;  4RW6 A;  4CGG A;  4KHW A;  3ISN C;  2O8B B;  3LZJ A;  3SUQ A;  1Q82 O;  3WXM B;  1TYQ B;  3O1W A;  3UE5 A;  4H0T B;  3EKU A;  5M1F A;  4UQG A;  3S9H A;  3V1R A;  3T7Z A;  3EE9 A;  1RT3 A;  1N32 K;  5BRF A;  3AVM A;  4JKG A;  3U6F A;  3NCI A;  2HF4 A;  2NZT A;  3DI6 A;  4C8L A;  4LH4 A;  4B9T A;  3RVC A;  2BTF A;  2AA4 A;  4A62 A;  3PIO L;  4C8K A;  4BE1 A;  4R5P A;  1KTQ A;  1Q18 A;  4DKW A;  4DV3 K;  3DOK A;  1IH7 A;  4DTR A;  1NGB A;  4JI5 K;  1A5W A;  3K5O A;  4U67 L;  3AO1 A;  4NCG A;  4PL8 A;  2RE2 A;  3WNG A;  3HVR A;  3R8E A;  4H5T A;  1YIT N;  3QNO A;  3WQU A;  2P51 A;  2FSN A;  4E89 A;  1GLD G;  2GWJ A;  1ILY A;  2VG7 A;  4WYB A;  1S1U A;  1K8A O;  3E9O A;  3QEI A;  4KHP K;  3SNN A;  2ZWH A;  2QK9 A;  3CQY A;  3DM2 A;  4GMJ B;  5J2P A;  4B1Z A;  1U6Z A;  2Q0U A;  3VOV A;  4ZTF A;  2HVI A;  4DLE A;  1VQ8 N;  1VSL A;  5JMV A;  1HPZ A;  4KB1 A;  5LL6 Z;  4C8O A;  3AO3 A;  3U4L A;  2X6S A;  2FBT A;  3J81 O;  4WE1 A;  1YVN A;  3HPH A;  1QTM A;  4FPA A;  4FJL A;  2Q0R A;  2O8C A;  2A40 A;  1HJR A;  1BO5 O;  1XNQ K;  1EXQ A;  3QIC A;  1BA1 A;  4M3W A;  4CJ7 A;  1T03 A;  1RIL A;  3MX2 A;  4CF2 A;  4YHH K;  4OLB A;  3OYL A;  4AF1 A;  3DLG A;  2J4R A;  5AQV A;  4CEZ A;  4QS8 A;  5AQT A;  4B3M K;  1S9G A;  4PKG A;  1YJ9 N;  2IIR A;  3O9U A;  4IFY A;  3LP2 A;  1IG9 A;  3G71 N;  4CJK A;  4CZI A;  4CI6 A;  4GVM A;  1WNS A;  2FC0 A;  3MWT A;  5I3U A;  4DQQ A;  4KI4 A;  3B6O A;  3VF4 A;  4WCE L;  2D5R A;  1CXU A;  5FPM A;  3OHR A;  3OYK A;  4X65 K;  3SQ4 A;  3V9X A;  1C0M A;  5AR0 A;  3M1F A;  2QM1 A;  4CJL A;  4AQY K;  1Q81 O;  4E7K A;  3CYM A;  1Z25 A;  2V7Y A;  3C7N B;  4FJI A;  3MCP A;  3TPQ A;  2YKM A;  4DQR A;  1IBL K;  1J9A A;  3CCS N;  3BDP A;  4KRF A;  2Z1J A;  4BC4 A;  5AQP A;  3VEY A;  4HCB A;  3L0Q A;  4W5T A;  3HBT A;  2OA8 A;  3KK1 A;  4EHU A;  2QI2 A;  3KWI A;  1WSH A;  3J7A P;  2QKK A;  4BRF A;  2QA4 N;  4JS4 A;  4BQL A;  4MDA A;  3HP6 A;  4DSJ A;  4FZZ A;  5CE3 A;  5BPL A;  5BRE A;  4FLV A;  4QOZ B;  3AVC A;  3HO1 A;  3L6Q A;  4CIG A;  1U49 A;  5GAG P;  1QVG M;  5AQK A;  4ID5 A;  3KLF A;  3LAK A;  3ZEU B;  2OCE A;  1EP4 A;  3V4I A;  1QS4 A;  3DMJ A;  4CZJ A;  3JAM O;  3OJU A;  1EQY A;  3RRG A;  3G4S N;  2W6K A;  3VQQ A;  4FK0 A;  4ID1 A;  1NGE A;  4FCY A;  3AVN A;  1Q8I A;  1CZB A;  1IKY A;  1HQU A;  1ZXO A;  4H5R A;  1C1B A;  5AZJ B;  4PL7 A;  4FO0 A;  5FRN A;  4DV2 K;  4KAZ A;  5E26 A;  4AHU A;  3ZX3 A;  3SZ2 A;  4IBN A;  1X9J A;  4FVM A;  2PY5 A;  3S3O A;  3SCX A;  4XIU A;  4AHV A;  3G0Z A;  4KFB A;  3WXI A;  1RT1 A;  4F3O A;  1IBK K;  3D2E B;  2A42 A;  1HJO A;  3AAP A;  1RDA A;  4FWO A;  4O0J A;  2EHG A;  5KGX A;  5EX5 A;  3CCE N;  5DMR A;  4FJK A;  1MA9 B;  3CMA N;  4JNE A;  4JN4 A;  2FXU A;  4NYF A;  3LPT A;  4EHT A;  4CHY A;  3QBW A;  4YOT A;  2I5J A;  4M7X A;  1WOQ A;  3WT0 A;  3C94 A;  2PBD A;  2HBM A;  1CZ9 A;  2IC3 A;  4ILH A;  3GDQ A;  4O5B A;  4OPH A;  2P9N B;  1VK0 A;  5AQO A;  4JAX A;  3AGR A;  4N5S A;  5FRM A;  3C65 A;  2O8D A;  4LY7 A;  3FZK A;  3L4I A;  3LP0 A;  2IVP A;  4WFN L;  4HTU A;  4LFB K;  4ICL A;  2JWK A;  5C24 A;  3C0B A;  1S22 A;  4CZL A;  1HKB A;  4IWV A;  3DLL L;  4R79 A;  5EVZ A;  4E1J A;  1U4B A;  3DLE A;  2HND A;  3QIO A;  4O55 A;  1BQM A;  4KTW A;  1JLE A;  1JXE A;  3AO2 A;  4OLA A;  4C8N A;  3VQ6 A;  3HJF A;  4WQ5 A;  4DV0 K;  4F9O A;  3SAG A;  2ZJP L;  5FPE A;  5BRD A;  2WFB A;  3ZSO A;  5CR4 A;  1U48 A;  4LF6 K;  4DTN A;  1RCH A;  3BZK A;  1BIZ A;  3K9K A;  4JK9 A;  3AVA A;  3BP8 A;  3P5J A;  4FW1 A;  5A2Q O;  3CHW A;  1KAZ A;  4H4M A;  3NF6 A;  5J1E A;  1FW6 A;  1WAJ A;  4KHU A;  1JLB A;  1V4S A;  3A5M C;  1KSP A;  3RSE B;  3SMP A;  2HMI A;  4CEF A;  3AAR A;  4E19 A;  4OGE A;  1L3T A;  1X9M A;  2UUB K;  2HVH A;  4FK2 A;  1RBT A;  2ETJ A;  4ELV A;  4E3S A;  3WEE A;  3L2R A;  1ZBF A;  4FSV A;  1VQ9 N;  3AVJ A;  2D0B A;  4JHD B;  2P9U A;  3EL2 A;  4J8F A;  2F8S A;  1ZBI A;  5CY4 A;  5AQS A;  2GUI A;  3I0S A;  4HWI A;  4BRQ A;  1KD1 O;  4JI1 K;  3V9W A;  1JLA A;  3UIQ A;  2XO7 A;  4FJN A;  4CZK A;  2G8I A;  5BR8 K;  2CGL A;  4FM0 A;  3HST B;  3NVM A;  3RR8 A;  1TVR A;  4KV8 A;  5CYQ A;  4A2B A;  3QES A;  3CD6 N;  5HOO A;  4B3T K;  1TL3 A;  1W9H A;  4E7L A;  3VQ8 A;  2W41 A;  4O5F A;  3SQ0 A;  4FM1 A;  2QXF A;  1SL0 A;  2KKZ A;  1XWL A;  4X64 K;  1EX4 A;  4IO9 L;  4B9U A;  2AJQ A;  4H4O A;  1BI4 A;  1NG9 A;  1RGI A;  3F9M A;  1J5O A;  3SUO A;  5T7B A;  3SMS A;  5GAD P;  4DSI A;  3CCJ N;  1YUW A;  1LW2 A;  4BWM A;  1JXB A;  2E1Y A;  4RW8 A;  1RT5 A;  2RF2 A;  5M1O A;  5BPN A;  2FBY A;  2NUB A;  5C0Y A;  1FXX A;  1RDC A;  4CW7 B;  2PFU A;  5AZI A;  3THX A;  1NOZ A;  3ALY A;  2OZM A;  4XH1 A;  4WF9 L;  2WC9 A;  2VYP A;  4FJ8 A;  4EZ9 A;  4BRA A;  4KB0 A;  3SBT A;  2VCP A;  2JLE A;  3IAY A;  3TTC A;  3K58 A;  2D0C A;  5JVG L;  2ZM6 K;  1NWK A;  3QEV A;  4UY8 O;  5SWM A;  4KHN A;  4DFK A;  1IKX A;  3H6E A;  3TSU A;  1SKW A;  2KZZ A;  5J2M A;  4DTX A;  3D6R A;  5HRR A;  1NK9 A;  1NMD A;  1ZBS A;  5CZ2 A;  3JS6 A;  2O8F A;  3SYZ A;  2O8C B;  3HP9 A;  4DFP A;  5LJW A;  4CEO A;  3O9T A;  3KK3 A;  4DR5 K;  3CME N;  3J7Z O;  4M3Z A;  4JI6 K;  1I3A A;  3NFA A;  2LSN A;  1DLO A;  1XNR K;  3ZSV A;  4CZF A;  1N6Q A;  4DR7 K;  2P1J A;  3OYH A;  5JLF A;  5HRO A;  3EN9 A;  3M8Q A;  4DTO A;  1NMN A;  3VN5 A;  2P9K A;  4FLW A;  3G25 A;  1DTQ A;  2KQ2 A;  4CJE A;  1U04 A;  5LJV A;  5EU7 A;  3VEO A;  4AHT A;  4WQ4 A;  1N5Y A;  5KI6 A;  3HOS A;  1MWM A;  1T6D A;  2CGJ A;  4RW7 A;  3B6P A;  5BR9 A;  3CFP A;  4NCA A;  1L3V A;  3R9P A;  3H46 O;  1WB9 A;  4NLB A;  4IOX A;  2OPR A;  4CEB A;  2OYQ A;  2F96 A;  1NK4 A;  4QAG A;  5AQN A;  1SL2 A;  1B9D A;  4RG8 A;  4BG8 A;  1MU2 A;  4BQZ A;  3R3L A;  1HYS A;  3OYF A;  3JSM A;  1YIJ N;  1T05 A;  1VQK N;  3D7E O;  5AQR A;  3HT3 A;  5LMN K;  2YNF A;  3TTF A;  2UXC K;  3D0P A;  2HHU A;  1J5E K;  4A57 A;  3K57 A;  2YHY A;  4C8M A;  3P83 D;  4CGD A;  2GBZ A;  3LM9 A;  3ENB A;  1ATN A;  3DXK A;  4ILG B;  4DU3 A;  1HKG A;  4I2P A;  1XC9 A;  5F2R A;  2X6N A;  2QWM A;  4CCH A;  3VET A;  4CES A;  3IMX A;  2VG6 A;  4EP5 A;  2CH5 A;  1D5A A;  4DQI A;  1OH5 A;  4CHO A;  4BE2 A;  4H0V B;  1QQN A;  4CK1 A;  3O3G A;  3WXJ A;  1BU6 O;  2Y1I A;  3WXL A;  2KZM A;  3J7Y P;  4FPB A;  4OPJ A;  1HX1 A;  1H1V A;  2YNH A;  4I7F A;  4Y1D A;  4YOU A;  3CCM N;  3O80 A;  5JS2 A;  2B6A A;  4FM2 A;  2A1R A;  2A1S A;  5C2F A;  1TUY A;  5AQZ A;  2E2Q A;  4B1V A;  4GV6 A;  2DTU A;  3O9S A;  1RDU A;  2QXL A;  4A59 A;  4PA1 A;  5HBM A;  3C6A A;  4FWM A;  5F1X A;  3PO4 A;  4Z4E A;  1MWK A;  3DYA A;  2ZF5 O;  5CZ1 A;  3A0I X;  4CK3 A;  1ZYQ A;  1RBU A;  3UKU A;  4C23 A;  3CJB A;  2YJF A;  4JKD A;  4CJW A;  2NRV A;  4JLH A;  4JRP A;  4C1N I;  4W5Q A;  3IDH A;  2GUP A;  1L3U A;  2OAN A;  4DS4 A;  2AP1 A;  2GX9 A;  2HMP A;  4BRH A;  4NXN K;  3L4Q A;  3LWM A;  1IJJ A;  3U3Y A;  2XY6 A;  3QFP A;  3BF1 A;  5M1P A;  1X9W A;  1VSM A;  3NDK A;  3VF6 A;  2D0A A;  4E1M A;  4WFB L;  3LDO A;  1VQ5 N;  4H0P A;  4A61 A;  5FLX O;  2RPI A;  3O3F A;  4HTL A;  3QIP A;  4IOC L;  3P31 A;  3TU5 A;  4NXM K;  3CC7 N;  3O1B A;  2R7Y A;  3TR8 A;  3JYT A;  3MK6 A;  4BGB A;  4DSK A;  1RTH A;  3MX5 A;  4Z4F A;  5JLH A;  3OYC A;  3C6T A;  4IEI A;  1YJW N;  2O8D B;  3VF2 A;  3DLH A;  3VGK A;  1TUU A;  2UUA K;  4YY3 K;  2P5O A;  3P4I A;  4Z4C A;  1DGK N;  1IBM K;  2E1Z A;  2QWL A;  3A8Y A;  3ATV A;  2GWK A;  4F2R A;  3WUH A;  2HOE A;  1EO1 A;  3P39 A;  1SV5 A;  3KZB A;  4Z4I A;  3CF5 L;  2NRT A;  4H0X B;  1UWB A;  4FJJ A;  1T8E A;  3PX4 A;  4DTU A;  3QEW A;  3C6U A;  1GLE G;  2XHB A;  1JLG A;  1QZ5 A;  4RTF D;  4DFJ A;  2OPP A;  1Q9Y A;  4F8R A;  3O5B A;  5GIO A;  1QE1 A;  4DS5 A;  2FSK A;  3VA0 A;  1JCE A;  4E7J A;  4DB3 A;  3VQB A;  1BDG A;  3V9Z A;  2EX3 A;  3WEE B;  4OKE A;  1GLB G;  1NJW A;  1Z05 A;  3VQC A;  3TI0 A;  5LY3 A;  3EZ5 A;  3QET A;  3ZSZ A;  4KRE A;  1T3V A;  1C0F A;  1SAZ A;  1MDU B;  4K41 A;  1X3M A;  4CFD A;  3MWP A;  3KLE A;  3M6G A;  3O08 A;  5KQ8 A;  4HVJ A;  4XEI A;  3VPZ A;  1EWR A;  4J2E A;  4JKC A;  2P9S A;  5HL7 L;  4FLY A;  2XRI A;  3SPY A;  1FKP A;  4KTZ A;  4JKE A;  4B9V A;  4IEE A;  4KPY A;  2IVN A;  3E1Y A;  4JS5 A;  1L3S A;  1RTJ A;  3QML A;  2PYL A;  4AM7 A;  4FJM A;  1BI4 B;  5IT9 O;  4KHS A;  4G9Z A;  3GE1 A;  3N4P A;  2B5J A;  2Q1N A;  5C12 A;  3C95 A;  3T3F A;  3I56 N;  5JVH L;  1LWE A;  1T6C A;  2BGG A;  1NGJ A;  1SUQ A;  3CPW M;  4N41 A;  1NK7 A;  1XQS C;  3MDQ A;  3ID8 A;  1KRP A;  3ULD A;  4W5R A;  4CGI A;  4CEA A;  4QCL A;  2HBL A;  3F73 A;  3THX B;  3R6M A;  3OS2 A;  3LDP A;  4V19 S;  4IKF A;  1QSY A;  4CIF A;  5BN8 A;  1VRT A;  2VWB A;  4KH4 A;  4DU4 A;  1D9D A;  1YAG A;  4DR2 K;  3IKM A;  4QS9 A;  4ISF A;  2Z1I A;  4EIA A;  4LF9 K;  4KH6 A;  1S72 N;  5TKY A;  3HSC A;  3CET A;  5FRO A;  3ITH A;  4IFV A;  2ZGZ A;  3NAE A;  4Z4H A;  4B3O A;  4CER A;  3SV4 A;  1HNV A;  3ULE B;  3NF9 A;  1RDD A;  2ASP A;  4CD1 A;  3SV3 A;  1YT3 A;  2O8F B;  4EP4 A;  2Q31 A;  2G8F A;  3K9J A;  3PY8 A;  3W3D A;  3KKR A;  1K6Y A;  2P9I A;  4KH5 A;  1KVC A;  3VEZ A;  4DLG A;  1NKC A;  1IV0 A;  3FZL A;  4BR2 A;  4CJV A;  4BAC A;  1NM1 A;  2GV9 A;  1NJY A;  3AGK A;  1HYV A;  2FSJ A;  2NRX A;  1Q9X A;  2HNY A;  2IVO A;  3SI6 A;  2P9K B;  1RT4 A;  4CFA A;  4IXC A;  3TAF A;  4K43 A;  4JRQ A;  4K0K K;  2CGK A;  2D4W A;  4A2A A;  3K2P A;  3O9R A;  3FFI A;  2P9L A;  4CJP A;  4JD2 A;  2WBN A;  1RDB A;  4CEC A;  3OYN A;  4H5W A;  3ZET A;  3HTV A;  4DV5 K;  1NKB A;  4CE9 A;  5HRP A;  4ZTJ A;  3L2V A;  1ZC6 A;  3IG1 A;  4BDZ A;  1XMQ K;  3LAN A;  5C10 A;  3WXK A;  4I6M B;  2NLX A;  1A5X A;  4JI2 K;  3RMC A;  1BG3 A;  3KWG A;  3KJV A;  1ZBH A;  1BHL A;  4M3U A;  3KKS A;  4XH5 A;  4GW6 A;  5HRN A;  2H3G X;  3W0L A;  1L5U A;  1VQ7 N;  4AHS A;  3LM2 A;  3NMU A;  3O4W A;  4CJT A;  3D2F A;  5ELZ A;  5FDL A;  5SZT A;  3ZLJ A;  4MLH A;  4JKH A;  4FJG A;  1DTT A;  3VEN A;  1LAW A;  3QIN A;  2KTQ A;  3GBT A;  1ZBL A;  3UKR B;  4FLT A;  5AQQ A;  2UXD K;  5J2Q A;  5ADX A;  5JS1 A;  4QS7 A;  5GAH P;  4DV4 K;  4EZ6 A;  3PX6 A;  3HPG A;  1Z26 A;  2HW3 A;  1HQE A;  4FL9 A;  2HB5 A;  3BY5 A;  3H45 C;  1Y97 A;  1LAV A;  4H0Y B;  4PWD A;  5AQF A;  3U9Z A;  4Y0W A;  1KVA A;  3AVK A;  3ZSX A;  2ZE2 A;  5LMU K;  1UOC A;  4YOY A;  2ZQB A;  1BUP A;  4CF8 A;  5DM7 L;  1KAY A;  4A5A A;  2E2N A;  5AQI A;  5KPR A;  3THY A;  3KVG A;  3UKU B;  4W5N A;  4FJ9 A;  2HHT A;  2YCH A;  5EXW A;  5I9E B;  3CCV N;  3KK7 A;  3LDL A;  3IRX A;  2E2O A;  3EY1 A;  1JL2 A;  3C6H A;  1A5V A;  2VWJ A;  1YJN N;  2W42 A;  2DPN A;  3E9L A;  3VEV A;  1QHT A;  3U3G A;  5M1N A;  1C1A A;  3DWL A;  1KC8 O;  4BVO A;  3CC4 N;  2A3Z A;  2FF6 A;  4FYD A;  4BG9 A;  5AQL A;  4CBW A;  5GIN A;  4B9N A;  4CF1 A;  1M90 O;  1NJX A;  2E6M A;  1S3X A;  1WAF A;  3AVB A;  3VQD A;  1KVB A;  3DRS A;  4ISG A;  2E5L K;  3KLH A;  1OKJ A;  3V81 A;  3VQA A;  1XHX A;  3VES A;  4DTP A;  1NGC A;  4FWK A;  2YI1 A;  3K5N A;  1BA0 A;  2F4V K;  3TAB A;  1XHZ A;  5ADX H;  2VQE K;  5H1S Q;  5C15 A;  1LOT B;  4AIL C;  3RMB A;  1JKH A;  3MEC A;  4JKG B;  5HLF A;  1TK8 A;  2HBK A;  4O0I A;  4OPA A;  4K8X A;  1ZBU A;  4FOI A;  1HR0 K;  3AVI A;  3ZT0 A;  3VA3 A;  3OBY A;  1KLN A;  3MN5 A;  5BRH A;  3M5R A;  4DQS A;  3PX0 A;  4CJF A;  3ZX2 A;  1WSE A;  1GOA A;  5C2D A;  2NRH A;  3K5L A;  3FLC O;  4L3Q A;  3D45 A;  4BVP A;  3SQ1 A;  3F5T A;  4FLU A;  3CER A;  4B8A B;  3ZCM A;  4OKK A;  3SBG A;  4LH5 A;  2E2P A;  2Z1G A;  4PY5 A;  3NHG A;  3CJC A;  3O9Q A;  4IDH A;  4M42 A;  1B9F A;  3NGZ A;  3EKS A;  3SQ2 A;  4RCH A;  3O6W A;  3NH0 A;  1EWQ A;  3CFO A;  4B1X B;  3MEG A;  3LDS A;  4BRC A;  4OKJ A;  3I33 A;  3OA9 A;  3L2W A;  3LP1 A;  4IG3 A;  3AVL A;  4FWL A;  4JKB A;  1SL1 A;  1HRH A;  4B9M A;  4CHQ A;  3CCQ N;  3THV A;  2P9S B;  4BC2 A;  4Q0B A;  4Q5V A;  2YHX A;  3C7N A;  1UAX A;  4H8K A;  3TAE A;  1WBD A;  4HUE A;  2QWN A;  1N33 K;  5C25 A;  1JLQ A;  3LWL A;  4AH9 A;  3ENH A;  1BGX T;  2V51 B;  4DFM A;  4OX9 K;  3RR7 A;  4FXD A;  5TKW A;  1N8R O;  3CCU N;  3P1G A;  2D0P A;  2D0O A;  4KHY A;  4J2A A;  4YOV A;  3E01 A;  1J53 A;  4FJ5 A;  4CZH A;  4DCH A;  1KFS A;  4AM6 A;  3OYD A;  2P5G A;  4M3X A;  1CZA N;  3AA3 A;  4LSL A;  1ATS A;  4CEE A;  4E1N A;  1NGI A;  4OVL A;  3ZEU A;  1HYZ A;  3VTH A;  1HKC A;  1BL3 A;  4BR7 A;  4OPK A;  5KRS A;  2QEX N;  2QWO A;  4N47 A;  4DSF A;  2A41 A;  4NLC A;  2OZS A;  3KLG A;  1C1C A;  4FWS A;  4WFA L;  4FVU A;  2YNI A;  1YVU A;  1REV A;  2I7N A;  2G8V A;  1HLU A;  3EZW A;  1RFQ A;  3RWU A;  2ITM A;  3EO3 A;  1SZ2 A;  3LDQ A;  1S1T A;  3MXM A;  4LFA K;  4LSN A;  4BRP A;  3VQE A;  1LCU A;  2P9I B;  4CK2 A;  3TAP A;  2ZD1 A;  1JCG A;  4GKK K;  1NU0 A;  2O8E A;  4KO0 A;  3TSQ A;  1C0T A;  1JL1 A;  1TV6 A;  3D2E A;  2IOC A;  3CIP A;  1BQN A;  2WOM A;  1NBW A;  1U2V A;  1K8K A;  2WTU A;  1NLV A;  4FJ7 A;  5F0X A;  4DF8 A;  3J80 O;  3VEW A;  2VGN A;  4BRD A;  1KCF A;  2E6L A;  5AQJ A;  4B9S A;  1WUA A;  4BWJ A;  1CXQ A;  2P9L B;  3DXM A;  3NH2 A;  1NK5 A;  3ZSR A;  3BEX A;  3PUF A;  4IZ9 A;  1U45 A;  3O8M A;  1V4T A;  3BZC A;  3TAR A;  5JIC A;  3L2Q A;  1JLC A;  2Q3S A;  3ZET B;  1K73 O;  2P9N A;  3FE1 A;  3G6E N;  4K8Z A;  3CC2 N;  1N36 K;  4DUZ K;  4A5B A;  4E7H A;  1C0G A;  2BDP A;  1VSI A;  3UB5 A;  3HI0 A;  1YF5 L;  4MLE A;  3ZX0 A;  4RW4 A;  4BDP A;  2KFN A;  3HOT A;  4BRL A;  2DFF A;  2FLO A;  4HUF A;  4C1N K;  4DQP A;  4WQ4 C;  4DV1 K;  3BUZ B;  3FZM A;  1WSJ A;  4NB4 A;  2QKB A;  1ASV A;  4CZG A;  1D9F A;  3M3Z A;  4F2S A;  2HHQ A;  1T7P A;  2UUC K;  3N4Q A;  3HPO A;  3D2F B;  4GV9 A;  2BUP A;  3DLB A;  2G8W A;  2VGM A;  3EE8 A;  4YOR A;  1HNZ K;  1DT9 A;  1SQK A;  3OYB A;  3CJ7 A;  4DHY A;  4W5O A;  3AVG A;  2P9P A;  1GLC G;  4IDK A;  4BGA A;  1D4X A;  5DK5 A;  3OYE A;  1NNE A;  5D3G A;  4DWI A;  2F8T A;  4NO7 A;  3OYG A;  4K25 A;  4LF7 K;  5FPN A;  3S41 A;  5M1Q A;  4DR1 K;  1VSF A;  3H3O B;  1C6V A;  1KLM A;  3MCA B;  3AV9 A;  4GVE A;  4FOE A;  1ASU A;  3QDK A;  3IFR A;  2O4I A;  2HHW A;  3THY B;  3OYM A;  1E4F T;  3U8X A;  1VSH A;  2V7Z A;  4CVN E;  5IWA K;  5I42 A;  4H03 B;  5AQG A;  2F9W A;  4BDY A;  1WLJ A;  3VQP A;  2OTJ N;  4JKA A;  3TAN A;  3SJJ A;  4H5V A;  3HZ6 A;  1GLJ O;  3PSI A;  3T1A A;  2Q36 A;  4LC9 B;  2VQF K;  4M7Y A;  3AVF A;  1OH6 A;  3HYF A;  4Y1C A;  3DJC A;  4YDU C;  3QFU A;  1QZ6 A;  1OVQ A;  2ITG A;  4GNI A;  4GKJ K;  1XUP O;  4EAH D;  4M63 C;  3RRH A;  3ATU A;  4E0D A;  2BAN A;  4JKF A;  3BGR A;  4CJS A;  1S1V A;  1S1X A;  2P9U B;  3T69 A;  4DV6 K;  3NF8 A;  3ZSW A;  4I9Q A;  2YV0 X;  4KTQ A;  4K42 A;  3H08 A;  5BPM A;  3T1Y K;  4FZY A;  4LF8 K;  4F3T A;  2ATQ A;  4PUO A;  4BRE A;  4ISE A;  5EOY A;  1NGA A;  2A6A A;  4O44 A;  2Q97 A;  3ASM A;  4HHT A;  4MFB A;  1W0H A;  1I39 A;  3FZF A;  2G8U A;  1S9E A;  4BRI A;  2V52 B;  3VGM A;  3NF7 A;  3P38 A;  4DR3 K;  1XI1 A;  4B9Q A;  1BOT O;  3AVH A;  1W2B M;  1O13 A;  1WSG A;  4CJR A;  1ATR A;  3JXU A;  2KHO A;  4YOW A;  3MN6 A;  2HST A;  4X66 K;  3DLK A;  4IJN A;  3CQX A;  3THW A;  4FWR A;  4B1U B;  2VG5 A;  1YTA A;  3A5O C;  1VQO N;  2ASM A;  4E7I A;  2XY7 A;  2X78 A;  2YNG A;  2YHA A;  1JJ2 M;  3ID6 A;  3Q7B A;  3LZI A;  4F4K A;  1TK5 A;  5AZI B;  4BR9 A;  3MED A;  1LV5 A;  4I2Q A;  4BC5 A;  1RTD A;  1SKS A;  1IO2 A;  2OTL N;  1VQ4 N;  4NCB A;  3KK2 A;  3L2U A;  1CLQ A;  2XY8 A;  1UA1 A;  3AY9 A;  3E9P A;  2B4J A;  2E20 A;  1OVY A;  3QER A;  3ZSQ A;  4M3R A;  4M45 A;  2NRR A;  3SUP A;  3RMD A;  2FF3 B;  3I8B A;  3NBP A;  4JEP A;  5E84 A;  4JI4 K;  5DM6 L;  5AJ3 K;  3A2F A;  1IG8 A;  3K5M A;  4B3S K;  2E4L A;  1HNX K;  3ENO A;  1KAX A;  2EWS A;  2QTD A;  3WQT A;  2IDO A;  2UXB K;  1NK6 A;  2QWR A;  5KTQ A;  3VEX A;  3SLC A;  3TTD A;  5AQU A;  3EYZ A;  3KD5 E;  4PQU A;  1QHA A;  3KTQ A;  3AA5 X;  4JK7 A;  3ZT2 A;  3I55 N;  1ASW A;  3CPE A;  1M1K O;  4FWN A;  2IAJ A;  1BCO A;  4B8C A;  2YHW A;  5K14 A;  2Q2R A;  4RWT A;  3RMA A;  1VSE A;  4LD0 A;  1WSI A;  1LW0 A;  1VAZ A;  4FWQ A;  1GOC A;  1NJI O;  3VTI A;  1JLF A;  1VSJ A;  1X3N A;  1VSK A;  2D1K A;  3FR0 A;  4H5N A;  4AHC A;  4FJH A;  4CJQ A;  1VHX A;  3AAQ A;  4DTM A;  2RN2 A;  1NGD A;  2QW9 A;  3L3V A;  4BR5 A;  3T1H K;  1HUX A;  1N34 K;  5KPZ A;  3TWH A;  3NGY A;  3HL8 A;  3MEE A;  3VQ9 A;  3L3U A;  2JGU A;  2X74 A;  1S6Q A;  1WSF A;  2CH6 A;  3NE6 A;  5AQM A;  3LL3 A;  4FLZ A;  1C0U A;  1Q86 O;  2ZGY A;  4CEQ A;  4CJ4 A;  1RT2 A;  1RDW X;  3R1X A;  4B9L A;  3LPU A;  3IS9 A;  3OYJ A;  1Q7Y O;  4FWP A;  1LWF A;  3CM5 A;  1YTU A;  3DXK B;  3OY9 A;  3NH1 A;  4CGH A;  5GAE P;  2FBX A;  1ESV A;  4LF4 K;  2O8E B;  4CF9 A;  1NK8 A;  3H1V X;  1E3M A;  4MO4 A;  1U2V B;  5MLC Q;  1K8K B;  2GTD A;  4KBO A;  3A5N C;  4OGC A;  3QEP A;  2HHH K;  3CI5 A;  2G8H A;  3LDN A;  1TAQ A;  4HCC A;  3V9S A;  4B08 A;  4L8R B;  3ZSY A;  1IKW A;  3SAF A;  3ZT3 A;  3DXM B;  1D8Y A;  3F9K A;  3CJ9 A;  3Q7C A;  4BC3 A;  4FW2 A;  3O4Q A;  1JCF A;  3KIO A;  3QO9 A;  1GOB A;  4O4G A;  4B3R K;  5FPD A;  2DY4 A;  3OYA A;  2RKI A;  5AQX A;  1YI2 N;  4PHT X;  2O8B A;  2NRZ A;  3V1O A;  1DKG D;  1TYQ A;  2OPS A;  4KKO A;  5C42 A;  3QEX A;  2HHV A;  1FKO A;  3CCR N;  3BF3 A;  3OVN A;  4PKI A;  4DSE A;  3TAQ A;  4CGF A;  5KQD A;  4ZHR A;  4OO1 J;  4YOX A;  1W97 L;  4G1Q A;  4JI8 K;  3GL1 A;  2IS3 A;  3H3N O;  2GEM A;  1RBS A;  2YHB A;  3O4N A;  2OPQ A;  2DFE A;  3A5L C;  4FZX C;  3OTO K;  1W7A A;  4J2D A;  3CM6 A;  4BR4 A;  4DTJ A;  1VQM N;  3OW2 M;  1HNW K;  4DU1 A;  2P9P B;  4MQ3 A;  4B1W B;  1YXQ A;  5AQW A;  3MXI A;  1IKV A;  1BWF O;  5CHI A;  1TKZ A;  4CHZ A;  1KFD A;  3I0R A;  4FLX A;  1BIS A;  1OH7 A;  3L8B A;  3S3N A;  3S3M A;  4JV5 K;  5HP1 A;  3OJS A;  1VQ6 N;  1RTI A;  3ZT1 A;  3K0S A;  4AHR A;  3HM9 A;  3CG7 A;  3DLR A;  4RW9 A;  2HHS A;  2W40 A;  3KHY A;  3M8S A;  3MN7 A;  4DTS A;  4IG0 A;  4JYA K;  1TKD A;  1ITG A;  4GY2 B;  1I94 K;  2E88 A;  1GLL O;  3HVT A;  1G99 A;  5AQH A;  1RT6 A;  1J54 A;  4JI3 K;  3LAL A;  4IJA A;  1J6Z A;  3AA2 A;  3FGU A;  2FBV A;  3HK2 A;  5CYM A;  1VSD A;  1Z6R A;  1QQO A;  2PAV A;  4WQ5 C;  1FK9 A;  2F9T A;  3DRR A;  5KPT A;  1F21 A;  1S6P A;  4BRK A;  4MDB A;  3RTV A;  1QQM A;  4CZE A;  1YHQ N;  3O3H A;  3M8P A;  4KI6 A;  2A5X A;  4BR0 A;  2UU9 K;  4ILJ A;  4CED A;  4JK8 A;  1R0A A;  3SJH A;  2I7P A;  4MO5 A;  3CFR A;  1BCM A;  3CJ1 A;  4X62 K;  3GG4 A;  4FK4 A;  1KQS M;  5BN9 A;  5AQY A;  3KLI A;  2Y1J A;  2JWL A;  4BRO A;  1SS6 A;  2BE2 A;  4DF4 A;  4KHQ A;  3CJA A;  4M41 A;  3VQ7 A;  1P90 A;  5J2N A;  4DR4 K;  2YX6 A;  4IFE A;  3DRP A;  1TK0 A;  2HNZ A;  1GLA G;  3TAG A;  3KD1 E;  4BRG A;  1QSS A;  1BIU A;  3ULE A;  3QB0 A;  1NKE A;  3VQ5 A;  3OS1 A;  1NGH A;  2Z1H A;  4EFH A;  4H0O A;  3MN9 A;  3LAM A;  3THW B;  1VQL N;  5AFU A;  3QBX A;  4DR6 K;  4J2B A;  3HXM A;  2QWP A;  4IOA L;  4CJU A;  1RT7 A;  2KW4 A;  4Z94 A;  3M8R A;  4LFC K;  2UYT A;  2YKN A; 
#chains in the Genus database with same CATH homology
 4ELU A;  4H4M A;  3NF6 A;  3NF9 A;  1RDD A;  3SV3 A;  5J1E A;  1YT3 A;  4EP4 A;  1WAJ A;  1ASU A;  2G8F A;  1JLB A;  3PY8 A;  4KHU A;  1KSP A;  3KKR A;  2O4I A;  1K6Y A;  1TKX A;  3WNE A;  4CEF A;  3OYM A;  1U47 A;  2HMI A;  2HHW A;  4E19 A;  4OGE A;  3SUN A;  1L3T A;  1VSH A;  4CIE A;  3OS0 A;  1KVC A;  1X9M A;  4Z4G A;  2HVH A;  4DLG A;  1NKC A;  4FK2 A;  1UA0 A;  1RBR A;  1RBT A;  2ETJ A;  4ELV A;  5I42 A;  4BDY A;  4E3S A;  3L2R A;  1WLJ A;  3LP3 A;  3VQP A;  4CJ3 A;  1ZBF A;  4CJV A;  3TAN A;  3AVJ A;  1TGO A;  4BAC A;  3SJJ A;  2D0B A;  1HMV A;  2GV9 A;  1G15 A;  1NJY A;  2PZS A;  3V9U A;  1HYV A;  4N76 A;  1ZBI A;  2F8S A;  5CY4 A;  2HNY A;  3T1A A;  2GUI A;  3SI6 A;  3I0S A;  1Q9X A;  4M3Y A;  2G8K A;  1RT4 A;  4CFA A;  4CFC A;  3V9W A;  1JLA A;  3TAF A;  3AVF A;  3UIQ A;  3HYF A;  3TAM A;  4Y1C A;  4JRQ A;  3DOL A;  3ZT4 A;  3PV8 A;  2XO7 A;  1S1W A;  1TL1 A;  4FJN A;  3WNH A;  3K2P A;  2G8I A;  4CJ5 A;  4YFU A;  2ITG A;  4FM0 A;  3FFI A;  3HST B;  2IGI A;  1NOY A;  3RR8 A;  1TVR A;  1O1W A;  1RNH A;  4CJP A;  4KV8 A;  5CYQ A;  1RDB A;  3RRH A;  3QES A;  4E0D A;  4CEC A;  1TL3 A;  2BAN A;  3BGR A;  1W9H A;  4CJS A;  1S1V A;  4YNQ A;  3MAQ A;  1TAU A;  1S1X A;  3OYN A;  4E7L A;  4CFB A;  3T19 A;  5KGW A;  3VQ8 A;  1NKB A;  4CE9 A;  5HRP A;  4ZTJ A;  2WON A;  3NF8 A;  3ZSW A;  1QQC A;  4I9L A;  3L2V A;  3SQ0 A;  2YV0 X;  3IG1 A;  2QXF A;  4FM1 A;  1SL0 A;  4KTQ A;  3H08 A;  1XWL A;  4TSX A;  4BDZ A;  1LWC A;  1EX4 A;  3LAN A;  3VQ4 A;  4B9U A;  4BE0 A;  2PYJ A;  2HHX A;  2AJQ A;  4CF0 A;  4FZY A;  4H4O A;  4Z0U A;  1BI4 A;  1A5X A;  3RMC A;  2KFZ A;  3KJV A;  4F3T A;  1J5O A;  1ZBH A;  3V6D A;  2DFH A;  1BHL A;  4M3U A;  2ATQ A;  3KKS A;  3SUO A;  3AO5 A;  4PUO A;  5T7B A;  4GW6 A;  4DSI A;  4HUG A;  3MXJ A;  2O4G A;  1LW2 A;  4O44 A;  4BWM A;  5HRN A;  3ASM A;  4OJR A;  4HHT A;  4MFB A;  1L5U A;  1JXB A;  3OYI A;  4RW8 A;  1RT5 A;  1W0H A;  1I39 A;  2RF2 A;  3G10 A;  2G8U A;  3QNN A;  1S9E A;  5HRS A;  1RBV A;  4CGJ A;  4AHS A;  3NF7 A;  2XY5 A;  4CJT A;  1XI1 A;  5FDL A;  5SZT A;  2FBY A;  2NUB A;  1TKT A;  4FJG A;  1DTT A;  3K59 A;  1FXX A;  1LAW A;  3QIN A;  2KTQ A;  1RDC A;  4N56 A;  1ZBL A;  4FLT A;  3AVH A;  1NJZ A;  5J2Q A;  3WNF A;  5JS1 A;  1WSG A;  1NOZ A;  4CHP A;  1B92 A;  4CJR A;  3ALY A;  3PX6 A;  2OZM A;  4EZ6 A;  4DMN A;  1SKR A;  1EKE A;  3HPG A;  4NYN A;  4EZ9 A;  4KB0 A;  4FJ8 A;  1Z26 A;  2JLE A;  3IAY A;  2HW3 A;  4ELT A;  3DLK A;  1HQE A;  3K58 A;  2D0C A;  1S5J A;  2HB5 A;  2VG5 A;  1YTA A;  4M3T A;  1Y97 A;  1LAV A;  3QEV A;  1NK0 A;  4E7I A;  2XY7 A;  2YNG A;  2X78 A;  4PWD A;  5SWM A;  2YHA A;  4KHN A;  5E41 A;  1WN7 A;  3LZI A;  4DFK A;  1IKX A;  1SKW A;  1TK5 A;  4F4K A;  1KVA A;  2KZZ A;  3AVK A;  5J2M A;  3ZSX A;  2ZE2 A;  4DTX A;  3AA4 A;  3MED A;  5HRR A;  1LV5 A;  1NK9 A;  1UOC A;  4I2Q A;  1RTD A;  2ZQB A;  1SKS A;  5CZ2 A;  4CF8 A;  1IO2 A;  3SYZ A;  3CQ8 A;  3HP9 A;  4NCB A;  3KK2 A;  3L2U A;  3NGI A;  1QSL A;  4DFP A;  4DSL A;  1CLQ A;  2XY8 A;  4CEO A;  3KK3 A;  1UA1 A;  1X9S A;  4CHN A;  2B4J A;  4W5N A;  3AO4 A;  4FJ9 A;  2HHT A;  2VWK A;  3QER A;  3ZSQ A;  4M3R A;  4M3Z A;  3PO5 A;  4M45 A;  1EET A;  1I3A A;  4FJX A;  3NFA A;  3IRX A;  2LSN A;  1HNI A;  1DLO A;  3EY1 A;  3ZSV A;  1JL2 A;  1N6Q A;  1VRU A;  3SUP A;  3RMD A;  2P1J A;  3OYH A;  5HRO A;  1A5V A;  2VWJ A;  3NBP A;  3M8Q A;  4DTO A;  2W42 A;  1X1P A;  5KRT A;  3SPZ A;  3QLH A;  3VN5 A;  4FLW A;  3A2F A;  1DTQ A;  2KQ2 A;  3I8D A;  1QHT A;  4DG1 A;  3V1Q A;  4CJE A;  3U3G A;  1U04 A;  3K5M A;  5EU7 A;  1C1A A;  2E4L A;  4AHT A;  4FYD A;  1N5Y A;  4RW6 A;  4CGG A;  5KI6 A;  4KHW A;  3ISN C;  2IDO A;  4RW7 A;  4B9N A;  3B6P A;  3LZJ A;  3CFP A;  3SUQ A;  4CF1 A;  1NK6 A;  5KTQ A;  2E6M A;  1NJX A;  4NCA A;  1WAF A;  1L3V A;  3EYZ A;  4UQG A;  3KD5 E;  3S9H A;  4PQU A;  2OPR A;  3AVB A;  3V1R A;  4CEB A;  3KTQ A;  3AA5 X;  2OYQ A;  1RT3 A;  1KVB A;  2F96 A;  3DRS A;  3VQD A;  3ZT2 A;  1NK4 A;  1ASW A;  4QAG A;  3AVM A;  3KLH A;  3V81 A;  2IAJ A;  1BCO A;  1SL2 A;  1B9D A;  4RG8 A;  3U6F A;  3VQA A;  3NCI A;  1XHX A;  1MU2 A;  4B8C A;  4DTP A;  3DI6 A;  4C8L A;  4LH4 A;  5K14 A;  3K5N A;  4B9T A;  1HYS A;  4C8K A;  3OYF A;  1VSE A;  3RMA A;  4LD0 A;  3JSM A;  4BE1 A;  4R5P A;  3TAB A;  1XHZ A;  1T05 A;  1WSI A;  1LW0 A;  1GOC A;  3HT3 A;  2YNF A;  1KTQ A;  1JLF A;  1VSJ A;  3D0P A;  3DOK A;  2HHU A;  3K57 A;  1VSK A;  4C8M A;  4AIL C;  3RMB A;  1IH7 A;  1JKH A;  3P83 D;  4AHC A;  4DTR A;  4CGD A;  1A5W A;  4FJH A;  3K5O A;  3MEC A;  4CJQ A;  5HLF A;  2GBZ A;  1TK8 A;  3AO1 A;  4NCG A;  4O0I A;  4K8X A;  4DTM A;  1ZBU A;  2RN2 A;  3WNG A;  3HVR A;  3AVI A;  3L3V A;  3ZT0 A;  3VA3 A;  4DU3 A;  4I2P A;  3TWH A;  1XC9 A;  1KLN A;  3NGY A;  3HL8 A;  2X6N A;  3MEE A;  3L3U A;  3VQ9 A;  4CCH A;  4DQS A;  3PX0 A;  4CES A;  2JGU A;  2X74 A;  1S6Q A;  2VG6 A;  1WSF A;  4CJF A;  1D5A A;  4EP5 A;  3QNO A;  4DQI A;  3NE6 A;  1WSE A;  1GOA A;  4FLZ A;  4CHO A;  2P51 A;  3K5L A;  4E89 A;  1C0U A;  4BE2 A;  2VG7 A;  4CEQ A;  4CJ4 A;  1RT2 A;  4CK1 A;  3O3G A;  2Y1I A;  2KZM A;  1S1U A;  3D45 A;  4OPJ A;  3SQ1 A;  3QEI A;  3SNN A;  2QK9 A;  4B9L A;  2YNH A;  3LPU A;  3IS9 A;  4B8A B;  4I7F A;  4OKK A;  4Y1D A;  3DM2 A;  4LH5 A;  3ZCM A;  3OYJ A;  2Z1G A;  4GMJ B;  5JS2 A;  1LWF A;  2B6A A;  3CM5 A;  4FM2 A;  2A1S A;  5J2P A;  2A1R A;  1YTU A;  3OY9 A;  3NH1 A;  4ZTF A;  3NHG A;  4PY5 A;  2HVI A;  4CGH A;  4DLE A;  2DTU A;  2FBX A;  1VSL A;  4PA1 A;  3P5J A;  5HBM A;  4CF9 A;  1NK8 A;  4M42 A;  1HPZ A;  4KB1 A;  4C8O A;  1B9F A;  3AO3 A;  2X6S A;  2FBT A;  3NGZ A;  3SQ2 A;  3PO4 A;  4WE1 A;  4Z4E A;  3DYA A;  3HPH A;  1QTM A;  5CZ1 A;  4FJL A;  3NH0 A;  1HJR A;  4CK3 A;  3CFO A;  1ZYQ A;  4OGC A;  1EXQ A;  3MEG A;  3QEP A;  1RBU A;  3LDS A;  2G8H A;  4OKJ A;  4M3W A;  1TAQ A;  3L2W A;  1RIL A;  3LP1 A;  4CJW A;  4CF2 A;  1T03 A;  4HCC A;  4IG3 A;  3V9S A;  3AVL A;  4JLH A;  3OYL A;  4JRP A;  4OLB A;  4B08 A;  4L8R B;  3DLG A;  4W5Q A;  3ZSY A;  1IKW A;  4CEZ A;  1L3U A;  1SL1 A;  4DS4 A;  3ZT3 A;  1HRH A;  4B9M A;  4CHQ A;  3LWM A;  1S9G A;  1D8Y A;  3F9K A;  3U3Y A;  2XY6 A;  3THV A;  4IFY A;  4FW2 A;  4Q0B A;  4Q5V A;  3LP2 A;  3O4Q A;  1X9W A;  3KIO A;  1IG9 A;  1VSM A;  3QO9 A;  4CJK A;  3NDK A;  2D0A A;  1UAX A;  1GOB A;  4GVM A;  4H8K A;  4E1M A;  1WNS A;  2FC0 A;  4O4G A;  4HUE A;  3TAE A;  5I3U A;  4DQQ A;  2DY4 A;  5C25 A;  2RKI A;  3OYA A;  4KI4 A;  3B6O A;  1JLQ A;  2RPI A;  3O3F A;  3LWL A;  2D5R A;  4AH9 A;  1CXU A;  3QIP A;  1BGX T;  2OPS A;  3V1O A;  2HHV A;  4KKO A;  5C42 A;  3QEX A;  1FKO A;  3OYK A;  4DFM A;  3SQ4 A;  2R7Y A;  3OVN A;  3V9X A;  3TR8 A;  1C0M A;  4DSE A;  3TAQ A;  4CGF A;  3JYT A;  3RR7 A;  4FXD A;  4CJL A;  4DSK A;  4ZHR A;  1RTH A;  4E7K A;  4G1Q A;  3CYM A;  1Z25 A;  4Z4F A;  3OYC A;  4FJI A;  2IS3 A;  3P1G A;  2YKM A;  3C6T A;  4DQR A;  4KHY A;  4J2A A;  1RBS A;  3E01 A;  3DLH A;  2YHB A;  1J9A A;  3O4N A;  2OPQ A;  1J53 A;  2DFE A;  4FJ5 A;  4FZX C;  1KFS A;  3OYD A;  3BDP A;  4KRF A;  2Z1J A;  2P5G A;  4M3X A;  2P5O A;  4J2D A;  3CM6 A;  4Z4C A;  4HCB A;  3AA3 A;  4W5T A;  4DTJ A;  4LSL A;  2OA8 A;  3KK1 A;  4E1N A;  4CEE A;  4F2R A;  4OVL A;  1WSH A;  4DU1 A;  4MQ3 A;  1HYZ A;  2QKK A;  1SV5 A;  1BL3 A;  4Z4I A;  4JS4 A;  3MXI A;  1IKV A;  4OPK A;  1UWB A;  4FJJ A;  5KRS A;  3PX4 A;  1T8E A;  4DTU A;  3HP6 A;  1TKZ A;  4DSJ A;  4N47 A;  3QEW A;  4CHZ A;  1KFD A;  4DSF A;  2OZS A;  3I0R A;  3KLG A;  4FZZ A;  1C1C A;  3C6U A;  1BIS A;  4FLX A;  4FLV A;  3L8B A;  2YNI A;  1YVU A;  1REV A;  3S3N A;  2G8V A;  4QOZ B;  2XHB A;  3AVC A;  3S3M A;  1JLG A;  3HO1 A;  4CIG A;  5HP1 A;  1U49 A;  3OJS A;  3RWU A;  4DFJ A;  1RTI A;  4ID5 A;  2OPP A;  3KLF A;  3LAK A;  1S1T A;  3ZT1 A;  3MXM A;  1Q9Y A;  1EP4 A;  4AHR A;  4F8R A;  3HM9 A;  4LSN A;  3V4I A;  1QS4 A;  3CG7 A;  3DLR A;  3DMJ A;  4RW9 A;  3OJU A;  1QE1 A;  4DS5 A;  3RRG A;  2HHS A;  3VQQ A;  3VQE A;  3M8S A;  4FK0 A;  4CK2 A;  3TAP A;  4ID1 A;  4DTS A;  2ZD1 A;  4IG0 A;  3VA0 A;  4E7J A;  4FCY A;  3AVN A;  1Q8I A;  1CZB A;  3VQB A;  4KO0 A;  1TKD A;  3V9Z A;  1IKY A;  2EX3 A;  1C0T A;  1JL1 A;  1HQU A;  1TV6 A;  1ITG A;  2IOC A;  4OKE A;  1NJW A;  1BQN A;  1C1B A;  2WOM A;  3VQC A;  3TI0 A;  3HVT A;  3EZ5 A;  1RT6 A;  1J54 A;  3QET A;  5FRN A;  4FJ7 A;  3LAL A;  3ZSZ A;  4KAZ A;  4KRE A;  3AA2 A;  4DF8 A;  4AHU A;  2FBV A;  3HK2 A;  5CYM A;  3SZ2 A;  1VSD A;  4IBN A;  4FVM A;  2PY5 A;  3S3O A;  1KCF A;  2E6L A;  3SCX A;  4CFD A;  4B9S A;  4XIU A;  4AHV A;  3G0Z A;  4KFB A;  3KLE A;  1RT1 A;  4BWJ A;  1CXQ A;  4F3O A;  3NH2 A;  4HVJ A;  1NK5 A;  4J2E A;  1FK9 A;  1RDA A;  3PUF A;  3DRR A;  3ZSR A;  4O0J A;  4FLY A;  1U45 A;  2EHG A;  2XRI A;  3SPY A;  1F21 A;  1FKP A;  4KTZ A;  3TAR A;  3L2Q A;  1JLC A;  1S6P A;  2Q3S A;  4B9V A;  5KGX A;  4FLU A;  3RTV A;  4KPY A;  5DMR A;  4FJK A;  3O3H A;  3M8P A;  4K8Z A;  4KI6 A;  4E7H A;  4JS5 A;  2BDP A;  1VSI A;  4NYF A;  4CED A;  3LPT A;  1L3S A;  1RTJ A;  1R0A A;  2PYL A;  4RW4 A;  4CHY A;  4FJM A;  1BI4 B;  4BDP A;  2KFN A;  2DFF A;  2I5J A;  4HUF A;  3CFR A;  4DQP A;  1BCM A;  4KHS A;  4FW1 A;  3C94 A;  4FK4 A;  2B5J A;  1WSJ A;  2QKB A;  1CZ9 A;  1ASV A;  3C95 A;  3T3F A;  3KLI A;  2Y1J A;  1D9F A;  2IC3 A;  1LWE A;  4O5B A;  2BGG A;  1VK0 A;  4F2S A;  1SUQ A;  4I9Q A;  4N5S A;  2BE2 A;  4N41 A;  1NK7 A;  5FRM A;  4DF4 A;  1T7P A;  4KHQ A;  2HHQ A;  3VQ7 A;  4M41 A;  3HPO A;  5J2N A;  4LY7 A;  3LP0 A;  4HTU A;  1KRP A;  3DLB A;  4ICL A;  3ULD A;  4W5R A;  2G8W A;  5C24 A;  1TK0 A;  3DRP A;  2HNZ A;  4CGI A;  4CEA A;  3TAG A;  3KD1 E;  4QCL A;  3F73 A;  3OS2 A;  3OYB A;  4IKF A;  1U4B A;  3DLE A;  2HND A;  4CIF A;  1QSY A;  1BIU A;  3QIO A;  1VRT A;  3AVG A;  4O55 A;  4W5O A;  1NKE A;  3VQ5 A;  4IDK A;  3OS1 A;  1BQM A;  4KTW A;  1D9D A;  1JLE A;  4DU4 A;  2Z1H A;  1JXE A;  3AO2 A;  4OLA A;  5DK5 A;  3LAM A;  4C8N A;  3VQ6 A;  3OYE A;  3HJF A;  5D3G A;  2Z1I A;  4J2B A;  1QSS A;  4DWI A;  2F8T A;  3HXM A;  3ZSO A;  3OYG A;  5FRO A;  1U48 A;  3ITH A;  4IFV A;  4CJU A;  1VSF A;  1RT7 A;  2KW4 A;  1C6V A;  1KLM A;  3NAE A;  3M8R A;  4DTN A;  1RCH A;  4Z4H A;  1BIZ A;  4CER A;  4B3O A;  3SV4 A;  3AVA A;  3AV9 A;  2YKN A;  1HNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...