3ZSQA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsqA00
3SUNA 3LWMA 4E1NA 4B9LA 4AILC 1RDAA 4M3RA 4KO0A 4DS5A 1T8EA 1U45A 1BGXT 3OYFA 5KRSA 4F8RA 4OLAA 1BI4B 4O44A 1TAUA 3DLBA 1U47A 4PQUA 1CXQA 2FBTA 4DTNA 4W5NA 3NGZA 1Z26A 1S1VA 3OYLA 2ITGA 3RTVA 4CGHA 3OYKA 4OJRA 4DQIA 4CEZA 1IKYA 1IO2A 1JLAA 4BWJA 4NYFA 1QQCA 4B9SA 3AVLA 1BL3A 2PYLA 1TK0A 3KTQA 1LWEA 1U04A 4ID5A 2JGUA 1RBUA 1JLBA 3M8QA 4J2BA 3ZT4A 3B6PA 4KI4A 3L3VA 3AV9A 2X6NA 4FLYA 4TSXA 3SCXA 3KLIA 4DSIA 4DTJA 4FK4A 4W5RA 2QXFA 1VRTA 4DU1A 1X1PA 2IOCA 2RKIA 4JLHA 1A5WA 4O55A 5HBMA 3NGIA 3QEXA 2G8HA 4M3ZA 3HK2A 2HW3A 3DLKA 3CQ8A 3P1GA 5HRNA 2X78A 2XY8A 3QEPA 1J54A 1WLJA 4FVMA 3THVA 1N5YA 4J2EA 2VWKA 4EP4A 3P5JA 4CHQA 3NH1A 3M8PA 3SV4A 2FC0A 4FW1A 3QNOA 3BDPA 4Z4EA 2HVHA 4FZYA 2X74A 4E7JA 3RMCA 1B9DA 3F73A 3HVTA 4BACA 4FJ5A 2XY5A 3AO1A 3AVGA 3KLEA 4CFAA 3SV3A 4NCAA 3KLFA 3DRRA 4KTWA 4DQRA 4DWIA 1NKEA 4CECA 2A1RA 1HNVA 1XWLA 4B8AB 4HUEA 4FJLA 3O3FA 1S1WA 3KIOA 3AVBA 3DLGA 2OZSA 2HHVA 4ELTA 1JXBA 1EKEA 3IS9A 1BISA 3MAQA 3VA0A 2G8VA 2HHXA 4CEBA 1KRPA 3ULDA 4IDKA 3DLRA 2P5OA 3DOLA 5D3GA 1TKDA 1VSFA 4CGIA 3L2VA 1LW2A 4BDZA 1XHZA 2PZSA 4Q5VA 1L3UA 1T03A 2EHGA 4FM0A 1WSJA 1NJYA 3QO9A 3TANA 1UOCA 2PY5A 4B9NA 2KQ2A 4CEAA 3MEDA 2IAJA 3LP1A 4LSLA 3NF9A 3U6FA 4EZ6A 5E41A 4M41A 1RT6A 2NUBA 4W5QA 1RBVA 2OZMA 1F21A 3CFOA 1S1XA 2E6MA 3NF6A 3G0ZA 4DTOA 1VK0A 1L3SA 2DTUA 3QINA 2D5RA 5CZ2A 5FROA 4KTQA 4AHSA 4AHTA 4LH5A 4FJIA 1GOBA 3AVAA 1JKHA 4CF8A 1EXQA 3O3HA 2BDPA 3V81A 4O5BA 4CGDA 3EZ5A 4I9LA 4EP5A 4CJUA 4CFDA 1Z25A 1IKVA 1U49A 1HRHA 4FYDA 3CFPA 1UA0A 1SL2A 3QEVA 1N6QA 2Q3SA 4KPYA 1ZBUA 4E89A 2YKNA 2KFZA 3IRXA 5JS2A 1ASUA 3KLGA 4JS5A 1MU2A 2DFFA 4OPJA 3V9WA 3WNEA 2QK9A 3CM6A 1T05A 3K5LA 4FLZA 3V9SA 3KD5E 3KK1A 1L3VA 3I8DA 3OYBA 4DU4A 1YTAA 4OKJA 3NAEA 2HNDA 3AVHA 1RDDA 1QS4A 1XHXA 4KREA 1GOAA 3AVFA 4KHUA 2E6LA 2B5JA 1LV5A 3KJVA 4GVMA 2A1SA 3OJUA 3WNFA 4FM2A 3T19A 3SQ2A 3RR8A 4J2AA 1NK4A 3CM5A 1A5VA 3HL8A 4CF9A 3SUOA 1XI1A 2D0AA 4RW4A 1VSDA 1FK9A 1VSHA 4CJKA 3OYAA 3U3YA 1CZ9A 4CJFA 1BHLA 4Z4GA 1NOZA 4M3WA 3VQBA 4KRFA 3AVIA 2P1JA 2ZE2A 3PO4A 4DS4A 3ZCMA 4YFUA 3TAQA 1KFSA 4FJGA 2ATQA 4H8KA 5DMRA 4CGFA 4CJ5A 1SUQA 2DFHA 2XHBA 3NDKA 4BE2A 3MXIA 5KTQA 3SPYA 4I9QA 2Z1JA 2W42A 3IG1A 4DFKA 4FJNA 4FK2A 2R7YA 3QNNA 2YHAA 2HHUA 3AVKA 1RBTA 1X9MA 4NCBA 3SI6A 5EU7A 5KGWA 4NYNA 1C0UA 3LANA 4Z4CA 3ISNC 4DFPA 3M8RA 1Y97A 4KHQA 3NF8A 3PX6A 5HRSA 2KZZA 2KFNA 3JSMA 1BIUA 1ASVA 2P51A 3SQ1A 1ZBHA 3O3GA 3AVNA 1KLNA 3OYCA 3D0PA 1BCMA 1JLGA 1CLQA 4JS4A 3ZT0A 5FDLA 3AO5A 4FLWA 4E7HA 4E0DA 1VSKA 3DMJA 1D5AA 5HLFA 2P5GA 1QSYA 4B3OA 3SJJA 4DTRA 1WSFA 3V1RA 2OPPA 4CJLA 4E1MA 1BQNA 4CFCA 4XIUA 4B9UA 3ZSRA 2HB5A 3FFIA 4M45A 3NE6A 1B92A 4CGJA 4I7FA 3LZIA 3NFAA 3MXMA 4HCBA 1KVCA 1HYSA 2YNFA 4CK1A 2WOMA 2XY7A 2D0CA 4ZTFA 4IBNA 1KVAA 4DSJA 1VSJA 3MXJA 4CF0A 3HVRA 4CESA 4CIEA 1U48A 2G8IA 3RMDA 2F8SA 3KLHA 3V1OA 4RW9A 3RMAA 3NCIA 5CYQA 4CFBA 3S3OA 2XY6A 3SNNA 4M3XA 4DTSA 1TVRA 2GBZA 3OS1A 2G8UA 3HP9A 1WAJA 4KTZA 3S9HA 4CK3A 3PUFA 1TK5A 1QSLA 3UIQA 1YVUA 4FJXA 3ALYA 4DTXA 1QE1A 1RTHA 4CJWA 1I39A 1BQMA 2DFEA 3HPOA 4JRPA 1SKWA 4C8OA 4FJMA 1ZBFA 1JLQA 4KKOA 4CJ3A 2DY4A 1O1WA 2WONA 3PY8A 3MECA 1LWFA 4E7KA 1WNSA 1XC9A 4KB1A 5KI6A 4FLVA 4CK2A 1SL1A 4DLEA 2YNIA 3MEGA 5T7BA 4ID1A 3TABA 3M8SA 4DLGA 1RILA 2G8FA 3AA3A 4B9VA 4GW6A 3LP3A 3OYEA 3H08A 1TKXA 3L2UA 1U4BA 4FK0A 4Z4FA 4QOZB 3K2PA 4F2SA 1S9GA 4CJVA 2QKBA 4Q0BA 1W0HA 3PX4A 2HHQA 3L8BA 5C25A 4FJJA 3VQQA 3LPTA 2YNHA 3B6OA 2BE2A 3A2FA 1RBSA 4B8CA 4W5OA 3NH0A 3S3MA 4OLBA 3O4NA 1JL2A 3T1AA 1NK5A 2LSNA 1S5JA 1B9FA 3O4QA 4FM1A 2GV9A 3L2QA 1VSMA 4FJKA 3LALA 5CY4A 4FLUA 1NJZA 4FJHA 3C6UA 3SUPA 1NK7A 4DFMA 4FJ9A 4B9MA 3VQ5A 3DI6A 4ELVA 1C1BA 1S6PA 2OPQA 3KKRA 3V9UA 1Q9XA 1SKSA 1YTUA 2OA8A 4IFVA 4CCHA 3QEIA 5J2MA 4ZHRA 4PUOA 2E4LA 1W9HA 2HNYA 1VRUA 1D8YA 4QAGA 1EP4A 1WSIA 5J1EA 3LP2A 4E19A 4M3UA 1HQUA 4BDPA 4CIFA 3OYNA 1X9WA 3C95A 4KHSA 3SYZA 4O0IA 4B9TA 1QTMA 4UQGA 1IKWA 3D45A 2HNZA 1HNIA 1QHTA 3C94A 1LWCA 3ZT2A 4CIGA 3VQ7A 3HT3A 3LZJA 4Y1DA 4CHOA 3T3FA 1I3AA 1TKZA 3IAYA 4E7IA 5K14A 4K8XA 4KB0A 2VG7A 4FW2A 3TR8A 4BE0A 3CYMA 3G10A 3AO2A 2Z1GA 3V9XA 4CEDA 5SZTA 1NK8A 1RT1A 4DU3A 1HYZA 4CEOA 3TI0A 4J2DA 4LH4A 4OKKA 2BANA 3OY9A 3EYZA 1LW0A 5KGXA 1KSPA 3SPZA 1HQEA 1EETA 5J2PA 4FJ8A 3QEWA 2O4IA 1TV6A 4N5SA 1CXUA 3DLEA 1C0TA 3DRPA 3QERA 4N56A 2B6AA 1A5XA 1BCOA 2B4JA 4OPKA 4JRQA 4RG8A 3ITHA 4CJEA 1NJWA 3HPHA 3OS2A 4MFBA 2G8WA 1ITGA 4NCGA 4DF8A 2ZD1A 4HCCA 3LDSA 3HP6A 2XRIA 1S1UA 4C8MA 4B08A 3V6DA 3TAPA 2G8KA 1T7PA 1UAXA 1J53A 4HUGA 3HO1A 1HYVA 4HUFA 4CJRA 3S3NA 1SV5A 3VQEA 2HMIA 3V1QA 1BI4A 3AO3A 4IG0A 1KFDA 3ZSOA 3OYMA 5FRMA 4MQ3A 4F2RA 2VWJA 2FBYA 4PWDA 1D9FA 4FJ7A 4AHUA 3L2WA 3TAFA 1UWBA 4LD0A 2QKKA 4Z0UA 3DOKA 4RW8A 3AA2A 1K6YA 1RTJA 4AHVA 3NGYA 4RW6A 1GOCA 5J2QA 2IGIA 1TGOA 1J5OA 4ICLA 4AH9A 3QETA 5HP1A 5HRRA 4I2PA 1S9EA 2RF2A 3ZSWA 4CGGA 4DFJA 3OS0A 1FKOA 4FCYA 2IDOA 4CEEA 3I0SA 3ZSXA 3RRGA 4Z4IA 3KKSA 3LAKA 1RT5A 4CJTA 4F3TA 4DTUA 3VQ4A 1YT3A 1DTTA 4CHPA 1REVA 3OJSA 1IKXA 2YKMA 1KLMA 1C1AA 2IC3A 3AA4A 3MEEA 4DG1A 1TL3A 4PY5A 5C24A 2HHWA 4CHZA 1WSGA 4OKEA 3K5OA 1R0AA 1NKCA 1RT4A 3HM9A 4DSFA 4N76A 2F96A 3WNGA 3ZT1A 5C42A 3V9ZA 1RTIA 2JLEA 3RR7A 3LWLA 2FBXA 1JL1A 3ZSVA 3TWHA 1KVBA 1L5UA 3OYJA 1C6VA 5FRNA 1CZBA 3RMBA 1S1TA 3HSTB 4HTUA 1JLFA 3L2RA 4O4GA 3HJFA 1NK0A 3P83D 3TAMA 2Y1IA 1NKBA 3LPUA 1WAFA 3QIOA 4CERA 4CJ4A 5HRPA 4K8ZA 3LAMA 1DLOA 4OGEA 3HYFA 4EZ9A 2D0BA 1IG9A 2YV0X 4LY7A 3SQ0A 4HHTA 4M3YA 1J9AA 4RW7A 3NHGA 4DSEA 3DLHA 4IFYA 3QLHA 5I42A 4KI6A 3PX0A 4DQPA 2BGGA 4KHWA 4CF1A 1DTQA 2RPIA 3VQPA 4FLXA 3RWUA 1IH7A 4CF2A 1D9DA 1HMVA 3VQDA 1QSSA 3KK2A 4H4OA 4KFBA 4DTMA 1VSIA 1NJXA 2YHBA 1ZBIA 2FBVA 3ZSZA 2Z1IA 5SWMA 2Y1JA 4CJQA 4ELUA 1ZBLA 5JS1A 4GMJB 3QIPA 3OYGA 1WSHA 1VSEA 3SZ2A 4DTPA 2OPSA 5I3UA 4FZZA 4F4KA 1JLCA 1RBRA 4F3OA 3E01A 1C1CA 4PA1A 4L8RB 4CHYA 3PV8A 2AJQA 4Y1CA 3KD1E 5CZ1A 1RCHA 3OYDA 3ZSQA 3K5MA 5HROA 1TK8A 3DRSA 1NK6A 2HHTA 4FZXC 4N47A 2F8TA 4DSLA 3EY1A 1EX4A 3QESA 4C8LA 1RDBA 3HXMA 2HVIA 4G1QA 4FLTA 2IS3A 4CEQA 2PYJA 1VSLA 3K58A 4DQQA 1RTDA 4AHRA 3ASMA 3VQ9A 3L3UA 3WNHA 4N41A 1TL1A 2RN2A 1BIZA 4M42A 5CYMA 5DK5A 4DQSA 4KV8A 1RDCA 4BE1A 2X6SA 2OYQA 3C6TA 2Z1HA 4R5PA 4W5TA 3ZT3A 1L3TA 1RT2A 1NK9A 1TKTA 3I0RA 4C8KA 1RT7A 3OVNA 4FXDA 4QCLA 2EX3A 1ZYQA 1ASWA 3BGRA 2XO7A 1Q8IA 4DMNA 3JYTA 1FKPA 1LAVA 4E7LA 3AVCA 2ZQBA 3AVMA 4OGCA 4E3SA 1SL0A 3K59A 4WE1A 1JLEA 1HPZA 2VG6A 3NBPA 3CFRA 1JXEA 4O0JA 3U3GA 3CG7A 2YNGA 3NH2A 3K57A 2I5JA 3VQ6A 2ETJA 2KW4A 1FXXA 3TARA 4M3TA 2O4GA 3VA3A 3VQCA 4AHCA 4BDYA 3DYAA 5J2NA 1NOYA 3K5NA 3AA5X 1C0MA 4Z4HA 3AO4A 4IKFA 4CHNA 3ZSYA 4CJPA 1WSEA 4HVJA 3VQAA 4C8NA 4IG3A 1G15A 1RT3A 3F9KA 3HPGA 3RRHA 4DF4A 4CJSA 3SUQA 4KHYA 4ZTJA 2KTQA 3VQ8A 4KAZA 1WN7A 3LP0A 4KHNA 3PO5A 3AVJA 1RNHA 3NF7A 4LSNA 1S6QA 1KCFA 4OVLA 3VN5A 2HHSA 4CEFA 1SKRA 1UA1A 1LAWA 1HJRA 3KK3A 4CE9A 3TAEA 2OPRA 3TAGA 1TAQA 3OYHA 3DM2A 2GUIA 2KZMA 4YNQA 3SQ4A 4I2QA 2VG5A 1X9SA 1Q9YA 4DSKA 1KTQA 5KRTA 3V4IA 4H4MA 3OYIA 4BWMA
chains in the Genus database with same CATH superfamily
3LWMA 3PSFA 2ASMA 4M3RA 4IDHA 3TSPA 5LJWA 1QQNA 3CERA 4OLAA 5AZIB 4JKFA 4EIAA 1Z26A 4KHUA 3OYKA 4DQIA 1IKYA 2GWJA 1BL3A 2PYLA 3KTQA 3AGRA 2EWSA 5DM7L 4H5TA 4J2BA 5AQGA 4BRPA 4BY9C 4DKWA 4IFEA 4FLYA 4TSXA 3IFRA 5M1OA 4W5RA 4A5BA 3THWA 4H5VA 2IOCA 3BF1A 4JLHA 1A5WA 4M3ZA 4A2AA 1YAGA 2X78A 1OKJA 1J54A 3SBTA 3QEPA 1BUPA 3ZX2A 4KH4A 3NH1A 3SV4A 3HSCA 3HZ6A 1NGJA 3QNOA 4E7JA 5AQMA 3F73A 3KK7A 2P9KA 3J7YP 4RCHA 3KLFA 3U9DA 4KTWA 1NKEA 4CECA 1BG3A 4FJLA 4B8AB 2FXUA 3KIOA 4ELTA 3OA9A 3IMXA 1NMDA 3N4QA 2G8VA 4DV7K 1YIJN 4CEBA 3TTDA 1NGIA 4WQ5C 2BUPA 4MDBA 1VSFA 4CGIA 3CCMN 3WXLA 5AFUH 4JI0K 1XHZA 2PZSA 4HWIA 1ATSA 2EHGA 5BRDA 3TANA 1UOCA 1ZBSA 4B9NA 4CEAA 2P9SB 3PLAA 3NF9A 3HRGA 5JLFA 1F21A 2Q2RA 3LM2A 2E6MA 3G0ZA 1VK0A 4Y0WA 2DTUA 3L4QA 2F9WA 2FSJA 4O5BA 3EZ5A 4I9LA 4CJUA 4CFDA 1Q18A 3CQXA 4KBOA 3N4PA 1UA0A 4BC4A 4JS5A 1QHAA 3WNEA 2QK9A 1HJOA 1L3VA 4DU4A 1YTAA 3VTIA 1QS4A 1QQOA 4FSVA 1GOAA 4IO9L 2E6LA 2B5JA 3KJVA 3OJUA 4BRGA 2UXCK 4B1YB 2JWLA 1EWQA 1SAZA 1OVQA 3T19A 3SQ2A 2NRRA 3CM5A 4IXCA 4J2AA 2D0AA 3MN5A 3OYAA 1VSDA 1FK9A 2P9NA 3LDLA 3U3YA 3CC7N 5BR8K 3ZCMA 3TAQA 2Q36A 4FJGA 4CGFA 4H8KA 5DMRA 4CJ5A 3THYB 2DFHA 1VAZA 3LM9A 3QNNA 2YHAA 2HHUA 4NCBA 2WBNA 5KGWA 4NYNA 4DFPA 3ISNC 3NF8A 3PX6A 2KZZA 3LDOA 5LMNK 3AVNA 2GWKA 1KLNA 1BCMA 3VGLA 4FLWA 1VSKA 1U6ZA 5HLFA 4JKDA 4B3OA 4RWTA 4CJLA 1BQNA 3BF3A 2HB5A 3NE6A 3MXMA 4CGJA 3ZYYX 3NFAA 1QZ6A 4QS8A 4YHHK 4JI4K 2XY7A 3HVRA 3MXJA 4CF0A 4KH5A 2D4WA 3D2EA 3CCUN 2F8SA 3KLHA 2Q31A 4RW9A 3DLLL 3RMAA 1S72N 3NCIA 4DR3K 1TYQB 3B8AX 4CFBA 5DM6L 4DTSA 5KPZA 2G8UA 1WAJA 4CK3A 3PUFA 1QSLA 4B3RK 4DQ8A 2ZF5O 1RTHA 4CJWA 1BQMA 1SKWA 4KKOA 4BVPA 1O1WA 2WONA 3ATVA 4E7KA 4ILHA 3VEXA 1SL1A 5JVGL 2YNIA 2E5LK 3LDNA 2NLXA 4B3TK 4NO7A 4GW6A 3C65A 4FWSA 3H08A 3OYEA 3L2UA 1XNQK 3FR0A 4F2SA 4CJVA 4Q0BA 2ZGYA 4LC9B 2BH1A 4RTFD 3PIPL 3L8BA 5AQIA 5EVZA 3LPTA 3B6OA 3C6HA 3Q7BA 3NH0A 5ADXA 3S3MA 3DXMB 1NK5A 2LSNA 4C23A 1VSMA 4FLUA 4FJHA 2Q0RA 1W7AA 5KQ8A 1Q81O 1E4FT 1V4SA 1QVFM 4BRIA 4NLBA 4ZHRA 3ULEA 2E4LA 1VRUA 2QXLA 4QAGA 3A5NC 5J1EA 4BDPA 3RVCA 5IWAK 2V51B 3ZETB 4KHSA 4R79A 3SBGA 4UQGA 3O9UA 3O9TA 4DV1K 3HT3A 3ZT2A 4E7IA 2VG7A 3CYMA 1RT1A 4CEOA 3TI0A 2D0PA 4LH4A 4OKKA 1LW0A 4EHUA 1CXUA 3QERA 5LY3A 1BCOA 5EX5A 4JI2K 1NGCA 1NJWA 3HPHA 2GTDA 3LDQA 1BO5O 3TAPA 2XRIA 3V6DA 4GNIA 3FZKA 3IUCA 4B1ZA 3JXUA 4BR9A 4B3SK 4HUFA 3S3NA 2HMIA 3AO3A 4LF8K 3ZSOA 1YF5L 4MQ3A 2FBYA 3C6AA 1YUWA 3SAHA 3L2WA 3TAFA 1FW6A 4DR5K 5HL7L 4RW8A 3R1XA 1J5OA 5HP1A 2E2PA 4CGGA 5CHIA 4BR5A 4FCYA 2IDOA 4CEEA 5FPEA 3KKSA 4EFHA 3LAKA 1DGKN 1VQLN 4F3TA 4DTUA 3VQ4A 5HOOA 2QEXN 3OJSA 4BREA 2VYPA 4OKEA 2PAVA 2F96A 1TUUA 2JLEA 4PL7A 2FBXA 1C0FA 1L5UA 1C6VA 5FRNA 1CZBA 3RMBA 1S1TA 3O1WA 4IEIA 2Y1IA 3FZMA 4K8ZA 2OCEA 4BRCA 4XH5A 4LY7A 4BR2A 4HHTA 1J9AA 3QBXA 3ATUA 4IFYA 4DSEA 4KI6A 3MK6A 3VQPA 2JWKA 5KQDA 3RWUA 5LL6Z 1IH7A 3RSEA 2UXDK 4KFBA 1VSIA 5H1SQ 1ZBIA 3OTOK 2Z1IA 2Y1JA 4CJQA 5AQPA 3MMVA 1WSHA 2IVOA 4O5FA 1BDGA 4JKGB 3E01A 3MN6A 3U4LA 1T3VA 3PV8A 2VQFK 3K5MA 3VMFB 3ZSQA 1HNXK 2HHTA 1KAXA 3E9PA 2F8TA 2UU9K 4GKJK 3O6WA 3BEXA 2IS3A 2PYJA 3AARA 4L3QA 4X66K 3WNHA 4WYBA 1BIZA 3G6EN 3D2FB 3C7NA 5DK5A 1ESVA 4BR7A 1HUXA 4IO8A 3C6TA 1XC3A 3P31A 1NK9A 3I0RA 2QWOA 1RT7A 4DR1K 4A61A 2QWPA 4JK9A 4H0YB 1Q8IA 1BU6O 2QWQA 2QWRA 3J80O 3AVCA 1SL0A 2FF3B 3CIPA 1JLEA 1HPZA 2VG6A 3NBPA 3U3GA 3K57A 2I5JA 3DYAA 4IKFA 1IBKK 3ZSYA 1WSEA 2QWMA 3MWPA 4HVJA 3UE5A 1G15A 1RT3A 3RRHA 4CJSA 2FSKA 2KTQA 4KAZA 3HM8A 1WN7A 4FPBA 3NF7A 1Y64A 3W0LA 1UA1A 1LAWA 3KK3A 4H0TB 2OPRA 5AQYA 2GUIA 2KZMA 2GEMA 1NWKA 1KTQA 3PX0A 4BWMA 3SUNA 4E1NA 1P8ZA 4KO0A 4DS5A 1T8EA 1T6DA 1JCGA 5KRSA 4F8RA 1BI4B 1C0GA 2FBTA 3VENA 4DTNA 4W5NA 3NGZA 2ITGA 3MCPA 1VQ7N 1NGEA 4BWJA 3VF4A 5EY4A 5ELZA 1TK0A 4ID5A 2JGUA 3A5MC 3M8QA 4E1JA 2O8FA 3ZT4A 1Q7YO 2NRHA 3AV9A 4WQ4A 3CCEN 4A57A 4DTJA 3MDQA 4FK4A 3T1YK 5GIOA 4BG8A 3M1FA 1Q82O 3VEZA 4DU1A 2HW3A 5AZJA 2RE2A 3QEXA 3CQ8A 5GADP 2XY8A 4FVMA 3THVA 1MA9B 1N5YA 4JI7K 4CHQA 2FC0A 5E26A 4FZYA 3RMCA 1B9DA 2HOEA 2J4RA 3HVTA 4OO1J 4FJ5A 4B1XB 2HBKA 1WUAA 3KLEA 5F1XA 4BRNA 1GLDG 3VERA 2A1RA 1YVNA 3MN7A 2OZSA 2HHVA 1EKEA 3VF2A 3MAQA 2HHXA 3HI0A 1KRPA 2V52B 2P5OA 4QS7A 3CCVN 1VQ8N 4F9OA 4IZ9A 2UYTA 2ZJRL 1L3UA 1XNRK 2A42A 4PL8A 4FVUA 3CD6N 2PBDA 3K9JA 3QO9A 4LSLA 1NM1A 2A41A 2P9IA 4W5QA 1RBVA 2RHKA 3VTHA 3OBWA 1L3SA 3QINA 3THXA 3CMEN 4FJIA 1GOBA 3AVAA 2ZJPL 1X3MA 1EXQA 4EP5A 1EO1A 4X65K 4KHPK 1SL2A 3QEVA 4KPYA 2Q3SA 4BRFA 5GAGP 3KLGA 5GAEP 4ISFA 3V9SA 3KD5E 3I8DA 3EE8A 3JS6A 1RDDA 2V7YA 2A1SA 3TU5A 4B1UB 4FOEA 2KLAA 3EO3A 5AR0A 4FM2A 3RR8A 3HL8A 3SUOA 4H0XB 1VSHA 3CJ7A 4CJKA 4Z4GA 1NOZA 4M3WA 2YJFA 4KRFA 2ZE2A 4AF1A 4YFUA 2YHWA 4FWNA 3NDKA 3MXIA 4I9QA 5KTQA 2Z1JA 4JNEA 3IG1A 4FK2A 1K8KB 3AVKA 1U2VB 3LANA 4KHQA 1Y97A 3WQTA 1S22A 2KFNA 2IVNA 4H5NA 3CHWA 3SQ1A 2E20A 2P9NB 3AAPA 2E2OA 2W41A 4JS4A 4E7HA 2CGLA 3CCLN 4ILGB 3FFIA 2OANA 1VQ9N 3LZIA 2CH6A 3CMAN 4DR4K 1KVCA 4ZTFA 2WOMA 2D0CA 3KWIA 4DV0K 4CZIA 4DSJA 4CIEA 1U48A 5GAHP 3RMDA 3V1OA 5KPRA 3M5RA 3P39A 2ZGZA 5CYQA 4FWRA 4EAHD 2XY6A 1BA0A 2GBZA 3OS1A 4KTZA 3S9HA 3HBTA 1TK5A 4FJXA 3ALYA 4YY3K 4DTXA 4GV3A 3EKSA 4LF5K 1ZBFA 1JLQA 1VQ4N 1LWFA 1T44A 3G4SN 5KI6A 4CK2A 5M1PA 3ZEUB 1MWMA 5T7BA 3BZKA 3WXKA 3UKRB 1NLVA 1RILA 1LOTB 2G8FA 3H1QA 4B9VA 3F9MA 4Z4FA 3WQUA 1MWKA 2P9UA 2NZTA 3QDKA 2QKBA 3L6QA 3PX4A 4CZLA 2GX9A 2YNHA 2ZJQL 1RBSA 4W5OA 4OLBA 1JL2A 3T1AA 1YITN 2OTLN 3SAGA 3HOSA 3L2QA 1NJZA 3C6UA 4JD2B 3VEWA 4K41A 3CETA 3VQ5A 1C1BA 2OA8A 4IFVA 3QEIA 5J2MA 2P9LB 1ATNA 1VQPN 4M3UA 1HQUA 4CIFA 4B3MK 3F5TA 4B1WB 1IKWA 2Q0UA 3O9RA 3LZJA 1E3MA 4CHOA 1I3AA 4K8XA 2O8EB 3TPQA 5AQQA 1OH5A 4FW2A 4BE0A 1JCEA 2Z1GA 4JEPA 4CZFA 3CJ9A 4FOIA 2D1KA 3EYZA 3DXKA 3ULEB 2FSNA 1N32K 3A0IX 1VQ6N 2NRXA 3KHYA 5AQSA 1Z6RA 3H3OB 1C0TA 1OVYA 1X3NA 3SMSA 2B4JA 4JRQA 4RG8A 2NRZA 4BC5A 2QI2A 4MFBA 1ITGA 3QFUA 2ZD1A 4HCCA 3LDSA 1HLUA 1S1UA 4JHDB 1HYVA 5C2FA 2FLOA 3VQEA 3V1QA 3T7ZA 3TSUA 5AZIA 4FO0A 3OYMA 3EEQA 5FRMA 2VWJA 4PWDA 5KPTA 2NRTA 4DR7K 4BVOA 4DCHA 4BC3A 4I6MB 4AHVA 4RW6A 5J2QA 2VWBA 5AQHA 2RF2A 3ZSWA 4DFJA 3OS0A 3M6GA 3I0SA 3RRGA 4DV4K 1RT5A 3OBYA 1YT3A 2HSTA 4DG1A 1WSGA 3I8BA 1R0AA 4A5AA 1YHQN 1JL1A 1KVBA 3OYJA 4DV6K 1JLFA 3M3ZA 1S3XA 3HJFA 1ILYA 3TAMA 1NKBA 3LPUA 4CJ4A 4C1NK 4WF9L 4CZMA 3HYFA 4EZ9A 3SQ0A 3NHGA 4RW7A 3DLHA 3CI5A 2BGGA 4DQPA 4BR4A 3VQDA 2CGJA 1NJXA 2Q97A 2YHBA 2FBVA 3P4IA 3ZSZA 2P9SA 3R8EA 3E9OA 1ZBLA 2YX6A 4GMJB 3QIPA 1VSEA 4FZZA 1ATRA 4H0OA 3QMLA 4L8RB 3WXIA 4CHYA 3OYDA 3KZBA 5BRHA 5AQRA 4MLHA 5C0YA 4DSLA 1SQKA 5AJ3K 3QESA 3I33A 3PSIA 4MDAA 5EXWA 4DQQA 1RTDA 3W3DA 3ENOA 2F9TA 1KAYA 5TKWA 2WFBA 4KV8A 4BC2A 1JJ2M 2X6SA 4DHYA 3FLCO 4QS9A 3SJHA 3ZT3A 1L3TA 1TKTA 3KWGA 4C8KA 3OVNA 4FXDA 4QCLA 2EX3A 5C12A 1ASWA 3BZCA 4G9ZA 2XO7A 4DMNA 1LAVA 2ZQBA 3AVMA 4OGCA 4E3SA 3L4IA 4WE1A 1VHXA 2QWLA 4IEEA 2A5XA 1JXEA 4O0JA 2YNGA 3THYA 3VQ6A 2KW4A 4A2BA 3MN9A 3VA3A 2E2NA 4AHCA 2YCHA 3AA5X 3CJ1A 3GE1A 4AM7A 4CBWA 4CZHA 5FPMA 4JI6K 1Z05A 3F9KA 3HPGA 5AQLA 4CBUA 3SUQA 4KHYA 4ZTJA 3A8YA 4O8KA 4KHNA 4LSNA 1S6QA 2HHSA 3VN5A 2YHYA 1HJRA 4CE9A 3TAEA 3TAGA 5C10A 5JLHA 1HNZK 1HNWK 1WBBA 3DM2A 2YJEA 4BRAA 4MO4A 3ZX0A 2VG5A 1X9SA 2O8DB 3V4IA 3O9QA 4O8UA 4CVNE 5BPLA 4AILC 3R3LA 1U45A 3OYFA 3LL3A 4O44A 4LFCK 5JMVA 3H46O 4YORA 4PQUA 4X62K 1S1VA 4CGHA 2E8AA 4AQYK 3NVKA 1JLAA 1QQCA 3AVLA 4B1VA 5A2QO 2ITMA 3B6PA 4PKHA 4KI4A 3IDHA 4YOWA 2X6NA 4JI8K 3ID6A 3SCXA 3KLIA 2QXFA 1VRTA 1BWFO 1GLJO 1NGHA 2RKIA 4O55A 5HBMA 5M1QA 2G8HA 5BREA 3CPEA 3DLKA 1KXPA 5HRNA 3R6MA 3BUZB 1WLJA 1OH6A 4J2EA 3UB5A 2VWKA 4EP4A 3P5JA 3M8PA 4FW1A 1M1KO 4K0KK 2HVHA 2X74A 2W6LA 4BACA 4ILJA 2XY5A 5BPNA 3AVGA 4BGBA 2HBLA 3SV3A 4BRKA 4CZJA 4X64K 4DQRA 4DWIA 3FZLA 1XWLA 4HUEA 3DXMA 5I9EB 3DLGA 3EL2A 3IS9A 1BISA 2HMPA 4H0PA 3U9ZA 5AZJB 2KKZA 3VA0A 4IDKA 3DLRA 3DOLA 5FPDA 4NB4A 2O8BB 1LW2A 4JAXA 3AGKA 3LP1A 1SZ2A 5E41A 3C0BA 2OZMA 3CC4N 1S1XA 3AY9A 4CJ7A 4DTOA 4GKKK 5CZ2A 3VOVA 4AHSA 4AHTA 5M1KA 4LH5A 3O4WA 3BP8A 4CF8A 3O80A 3U8XA 1U49A 1HRHA 3WUHA 3CF5L 3CFPA 1N6QA 4FYDA 2E1YA 2YKNA 5BRFA 1ASUA 2O8CB 1MU2A 3SK3A 4FWOA 3WEEB 3CM6A 4FLZA 4OKJA 3NAEA 2HNDA 1XHXA 3A5LC 5B8HA 3CC2N 5LJVA 1NJIO 1Q86O 4GVMA 3WNFA 1NK4A 1A5VA 3O9SA 1XI1A 4CF9A 1CZ9A 5F2RA 1BHLA 4LF4K 3F2KA 3PO4A 1KFSA 2ATQA 4BE2A 3HTVA 1SS6A 2R7YA 1RBTA 1X9MA 3SAFA 3SI6A 5AFUA 5EU7A 3A5OC 1C0UA 5GINA 5HRSA 1KC8O 2QW9A 4WQ5A 3CQYA 3JSMA 1ASVA 2P51A 2YHXA 3OYCA 2CH5A 1JLGA 5F0XA 3D0PA 1CLQA 4BGAA 5FDLA 3AO5A 4E0DA 3OHRA 3DMJA 1NU0A 2P5GA 1IG8A 3R9PA 2A6AA 4DTRA 2AA4A 4E1MA 5AQUA 4XIUA 2HBJA 3ZSRA 4I7FA 2WC9A 1ZXOA 2QA4N 2G8IA 2AP1A 3CXCM 4DV5K 1TVRA 3HP9A 2VGNA 3E1YA 4C8OA 4JRPA 2UUAK 4FJMA 3QB0A 1YJNN 2DY4A 1OH7A 3PY8A 3MECA 1NGGA 1WNSA 4FLVA 1KQSM 3THWB 4JKGA 1RGIA 1GLBG 2WTUA 1BA1A 4ID1A 3TABA 3M8SA 4DLGA 4FWQA 3FZFA 1U4BA 1TKXA 4QOZB 4FK0A 4UY8O 3K2PA 5AQTA 4PKGA 1W0HA 2P9KB 4WFAL 2DPNA 5C25A 4FJJA 3VQQA 4JKCA 2BE2A 4CZGA 3A2FA 3D2FA 4BRMA 3J7AP 3O4NA 1FJGK 1B9FA 5AQVA 3O4QA 4FM1A 1VQNN 2GV9A 4FJKA 4JKBA 1NK7A 4DFMA 4FJ9A 4ELVA 2W6KA 1S6PA 3WXJA 1Q9XA 4IOCL 4PUOA 4CD3A 2P9UB 1W9HA 4AM6A 2HNYA 1D8YA 1EP4A 3ID8A 2HBMA 3LP2A 4E19A 4CZEA 3OYNA 1X9WA 1GLCG 4B9TA 5M1FA 2HNZA 1HNIA 3J81O 1TKZA 2UUCK 4KB0A 3DWLA 3IKMA 3AO2A 4CEDA 1NK8A 4DU3A 1HYZA 1N34K 1G99A 3TSQA 3J7ZO 2BTFA 5KGXA 4DUZK 2ASPA 5J2PA 2O4IA 3DLEA 1OH8A 2B6AA 1A5XA 4JKAA 2P9PA 1MDUB 1NGBA 4CJEA 2G8WA 3OS2A 4DF8A 2Q1NA 3HP6A 1J53A 5JVHL 4HUGA 3HO1A 4U67L 3SMPA 2QTDA 1BI4A 4EHTA 4DB3A 2I7NA 4GV6A 4YDUA 1D9FA 2V7ZA 1M90O 3ZLJA 4LD0A 2QKKA 4Z0UA 1K6YA 4M63C 1GOCA 1I94K 1TGOA 1IJJA 4AH9A 3GOIA 5HRRA 4I2PA 1S9EA 4FWKA 1LCUA 3ZSXA 4JKEA 4CJTA 1IKXA 4YOXA 1KLMA 1C1AA 2IC3A 3AA4A 2HHWA 1TL3A 4BROA 2UUBK 4GV9A 1NKCA 1GLEG 1RT4A 4ISEA 3HM9A 4N76A 3V9ZA 5C42A 1RTIA 3ZSVA 2ZWHA 3TWHA 3GDQA 4MO5A 3FE1A 3HSTB 3L2RA 4O4GA 3WXMB 3UKUA 5HRPA 3D2EB 3CJCA 2YV0X 3EN9A 4JK8A 4M3YA 3SLCA 5I42A 2RPIA 4FLXA 1HMVA 4GY2B 4H4OA 3KK2A 5SWMA 5BR9A 4ELUA 4BG9A 1JLCA 1RBRA 4F3OA 3VEYA 4Y1CA 3KD1E 5CZ1A 1RCHA 4JN4A 3CPWM 5HROA 1TK8A 1NK6A 3VETA 1HKCA 1EX4A 4G1QA 4FLTA 1EWRA 4CEQA 3ASMA 3VQ9A 3L3UA 4N41A 3JAMO 4M42A 5CYMA 1W97L 1CZAN 5AQWA 3DJCA 4WQ4C 3G25A 4R5PA 2A3ZA 4M7YA 3BGRA 5AQKA 1N8RO 3JYTA 1FKPA 3K59A 4K42A 4IJAA 3CFRA 3NH2A 5BPMA 3QICA 1NGFA 2ETJA 1FXXA 3VQCA 4BRDA 4BDYA 1K8KA 4Z4HA 3AO4A 4WCEL 1U2VA 1RDUA 4CJPA 3T1HK 3FZHA 1D4XA 3K0SA 3VQ8A 3ZX3A 3CCQN 4DUYK 1HR0K 4JK7A 3PO5A 3AVJA 1RNHA 4OVLA 4CEFA 3FFKB 1TAQA 3GBTA 1GLFO 1QZ5A 4I2QA 5KRTA 1K73O 4H4MA 4CI6A 4B9LA 1RDAA 4JV5K 2HHHK 1BGXT 1TAUA 3DLBA 1U47A 1CXQA 1IBMK 3RTVA 1HKGA 3OYLA 4OJRA 4CEZA 1IO2A 4NYFA 4B9SA 2E2QA 3EE9A 1LWEA 1U04A 4A59A 1RBUA 1JLBA 3L3VA 1XMOK 1HPMA 4BRHA 4LF7K 4DSIA 3AAQA 4A62A 1X1PA 3NGIA 3ZEUA 4MLEA 3I55N 1E4GT 3HK2A 3UKRA 3P1GA 4K43A 1N33K 3PIOL 3BDPA 4Z4EA 3T69A 2VQEK 3AO1A 4NCAA 4CFAA 3EZWA 2NRVA 1VQMN 3DRRA 1YJWN 3NMUA 1HNVA 1RDWX 3O3FA 1S1WA 3AVBA 3K9KA 1JXBA 3QBWA 3D6RA 4JD2A 4DR2K 1QVGM 3ULDA 1RFQA 5D3GA 1TKDA 4YDUC 3L2VA 1IV0A 4BDZA 3RSEB 2P9LA 1NG9A 1H1VA 2F7TA 4Q5VA 1T03A 4FM0A 5AQNA 5AQFA 1WSJA 3VF6A 1NJYA 2E1ZA 2WUSA 2PY5A 4LFAK 2KQ2A 3MEDA 2IAJA 3U6FA 5M1NA 4EZ6A 4M41A 1RT6A 2NUBA 3CFOA 5CR4A 4H0VB 3NF6A 2O8EA 2D5RA 5FROA 4KTQA 1GLAG 1JKHA 3O3HA 2BDPA 3V81A 3EKUA 1NMNA 4CGDA 2VGMA 1Z25A 1IKVA 1K9MO 4BQLA 1ZBUA 4E89A 2KFZA 1EQYA 3IRXA 5JS2A 2DFFA 4OPJA 3DAWA 3V9WA 3CCJN 1T05A 3K5LA 3C7NB 5E84A 3KK1A 3OYBA 3CJAA 4JHDA 3AVHA 2NNWA 4KREA 1DKGD 3AVFA 1LV5A 3MWTA 4K25A 4OPAA 4RW4A 4CJFA 3BY5A 4FWPA 4IOXA 3VQBA 3HOTA 3AVIA 2P1JA 4FPAA 1YI2N 4DS4A 4I6MA 1SUQA 2HF3A 2XHBA 4YOUA 3QFPA 3SPYA 2W42A 4FJNA 4DFKA 3CJBA 3J8AA 4Z4CA 3M8RA 5IT9O 2F4VK 4CBXA 1WOQA 1BIUA 1VQKN 1ZBHA 1TYQA 3O3GA 3G71N 4OPHA 1HX1A 3ZT0A 2YI1A 3ENHA 5BN8A 1D5AA 1VQ5N 1QSYA 4IWVA 3SJJA 1WSFA 3V1RA 4YOYA 2OPPA 4CFCA 4B9UA 4M45A 1QQMA 1B92A 4H03B 4HCBA 1HYSA 5AQZA 2YNFA 4CK1A 4OX9K 4IBNA 1KVAA 1VSJA 4DV3K 4CESA 1TUYA 4BRLA 3KVGA 1HKBA 3S3OA 3SNNA 4M3XA 3CCSN 3UIQA 2GUPA 1YVUA 3OW2M 1QE1A 5FPNA 1I39A 2DFEA 3HPOA 2O8FB 3S41A 4CJ3A 1NBWA 4NXMK 1XC9A 4KB1A 1V4TA 4FL9A 3O08A 4DLEA 1N36K 1YXQA 2D0OA 3MEGA 4BQZA 2I7PA 5BN9A 3AA3A 3P38A 3LP3A 5CE3A 3FGUA 1S9GA 3VPZA 2W40A 2HHQA 2NRWA 4LFBK 4C1NI 3ZETA 4B8CA 5EOYA 1S5JA 3MCAB 1BOTO 3LALA 5CY4A 5AQOA 4BR0A 3SUPA 5MLCQ 3LDPA 3CCRN 5JS1A 4B9MA 3DI6A 1X9JA 1YTUA 2OPQA 1KAZA 3KKRA 3V9UA 1NGDA 1SKSA 3O8MA 2A40A 4NLCA 4CCHA 4JI1K 4XH4A 1WSIA 4PHTX 3TTCA 3C95A 3SYZA 4O0IA 1J5EK 5JICA 1QTMA 2P9IB 3VEVA 3D45A 1QHTA 3C94A 3H3NO 1LWCA 4CIGA 3VQ7A 4Y1DA 3T3FA 3IAYA 5K14A 5GIPA 3TR8A 3THXB 3G10A 3V9XA 5SZTA 3O1BA 4HTLA 3TTFA 3E9LA 5C15A 4J2DA 2BANA 3OY9A 1KSPA 1NNEA 3SPZA 1HQEA 1EETA 4XEIA 4B9QA 4FJ8A 3QEWA 4YOTA 1TV6A 4N5SA 3DRPA 3WT0A 4N56A 2ZM6K 4OPKA 1R59O 1YJ9N 3ITHA 4NCGA 2IVPA 2O8DA 4FWLA 4C8MA 4B08A 1T7PA 2G8KA 1UAXA 4WFBL 4CJRA 1SV5A 4IG0A 2IIRA 1KFDA 5ADXH 4F2RA 4FJ7A 4AHUA 5AQXA 2HF4A 4YOVA 3D7EO 1UWBA 3DOKA 2P9PB 3AA2A 1RTJA 3NGYA 4DV2K 2IGIA 4ICLA 3QETA 3ENBA 4GVEA 4LF9K 4DR6K 1FKOA 2VCPA 2GELA 4Z4IA 3MX2A 4KH6A 1DTTA 4CHPA 1REVA 1DT9A 2YKMA 3MEEA 4PY5A 5C24A 5AQJA 4CHZA 3K5OA 4IOAL 4DSFA 4PKIA 3WNGA 3ZT1A 3RR7A 4CZKA 3GG4A 3LWLA 4H5WA 3VGMA 4H5RA 4CW7B 2PFUA 2CGKA 4HTUA 2OTJN 1XMQK 1NK0A 3P83D 1WAFA 3QIOA 4CERA 3LAMA 1DLOA 1VQON 4OGEA 1WB9A 4U7BA 4J8FA 4NXNK 2D0BA 1IG9A 3E66A 5LMUK 2O8BA 3VGKA 3QLHA 4KHWA 4CF1A 1DTQA 1XUPO 4CF2A 1WBDA 1D9DA 4JI5K 1QSSA 4XH1A 4DTMA 5C2DA 2H3GX 1K8AO 3MX5A 4LF6K 3OYGA 3SZ2A 4DTPA 2OPSA 5I3UA 4F4KA 3UKUB 1C1CA 4PA1A 2FF6A 2QWNA 2AJQA 3Q7CA 4FWMA 1NGAA 3DRSA 4IJNA 4N47A 4FZXC 4CD1A 3EY1A 4C8LA 1RDBA 3HXMA 2HVIA 1GLLO 1VSLA 3K58A 1KD1O 2KHOA 4JKHA 4ISGA 4AHRA 4JYAK 3VESA 1TL1A 2O8CA 2RN2A 3WEEA 3H45C 4DQSA 1RDCA 4BE1A 4BRQA 1P90A 3O5BA 2OYQA 4WFNL 2Z1HA 1ZC6A 4W5TA 1RT2A 1T6CA 4M7XA 1ZYQA 3L0QA 4E7LA 3GL1A 3I56N 1JCFA 5TKYA 3CG7A 1DEJA 3TARA 4M3TA 1J6ZA 2O4GA 4V19S 1IBLK 5J2NA 4JI3K 1NOYA 3K5NA 1C0MA 4CHNA 3VQAA 4C8NA 4IG3A 3NVMA 4DF4A 5FLXO 3DXKB 2ASOA 3LP0A 2QM1A 3H1VX 1KCFA 1SKRA 1XQSC 3H6EA 3VEOA 3OYHA 1W2BM 4Z94A 4YNQA 1O13A 3SQ4A 2E88A 1Q9YA 4DSKA 2UXBK 3OYIA
chains in the Genus database with same CATH topology
3SUNA 3LWMA 4E1NA 4B9LA 4AILC 1RDAA 4M3RA 4KO0A 4DS5A 1T8EA 1U45A 1BGXT 3OYFA 5KRSA 4F8RA 4OLAA 1BI4B 4O44A 1TAUA 3DLBA 1U47A 4PQUA 1CXQA 2FBTA 4DTNA 4W5NA 3NGZA 1Z26A 1S1VA 3OYLA 2ITGA 3RTVA 4CGHA 3OYKA 4OJRA 4DQIA 4CEZA 1IKYA 1IO2A 1JLAA 4BWJA 4NYFA 1QQCA 4B9SA 3AVLA 1BL3A 2PYLA 1TK0A 3KTQA 1LWEA 1U04A 4ID5A 2JGUA 1RBUA 1JLBA 3M8QA 4J2BA 3ZT4A 3B6PA 4KI4A 3L3VA 3AV9A 2X6NA 4FLYA 4TSXA 3SCXA 3KLIA 4DSIA 4DTJA 4FK4A 4W5RA 2QXFA 1VRTA 4DU1A 1X1PA 2IOCA 2RKIA 4JLHA 1A5WA 4O55A 5HBMA 3NGIA 3QEXA 2G8HA 4M3ZA 3HK2A 2HW3A 3DLKA 3CQ8A 3P1GA 5HRNA 2X78A 2XY8A 3QEPA 1J54A 1WLJA 4FVMA 3THVA 1N5YA 4J2EA 2VWKA 4EP4A 3P5JA 4CHQA 3NH1A 3M8PA 3SV4A 2FC0A 4FW1A 3QNOA 3BDPA 4Z4EA 2HVHA 4FZYA 2X74A 4E7JA 3RMCA 1B9DA 3F73A 3HVTA 4BACA 4FJ5A 2XY5A 3AO1A 3AVGA 3KLEA 4CFAA 3SV3A 4NCAA 3KLFA 3DRRA 4KTWA 4DQRA 4DWIA 1NKEA 4CECA 2A1RA 1HNVA 1XWLA 4B8AB 4HUEA 4FJLA 3O3FA 1S1WA 3KIOA 3AVBA 3DLGA 2OZSA 2HHVA 4ELTA 1JXBA 1EKEA 3IS9A 1BISA 3MAQA 3VA0A 2G8VA 2HHXA 4CEBA 1KRPA 3ULDA 4IDKA 3DLRA 2P5OA 3DOLA 5D3GA 1TKDA 1VSFA 4CGIA 3L2VA 1LW2A 4BDZA 1XHZA 2PZSA 4Q5VA 1L3UA 1T03A 2EHGA 4FM0A 1WSJA 1NJYA 3QO9A 3TANA 1UOCA 2PY5A 4B9NA 2KQ2A 4CEAA 3MEDA 2IAJA 3LP1A 4LSLA 3NF9A 3U6FA 4EZ6A 5E41A 4M41A 1RT6A 2NUBA 4W5QA 1RBVA 2OZMA 1F21A 3CFOA 1S1XA 2E6MA 3NF6A 3G0ZA 4DTOA 1VK0A 1L3SA 2DTUA 3QINA 2D5RA 5CZ2A 5FROA 4KTQA 4AHSA 4AHTA 4LH5A 4FJIA 1GOBA 3AVAA 1JKHA 4CF8A 1EXQA 3O3HA 2BDPA 3V81A 4O5BA 4CGDA 3EZ5A 4I9LA 4EP5A 4CJUA 4CFDA 1Z25A 1IKVA 1U49A 1HRHA 4FYDA 3CFPA 1UA0A 1SL2A 3QEVA 1N6QA 2Q3SA 4KPYA 1ZBUA 4E89A 2YKNA 2KFZA 3IRXA 5JS2A 1ASUA 3KLGA 4JS5A 1MU2A 2DFFA 4OPJA 3V9WA 3WNEA 2QK9A 3CM6A 1T05A 3K5LA 4FLZA 3V9SA 3KD5E 3KK1A 1L3VA 3I8DA 3OYBA 4DU4A 1YTAA 4OKJA 3NAEA 2HNDA 3AVHA 1RDDA 1QS4A 1XHXA 4KREA 1GOAA 3AVFA 4KHUA 2E6LA 2B5JA 1LV5A 3KJVA 4GVMA 2A1SA 3OJUA 3WNFA 4FM2A 3T19A 3SQ2A 3RR8A 4J2AA 1NK4A 3CM5A 1A5VA 3HL8A 4CF9A 3SUOA 1XI1A 2D0AA 4RW4A 1VSDA 1FK9A 1VSHA 4CJKA 3OYAA 3U3YA 1CZ9A 4CJFA 1BHLA 4Z4GA 1NOZA 4M3WA 3VQBA 4KRFA 3AVIA 2P1JA 2ZE2A 3PO4A 4DS4A 3ZCMA 4YFUA 3TAQA 1KFSA 4FJGA 2ATQA 4H8KA 5DMRA 4CGFA 4CJ5A 1SUQA 2DFHA 2XHBA 3NDKA 4BE2A 3MXIA 5KTQA 3SPYA 4I9QA 2Z1JA 2W42A 3IG1A 4DFKA 4FJNA 4FK2A 2R7YA 3QNNA 2YHAA 2HHUA 3AVKA 1RBTA 1X9MA 4NCBA 3SI6A 5EU7A 5KGWA 4NYNA 1C0UA 3LANA 4Z4CA 3ISNC 4DFPA 3M8RA 1Y97A 4KHQA 3NF8A 3PX6A 5HRSA 2KZZA 2KFNA 3JSMA 1BIUA 1ASVA 2P51A 3SQ1A 1ZBHA 3O3GA 3AVNA 1KLNA 3OYCA 3D0PA 1BCMA 1JLGA 1CLQA 4JS4A 3ZT0A 5FDLA 3AO5A 4FLWA 4E7HA 4E0DA 1VSKA 3DMJA 1D5AA 5HLFA 2P5GA 1QSYA 4B3OA 3SJJA 4DTRA 1WSFA 3V1RA 2OPPA 4CJLA 4E1MA 1BQNA 4CFCA 4XIUA 4B9UA 3ZSRA 2HB5A 3FFIA 4M45A 3NE6A 1B92A 4CGJA 4I7FA 3LZIA 3NFAA 3MXMA 4HCBA 1KVCA 1HYSA 2YNFA 4CK1A 2WOMA 2XY7A 2D0CA 4ZTFA 4IBNA 1KVAA 4DSJA 1VSJA 3MXJA 4CF0A 3HVRA 4CESA 4CIEA 1U48A 2G8IA 3RMDA 2F8SA 3KLHA 3V1OA 4RW9A 3RMAA 3NCIA 5CYQA 4CFBA 3S3OA 2XY6A 3SNNA 4M3XA 4DTSA 1TVRA 2GBZA 3OS1A 2G8UA 3HP9A 1WAJA 4KTZA 3S9HA 4CK3A 3PUFA 1TK5A 1QSLA 3UIQA 1YVUA 4FJXA 3ALYA 4DTXA 1QE1A 1RTHA 4CJWA 1I39A 1BQMA 2DFEA 3HPOA 4JRPA 1SKWA 4C8OA 4FJMA 1ZBFA 1JLQA 4KKOA 4CJ3A 2DY4A 1O1WA 2WONA 3PY8A 3MECA 1LWFA 4E7KA 1WNSA 1XC9A 4KB1A 5KI6A 4FLVA 4CK2A 1SL1A 4DLEA 2YNIA 3MEGA 5T7BA 4ID1A 3TABA 3M8SA 4DLGA 1RILA 2G8FA 3AA3A 4B9VA 4GW6A 3LP3A 3OYEA 3H08A 1TKXA 3L2UA 1U4BA 4FK0A 4Z4FA 4QOZB 3K2PA 4F2SA 1S9GA 4CJVA 2QKBA 4Q0BA 1W0HA 3PX4A 2HHQA 3L8BA 5C25A 4FJJA 3VQQA 3LPTA 2YNHA 3B6OA 2BE2A 3A2FA 1RBSA 4B8CA 4W5OA 3NH0A 3S3MA 4OLBA 3O4NA 1JL2A 3T1AA 1NK5A 2LSNA 1S5JA 1B9FA 3O4QA 4FM1A 2GV9A 3L2QA 1VSMA 4FJKA 3LALA 5CY4A 4FLUA 1NJZA 4FJHA 3C6UA 3SUPA 1NK7A 4DFMA 4FJ9A 4B9MA 3VQ5A 3DI6A 4ELVA 1C1BA 1S6PA 2OPQA 3KKRA 3V9UA 1Q9XA 1SKSA 1YTUA 2OA8A 4IFVA 4CCHA 3QEIA 5J2MA 4ZHRA 4PUOA 2E4LA 1W9HA 2HNYA 1VRUA 1D8YA 4QAGA 1EP4A 1WSIA 5J1EA 3LP2A 4E19A 4M3UA 1HQUA 4BDPA 4CIFA 3OYNA 1X9WA 3C95A 4KHSA 3SYZA 4O0IA 4B9TA 1QTMA 4UQGA 1IKWA 3D45A 2HNZA 1HNIA 1QHTA 3C94A 1LWCA 3ZT2A 4CIGA 3VQ7A 3HT3A 3LZJA 4Y1DA 4CHOA 3T3FA 1I3AA 1TKZA 3IAYA 4E7IA 5K14A 4K8XA 4KB0A 2VG7A 4FW2A 3TR8A 4BE0A 3CYMA 3G10A 3AO2A 2Z1GA 3V9XA 4CEDA 5SZTA 1NK8A 1RT1A 4DU3A 1HYZA 4CEOA 3TI0A 4J2DA 4LH4A 4OKKA 2BANA 3OY9A 3EYZA 1LW0A 5KGXA 1KSPA 3SPZA 1HQEA 1EETA 5J2PA 4FJ8A 3QEWA 2O4IA 1TV6A 4N5SA 1CXUA 3DLEA 1C0TA 3DRPA 3QERA 4N56A 2B6AA 1A5XA 1BCOA 2B4JA 4OPKA 4JRQA 4RG8A 3ITHA 4CJEA 1NJWA 3HPHA 3OS2A 4MFBA 2G8WA 1ITGA 4NCGA 4DF8A 2ZD1A 4HCCA 3LDSA 3HP6A 2XRIA 1S1UA 4C8MA 4B08A 3V6DA 3TAPA 2G8KA 1T7PA 1UAXA 1J53A 4HUGA 3HO1A 1HYVA 4HUFA 4CJRA 3S3NA 1SV5A 3VQEA 2HMIA 3V1QA 1BI4A 3AO3A 4IG0A 1KFDA 3ZSOA 3OYMA 5FRMA 4MQ3A 4F2RA 2VWJA 2FBYA 4PWDA 1D9FA 4FJ7A 4AHUA 3L2WA 3TAFA 1UWBA 4LD0A 2QKKA 4Z0UA 3DOKA 4RW8A 3AA2A 1K6YA 1RTJA 4AHVA 3NGYA 4RW6A 1GOCA 5J2QA 2IGIA 1TGOA 1J5OA 4ICLA 4AH9A 3QETA 5HP1A 5HRRA 4I2PA 1S9EA 2RF2A 3ZSWA 4CGGA 4DFJA 3OS0A 1FKOA 4FCYA 2IDOA 4CEEA 3I0SA 3ZSXA 3RRGA 4Z4IA 3KKSA 3LAKA 1RT5A 4CJTA 4F3TA 4DTUA 3VQ4A 1YT3A 1DTTA 4CHPA 1REVA 3OJSA 1IKXA 2YKMA 1KLMA 1C1AA 2IC3A 3AA4A 3MEEA 4DG1A 1TL3A 4PY5A 5C24A 2HHWA 4CHZA 1WSGA 4OKEA 3K5OA 1R0AA 1NKCA 1RT4A 3HM9A 4DSFA 4N76A 2F96A 3WNGA 3ZT1A 5C42A 3V9ZA 1RTIA 2JLEA 3RR7A 3LWLA 2FBXA 1JL1A 3ZSVA 3TWHA 1KVBA 1L5UA 3OYJA 1C6VA 5FRNA 1CZBA 3RMBA 1S1TA 3HSTB 4HTUA 1JLFA 3L2RA 4O4GA 3HJFA 1NK0A 3P83D 3TAMA 2Y1IA 1NKBA 3LPUA 1WAFA 3QIOA 4CERA 4CJ4A 5HRPA 4K8ZA 3LAMA 1DLOA 4OGEA 3HYFA 4EZ9A 2D0BA 1IG9A 2YV0X 4LY7A 3SQ0A 4HHTA 4M3YA 1J9AA 4RW7A 3NHGA 4DSEA 3DLHA 4IFYA 3QLHA 5I42A 4KI6A 3PX0A 4DQPA 2BGGA 4KHWA 4CF1A 1DTQA 2RPIA 3VQPA 4FLXA 3RWUA 1IH7A 4CF2A 1D9DA 1HMVA 3VQDA 1QSSA 3KK2A 4H4OA 4KFBA 4DTMA 1VSIA 1NJXA 2YHBA 1ZBIA 2FBVA 3ZSZA 2Z1IA 5SWMA 2Y1JA 4CJQA 4ELUA 1ZBLA 5JS1A 4GMJB 3QIPA 3OYGA 1WSHA 1VSEA 3SZ2A 4DTPA 2OPSA 5I3UA 4FZZA 4F4KA 1JLCA 1RBRA 4F3OA 3E01A 1C1CA 4PA1A 4L8RB 4CHYA 3PV8A 2AJQA 4Y1CA 3KD1E 5CZ1A 1RCHA 3OYDA 3ZSQA 3K5MA 5HROA 1TK8A 3DRSA 1NK6A 2HHTA 4FZXC 4N47A 2F8TA 4DSLA 3EY1A 1EX4A 3QESA 4C8LA 1RDBA 3HXMA 2HVIA 4G1QA 4FLTA 2IS3A 4CEQA 2PYJA 1VSLA 3K58A 4DQQA 1RTDA 4AHRA 3ASMA 3VQ9A 3L3UA 3WNHA 4N41A 1TL1A 2RN2A 1BIZA 4M42A 5CYMA 5DK5A 4DQSA 4KV8A 1RDCA 4BE1A 2X6SA 2OYQA 3C6TA 2Z1HA 4R5PA 4W5TA 3ZT3A 1L3TA 1RT2A 1NK9A 1TKTA 3I0RA 4C8KA 1RT7A 3OVNA 4FXDA 4QCLA 2EX3A 1ZYQA 1ASWA 3BGRA 2XO7A 1Q8IA 4DMNA 3JYTA 1FKPA 1LAVA 4E7LA 3AVCA 2ZQBA 3AVMA 4OGCA 4E3SA 1SL0A 3K59A 4WE1A 1JLEA 1HPZA 2VG6A 3NBPA 3CFRA 1JXEA 4O0JA 3U3GA 3CG7A 2YNGA 3NH2A 3K57A 2I5JA 3VQ6A 2ETJA 2KW4A 1FXXA 3TARA 4M3TA 2O4GA 3VA3A 3VQCA 4AHCA 4BDYA 3DYAA 5J2NA 1NOYA 3K5NA 3AA5X 1C0MA 4Z4HA 3AO4A 4IKFA 4CHNA 3ZSYA 4CJPA 1WSEA 4HVJA 3VQAA 4C8NA 4IG3A 1G15A 1RT3A 3F9KA 3HPGA 3RRHA 4DF4A 4CJSA 3SUQA 4KHYA 4ZTJA 2KTQA 3VQ8A 4KAZA 1WN7A 3LP0A 4KHNA 3PO5A 3AVJA 1RNHA 3NF7A 4LSNA 1S6QA 1KCFA 4OVLA 3VN5A 2HHSA 4CEFA 1SKRA 1UA1A 1LAWA 1HJRA 3KK3A 4CE9A 3TAEA 2OPRA 3TAGA 1TAQA 3OYHA 3DM2A 2GUIA 2KZMA 4YNQA 3SQ4A 4I2QA 2VG5A 1X9SA 1Q9YA 4DSKA 1KTQA 5KRTA 3V4IA 4H4MA 3OYIA 4BWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUN A;  3LWM A;  4E1N A;  4B9L A;  4AIL C;  1RDA A;  4M3R A;  4KO0 A;  4DS5 A;  1T8E A;  1U45 A;  1BGX T;  3OYF A;  5KRS A;  4F8R A;  4OLA A;  1BI4 B;  4O44 A;  1TAU A;  3DLB A;  1U47 A;  4PQU A;  1CXQ A;  2FBT A;  4DTN A;  4W5N A;  3NGZ A;  1Z26 A;  1S1V A;  3OYL A;  2ITG A;  3RTV A;  4CGH A;  3OYK A;  4OJR A;  4DQI A;  4CEZ A;  1IKY A;  1IO2 A;  1JLA A;  4BWJ A;  4NYF A;  1QQC A;  4B9S A;  3AVL A;  1BL3 A;  2PYL A;  1TK0 A;  3KTQ A;  1LWE A;  1U04 A;  4ID5 A;  2JGU A;  1RBU A;  1JLB A;  3M8Q A;  4J2B A;  3ZT4 A;  3B6P A;  4KI4 A;  3L3V A;  3AV9 A;  2X6N A;  4FLY A;  4TSX A;  3SCX A;  3KLI A;  4DSI A;  4DTJ A;  4FK4 A;  4W5R A;  2QXF A;  1VRT A;  4DU1 A;  1X1P A;  2IOC A;  2RKI A;  4JLH A;  1A5W A;  4O55 A;  5HBM A;  3NGI A;  3QEX A;  2G8H A;  4M3Z A;  3HK2 A;  2HW3 A;  3DLK A;  3CQ8 A;  3P1G A;  5HRN A;  2X78 A;  2XY8 A;  3QEP A;  1J54 A;  1WLJ A;  4FVM A;  3THV A;  1N5Y A;  4J2E A;  2VWK A;  4EP4 A;  3P5J A;  4CHQ A;  3NH1 A;  3M8P A;  3SV4 A;  2FC0 A;  4FW1 A;  3QNO A;  3BDP A;  4Z4E A;  2HVH A;  4FZY A;  2X74 A;  4E7J A;  3RMC A;  1B9D A;  3F73 A;  3HVT A;  4BAC A;  4FJ5 A;  2XY5 A;  3AO1 A;  3AVG A;  3KLE A;  4CFA A;  3SV3 A;  4NCA A;  3KLF A;  3DRR A;  4KTW A;  4DQR A;  4DWI A;  1NKE A;  4CEC A;  2A1R A;  1HNV A;  1XWL A;  4B8A B;  4HUE A;  4FJL A;  3O3F A;  1S1W A;  3KIO A;  3AVB A;  3DLG A;  2OZS A;  2HHV A;  4ELT A;  1JXB A;  1EKE A;  3IS9 A;  1BIS A;  3MAQ A;  3VA0 A;  2G8V A;  2HHX A;  4CEB A;  1KRP A;  3ULD A;  4IDK A;  3DLR A;  2P5O A;  3DOL A;  5D3G A;  1TKD A;  1VSF A;  4CGI A;  3L2V A;  1LW2 A;  4BDZ A;  1XHZ A;  2PZS A;  4Q5V A;  1L3U A;  1T03 A;  2EHG A;  4FM0 A;  1WSJ A;  1NJY A;  3QO9 A;  3TAN A;  1UOC A;  2PY5 A;  4B9N A;  2KQ2 A;  4CEA A;  3MED A;  2IAJ A;  3LP1 A;  4LSL A;  3NF9 A;  3U6F A;  4EZ6 A;  5E41 A;  4M41 A;  1RT6 A;  2NUB A;  4W5Q A;  1RBV A;  2OZM A;  1F21 A;  3CFO A;  1S1X A;  2E6M A;  3NF6 A;  3G0Z A;  4DTO A;  1VK0 A;  1L3S A;  2DTU A;  3QIN A;  2D5R A;  5CZ2 A;  5FRO A;  4KTQ A;  4AHS A;  4AHT A;  4LH5 A;  4FJI A;  1GOB A;  3AVA A;  1JKH A;  4CF8 A;  1EXQ A;  3O3H A;  2BDP A;  3V81 A;  4O5B A;  4CGD A;  3EZ5 A;  4I9L A;  4EP5 A;  4CJU A;  4CFD A;  1Z25 A;  1IKV A;  1U49 A;  1HRH A;  4FYD A;  3CFP A;  1UA0 A;  1SL2 A;  3QEV A;  1N6Q A;  2Q3S A;  4KPY A;  1ZBU A;  4E89 A;  2YKN A;  2KFZ A;  3IRX A;  5JS2 A;  1ASU A;  3KLG A;  4JS5 A;  1MU2 A;  2DFF A;  4OPJ A;  3V9W A;  3WNE A;  2QK9 A;  3CM6 A;  1T05 A;  3K5L A;  4FLZ A;  3V9S A;  3KD5 E;  3KK1 A;  1L3V A;  3I8D A;  3OYB A;  4DU4 A;  1YTA A;  4OKJ A;  3NAE A;  2HND A;  3AVH A;  1RDD A;  1QS4 A;  1XHX A;  4KRE A;  1GOA A;  3AVF A;  4KHU A;  2E6L A;  2B5J A;  1LV5 A;  3KJV A;  4GVM A;  2A1S A;  3OJU A;  3WNF A;  4FM2 A;  3T19 A;  3SQ2 A;  3RR8 A;  4J2A A;  1NK4 A;  3CM5 A;  1A5V A;  3HL8 A;  4CF9 A;  3SUO A;  1XI1 A;  2D0A A;  4RW4 A;  1VSD A;  1FK9 A;  1VSH A;  4CJK A;  3OYA A;  3U3Y A;  1CZ9 A;  4CJF A;  1BHL A;  4Z4G A;  1NOZ A;  4M3W A;  3VQB A;  4KRF A;  3AVI A;  2P1J A;  2ZE2 A;  3PO4 A;  4DS4 A;  3ZCM A;  4YFU A;  3TAQ A;  1KFS A;  4FJG A;  2ATQ A;  4H8K A;  5DMR A;  4CGF A;  4CJ5 A;  1SUQ A;  2DFH A;  2XHB A;  3NDK A;  4BE2 A;  3MXI A;  5KTQ A;  3SPY A;  4I9Q A;  2Z1J A;  2W42 A;  3IG1 A;  4DFK A;  4FJN A;  4FK2 A;  2R7Y A;  3QNN A;  2YHA A;  2HHU A;  3AVK A;  1RBT A;  1X9M A;  4NCB A;  3SI6 A;  5EU7 A;  5KGW A;  4NYN A;  1C0U A;  3LAN A;  4Z4C A;  3ISN C;  4DFP A;  3M8R A;  1Y97 A;  4KHQ A;  3NF8 A;  3PX6 A;  5HRS A;  2KZZ A;  2KFN A;  3JSM A;  1BIU A;  1ASV A;  2P51 A;  3SQ1 A;  1ZBH A;  3O3G A;  3AVN A;  1KLN A;  3OYC A;  3D0P A;  1BCM A;  1JLG A;  1CLQ A;  4JS4 A;  3ZT0 A;  5FDL A;  3AO5 A;  4FLW A;  4E7H A;  4E0D A;  1VSK A;  3DMJ A;  1D5A A;  5HLF A;  2P5G A;  1QSY A;  4B3O A;  3SJJ A;  4DTR A;  1WSF A;  3V1R A;  2OPP A;  4CJL A;  4E1M A;  1BQN A;  4CFC A;  4XIU A;  4B9U A;  3ZSR A;  2HB5 A;  3FFI A;  4M45 A;  3NE6 A;  1B92 A;  4CGJ A;  4I7F A;  3LZI A;  3NFA A;  3MXM A;  4HCB A;  1KVC A;  1HYS A;  2YNF A;  4CK1 A;  2WOM A;  2XY7 A;  2D0C A;  4ZTF A;  4IBN A;  1KVA A;  4DSJ A;  1VSJ A;  3MXJ A;  4CF0 A;  3HVR A;  4CES A;  4CIE A;  1U48 A;  2G8I A;  3RMD A;  2F8S A;  3KLH A;  3V1O A;  4RW9 A;  3RMA A;  3NCI A;  5CYQ A;  4CFB A;  3S3O A;  2XY6 A;  3SNN A;  4M3X A;  4DTS A;  1TVR A;  2GBZ A;  3OS1 A;  2G8U A;  3HP9 A;  1WAJ A;  4KTZ A;  3S9H A;  4CK3 A;  3PUF A;  1TK5 A;  1QSL A;  3UIQ A;  1YVU A;  4FJX A;  3ALY A;  4DTX A;  1QE1 A;  1RTH A;  4CJW A;  1I39 A;  1BQM A;  2DFE A;  3HPO A;  4JRP A;  1SKW A;  4C8O A;  4FJM A;  1ZBF A;  1JLQ A;  4KKO A;  4CJ3 A;  2DY4 A;  1O1W A;  2WON A;  3PY8 A;  3MEC A;  1LWF A;  4E7K A;  1WNS A;  1XC9 A;  4KB1 A;  5KI6 A;  4FLV A;  4CK2 A;  1SL1 A;  4DLE A;  2YNI A;  3MEG A;  5T7B A;  4ID1 A;  3TAB A;  3M8S A;  4DLG A;  1RIL A;  2G8F A;  3AA3 A;  4B9V A;  4GW6 A;  3LP3 A;  3OYE A;  3H08 A;  1TKX A;  3L2U A;  1U4B A;  4FK0 A;  4Z4F A;  4QOZ B;  3K2P A;  4F2S A;  1S9G A;  4CJV A;  2QKB A;  4Q0B A;  1W0H A;  3PX4 A;  2HHQ A;  3L8B A;  5C25 A;  4FJJ A;  3VQQ A;  3LPT A;  2YNH A;  3B6O A;  2BE2 A;  3A2F A;  1RBS A;  4B8C A;  4W5O A;  3NH0 A;  3S3M A;  4OLB A;  3O4N A;  1JL2 A;  3T1A A;  1NK5 A;  2LSN A;  1S5J A;  1B9F A;  3O4Q A;  4FM1 A;  2GV9 A;  3L2Q A;  1VSM A;  4FJK A;  3LAL A;  5CY4 A;  4FLU A;  1NJZ A;  4FJH A;  3C6U A;  3SUP A;  1NK7 A;  4DFM A;  4FJ9 A;  4B9M A;  3VQ5 A;  3DI6 A;  4ELV A;  1C1B A;  1S6P A;  2OPQ A;  3KKR A;  3V9U A;  1Q9X A;  1SKS A;  1YTU A;  2OA8 A;  4IFV A;  4CCH A;  3QEI A;  5J2M A;  4ZHR A;  4PUO A;  2E4L A;  1W9H A;  2HNY A;  1VRU A;  1D8Y A;  4QAG A;  1EP4 A;  1WSI A;  5J1E A;  3LP2 A;  4E19 A;  4M3U A;  1HQU A;  4BDP A;  4CIF A;  3OYN A;  1X9W A;  3C95 A;  4KHS A;  3SYZ A;  4O0I A;  4B9T A;  1QTM A;  4UQG A;  1IKW A;  3D45 A;  2HNZ A;  1HNI A;  1QHT A;  3C94 A;  1LWC A;  3ZT2 A;  4CIG A;  3VQ7 A;  3HT3 A;  3LZJ A;  4Y1D A;  4CHO A;  3T3F A;  1I3A A;  1TKZ A;  3IAY A;  4E7I A;  5K14 A;  4K8X A;  4KB0 A;  2VG7 A;  4FW2 A;  3TR8 A;  4BE0 A;  3CYM A;  3G10 A;  3AO2 A;  2Z1G A;  3V9X A;  4CED A;  5SZT A;  1NK8 A;  1RT1 A;  4DU3 A;  1HYZ A;  4CEO A;  3TI0 A;  4J2D A;  4LH4 A;  4OKK A;  2BAN A;  3OY9 A;  3EYZ A;  1LW0 A;  5KGX A;  1KSP A;  3SPZ A;  1HQE A;  1EET A;  5J2P A;  4FJ8 A;  3QEW A;  2O4I A;  1TV6 A;  4N5S A;  1CXU A;  3DLE A;  1C0T A;  3DRP A;  3QER A;  4N56 A;  2B6A A;  1A5X A;  1BCO A;  2B4J A;  4OPK A;  4JRQ A;  4RG8 A;  3ITH A;  4CJE A;  1NJW A;  3HPH A;  3OS2 A;  4MFB A;  2G8W A;  1ITG A;  4NCG A;  4DF8 A;  2ZD1 A;  4HCC A;  3LDS A;  3HP6 A;  2XRI A;  1S1U A;  4C8M A;  4B08 A;  3V6D A;  3TAP A;  2G8K A;  1T7P A;  1UAX A;  1J53 A;  4HUG A;  3HO1 A;  1HYV A;  4HUF A;  4CJR A;  3S3N A;  1SV5 A;  3VQE A;  2HMI A;  3V1Q A;  1BI4 A;  3AO3 A;  4IG0 A;  1KFD A;  3ZSO A;  3OYM A;  5FRM A;  4MQ3 A;  4F2R A;  2VWJ A;  2FBY A;  4PWD A;  1D9F A;  4FJ7 A;  4AHU A;  3L2W A;  3TAF A;  1UWB A;  4LD0 A;  2QKK A;  4Z0U A;  3DOK A;  4RW8 A;  3AA2 A;  1K6Y A;  1RTJ A;  4AHV A;  3NGY A;  4RW6 A;  1GOC A;  5J2Q A;  2IGI A;  1TGO A;  1J5O A;  4ICL A;  4AH9 A;  3QET A;  5HP1 A;  5HRR A;  4I2P A;  1S9E A;  2RF2 A;  3ZSW A;  4CGG A;  4DFJ A;  3OS0 A;  1FKO A;  4FCY A;  2IDO A;  4CEE A;  3I0S A;  3ZSX A;  3RRG A;  4Z4I A;  3KKS A;  3LAK A;  1RT5 A;  4CJT A;  4F3T A;  4DTU A;  3VQ4 A;  1YT3 A;  1DTT A;  4CHP A;  1REV A;  3OJS A;  1IKX A;  2YKM A;  1KLM A;  1C1A A;  2IC3 A;  3AA4 A;  3MEE A;  4DG1 A;  1TL3 A;  4PY5 A;  5C24 A;  2HHW A;  4CHZ A;  1WSG A;  4OKE A;  3K5O A;  1R0A A;  1NKC A;  1RT4 A;  3HM9 A;  4DSF A;  4N76 A;  2F96 A;  3WNG A;  3ZT1 A;  5C42 A;  3V9Z A;  1RTI A;  2JLE A;  3RR7 A;  3LWL A;  2FBX A;  1JL1 A;  3ZSV A;  3TWH A;  1KVB A;  1L5U A;  3OYJ A;  1C6V A;  5FRN A;  1CZB A;  3RMB A;  1S1T A;  3HST B;  4HTU A;  1JLF A;  3L2R A;  4O4G A;  3HJF A;  1NK0 A;  3P83 D;  3TAM A;  2Y1I A;  1NKB A;  3LPU A;  1WAF A;  3QIO A;  4CER A;  4CJ4 A;  5HRP A;  4K8Z A;  3LAM A;  1DLO A;  4OGE A;  3HYF A;  4EZ9 A;  2D0B A;  1IG9 A;  2YV0 X;  4LY7 A;  3SQ0 A;  4HHT A;  4M3Y A;  1J9A A;  4RW7 A;  3NHG A;  4DSE A;  3DLH A;  4IFY A;  3QLH A;  5I42 A;  4KI6 A;  3PX0 A;  4DQP A;  2BGG A;  4KHW A;  4CF1 A;  1DTQ A;  2RPI A;  3VQP A;  4FLX A;  3RWU A;  1IH7 A;  4CF2 A;  1D9D A;  1HMV A;  3VQD A;  1QSS A;  3KK2 A;  4H4O A;  4KFB A;  4DTM A;  1VSI A;  1NJX A;  2YHB A;  1ZBI A;  2FBV A;  3ZSZ A;  2Z1I A;  5SWM A;  2Y1J A;  4CJQ A;  4ELU A;  1ZBL A;  5JS1 A;  4GMJ B;  3QIP A;  3OYG A;  1WSH A;  1VSE A;  3SZ2 A;  4DTP A;  2OPS A;  5I3U A;  4FZZ A;  4F4K A;  1JLC A;  1RBR A;  4F3O A;  3E01 A;  1C1C A;  4PA1 A;  4L8R B;  4CHY A;  3PV8 A;  2AJQ A;  4Y1C A;  3KD1 E;  5CZ1 A;  1RCH A;  3OYD A;  3ZSQ A;  3K5M A;  5HRO A;  1TK8 A;  3DRS A;  1NK6 A;  2HHT A;  4FZX C;  4N47 A;  2F8T A;  4DSL A;  3EY1 A;  1EX4 A;  3QES A;  4C8L A;  1RDB A;  3HXM A;  2HVI A;  4G1Q A;  4FLT A;  2IS3 A;  4CEQ A;  2PYJ A;  1VSL A;  3K58 A;  4DQQ A;  1RTD A;  4AHR A;  3ASM A;  3VQ9 A;  3L3U A;  3WNH A;  4N41 A;  1TL1 A;  2RN2 A;  1BIZ A;  4M42 A;  5CYM A;  5DK5 A;  4DQS A;  4KV8 A;  1RDC A;  4BE1 A;  2X6S A;  2OYQ A;  3C6T A;  2Z1H A;  4R5P A;  4W5T A;  3ZT3 A;  1L3T A;  1RT2 A;  1NK9 A;  1TKT A;  3I0R A;  4C8K A;  1RT7 A;  3OVN A;  4FXD A;  4QCL A;  2EX3 A;  1ZYQ A;  1ASW A;  3BGR A;  2XO7 A;  1Q8I A;  4DMN A;  3JYT A;  1FKP A;  1LAV A;  4E7L A;  3AVC A;  2ZQB A;  3AVM A;  4OGC A;  4E3S A;  1SL0 A;  3K59 A;  4WE1 A;  1JLE A;  1HPZ A;  2VG6 A;  3NBP A;  3CFR A;  1JXE A;  4O0J A;  3U3G A;  3CG7 A;  2YNG A;  3NH2 A;  3K57 A;  2I5J A;  3VQ6 A;  2ETJ A;  2KW4 A;  1FXX A;  3TAR A;  4M3T A;  2O4G A;  3VA3 A;  3VQC A;  4AHC A;  4BDY A;  3DYA A;  5J2N A;  1NOY A;  3K5N A;  3AA5 X;  1C0M A;  4Z4H A;  3AO4 A;  4IKF A;  4CHN A;  3ZSY A;  4CJP A;  1WSE A;  4HVJ A;  3VQA A;  4C8N A;  4IG3 A;  1G15 A;  1RT3 A;  3F9K A;  3HPG A;  3RRH A;  4DF4 A;  4CJS A;  3SUQ A;  4KHY A;  4ZTJ A;  2KTQ A;  3VQ8 A;  4KAZ A;  1WN7 A;  3LP0 A;  4KHN A;  3PO5 A;  3AVJ A;  1RNH A;  3NF7 A;  4LSN A;  1S6Q A;  1KCF A;  4OVL A;  3VN5 A;  2HHS A;  4CEF A;  1SKR A;  1UA1 A;  1LAW A;  1HJR A;  3KK3 A;  4CE9 A;  3TAE A;  2OPR A;  3TAG A;  1TAQ A;  3OYH A;  3DM2 A;  2GUI A;  2KZM A;  4YNQ A;  3SQ4 A;  4I2Q A;  2VG5 A;  1X9S A;  1Q9Y A;  4DSK A;  1KTQ A;  5KRT A;  3V4I A;  4H4M A;  3OYI A;  4BWM A; 
#chains in the Genus database with same CATH topology
 3LWM A;  3PSF A;  2ASM A;  4M3R A;  4IDH A;  3TSP A;  5LJW A;  1QQN A;  3CER A;  4OLA A;  5AZI B;  4JKF A;  4EIA A;  1Z26 A;  4KHU A;  3OYK A;  4DQI A;  1IKY A;  2GWJ A;  1BL3 A;  2PYL A;  3KTQ A;  3AGR A;  2EWS A;  5DM7 L;  4H5T A;  4J2B A;  5AQG A;  4BRP A;  4BY9 C;  4DKW A;  4IFE A;  4FLY A;  4TSX A;  3IFR A;  5M1O A;  4W5R A;  4A5B A;  3THW A;  4H5V A;  2IOC A;  3BF1 A;  4JLH A;  1A5W A;  4M3Z A;  4A2A A;  1YAG A;  2X78 A;  1OKJ A;  1J54 A;  3SBT A;  3QEP A;  1BUP A;  3ZX2 A;  4KH4 A;  3NH1 A;  3SV4 A;  3HSC A;  3HZ6 A;  1NGJ A;  3QNO A;  4E7J A;  5AQM A;  3F73 A;  3KK7 A;  2P9K A;  3J7Y P;  4RCH A;  3KLF A;  3U9D A;  4KTW A;  1NKE A;  4CEC A;  1BG3 A;  4FJL A;  4B8A B;  2FXU A;  3KIO A;  4ELT A;  3OA9 A;  3IMX A;  1NMD A;  3N4Q A;  2G8V A;  4DV7 K;  1YIJ N;  4CEB A;  3TTD A;  1NGI A;  4WQ5 C;  2BUP A;  4MDB A;  1VSF A;  4CGI A;  3CCM N;  3WXL A;  5AFU H;  4JI0 K;  1XHZ A;  2PZS A;  4HWI A;  1ATS A;  2EHG A;  5BRD A;  3TAN A;  1UOC A;  1ZBS A;  4B9N A;  4CEA A;  2P9S B;  3PLA A;  3NF9 A;  3HRG A;  5JLF A;  1F21 A;  2Q2R A;  3LM2 A;  2E6M A;  3G0Z A;  1VK0 A;  4Y0W A;  2DTU A;  3L4Q A;  2F9W A;  2FSJ A;  4O5B A;  3EZ5 A;  4I9L A;  4CJU A;  4CFD A;  1Q18 A;  3CQX A;  4KBO A;  3N4P A;  1UA0 A;  4BC4 A;  4JS5 A;  1QHA A;  3WNE A;  2QK9 A;  1HJO A;  1L3V A;  4DU4 A;  1YTA A;  3VTI A;  1QS4 A;  1QQO A;  4FSV A;  1GOA A;  4IO9 L;  2E6L A;  2B5J A;  3KJV A;  3OJU A;  4BRG A;  2UXC K;  4B1Y B;  2JWL A;  1EWQ A;  1SAZ A;  1OVQ A;  3T19 A;  3SQ2 A;  2NRR A;  3CM5 A;  4IXC A;  4J2A A;  2D0A A;  3MN5 A;  3OYA A;  1VSD A;  1FK9 A;  2P9N A;  3LDL A;  3U3Y A;  3CC7 N;  5BR8 K;  3ZCM A;  3TAQ A;  2Q36 A;  4FJG A;  4CGF A;  4H8K A;  5DMR A;  4CJ5 A;  3THY B;  2DFH A;  1VAZ A;  3LM9 A;  3QNN A;  2YHA A;  2HHU A;  4NCB A;  2WBN A;  5KGW A;  4NYN A;  4DFP A;  3ISN C;  3NF8 A;  3PX6 A;  2KZZ A;  3LDO A;  5LMN K;  3AVN A;  2GWK A;  1KLN A;  1BCM A;  3VGL A;  4FLW A;  1VSK A;  1U6Z A;  5HLF A;  4JKD A;  4B3O A;  4RWT A;  4CJL A;  1BQN A;  3BF3 A;  2HB5 A;  3NE6 A;  3MXM A;  4CGJ A;  3ZYY X;  3NFA A;  1QZ6 A;  4QS8 A;  4YHH K;  4JI4 K;  2XY7 A;  3HVR A;  3MXJ A;  4CF0 A;  4KH5 A;  2D4W A;  3D2E A;  3CCU N;  2F8S A;  3KLH A;  2Q31 A;  4RW9 A;  3DLL L;  3RMA A;  1S72 N;  3NCI A;  4DR3 K;  1TYQ B;  3B8A X;  4CFB A;  5DM6 L;  4DTS A;  5KPZ A;  2G8U A;  1WAJ A;  4CK3 A;  3PUF A;  1QSL A;  4B3R K;  4DQ8 A;  2ZF5 O;  1RTH A;  4CJW A;  1BQM A;  1SKW A;  4KKO A;  4BVP A;  1O1W A;  2WON A;  3ATV A;  4E7K A;  4ILH A;  3VEX A;  1SL1 A;  5JVG L;  2YNI A;  2E5L K;  3LDN A;  2NLX A;  4B3T K;  4NO7 A;  4GW6 A;  3C65 A;  4FWS A;  3H08 A;  3OYE A;  3L2U A;  1XNQ K;  3FR0 A;  4F2S A;  4CJV A;  4Q0B A;  2ZGY A;  4LC9 B;  2BH1 A;  4RTF D;  3PIP L;  3L8B A;  5AQI A;  5EVZ A;  3LPT A;  3B6O A;  3C6H A;  3Q7B A;  3NH0 A;  5ADX A;  3S3M A;  3DXM B;  1NK5 A;  2LSN A;  4C23 A;  1VSM A;  4FLU A;  4FJH A;  2Q0R A;  1W7A A;  5KQ8 A;  1Q81 O;  1E4F T;  1V4S A;  1QVF M;  4BRI A;  4NLB A;  4ZHR A;  3ULE A;  2E4L A;  1VRU A;  2QXL A;  4QAG A;  3A5N C;  5J1E A;  4BDP A;  3RVC A;  5IWA K;  2V51 B;  3ZET B;  4KHS A;  4R79 A;  3SBG A;  4UQG A;  3O9U A;  3O9T A;  4DV1 K;  3HT3 A;  3ZT2 A;  4E7I A;  2VG7 A;  3CYM A;  1RT1 A;  4CEO A;  3TI0 A;  2D0P A;  4LH4 A;  4OKK A;  1LW0 A;  4EHU A;  1CXU A;  3QER A;  5LY3 A;  1BCO A;  5EX5 A;  4JI2 K;  1NGC A;  1NJW A;  3HPH A;  2GTD A;  3LDQ A;  1BO5 O;  3TAP A;  2XRI A;  3V6D A;  4GNI A;  3FZK A;  3IUC A;  4B1Z A;  3JXU A;  4BR9 A;  4B3S K;  4HUF A;  3S3N A;  2HMI A;  3AO3 A;  4LF8 K;  3ZSO A;  1YF5 L;  4MQ3 A;  2FBY A;  3C6A A;  1YUW A;  3SAH A;  3L2W A;  3TAF A;  1FW6 A;  4DR5 K;  5HL7 L;  4RW8 A;  3R1X A;  1J5O A;  5HP1 A;  2E2P A;  4CGG A;  5CHI A;  4BR5 A;  4FCY A;  2IDO A;  4CEE A;  5FPE A;  3KKS A;  4EFH A;  3LAK A;  1DGK N;  1VQL N;  4F3T A;  4DTU A;  3VQ4 A;  5HOO A;  2QEX N;  3OJS A;  4BRE A;  2VYP A;  4OKE A;  2PAV A;  2F96 A;  1TUU A;  2JLE A;  4PL7 A;  2FBX A;  1C0F A;  1L5U A;  1C6V A;  5FRN A;  1CZB A;  3RMB A;  1S1T A;  3O1W A;  4IEI A;  2Y1I A;  3FZM A;  4K8Z A;  2OCE A;  4BRC A;  4XH5 A;  4LY7 A;  4BR2 A;  4HHT A;  1J9A A;  3QBX A;  3ATU A;  4IFY A;  4DSE A;  4KI6 A;  3MK6 A;  3VQP A;  2JWK A;  5KQD A;  3RWU A;  5LL6 Z;  1IH7 A;  3RSE A;  2UXD K;  4KFB A;  1VSI A;  5H1S Q;  1ZBI A;  3OTO K;  2Z1I A;  2Y1J A;  4CJQ A;  5AQP A;  3MMV A;  1WSH A;  2IVO A;  4O5F A;  1BDG A;  4JKG B;  3E01 A;  3MN6 A;  3U4L A;  1T3V A;  3PV8 A;  2VQF K;  3K5M A;  3VMF B;  3ZSQ A;  1HNX K;  2HHT A;  1KAX A;  3E9P A;  2F8T A;  2UU9 K;  4GKJ K;  3O6W A;  3BEX A;  2IS3 A;  2PYJ A;  3AAR A;  4L3Q A;  4X66 K;  3WNH A;  4WYB A;  1BIZ A;  3G6E N;  3D2F B;  3C7N A;  5DK5 A;  1ESV A;  4BR7 A;  1HUX A;  4IO8 A;  3C6T A;  1XC3 A;  3P31 A;  1NK9 A;  3I0R A;  2QWO A;  1RT7 A;  4DR1 K;  4A61 A;  2QWP A;  4JK9 A;  4H0Y B;  1Q8I A;  1BU6 O;  2QWQ A;  2QWR A;  3J80 O;  3AVC A;  1SL0 A;  2FF3 B;  3CIP A;  1JLE A;  1HPZ A;  2VG6 A;  3NBP A;  3U3G A;  3K57 A;  2I5J A;  3DYA A;  4IKF A;  1IBK K;  3ZSY A;  1WSE A;  2QWM A;  3MWP A;  4HVJ A;  3UE5 A;  1G15 A;  1RT3 A;  3RRH A;  4CJS A;  2FSK A;  2KTQ A;  4KAZ A;  3HM8 A;  1WN7 A;  4FPB A;  3NF7 A;  1Y64 A;  3W0L A;  1UA1 A;  1LAW A;  3KK3 A;  4H0T B;  2OPR A;  5AQY A;  2GUI A;  2KZM A;  2GEM A;  1NWK A;  1KTQ A;  3PX0 A;  4BWM A;  3SUN A;  4E1N A;  1P8Z A;  4KO0 A;  4DS5 A;  1T8E A;  1T6D A;  1JCG A;  5KRS A;  4F8R A;  1BI4 B;  1C0G A;  2FBT A;  3VEN A;  4DTN A;  4W5N A;  3NGZ A;  2ITG A;  3MCP A;  1VQ7 N;  1NGE A;  4BWJ A;  3VF4 A;  5EY4 A;  5ELZ A;  1TK0 A;  4ID5 A;  2JGU A;  3A5M C;  3M8Q A;  4E1J A;  2O8F A;  3ZT4 A;  1Q7Y O;  2NRH A;  3AV9 A;  4WQ4 A;  3CCE N;  4A57 A;  4DTJ A;  3MDQ A;  4FK4 A;  3T1Y K;  5GIO A;  4BG8 A;  3M1F A;  1Q82 O;  3VEZ A;  4DU1 A;  2HW3 A;  5AZJ A;  2RE2 A;  3QEX A;  3CQ8 A;  5GAD P;  2XY8 A;  4FVM A;  3THV A;  1MA9 B;  1N5Y A;  4JI7 K;  4CHQ A;  2FC0 A;  5E26 A;  4FZY A;  3RMC A;  1B9D A;  2HOE A;  2J4R A;  3HVT A;  4OO1 J;  4FJ5 A;  4B1X B;  2HBK A;  1WUA A;  3KLE A;  5F1X A;  4BRN A;  1GLD G;  3VER A;  2A1R A;  1YVN A;  3MN7 A;  2OZS A;  2HHV A;  1EKE A;  3VF2 A;  3MAQ A;  2HHX A;  3HI0 A;  1KRP A;  2V52 B;  2P5O A;  4QS7 A;  3CCV N;  1VQ8 N;  4F9O A;  4IZ9 A;  2UYT A;  2ZJR L;  1L3U A;  1XNR K;  2A42 A;  4PL8 A;  4FVU A;  3CD6 N;  2PBD A;  3K9J A;  3QO9 A;  4LSL A;  1NM1 A;  2A41 A;  2P9I A;  4W5Q A;  1RBV A;  2RHK A;  3VTH A;  3OBW A;  1L3S A;  3QIN A;  3THX A;  3CME N;  4FJI A;  1GOB A;  3AVA A;  2ZJP L;  1X3M A;  1EXQ A;  4EP5 A;  1EO1 A;  4X65 K;  4KHP K;  1SL2 A;  3QEV A;  4KPY A;  2Q3S A;  4BRF A;  5GAG P;  3KLG A;  5GAE P;  4ISF A;  3V9S A;  3KD5 E;  3I8D A;  3EE8 A;  3JS6 A;  1RDD A;  2V7Y A;  2A1S A;  3TU5 A;  4B1U B;  4FOE A;  2KLA A;  3EO3 A;  5AR0 A;  4FM2 A;  3RR8 A;  3HL8 A;  3SUO A;  4H0X B;  1VSH A;  3CJ7 A;  4CJK A;  4Z4G A;  1NOZ A;  4M3W A;  2YJF A;  4KRF A;  2ZE2 A;  4AF1 A;  4YFU A;  2YHW A;  4FWN A;  3NDK A;  3MXI A;  4I9Q A;  5KTQ A;  2Z1J A;  4JNE A;  3IG1 A;  4FK2 A;  1K8K B;  3AVK A;  1U2V B;  3LAN A;  4KHQ A;  1Y97 A;  3WQT A;  1S22 A;  2KFN A;  2IVN A;  4H5N A;  3CHW A;  3SQ1 A;  2E20 A;  2P9N B;  3AAP A;  2E2O A;  2W41 A;  4JS4 A;  4E7H A;  2CGL A;  3CCL N;  4ILG B;  3FFI A;  2OAN A;  1VQ9 N;  3LZI A;  2CH6 A;  3CMA N;  4DR4 K;  1KVC A;  4ZTF A;  2WOM A;  2D0C A;  3KWI A;  4DV0 K;  4CZI A;  4DSJ A;  4CIE A;  1U48 A;  5GAH P;  3RMD A;  3V1O A;  5KPR A;  3M5R A;  3P39 A;  2ZGZ A;  5CYQ A;  4FWR A;  4EAH D;  2XY6 A;  1BA0 A;  2GBZ A;  3OS1 A;  4KTZ A;  3S9H A;  3HBT A;  1TK5 A;  4FJX A;  3ALY A;  4YY3 K;  4DTX A;  4GV3 A;  3EKS A;  4LF5 K;  1ZBF A;  1JLQ A;  1VQ4 N;  1LWF A;  1T44 A;  3G4S N;  5KI6 A;  4CK2 A;  5M1P A;  3ZEU B;  1MWM A;  5T7B A;  3BZK A;  3WXK A;  3UKR B;  1NLV A;  1RIL A;  1LOT B;  2G8F A;  3H1Q A;  4B9V A;  3F9M A;  4Z4F A;  3WQU A;  1MWK A;  2P9U A;  2NZT A;  3QDK A;  2QKB A;  3L6Q A;  3PX4 A;  4CZL A;  2GX9 A;  2YNH A;  2ZJQ L;  1RBS A;  4W5O A;  4OLB A;  1JL2 A;  3T1A A;  1YIT N;  2OTL N;  3SAG A;  3HOS A;  3L2Q A;  1NJZ A;  3C6U A;  4JD2 B;  3VEW A;  4K41 A;  3CET A;  3VQ5 A;  1C1B A;  2OA8 A;  4IFV A;  3QEI A;  5J2M A;  2P9L B;  1ATN A;  1VQP N;  4M3U A;  1HQU A;  4CIF A;  4B3M K;  3F5T A;  4B1W B;  1IKW A;  2Q0U A;  3O9R A;  3LZJ A;  1E3M A;  4CHO A;  1I3A A;  4K8X A;  2O8E B;  3TPQ A;  5AQQ A;  1OH5 A;  4FW2 A;  4BE0 A;  1JCE A;  2Z1G A;  4JEP A;  4CZF A;  3CJ9 A;  4FOI A;  2D1K A;  3EYZ A;  3DXK A;  3ULE B;  2FSN A;  1N32 K;  3A0I X;  1VQ6 N;  2NRX A;  3KHY A;  5AQS A;  1Z6R A;  3H3O B;  1C0T A;  1OVY A;  1X3N A;  3SMS A;  2B4J A;  4JRQ A;  4RG8 A;  2NRZ A;  4BC5 A;  2QI2 A;  4MFB A;  1ITG A;  3QFU A;  2ZD1 A;  4HCC A;  3LDS A;  1HLU A;  1S1U A;  4JHD B;  1HYV A;  5C2F A;  2FLO A;  3VQE A;  3V1Q A;  3T7Z A;  3TSU A;  5AZI A;  4FO0 A;  3OYM A;  3EEQ A;  5FRM A;  2VWJ A;  4PWD A;  5KPT A;  2NRT A;  4DR7 K;  4BVO A;  4DCH A;  4BC3 A;  4I6M B;  4AHV A;  4RW6 A;  5J2Q A;  2VWB A;  5AQH A;  2RF2 A;  3ZSW A;  4DFJ A;  3OS0 A;  3M6G A;  3I0S A;  3RRG A;  4DV4 K;  1RT5 A;  3OBY A;  1YT3 A;  2HST A;  4DG1 A;  1WSG A;  3I8B A;  1R0A A;  4A5A A;  1YHQ N;  1JL1 A;  1KVB A;  3OYJ A;  4DV6 K;  1JLF A;  3M3Z A;  1S3X A;  3HJF A;  1ILY A;  3TAM A;  1NKB A;  3LPU A;  4CJ4 A;  4C1N K;  4WF9 L;  4CZM A;  3HYF A;  4EZ9 A;  3SQ0 A;  3NHG A;  4RW7 A;  3DLH A;  3CI5 A;  2BGG A;  4DQP A;  4BR4 A;  3VQD A;  2CGJ A;  1NJX A;  2Q97 A;  2YHB A;  2FBV A;  3P4I A;  3ZSZ A;  2P9S A;  3R8E A;  3E9O A;  1ZBL A;  2YX6 A;  4GMJ B;  3QIP A;  1VSE A;  4FZZ A;  1ATR A;  4H0O A;  3QML A;  4L8R B;  3WXI A;  4CHY A;  3OYD A;  3KZB A;  5BRH A;  5AQR A;  4MLH A;  5C0Y A;  4DSL A;  1SQK A;  5AJ3 K;  3QES A;  3I33 A;  3PSI A;  4MDA A;  5EXW A;  4DQQ A;  1RTD A;  3W3D A;  3ENO A;  2F9T A;  1KAY A;  5TKW A;  2WFB A;  4KV8 A;  4BC2 A;  1JJ2 M;  2X6S A;  4DHY A;  3FLC O;  4QS9 A;  3SJH A;  3ZT3 A;  1L3T A;  1TKT A;  3KWG A;  4C8K A;  3OVN A;  4FXD A;  4QCL A;  2EX3 A;  5C12 A;  1ASW A;  3BZC A;  4G9Z A;  2XO7 A;  4DMN A;  1LAV A;  2ZQB A;  3AVM A;  4OGC A;  4E3S A;  3L4I A;  4WE1 A;  1VHX A;  2QWL A;  4IEE A;  2A5X A;  1JXE A;  4O0J A;  2YNG A;  3THY A;  3VQ6 A;  2KW4 A;  4A2B A;  3MN9 A;  3VA3 A;  2E2N A;  4AHC A;  2YCH A;  3AA5 X;  3CJ1 A;  3GE1 A;  4AM7 A;  4CBW A;  4CZH A;  5FPM A;  4JI6 K;  1Z05 A;  3F9K A;  3HPG A;  5AQL A;  4CBU A;  3SUQ A;  4KHY A;  4ZTJ A;  3A8Y A;  4O8K A;  4KHN A;  4LSN A;  1S6Q A;  2HHS A;  3VN5 A;  2YHY A;  1HJR A;  4CE9 A;  3TAE A;  3TAG A;  5C10 A;  5JLH A;  1HNZ K;  1HNW K;  1WBB A;  3DM2 A;  2YJE A;  4BRA A;  4MO4 A;  3ZX0 A;  2VG5 A;  1X9S A;  2O8D B;  3V4I A;  3O9Q A;  4O8U A;  4CVN E;  5BPL A;  4AIL C;  3R3L A;  1U45 A;  3OYF A;  3LL3 A;  4O44 A;  4LFC K;  5JMV A;  3H46 O;  4YOR A;  4PQU A;  4X62 K;  1S1V A;  4CGH A;  2E8A A;  4AQY K;  3NVK A;  1JLA A;  1QQC A;  3AVL A;  4B1V A;  5A2Q O;  2ITM A;  3B6P A;  4PKH A;  4KI4 A;  3IDH A;  4YOW A;  2X6N A;  4JI8 K;  3ID6 A;  3SCX A;  3KLI A;  2QXF A;  1VRT A;  1BWF O;  1GLJ O;  1NGH A;  2RKI A;  4O55 A;  5HBM A;  5M1Q A;  2G8H A;  5BRE A;  3CPE A;  3DLK A;  1KXP A;  5HRN A;  3R6M A;  3BUZ B;  1WLJ A;  1OH6 A;  4J2E A;  3UB5 A;  2VWK A;  4EP4 A;  3P5J A;  3M8P A;  4FW1 A;  1M1K O;  4K0K K;  2HVH A;  2X74 A;  2W6L A;  4BAC A;  4ILJ A;  2XY5 A;  5BPN A;  3AVG A;  4BGB A;  2HBL A;  3SV3 A;  4BRK A;  4CZJ A;  4X64 K;  4DQR A;  4DWI A;  3FZL A;  1XWL A;  4HUE A;  3DXM A;  5I9E B;  3DLG A;  3EL2 A;  3IS9 A;  1BIS A;  2HMP A;  4H0P A;  3U9Z A;  5AZJ B;  2KKZ A;  3VA0 A;  4IDK A;  3DLR A;  3DOL A;  5FPD A;  4NB4 A;  2O8B B;  1LW2 A;  4JAX A;  3AGK A;  3LP1 A;  1SZ2 A;  5E41 A;  3C0B A;  2OZM A;  3CC4 N;  1S1X A;  3AY9 A;  4CJ7 A;  4DTO A;  4GKK K;  5CZ2 A;  3VOV A;  4AHS A;  4AHT A;  5M1K A;  4LH5 A;  3O4W A;  3BP8 A;  4CF8 A;  3O80 A;  3U8X A;  1U49 A;  1HRH A;  3WUH A;  3CF5 L;  3CFP A;  1N6Q A;  4FYD A;  2E1Y A;  2YKN A;  5BRF A;  1ASU A;  2O8C B;  1MU2 A;  3SK3 A;  4FWO A;  3WEE B;  3CM6 A;  4FLZ A;  4OKJ A;  3NAE A;  2HND A;  1XHX A;  3A5L C;  5B8H A;  3CC2 N;  5LJV A;  1NJI O;  1Q86 O;  4GVM A;  3WNF A;  1NK4 A;  1A5V A;  3O9S A;  1XI1 A;  4CF9 A;  1CZ9 A;  5F2R A;  1BHL A;  4LF4 K;  3F2K A;  3PO4 A;  1KFS A;  2ATQ A;  4BE2 A;  3HTV A;  1SS6 A;  2R7Y A;  1RBT A;  1X9M A;  3SAF A;  3SI6 A;  5AFU A;  5EU7 A;  3A5O C;  1C0U A;  5GIN A;  5HRS A;  1KC8 O;  2QW9 A;  4WQ5 A;  3CQY A;  3JSM A;  1ASV A;  2P51 A;  2YHX A;  3OYC A;  2CH5 A;  1JLG A;  5F0X A;  3D0P A;  1CLQ A;  4BGA A;  5FDL A;  3AO5 A;  4E0D A;  3OHR A;  3DMJ A;  1NU0 A;  2P5G A;  1IG8 A;  3R9P A;  2A6A A;  4DTR A;  2AA4 A;  4E1M A;  5AQU A;  4XIU A;  2HBJ A;  3ZSR A;  4I7F A;  2WC9 A;  1ZXO A;  2QA4 N;  2G8I A;  2AP1 A;  3CXC M;  4DV5 K;  1TVR A;  3HP9 A;  2VGN A;  3E1Y A;  4C8O A;  4JRP A;  2UUA K;  4FJM A;  3QB0 A;  1YJN N;  2DY4 A;  1OH7 A;  3PY8 A;  3MEC A;  1NGG A;  1WNS A;  4FLV A;  1KQS M;  3THW B;  4JKG A;  1RGI A;  1GLB G;  2WTU A;  1BA1 A;  4ID1 A;  3TAB A;  3M8S A;  4DLG A;  4FWQ A;  3FZF A;  1U4B A;  1TKX A;  4QOZ B;  4FK0 A;  4UY8 O;  3K2P A;  5AQT A;  4PKG A;  1W0H A;  2P9K B;  4WFA L;  2DPN A;  5C25 A;  4FJJ A;  3VQQ A;  4JKC A;  2BE2 A;  4CZG A;  3A2F A;  3D2F A;  4BRM A;  3J7A P;  3O4N A;  1FJG K;  1B9F A;  5AQV A;  3O4Q A;  4FM1 A;  1VQN N;  2GV9 A;  4FJK A;  4JKB A;  1NK7 A;  4DFM A;  4FJ9 A;  4ELV A;  2W6K A;  1S6P A;  3WXJ A;  1Q9X A;  4IOC L;  4PUO A;  4CD3 A;  2P9U B;  1W9H A;  4AM6 A;  2HNY A;  1D8Y A;  1EP4 A;  3ID8 A;  2HBM A;  3LP2 A;  4E19 A;  4CZE A;  3OYN A;  1X9W A;  1GLC G;  4B9T A;  5M1F A;  2HNZ A;  1HNI A;  3J81 O;  1TKZ A;  2UUC K;  4KB0 A;  3DWL A;  3IKM A;  3AO2 A;  4CED A;  1NK8 A;  4DU3 A;  1HYZ A;  1N34 K;  1G99 A;  3TSQ A;  3J7Z O;  2BTF A;  5KGX A;  4DUZ K;  2ASP A;  5J2P A;  2O4I A;  3DLE A;  1OH8 A;  2B6A A;  1A5X A;  4JKA A;  2P9P A;  1MDU B;  1NGB A;  4CJE A;  2G8W A;  3OS2 A;  4DF8 A;  2Q1N A;  3HP6 A;  1J53 A;  5JVH L;  4HUG A;  3HO1 A;  4U67 L;  3SMP A;  2QTD A;  1BI4 A;  4EHT A;  4DB3 A;  2I7N A;  4GV6 A;  4YDU A;  1D9F A;  2V7Z A;  1M90 O;  3ZLJ A;  4LD0 A;  2QKK A;  4Z0U A;  1K6Y A;  4M63 C;  1GOC A;  1I94 K;  1TGO A;  1IJJ A;  4AH9 A;  3GOI A;  5HRR A;  4I2P A;  1S9E A;  4FWK A;  1LCU A;  3ZSX A;  4JKE A;  4CJT A;  1IKX A;  4YOX A;  1KLM A;  1C1A A;  2IC3 A;  3AA4 A;  2HHW A;  1TL3 A;  4BRO A;  2UUB K;  4GV9 A;  1NKC A;  1GLE G;  1RT4 A;  4ISE A;  3HM9 A;  4N76 A;  3V9Z A;  5C42 A;  1RTI A;  3ZSV A;  2ZWH A;  3TWH A;  3GDQ A;  4MO5 A;  3FE1 A;  3HST B;  3L2R A;  4O4G A;  3WXM B;  3UKU A;  5HRP A;  3D2E B;  3CJC A;  2YV0 X;  3EN9 A;  4JK8 A;  4M3Y A;  3SLC A;  5I42 A;  2RPI A;  4FLX A;  1HMV A;  4GY2 B;  4H4O A;  3KK2 A;  5SWM A;  5BR9 A;  4ELU A;  4BG9 A;  1JLC A;  1RBR A;  4F3O A;  3VEY A;  4Y1C A;  3KD1 E;  5CZ1 A;  1RCH A;  4JN4 A;  3CPW M;  5HRO A;  1TK8 A;  1NK6 A;  3VET A;  1HKC A;  1EX4 A;  4G1Q A;  4FLT A;  1EWR A;  4CEQ A;  3ASM A;  3VQ9 A;  3L3U A;  4N41 A;  3JAM O;  4M42 A;  5CYM A;  1W97 L;  1CZA N;  5AQW A;  3DJC A;  4WQ4 C;  3G25 A;  4R5P A;  2A3Z A;  4M7Y A;  3BGR A;  5AQK A;  1N8R O;  3JYT A;  1FKP A;  3K59 A;  4K42 A;  4IJA A;  3CFR A;  3NH2 A;  5BPM A;  3QIC A;  1NGF A;  2ETJ A;  1FXX A;  3VQC A;  4BRD A;  4BDY A;  1K8K A;  4Z4H A;  3AO4 A;  4WCE L;  1U2V A;  1RDU A;  4CJP A;  3T1H K;  3FZH A;  1D4X A;  3K0S A;  3VQ8 A;  3ZX3 A;  3CCQ N;  4DUY K;  1HR0 K;  4JK7 A;  3PO5 A;  3AVJ A;  1RNH A;  4OVL A;  4CEF A;  3FFK B;  1TAQ A;  3GBT A;  1GLF O;  1QZ5 A;  4I2Q A;  5KRT A;  1K73 O;  4H4M A;  4CI6 A;  4B9L A;  1RDA A;  4JV5 K;  2HHH K;  1BGX T;  1TAU A;  3DLB A;  1U47 A;  1CXQ A;  1IBM K;  3RTV A;  1HKG A;  3OYL A;  4OJR A;  4CEZ A;  1IO2 A;  4NYF A;  4B9S A;  2E2Q A;  3EE9 A;  1LWE A;  1U04 A;  4A59 A;  1RBU A;  1JLB A;  3L3V A;  1XMO K;  1HPM A;  4BRH A;  4LF7 K;  4DSI A;  3AAQ A;  4A62 A;  1X1P A;  3NGI A;  3ZEU A;  4MLE A;  3I55 N;  1E4G T;  3HK2 A;  3UKR A;  3P1G A;  4K43 A;  1N33 K;  3PIO L;  3BDP A;  4Z4E A;  3T69 A;  2VQE K;  3AO1 A;  4NCA A;  4CFA A;  3EZW A;  2NRV A;  1VQM N;  3DRR A;  1YJW N;  3NMU A;  1HNV A;  1RDW X;  3O3F A;  1S1W A;  3AVB A;  3K9K A;  1JXB A;  3QBW A;  3D6R A;  4JD2 A;  4DR2 K;  1QVG M;  3ULD A;  1RFQ A;  5D3G A;  1TKD A;  4YDU C;  3L2V A;  1IV0 A;  4BDZ A;  3RSE B;  2P9L A;  1NG9 A;  1H1V A;  2F7T A;  4Q5V A;  1T03 A;  4FM0 A;  5AQN A;  5AQF A;  1WSJ A;  3VF6 A;  1NJY A;  2E1Z A;  2WUS A;  2PY5 A;  4LFA K;  2KQ2 A;  3MED A;  2IAJ A;  3U6F A;  5M1N A;  4EZ6 A;  4M41 A;  1RT6 A;  2NUB A;  3CFO A;  5CR4 A;  4H0V B;  3NF6 A;  2O8E A;  2D5R A;  5FRO A;  4KTQ A;  1GLA G;  1JKH A;  3O3H A;  2BDP A;  3V81 A;  3EKU A;  1NMN A;  4CGD A;  2VGM A;  1Z25 A;  1IKV A;  1K9M O;  4BQL A;  1ZBU A;  4E89 A;  2KFZ A;  1EQY A;  3IRX A;  5JS2 A;  2DFF A;  4OPJ A;  3DAW A;  3V9W A;  3CCJ N;  1T05 A;  3K5L A;  3C7N B;  5E84 A;  3KK1 A;  3OYB A;  3CJA A;  4JHD A;  3AVH A;  2NNW A;  4KRE A;  1DKG D;  3AVF A;  1LV5 A;  3MWT A;  4K25 A;  4OPA A;  4RW4 A;  4CJF A;  3BY5 A;  4FWP A;  4IOX A;  3VQB A;  3HOT A;  3AVI A;  2P1J A;  4FPA A;  1YI2 N;  4DS4 A;  4I6M A;  1SUQ A;  2HF3 A;  2XHB A;  4YOU A;  3QFP A;  3SPY A;  2W42 A;  4FJN A;  4DFK A;  3CJB A;  3J8A A;  4Z4C A;  3M8R A;  5IT9 O;  2F4V K;  4CBX A;  1WOQ A;  1BIU A;  1VQK N;  1ZBH A;  1TYQ A;  3O3G A;  3G71 N;  4OPH A;  1HX1 A;  3ZT0 A;  2YI1 A;  3ENH A;  5BN8 A;  1D5A A;  1VQ5 N;  1QSY A;  4IWV A;  3SJJ A;  1WSF A;  3V1R A;  4YOY A;  2OPP A;  4CFC A;  4B9U A;  4M45 A;  1QQM A;  1B92 A;  4H03 B;  4HCB A;  1HYS A;  5AQZ A;  2YNF A;  4CK1 A;  4OX9 K;  4IBN A;  1KVA A;  1VSJ A;  4DV3 K;  4CES A;  1TUY A;  4BRL A;  3KVG A;  1HKB A;  3S3O A;  3SNN A;  4M3X A;  3CCS N;  3UIQ A;  2GUP A;  1YVU A;  3OW2 M;  1QE1 A;  5FPN A;  1I39 A;  2DFE A;  3HPO A;  2O8F B;  3S41 A;  4CJ3 A;  1NBW A;  4NXM K;  1XC9 A;  4KB1 A;  1V4T A;  4FL9 A;  3O08 A;  4DLE A;  1N36 K;  1YXQ A;  2D0O A;  3MEG A;  4BQZ A;  2I7P A;  5BN9 A;  3AA3 A;  3P38 A;  3LP3 A;  5CE3 A;  3FGU A;  1S9G A;  3VPZ A;  2W40 A;  2HHQ A;  2NRW A;  4LFB K;  4C1N I;  3ZET A;  4B8C A;  5EOY A;  1S5J A;  3MCA B;  1BOT O;  3LAL A;  5CY4 A;  5AQO A;  4BR0 A;  3SUP A;  5MLC Q;  3LDP A;  3CCR N;  5JS1 A;  4B9M A;  3DI6 A;  1X9J A;  1YTU A;  2OPQ A;  1KAZ A;  3KKR A;  3V9U A;  1NGD A;  1SKS A;  3O8M A;  2A40 A;  4NLC A;  4CCH A;  4JI1 K;  4XH4 A;  1WSI A;  4PHT X;  3TTC A;  3C95 A;  3SYZ A;  4O0I A;  1J5E K;  5JIC A;  1QTM A;  2P9I B;  3VEV A;  3D45 A;  1QHT A;  3C94 A;  3H3N O;  1LWC A;  4CIG A;  3VQ7 A;  4Y1D A;  3T3F A;  3IAY A;  5K14 A;  5GIP A;  3TR8 A;  3THX B;  3G10 A;  3V9X A;  5SZT A;  3O1B A;  4HTL A;  3TTF A;  3E9L A;  5C15 A;  4J2D A;  2BAN A;  3OY9 A;  1KSP A;  1NNE A;  3SPZ A;  1HQE A;  1EET A;  4XEI A;  4B9Q A;  4FJ8 A;  3QEW A;  4YOT A;  1TV6 A;  4N5S A;  3DRP A;  3WT0 A;  4N56 A;  2ZM6 K;  4OPK A;  1R59 O;  1YJ9 N;  3ITH A;  4NCG A;  2IVP A;  2O8D A;  4FWL A;  4C8M A;  4B08 A;  1T7P A;  2G8K A;  1UAX A;  4WFB L;  4CJR A;  1SV5 A;  4IG0 A;  2IIR A;  1KFD A;  5ADX H;  4F2R A;  4FJ7 A;  4AHU A;  5AQX A;  2HF4 A;  4YOV A;  3D7E O;  1UWB A;  3DOK A;  2P9P B;  3AA2 A;  1RTJ A;  3NGY A;  4DV2 K;  2IGI A;  4ICL A;  3QET A;  3ENB A;  4GVE A;  4LF9 K;  4DR6 K;  1FKO A;  2VCP A;  2GEL A;  4Z4I A;  3MX2 A;  4KH6 A;  1DTT A;  4CHP A;  1REV A;  1DT9 A;  2YKM A;  3MEE A;  4PY5 A;  5C24 A;  5AQJ A;  4CHZ A;  3K5O A;  4IOA L;  4DSF A;  4PKI A;  3WNG A;  3ZT1 A;  3RR7 A;  4CZK A;  3GG4 A;  3LWL A;  4H5W A;  3VGM A;  4H5R A;  4CW7 B;  2PFU A;  2CGK A;  4HTU A;  2OTJ N;  1XMQ K;  1NK0 A;  3P83 D;  1WAF A;  3QIO A;  4CER A;  3LAM A;  1DLO A;  1VQO N;  4OGE A;  1WB9 A;  4U7B A;  4J8F A;  4NXN K;  2D0B A;  1IG9 A;  3E66 A;  5LMU K;  2O8B A;  3VGK A;  3QLH A;  4KHW A;  4CF1 A;  1DTQ A;  1XUP O;  4CF2 A;  1WBD A;  1D9D A;  4JI5 K;  1QSS A;  4XH1 A;  4DTM A;  5C2D A;  2H3G X;  1K8A O;  3MX5 A;  4LF6 K;  3OYG A;  3SZ2 A;  4DTP A;  2OPS A;  5I3U A;  4F4K A;  3UKU B;  1C1C A;  4PA1 A;  2FF6 A;  2QWN A;  2AJQ A;  3Q7C A;  4FWM A;  1NGA A;  3DRS A;  4IJN A;  4N47 A;  4FZX C;  4CD1 A;  3EY1 A;  4C8L A;  1RDB A;  3HXM A;  2HVI A;  1GLL O;  1VSL A;  3K58 A;  1KD1 O;  2KHO A;  4JKH A;  4ISG A;  4AHR A;  4JYA K;  3VES A;  1TL1 A;  2O8C A;  2RN2 A;  3WEE A;  3H45 C;  4DQS A;  1RDC A;  4BE1 A;  4BRQ A;  1P90 A;  3O5B A;  2OYQ A;  4WFN L;  2Z1H A;  1ZC6 A;  4W5T A;  1RT2 A;  1T6C A;  4M7X A;  1ZYQ A;  3L0Q A;  4E7L A;  3GL1 A;  3I56 N;  1JCF A;  5TKY A;  3CG7 A;  1DEJ A;  3TAR A;  4M3T A;  1J6Z A;  2O4G A;  4V19 S;  1IBL K;  5J2N A;  4JI3 K;  1NOY A;  3K5N A;  1C0M A;  4CHN A;  3VQA A;  4C8N A;  4IG3 A;  3NVM A;  4DF4 A;  5FLX O;  3DXK B;  2ASO A;  3LP0 A;  2QM1 A;  3H1V X;  1KCF A;  1SKR A;  1XQS C;  3H6E A;  3VEO A;  3OYH A;  1W2B M;  4Z94 A;  4YNQ A;  1O13 A;  3SQ4 A;  2E88 A;  1Q9Y A;  4DSK A;  2UXB K;  3OYI A; 
#chains in the Genus database with same CATH homology
 3SUN A;  3LWM A;  4E1N A;  4B9L A;  4AIL C;  1RDA A;  4M3R A;  4KO0 A;  4DS5 A;  1T8E A;  1U45 A;  1BGX T;  3OYF A;  5KRS A;  4F8R A;  4OLA A;  1BI4 B;  4O44 A;  1TAU A;  3DLB A;  1U47 A;  4PQU A;  1CXQ A;  2FBT A;  4DTN A;  4W5N A;  3NGZ A;  1Z26 A;  1S1V A;  3OYL A;  2ITG A;  3RTV A;  4CGH A;  3OYK A;  4OJR A;  4DQI A;  4CEZ A;  1IKY A;  1IO2 A;  1JLA A;  4BWJ A;  4NYF A;  1QQC A;  4B9S A;  3AVL A;  1BL3 A;  2PYL A;  1TK0 A;  3KTQ A;  1LWE A;  1U04 A;  4ID5 A;  2JGU A;  1RBU A;  1JLB A;  3M8Q A;  4J2B A;  3ZT4 A;  3B6P A;  4KI4 A;  3L3V A;  3AV9 A;  2X6N A;  4FLY A;  4TSX A;  3SCX A;  3KLI A;  4DSI A;  4DTJ A;  4FK4 A;  4W5R A;  2QXF A;  1VRT A;  4DU1 A;  1X1P A;  2IOC A;  2RKI A;  4JLH A;  1A5W A;  4O55 A;  5HBM A;  3NGI A;  3QEX A;  2G8H A;  4M3Z A;  3HK2 A;  2HW3 A;  3DLK A;  3CQ8 A;  3P1G A;  5HRN A;  2X78 A;  2XY8 A;  3QEP A;  1J54 A;  1WLJ A;  4FVM A;  3THV A;  1N5Y A;  4J2E A;  2VWK A;  4EP4 A;  3P5J A;  4CHQ A;  3NH1 A;  3M8P A;  3SV4 A;  2FC0 A;  4FW1 A;  3QNO A;  3BDP A;  4Z4E A;  2HVH A;  4FZY A;  2X74 A;  4E7J A;  3RMC A;  1B9D A;  3F73 A;  3HVT A;  4BAC A;  4FJ5 A;  2XY5 A;  3AO1 A;  3AVG A;  3KLE A;  4CFA A;  3SV3 A;  4NCA A;  3KLF A;  3DRR A;  4KTW A;  4DQR A;  4DWI A;  1NKE A;  4CEC A;  2A1R A;  1HNV A;  1XWL A;  4B8A B;  4HUE A;  4FJL A;  3O3F A;  1S1W A;  3KIO A;  3AVB A;  3DLG A;  2OZS A;  2HHV A;  4ELT A;  1JXB A;  1EKE A;  3IS9 A;  1BIS A;  3MAQ A;  3VA0 A;  2G8V A;  2HHX A;  4CEB A;  1KRP A;  3ULD A;  4IDK A;  3DLR A;  2P5O A;  3DOL A;  5D3G A;  1TKD A;  1VSF A;  4CGI A;  3L2V A;  1LW2 A;  4BDZ A;  1XHZ A;  2PZS A;  4Q5V A;  1L3U A;  1T03 A;  2EHG A;  4FM0 A;  1WSJ A;  1NJY A;  3QO9 A;  3TAN A;  1UOC A;  2PY5 A;  4B9N A;  2KQ2 A;  4CEA A;  3MED A;  2IAJ A;  3LP1 A;  4LSL A;  3NF9 A;  3U6F A;  4EZ6 A;  5E41 A;  4M41 A;  1RT6 A;  2NUB A;  4W5Q A;  1RBV A;  2OZM A;  1F21 A;  3CFO A;  1S1X A;  2E6M A;  3NF6 A;  3G0Z A;  4DTO A;  1VK0 A;  1L3S A;  2DTU A;  3QIN A;  2D5R A;  5CZ2 A;  5FRO A;  4KTQ A;  4AHS A;  4AHT A;  4LH5 A;  4FJI A;  1GOB A;  3AVA A;  1JKH A;  4CF8 A;  1EXQ A;  3O3H A;  2BDP A;  3V81 A;  4O5B A;  4CGD A;  3EZ5 A;  4I9L A;  4EP5 A;  4CJU A;  4CFD A;  1Z25 A;  1IKV A;  1U49 A;  1HRH A;  4FYD A;  3CFP A;  1UA0 A;  1SL2 A;  3QEV A;  1N6Q A;  2Q3S A;  4KPY A;  1ZBU A;  4E89 A;  2YKN A;  2KFZ A;  3IRX A;  5JS2 A;  1ASU A;  3KLG A;  4JS5 A;  1MU2 A;  2DFF A;  4OPJ A;  3V9W A;  3WNE A;  2QK9 A;  3CM6 A;  1T05 A;  3K5L A;  4FLZ A;  3V9S A;  3KD5 E;  3KK1 A;  1L3V A;  3I8D A;  3OYB A;  4DU4 A;  1YTA A;  4OKJ A;  3NAE A;  2HND A;  3AVH A;  1RDD A;  1QS4 A;  1XHX A;  4KRE A;  1GOA A;  3AVF A;  4KHU A;  2E6L A;  2B5J A;  1LV5 A;  3KJV A;  4GVM A;  2A1S A;  3OJU A;  3WNF A;  4FM2 A;  3T19 A;  3SQ2 A;  3RR8 A;  4J2A A;  1NK4 A;  3CM5 A;  1A5V A;  3HL8 A;  4CF9 A;  3SUO A;  1XI1 A;  2D0A A;  4RW4 A;  1VSD A;  1FK9 A;  1VSH A;  4CJK A;  3OYA A;  3U3Y A;  1CZ9 A;  4CJF A;  1BHL A;  4Z4G A;  1NOZ A;  4M3W A;  3VQB A;  4KRF A;  3AVI A;  2P1J A;  2ZE2 A;  3PO4 A;  4DS4 A;  3ZCM A;  4YFU A;  3TAQ A;  1KFS A;  4FJG A;  2ATQ A;  4H8K A;  5DMR A;  4CGF A;  4CJ5 A;  1SUQ A;  2DFH A;  2XHB A;  3NDK A;  4BE2 A;  3MXI A;  5KTQ A;  3SPY A;  4I9Q A;  2Z1J A;  2W42 A;  3IG1 A;  4DFK A;  4FJN A;  4FK2 A;  2R7Y A;  3QNN A;  2YHA A;  2HHU A;  3AVK A;  1RBT A;  1X9M A;  4NCB A;  3SI6 A;  5EU7 A;  5KGW A;  4NYN A;  1C0U A;  3LAN A;  4Z4C A;  3ISN C;  4DFP A;  3M8R A;  1Y97 A;  4KHQ A;  3NF8 A;  3PX6 A;  5HRS A;  2KZZ A;  2KFN A;  3JSM A;  1BIU A;  1ASV A;  2P51 A;  3SQ1 A;  1ZBH A;  3O3G A;  3AVN A;  1KLN A;  3OYC A;  3D0P A;  1BCM A;  1JLG A;  1CLQ A;  4JS4 A;  3ZT0 A;  5FDL A;  3AO5 A;  4FLW A;  4E7H A;  4E0D A;  1VSK A;  3DMJ A;  1D5A A;  5HLF A;  2P5G A;  1QSY A;  4B3O A;  3SJJ A;  4DTR A;  1WSF A;  3V1R A;  2OPP A;  4CJL A;  4E1M A;  1BQN A;  4CFC A;  4XIU A;  4B9U A;  3ZSR A;  2HB5 A;  3FFI A;  4M45 A;  3NE6 A;  1B92 A;  4CGJ A;  4I7F A;  3LZI A;  3NFA A;  3MXM A;  4HCB A;  1KVC A;  1HYS A;  2YNF A;  4CK1 A;  2WOM A;  2XY7 A;  2D0C A;  4ZTF A;  4IBN A;  1KVA A;  4DSJ A;  1VSJ A;  3MXJ A;  4CF0 A;  3HVR A;  4CES A;  4CIE A;  1U48 A;  2G8I A;  3RMD A;  2F8S A;  3KLH A;  3V1O A;  4RW9 A;  3RMA A;  3NCI A;  5CYQ A;  4CFB A;  3S3O A;  2XY6 A;  3SNN A;  4M3X A;  4DTS A;  1TVR A;  2GBZ A;  3OS1 A;  2G8U A;  3HP9 A;  1WAJ A;  4KTZ A;  3S9H A;  4CK3 A;  3PUF A;  1TK5 A;  1QSL A;  3UIQ A;  1YVU A;  4FJX A;  3ALY A;  4DTX A;  1QE1 A;  1RTH A;  4CJW A;  1I39 A;  1BQM A;  2DFE A;  3HPO A;  4JRP A;  1SKW A;  4C8O A;  4FJM A;  1ZBF A;  1JLQ A;  4KKO A;  4CJ3 A;  2DY4 A;  1O1W A;  2WON A;  3PY8 A;  3MEC A;  1LWF A;  4E7K A;  1WNS A;  1XC9 A;  4KB1 A;  5KI6 A;  4FLV A;  4CK2 A;  1SL1 A;  4DLE A;  2YNI A;  3MEG A;  5T7B A;  4ID1 A;  3TAB A;  3M8S A;  4DLG A;  1RIL A;  2G8F A;  3AA3 A;  4B9V A;  4GW6 A;  3LP3 A;  3OYE A;  3H08 A;  1TKX A;  3L2U A;  1U4B A;  4FK0 A;  4Z4F A;  4QOZ B;  3K2P A;  4F2S A;  1S9G A;  4CJV A;  2QKB A;  4Q0B A;  1W0H A;  3PX4 A;  2HHQ A;  3L8B A;  5C25 A;  4FJJ A;  3VQQ A;  3LPT A;  2YNH A;  3B6O A;  2BE2 A;  3A2F A;  1RBS A;  4B8C A;  4W5O A;  3NH0 A;  3S3M A;  4OLB A;  3O4N A;  1JL2 A;  3T1A A;  1NK5 A;  2LSN A;  1S5J A;  1B9F A;  3O4Q A;  4FM1 A;  2GV9 A;  3L2Q A;  1VSM A;  4FJK A;  3LAL A;  5CY4 A;  4FLU A;  1NJZ A;  4FJH A;  3C6U A;  3SUP A;  1NK7 A;  4DFM A;  4FJ9 A;  4B9M A;  3VQ5 A;  3DI6 A;  4ELV A;  1C1B A;  1S6P A;  2OPQ A;  3KKR A;  3V9U A;  1Q9X A;  1SKS A;  1YTU A;  2OA8 A;  4IFV A;  4CCH A;  3QEI A;  5J2M A;  4ZHR A;  4PUO A;  2E4L A;  1W9H A;  2HNY A;  1VRU A;  1D8Y A;  4QAG A;  1EP4 A;  1WSI A;  5J1E A;  3LP2 A;  4E19 A;  4M3U A;  1HQU A;  4BDP A;  4CIF A;  3OYN A;  1X9W A;  3C95 A;  4KHS A;  3SYZ A;  4O0I A;  4B9T A;  1QTM A;  4UQG A;  1IKW A;  3D45 A;  2HNZ A;  1HNI A;  1QHT A;  3C94 A;  1LWC A;  3ZT2 A;  4CIG A;  3VQ7 A;  3HT3 A;  3LZJ A;  4Y1D A;  4CHO A;  3T3F A;  1I3A A;  1TKZ A;  3IAY A;  4E7I A;  5K14 A;  4K8X A;  4KB0 A;  2VG7 A;  4FW2 A;  3TR8 A;  4BE0 A;  3CYM A;  3G10 A;  3AO2 A;  2Z1G A;  3V9X A;  4CED A;  5SZT A;  1NK8 A;  1RT1 A;  4DU3 A;  1HYZ A;  4CEO A;  3TI0 A;  4J2D A;  4LH4 A;  4OKK A;  2BAN A;  3OY9 A;  3EYZ A;  1LW0 A;  5KGX A;  1KSP A;  3SPZ A;  1HQE A;  1EET A;  5J2P A;  4FJ8 A;  3QEW A;  2O4I A;  1TV6 A;  4N5S A;  1CXU A;  3DLE A;  1C0T A;  3DRP A;  3QER A;  4N56 A;  2B6A A;  1A5X A;  1BCO A;  2B4J A;  4OPK A;  4JRQ A;  4RG8 A;  3ITH A;  4CJE A;  1NJW A;  3HPH A;  3OS2 A;  4MFB A;  2G8W A;  1ITG A;  4NCG A;  4DF8 A;  2ZD1 A;  4HCC A;  3LDS A;  3HP6 A;  2XRI A;  1S1U A;  4C8M A;  4B08 A;  3V6D A;  3TAP A;  2G8K A;  1T7P A;  1UAX A;  1J53 A;  4HUG A;  3HO1 A;  1HYV A;  4HUF A;  4CJR A;  3S3N A;  1SV5 A;  3VQE A;  2HMI A;  3V1Q A;  1BI4 A;  3AO3 A;  4IG0 A;  1KFD A;  3ZSO A;  3OYM A;  5FRM A;  4MQ3 A;  4F2R A;  2VWJ A;  2FBY A;  4PWD A;  1D9F A;  4FJ7 A;  4AHU A;  3L2W A;  3TAF A;  1UWB A;  4LD0 A;  2QKK A;  4Z0U A;  3DOK A;  4RW8 A;  3AA2 A;  1K6Y A;  1RTJ A;  4AHV A;  3NGY A;  4RW6 A;  1GOC A;  5J2Q A;  2IGI A;  1TGO A;  1J5O A;  4ICL A;  4AH9 A;  3QET A;  5HP1 A;  5HRR A;  4I2P A;  1S9E A;  2RF2 A;  3ZSW A;  4CGG A;  4DFJ A;  3OS0 A;  1FKO A;  4FCY A;  2IDO A;  4CEE A;  3I0S A;  3ZSX A;  3RRG A;  4Z4I A;  3KKS A;  3LAK A;  1RT5 A;  4CJT A;  4F3T A;  4DTU A;  3VQ4 A;  1YT3 A;  1DTT A;  4CHP A;  1REV A;  3OJS A;  1IKX A;  2YKM A;  1KLM A;  1C1A A;  2IC3 A;  3AA4 A;  3MEE A;  4DG1 A;  1TL3 A;  4PY5 A;  5C24 A;  2HHW A;  4CHZ A;  1WSG A;  4OKE A;  3K5O A;  1R0A A;  1NKC A;  1RT4 A;  3HM9 A;  4DSF A;  4N76 A;  2F96 A;  3WNG A;  3ZT1 A;  5C42 A;  3V9Z A;  1RTI A;  2JLE A;  3RR7 A;  3LWL A;  2FBX A;  1JL1 A;  3ZSV A;  3TWH A;  1KVB A;  1L5U A;  3OYJ A;  1C6V A;  5FRN A;  1CZB A;  3RMB A;  1S1T A;  3HST B;  4HTU A;  1JLF A;  3L2R A;  4O4G A;  3HJF A;  1NK0 A;  3P83 D;  3TAM A;  2Y1I A;  1NKB A;  3LPU A;  1WAF A;  3QIO A;  4CER A;  4CJ4 A;  5HRP A;  4K8Z A;  3LAM A;  1DLO A;  4OGE A;  3HYF A;  4EZ9 A;  2D0B A;  1IG9 A;  2YV0 X;  4LY7 A;  3SQ0 A;  4HHT A;  4M3Y A;  1J9A A;  4RW7 A;  3NHG A;  4DSE A;  3DLH A;  4IFY A;  3QLH A;  5I42 A;  4KI6 A;  3PX0 A;  4DQP A;  2BGG A;  4KHW A;  4CF1 A;  1DTQ A;  2RPI A;  3VQP A;  4FLX A;  3RWU A;  1IH7 A;  4CF2 A;  1D9D A;  1HMV A;  3VQD A;  1QSS A;  3KK2 A;  4H4O A;  4KFB A;  4DTM A;  1VSI A;  1NJX A;  2YHB A;  1ZBI A;  2FBV A;  3ZSZ A;  2Z1I A;  5SWM A;  2Y1J A;  4CJQ A;  4ELU A;  1ZBL A;  5JS1 A;  4GMJ B;  3QIP A;  3OYG A;  1WSH A;  1VSE A;  3SZ2 A;  4DTP A;  2OPS A;  5I3U A;  4FZZ A;  4F4K A;  1JLC A;  1RBR A;  4F3O A;  3E01 A;  1C1C A;  4PA1 A;  4L8R B;  4CHY A;  3PV8 A;  2AJQ A;  4Y1C A;  3KD1 E;  5CZ1 A;  1RCH A;  3OYD A;  3ZSQ A;  3K5M A;  5HRO A;  1TK8 A;  3DRS A;  1NK6 A;  2HHT A;  4FZX C;  4N47 A;  2F8T A;  4DSL A;  3EY1 A;  1EX4 A;  3QES A;  4C8L A;  1RDB A;  3HXM A;  2HVI A;  4G1Q A;  4FLT A;  2IS3 A;  4CEQ A;  2PYJ A;  1VSL A;  3K58 A;  4DQQ A;  1RTD A;  4AHR A;  3ASM A;  3VQ9 A;  3L3U A;  3WNH A;  4N41 A;  1TL1 A;  2RN2 A;  1BIZ A;  4M42 A;  5CYM A;  5DK5 A;  4DQS A;  4KV8 A;  1RDC A;  4BE1 A;  2X6S A;  2OYQ A;  3C6T A;  2Z1H A;  4R5P A;  4W5T A;  3ZT3 A;  1L3T A;  1RT2 A;  1NK9 A;  1TKT A;  3I0R A;  4C8K A;  1RT7 A;  3OVN A;  4FXD A;  4QCL A;  2EX3 A;  1ZYQ A;  1ASW A;  3BGR A;  2XO7 A;  1Q8I A;  4DMN A;  3JYT A;  1FKP A;  1LAV A;  4E7L A;  3AVC A;  2ZQB A;  3AVM A;  4OGC A;  4E3S A;  1SL0 A;  3K59 A;  4WE1 A;  1JLE A;  1HPZ A;  2VG6 A;  3NBP A;  3CFR A;  1JXE A;  4O0J A;  3U3G A;  3CG7 A;  2YNG A;  3NH2 A;  3K57 A;  2I5J A;  3VQ6 A;  2ETJ A;  2KW4 A;  1FXX A;  3TAR A;  4M3T A;  2O4G A;  3VA3 A;  3VQC A;  4AHC A;  4BDY A;  3DYA A;  5J2N A;  1NOY A;  3K5N A;  3AA5 X;  1C0M A;  4Z4H A;  3AO4 A;  4IKF A;  4CHN A;  3ZSY A;  4CJP A;  1WSE A;  4HVJ A;  3VQA A;  4C8N A;  4IG3 A;  1G15 A;  1RT3 A;  3F9K A;  3HPG A;  3RRH A;  4DF4 A;  4CJS A;  3SUQ A;  4KHY A;  4ZTJ A;  2KTQ A;  3VQ8 A;  4KAZ A;  1WN7 A;  3LP0 A;  4KHN A;  3PO5 A;  3AVJ A;  1RNH A;  3NF7 A;  4LSN A;  1S6Q A;  1KCF A;  4OVL A;  3VN5 A;  2HHS A;  4CEF A;  1SKR A;  1UA1 A;  1LAW A;  1HJR A;  3KK3 A;  4CE9 A;  3TAE A;  2OPR A;  3TAG A;  1TAQ A;  3OYH A;  3DM2 A;  2GUI A;  2KZM A;  4YNQ A;  3SQ4 A;  4I2Q A;  2VG5 A;  1X9S A;  1Q9Y A;  4DSK A;  1KTQ A;  5KRT A;  3V4I A;  4H4M A;  3OYI A;  4BWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...