3ZSUA

Structure of the cyanoq protein from thermosynechococcus elongatus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
118
structure length
118
Chain Sequence
PPTYSELQITRIQDYLRDIEKNAERFADLEVSVAKGDWQEARNIMRGPLGEMLMDMRALNRNLLAKDQPTPTALTRALTDDFLKIDQGADLDSVTVAQEGFREAEADFKAYLNSLPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cyanoq from the Thermophilic Cyanobacterium Thermosynechococcus Elongatus and Detection in Isolated Photosystem II Complexes.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords TLL2057 PROTEIN
total genus 54
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zsuA00
1NZEA 3RFYA 3LS0A 1VYKA 3JCUQ 3LS1A 3ZSUA 2MWQA
chains in the Genus database with same CATH superfamily
2D5RB 4AL1A 2Z15A 2KW3C 3CAXA 4DBQA 4BJ5C 3CZ6A 4JTCB 4PFPA 3G50A 3PMRA 3FMSA 1TWGA 4WABA 4XWJA 2XL6A 3SEOA 5B3IA 1T6IA 4RD9A 1NU9C 2YZSA 2NUPA 2FAPB 5D91A 3U5SA 4BJ5A 3NMIA 1FTSA 3K6BA 1FMWA 4CSAA 4YL3A 1JPJA 4J32B 1MQVA 2W4BA 2VCAA 2YL3A 2HFIA 3SYNA 3VYWA 3RIPA 3ZTMA 2GWWA 4DRIB 4E18A 3GEHA 3US6A 3EHMA 1W2WA 3WAQA 1WGWA 3PCVA 3TK0A 4O6YA 3F47A 3EZHA 2ZPAA 1TWAA 2NG1A 3VAYA 4E0HA 1TWCA 2XLOA 5HSWA 1NFOA 4JTAB 2A0BA 2A6EF 1RCPA 5BQGA 4YK5A 1CPRA 1OCRC 1F1MA 1YA7O 1YZAA 2EIMC 3DE8A 4MW8A 1VTMP 1OXBA 2VCCA 4A2NB 1L3PA 1UFBA 3Q7LA 1JRAA 1OXKA 2W4MA 3HNKA 2W9YA 1OKKD 2HMZA 2XSEA 1ORJA 5T1DB 4MVZA 3GORA 3RYLA 3SZRA 3V5XA 1NLXA 4BPMA 5L0CA 1OR3A 2KQ9A 2MYSA 4E0IA 1EA8A 2WVQA 3S0XA 1VK5A 2RD9A 2CNWD 1BR2A 3CSKA 2BC5A 1D1AA 5DVWA 1ZW2A 3NMJA 3QW1A 1Q0FA 1XWJA 1Z3IX 3TD7A 3V5ZA 4DRJB 3EH2A 2MWQA 4E17A 3A11A 1LE4A 3M1CB 4P9TA 4EKWA 3GM3A 4C7OA 5B3SC 1J8YF 2KGOA 4MQ9F 5L0GA 3Q6NA 2CNWA 1FMVA 1KU2A 1Q0GA 2IM8A 3K1IC 3TULA 3X1OA 5L0FA 2EPKX 2G3KA 3W2WA 4YWQA 2PP4A 1DOVA 1BBHA 4QI0A 4HFFB 2V26A 3S27A 2Q00A 5E33A 3SXMA 4AX2A 1LI5A 2QE9A 1D0XA 3K1HA 3L1MA 1OW6A 3ECSA 4F4BA 4PFOA 3WHNA 4CX9A 5HV9A 1BR4A 1G4WR 3DWWA 2DYSC 5KYWA 2L6FA 3U3BA 2KK1A 2P0NA 2UUIA 3TJ5A 2R7RA 3Q6MA 1NG1A 4DXWA 4G7OF 4O6MA 1SYQA 4IWBA 4JC7A 2CGEA 2EIJC 2HKVA 3DE9A 2Y3DA 4CDAA 3L8JA 4EBJA 2EPOA 2XL4A 3MFNA 2HUJA 4LLCA 5A6BD 4C3DA 4GYTA 1YYJA 5DS6A 5EGYA 2PF4E 3SNHA 3G4XA 4BJ1A 3LNMB 1JR8A 2F22A 4JVSA 4K7BA 5GPGB 2R7WA 1ZHYA 3V5YA 5A6BA 1SZIA 3TJ6A 4AL0A 3CEXA 3KL4A 3JCUQ 2HV6A 1D0YA 5JP7A 2O9XA 1RKCA 4BEJA 3H65A 1YARO 4ZLCA 1E84A 4JRZA 1SF8A 2IXOA 2OCCC 4YJWA 2YEVA 1R4TA 4JEAA 2MHRA 4H54A 4OD4A 3POVA 2XXAA 2BL2A 2KC3A 2QY9A 1YDIA 2GDCA 3M15A 4H4KC 4LDRA 5COMA 1V55C 1T9KA 3M4CA 4YT5A 4OIQF 1ZU5A 3U3FA 3I5QA 3U0CA 2J7PD 2XRHA 3ABLC 1RKEA 3UGPA 1V4AA 3LJBA 2QNLA 4J7YA 3S84A 2VB6A 1EI7A 3RKOF 1O3UA 3MYFA 1OR2A 3ASNC 4XLPF 2XLMA 4KI2A 4PJJA 2UUHA 4RBNA 4G0HA 1FFHA 3KKBA 4HE8D 4O6NA 1LI7A 3MLGA 3OA1A 4IGGA 5KYYB 3GWNA 1LPEA 1T6QA 2OJQA 5DQZA 1RMVA 4DRHB 4L6RA 1WTYA 1G5ZA 3AQCA 1TFKB 2RSEB 3ITFA 3L34A 4MNDA 2VCBA 5F28E 1VB5A 1OCZC 1YZCA 3NYJA 3JTLO 4PJMA 2H7BA 4K0DA 2LCHA 3EPVA 3EG9B 3C8ZA 4PJNA 1Q0KA 3RQGA 3DMDA 1I4YA 5L0DA 1D1CA 4BJ6A 4PJLA 2YL7A 4O79A 3NG1A 5BUOA 4KC9A 4U5HA 1Q0DA 4CS8C 3SXYA 2R7VA 1VYIA 1M56C 3IQCA 1MMNA 5T3WA 3M4BA 5D92A 3GEIA 4CDYA 1OW7A 2PFDA 1GGQA 4K1OA 3ASOC 4G7ZF 3ZC4A 3IQ6A 2R7TA 2J8WA 2NUTB 5JRAA 4G7HF 1G4US 2JD3A 2WVNA 2PX0A 2P1AA 1N1CA 1YYXA 4MTGA 4AE4B 2ZXRA 3BEHA 4NTFA 2DGJA 2HS5A 2VASA 3HNLA 4EBKA 2OQMA 4CSAC 4FAPB 2NSFA 3NKDA 2EPLX 1R5ID 2R25A 3EGDB 2XLVA 5KYYA 2ZXWC 3U2LA 3AJMA 3DJNB 1H7IA 4JCHA 3R7CA 5FZTA 1HY5A 3SXZA 1CPQA 2J45A 3W8IA 2QLAA 3B0UX 3FAJA 4OIRF 4MVRA 1ZZPA 1GQAA 1GS9A 4RDAA 2XLWA 3ABMC 1E2XA 1ZW3A 3NYLA 3T6GB 2LQGA 2WZFA 2XS8A 3JZ0A 3OWTA 4I1MA 4CDVA 4BJ6C 2EINC 3G4ZA 4Z9JA 4B6IA 1AVOB 4CS8A 3JSEO 1MMAA 4KNWA 2H7VC 1MNDA 3JT1A 3B0PA 3F46A 3JRMO 2TMVP 2JX0A 1LE2A 1V54C 2E87A 3DD7A 4D4XA 1Z63A 2XXAB 1NBBA 3ATPA 4N6HA 5A6AA 2CCYA 4ANJA 1BZ4A 3EJNA 1AUEA 4XPXA 2ZD9A 2A69F 2I15A 3MYIA 4KBLA 1HW1A 4JEBA 3OEOA 4N4WA 5A69A 3IHUA 3KMIA 4I1OB 1HE9A 2WZGA 1KTMA 2A1DD 2J0WA 2J9BA 1A7VA 1E85A 3DI5A 1WASA 2R7QA 3NKEA 5EK0A 4OD5A 1QSPA 2HJMA 1ORSC 4YL1A 5KYXA 2NPUA 3NDBB 3DAFA 3IQTA 4MVSA 2CYDA 1M2VB 2R7SA 2GAQA 1FR0A 4WGZA 2IYLD 3TOLA 3DM9B 4N06A 3S29A 1K04A 2A0UA 4CS7A 3QMKA 1ZVZA 2ICWG 4JZAA 2G3VA 5BQHA 2IXPA 1OQCA 2AU5A 2XS1A 3ZTZA 4DVYP 3RF3A 1Z7Qc 4NCQA 4ER9A 2DI3A 2J7PA 3AG4C 3IEEA 3C8GA 5KYXB 3EFOB 2A6HF 4YL0A 2L6HA 5KYUA 2OJED 5KYNA 2YHSA 4ZLDA 1OCCC 3AG3C 2YLDA 2Q7RA 4EHPA 5JVEA 1CGME 4XLNF 2LIGA 3FAPB 4D4NA 3M79A 2YQYA 3HJCA 1Z6AA 4ULVA 1TKNA 2C04A 3AOUA 1KNYA 3RW0A 3SP1A 3KH2A 1RKEB 4QDLA 3ZVRA 1L7CA 3JSZA 2D4UA 2OU6A 3W2VA 1B68A 2J0XA 4E7ZA 2L7AA 3QW0A 3C8GD 1S7ZA 1PV3A 1AEPA 2FGYA 2Y3BA 4W8KA 3WG7C 2Y3HA 3EH1A 3QTHA 4MTOA 1A7EA 2I8BA 2ZXOA 4P9FA 3IPMO 3LEOA 3L0IA 1C02A 1QQ3A 3FHDA 2LSEA 3UMKA 2QTVA 4BJTA 4EUKB 1QKRA 4IB4A 4CS9C 2PX3A 1Y4CA 4XEFA 4DVZA 3FOPA 4CIHA 2Q9CA 3J06A 2IOQA 4LDKA 4G78A 1ST6A 1VYKA 4Z9HA 1O87A 3BRJA 1U6HA 4XEKA 3EGXA 3QVYA 1NU7D 2BE5F 3EZIA 2VH3A 4JE9A 5JS5A 1Y6DA 1OW8A 3UMHA 1M2OA 3EQLF 4UDVA 2B0HA 1D1BA 3GM2A 3WODF 4LDQA 4ONSA 3ZIBA 1M2VA 1NSGB 1U89A 2OEVA 4U5BE 1H6GA 3LEVA 4NTBA 4IJJA 4WGYA 3VF0A 5COGA 4OIPF 3AG1C 2ZXPA 1NFNA 2NUTA 1MMDA 1G8XA 1YAUO 5E3AA 3C63A 5TJ5E 3U8PA 3UNGC 5DLJA 1LS4A 2GA0A 2X0CA 5DQTA 2HMQA 1EKYA 2WL8A 3N24A 2HSQA 1ZHWA 1FAPB 4LLEA 1A7DA 3H2UA 1RJ9A 3ZSUA 4YT4A 3O39A 1QZXA 2YWAA 4PACA 1UG7A 5K0IA 3EFOA 3O10A 3RFYA 5A6JA 5JT4A 5DS5A 1C17M 4XTKA 4U9DA 3U8VA 4LERA 4J7TA 5IY5C 1I4ZA 2L81A 5F5FA 5B1AC 2ASRA 4O7GA 2HV7A 3T9OA 2M4EA 3HTKC 1OCOC 1M6TA 2Q9AA 4GEHA 5FCLA 3T4RA 2WVOA 3UR3C 4QI2A 2AVKA 4Q4ZF 4OIOF 5CI8A 2XLDA 4DOZA 4C3BA 3PDMP 1IZMA 1H9GA 1TQGA 2LFDA 1YJGA 3B9QA 4JKVA 5T3TA 3S9OA 4A4AA 1A41A 1ZHXA 1T5OA 4IAOA 1U0BB 2PNOA 4YT8A 4NQFA 3RQFA 1YVIA 3A9CA 1RJ9B 1WOLA 4CBEA 5JLIA 3ZDLA 2L9JA 4MTFA 1FFTC 2KYHA 2G62A 2LK4A 4FX5A 4CJOA 3HKKA 2NSGA 4LACB 3AQBA 3C18A 3O55A 3T6BA 4XPWA 3ZG1A 4W8PA 1XZPA 4FESA 3AGUA 3O6XA 2YL1A 2OKUA 1TFOB 2CDQA 2L6GA 2Q9BA 2EIKC 3GEEA 4FWVA 1YLMA 1HMDA 4U5CE 1BDJB 5E3CA 2W45A 1ZHTA 2NUPB 2OG2A 2ETSA 2DB4A 3T6JA 3GANA 3I5PA 3ZWIA 4CJGA 3FVYA 3GM1A 5AC4A 2V3CC 1MNEA 1QLEC 3I4UA 3V7OA 1LVKA 2LP4A 3AG2C 3B71A 3HNIA 4XPYA 2EPMX 3QZCA 3R2PA 2H7OA 1DOWA 1JOGA 1Z23A 2J9WA 3FXHA 1K40A 4AK9A 3K33A 4DBRA 4DJ9A 2DYRC 5JUAA 1E83A 3UGOA 2HZ8A 4XQ1A 3SXKA 3EHNA 3FOOA 4I3MA 1LM3B 4N6CA 5L0HA 1XZQA 3PHF2 2FFHA 2HSBA 4P6IC 3LUTB 4U5GA 5JSLA 1ZU4A 1D0ZA 1PD1A 2LFFA 1WWPA 2CW0F 3QVZA 3N2ZB 2J46A 3W4YA 2IXMA 4NTAA 3LS1A 5L0JA 5AC5A 4AE4A 4EBBA 4MS2A 5CIVA 5KYWB 1A0BA 2AP3A 4Q7CA 2XL8A 1PCXA 1Q0MA 4PK4A 3DXJF 1J8MF 2XM4A 4YT2A 3S28A 1LIHA 5B1BC 4U5DE 3C62A 3U9JA 3FDQA 3E9VA 1WN0A 2P7VA 1HE1A 2R03A 4JTDB 1BR1A 2IXNA 4I44A 4MVOA 1QPUA 4MVMA 1RXQA 2B0JA 1VLTA 1OKKA 3K66A 3GWLA 3NRHA 1ZYRF 2P6VA 3HNJA 5KYUB 1WATA 2X51A 1GM5A 3RH3A 2JPUA 4NY3A 1QVXA 1CGNA 3LLKA 4HFKB 4U9EA 5L3QA 4IRUA 2R7XA 3VM6A 3EGXB 4XEVA 2J9VA 1PD0A 4JCZA 2XLHA 3K7DA 3LAYA 2OOCA 3RVZA 4Q5SF 1ZHZA 3KYIA 3B0VC 3DJUB 1E86A 3VRCA 2GFHA 2P61A 1ORYA 3RVYA 2R7UA 2YRFA 2EILC 1K05A 2WB7A 1SMYF 2Q3TA 4CS9A 2H8AA 5BQIA 1FNTc 1LS1A 2M64A 1C03A 1CGOA 2XLEA 2YVKA 3B29A 3DZAA 3MBGA 4NC3A 4OINF 5EHHA 3U2MA 4R32A 2Y69C 2KNHA 2R05A 4CIPA 2Y3GA 2KJGA 4MVQA 3S90A 4JIOA 5L0IA 3H2VA 4GQHA 3GODA 3K1IA 1MMGA 3MX3A 1T01A 2IBFA 4MW3A 4C3EA 1VLSA 2WZLA 3DM5A 3AGTA 1EQ1A 3NYMA 2YLGA 2PBEA 1T6UA 4Z9IA 2HJ3A 3DKAA 2R9RB 4J30B 2Y39A 4JW1A 1APCA 2LD6A 3W8HA 2YL0A 4KNVA 4BG0A 2VC9A 3IQ5A 2R7OA 1TWHA 1O5HA 4E7SA 3ZQVA 1I5NA 2J9UA 1V74B 1M57C 3E70C 2QUPA 3LESA 3Q7GA 4EIYA 1LKXA 3JRTA 1H9TA 3C7JA 1VMAA 4M63A 4U5EE 5AGFA 3N0TA 3JYYA 3NMKA 4EWCA 4MVUA 3L8IA 3TQOA 2C03A 1SR2A 4JJFA 3X2QC 1JMWA 1TR2A 1NZEA 3C8GB 5COFA 2AWCA 3JYHA 4C7OB 2XM0A 3EG9A 3ABKC 3EGDA 3LNRA 4ULWA 4YN0B 5A6KA 2Q4FA 3RQEA 3DAGA 1Z5ZA 1JPNA 256BA 2YLIA 3LLIA 5CI9A 5E2QA 3ZQYA 1HW2A 2A68F 1IW7F 4JJGA 3U9MA 2OEXA 2R02A 2EPNA 2AWYA 3CQZA 4HEAJ 4JURI 4BEMJ 5L3VA 2KSFA 2YKZA 4IARA 4IAQA 1JAFA 5F5HA 1VOMA 1YA9A 4PR9A 3UMIA 3HLZA 3KPHA 4U5FE 4WJ0A 3TOMA 4X0RA 3LS0A 1S05A 5DS4A 1HMOA 3KYJA
chains in the Genus database with same CATH topology
2D5RB 2Z15A 2KW3C 4DBQA 4BJ5C 3CZ6A 4PFPA 3PMRA 4XWJA 3SEOA 1TWGA 4RD9A 4BJ5A 1NU9C 2YZSA 2NUPA 5D91A 1FTSA 3K6BA 1FMWA 4CSAA 1JPJA 4J32B 2W4BA 3VYWA 3SYNA 3RIPA 3EHMA 1W2WA 1WGWA 4O6YA 3F47A 3EZHA 2ZPAA 1TWAA 2NG1A 3VAYA 5HSWA 1TWCA 2A6EF 1OCRC 2EIMC 4A2NB 3Q7LA 2W4MA 2W9YA 1OKKD 2XSEA 3SZRA 5T1DB 3RYLA 2R7TA 2KQ9A 2MYSA 2WVQA 3S0XA 1VK5A 2CNWD 1BR2A 3CSKA 1D1AA 5DVWA 1Z3IX 3TD7A 3EH2A 2MWQA 3M1CB 4C7OA 5B3SC 1J8YF 2KGOA 4MQ9F 3Q6NA 2CNWA 1FMVA 1KU2A 3K1IC 3X1OA 2G3KA 3W2WA 4YWQA 2PP4A 4QI0A 4HFFB 2V26A 3S27A 5E33A 4AX2A 1D0XA 3K1HA 3ECSA 4F4BA 4PFOA 5KYWA 1BR4A 2DYSC 2R7RA 3Q6MA 1NG1A 4G7OF 4O6MA 4IWBA 2CGEA 2EIJC 2Y3DA 2XL4A 4LLCA 4C3DA 4GYTA 5DS6A 5EGYA 2PF4E 3SNHA 4BJ1A 4JVSA 4K7BA 2R7WA 1ZHYA 1SZIA 3KL4A 3JCUQ 2HV6A 1D0YA 2O9XA 4BEJA 3H65A 4ZLCA 1SF8A 2IXOA 2OCCC 4YJWA 2YEVA 4OD4A 3POVA 2XXAA 2QY9A 4H4KC 1V55C 4YT5A 4OIQF 1ZU5A 3I5QA 2J7PD 2XRHA 3ABLC 3UGPA 3LJBA 2VB6A 3RKOF 4XLPF 3ASNC 4KI2A 4PJJA 4RBNA 4G0HA 1FFHA 3KKBA 4HE8D 4O6NA 3MLGA 3OA1A 5KYYB 5DQZA 3L34A 3AQCA 4MNDA 3ITFA 1OCZC 3NYJA 4PJMA 2H7BA 4K0DA 3EPVA 3EG9B 4PJNA 3DMDA 1D1CA 4BJ6A 4PJLA 4O79A 3NG1A 5BUOA 4KC9A 4U5HA 4CS8C 2R7VA 1VYIA 1M56C 1MMNA 5T3WA 5D92A 2PFDA 3ASOC 4G7ZF 3ZC4A 2NUTB 2JD3A 2WVNA 2PX0A 1N1CA 4AE4B 2ZXRA 2DGJA 2VASA 4CSAC 3NKDA 3EGDB 5KYYA 2ZXWC 3DJNB 4JCHA 2J45A 3W8IA 3B0UX 3FAJA 4OIRF 4RDAA 3ABMC 3NYLA 2WZFA 4I1MA 3OWTA 4BJ6C 2EINC 4B6IA 4CS8A 1MMAA 4KNWA 2H7VC 1MNDA 3JT1A 3B0PA 3F46A 1Z63A 1V54C 2E87A 3DD7A 2XXAB 4ANJA 3EJNA 2A69F 4KBLA 3OEOA 3KMIA 4I1OB 2WZGA 2A1DD 2J0WA 2R7QA 3NKEA 4OD5A 5KYXA 3NDBB 3DAFA 1M2VB 2R7SA 2IYLD 3DM9B 4N06A 3S29A 4CS7A 3QMKA 4JZAA 2G3VA 2IXPA 4DVYP 2J7PA 3AG4C 3IEEA 5KYXB 3EFOB 2A6HF 5KYUA 5KYNA 4ZLDA 2YHSA 1OCCC 3AG3C 4XLNF 3HJCA 1Z6AA 1TKNA 2C04A 3SP1A 3KH2A 4QDLA 3ZVRA 3JSZA 3W2VA 2J0XA 4E7ZA 1S7ZA 2Y3BA 4W8KA 2FGYA 3WG7C 2Y3HA 3EH1A 2I8BA 2ZXOA 3L0IA 3FHDA 2LSEA 3UMKA 2QTVA 4BJTA 4CS9C 2PX3A 4DVZA 4CIHA 2Q9CA 2IOQA 1ST6A 1VYKA 1O87A 3EGXA 1NU7D 2BE5F 3EZIA 2VH3A 3UMHA 1M2OA 3EQLF 1D1BA 3WODF 3ZIBA 1M2VA 4U5BE 4OIPF 3LEVA 4IJJA 3AG1C 2ZXPA 2NUTA 1MMDA 1G8XA 5E3AA 3UNGC 5DLJA 5DQTA 2WL8A 3N24A 1ZHWA 4LLEA 1RJ9A 3ZSUA 4YT4A 3O39A 1QZXA 3EFOA 3RFYA 5DS5A 4XTKA 4LERA 5IY5C 5F5FA 2L81A 5B1AC 4O7GA 2HV7A 2M4EA 3HTKC 1OCOC 2Q9AA 4GEHA 5FCLA 3T4RA 2WVOA 3UR3C 4QI2A 4Q4ZF 4OIOF 5CI8A 4DOZA 4C3BA 1IZMA 5T3TA 3B9QA 1ZHXA 4IAOA 4YT8A 1RJ9B 4CBEA 2L9JA 1FFTC 4FX5A 2G62A 4LACB 3AQBA 3T6BA 3ZG1A 4FESA 3O6XA 4G7HF 2CDQA 2Q9BA 4FWVA 2EIKC 4U5CE 5E3CA 2W45A 1ZHTA 2NUPB 2OG2A 3T6JA 3GANA 3I5PA 2V3CC 3FVYA 1MNEA 1QLEC 3I4UA 3V7OA 1LVKA 3AG2C 3QZCA 2H7OA 1Z23A 2J9WA 4AK9A 3K33A 4DBRA 2DYRC 3UGOA 3EHNA 4I3MA 3PHF2 2FFHA 4P6IC 4U5GA 1ZU4A 1D0ZA 1PD1A 2CW0F 3N2ZB 2J46A 2IXMA 3LS1A 4AE4A 4EBBA 5KYWB 4Q7CA 1PCXA 4PK4A 3DXJF 1J8MF 4YT2A 3S28A 5B1BC 4U5DE 3FDQA 3E9VA 2P7VA 1BR1A 2IXNA 4I44A 2B0JA 1OKKA 3K66A 3NRHA 5KYUB 1ZYRF 2P6VA 2X51A 3RH3A 4NY3A 3LLKA 4HFKB 5L3QA 4IRUA 2R7XA 3EGXB 2J9VA 1PD0A 3K7DA 3LAYA 4Q5SF 1ZHZA 3B0VC 3DJUB 2GFHA 2R7UA 2EILC 2WB7A 1SMYF 2Q3TA 4CS9A 1LS1A 3DZAA 5EHHA 4OINF 2Y69C 2KNHA 2Y3GA 2KJGA 3GODA 3MX3A 1MMGA 4C3EA 4E7SA 2WZLA 3DM5A 3NYMA 4J30B 2Y39A 4JW1A 4BG0A 3W8HA 4KNVA 2R7OA 1TWHA 1O5HA 2J9UA 1M57C 3E70C 3LESA 3Q7GA 1LKXA 3JRTA 4U5EE 1VMAA 4M63A 3N0TA 4EWCA 2C03A 4JJFA 3X2QC 1TR2A 1NZEA 3JYHA 4C7OB 3EG9A 3ABKC 3EGDA 3LNRA 4ULWA 4YN0B 3DAGA 1Z5ZA 1JPNA 3LLIA 5CI9A 5E2QA 2A68F 1IW7F 4JJGA 4HEAJ 4JURI 3CQZA 5L3VA 5F5HA 1VOMA 3UMIA 3HLZA 4U5FE 4WJ0A 4X0RA 3LS0A 5DS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZE A;  3RFY A;  3LS0 A;  1VYK A;  3JCU Q;  3LS1 A;  3ZSU A;  2MWQ A; 
#chains in the Genus database with same CATH topology
 2D5R B;  4AL1 A;  2Z15 A;  2KW3 C;  3CAX A;  4DBQ A;  4BJ5 C;  3CZ6 A;  4JTC B;  4PFP A;  3G50 A;  3PMR A;  3FMS A;  1TWG A;  4WAB A;  4XWJ A;  2XL6 A;  3SEO A;  5B3I A;  1T6I A;  4RD9 A;  1NU9 C;  2YZS A;  2NUP A;  2FAP B;  5D91 A;  3U5S A;  4BJ5 A;  3NMI A;  1FTS A;  3K6B A;  1FMW A;  4CSA A;  4YL3 A;  1JPJ A;  4J32 B;  1MQV A;  2W4B A;  2VCA A;  2YL3 A;  2HFI A;  3SYN A;  3VYW A;  3RIP A;  3ZTM A;  2GWW A;  4DRI B;  4E18 A;  3GEH A;  3US6 A;  3EHM A;  1W2W A;  3WAQ A;  1WGW A;  3PCV A;  3TK0 A;  4O6Y A;  3F47 A;  3EZH A;  2ZPA A;  1TWA A;  2NG1 A;  3VAY A;  4E0H A;  1TWC A;  2XLO A;  5HSW A;  1NFO A;  4JTA B;  2A0B A;  2A6E F;  1RCP A;  5BQG A;  4YK5 A;  1CPR A;  1OCR C;  1F1M A;  1YA7 O;  1YZA A;  2EIM C;  3DE8 A;  4MW8 A;  1VTM P;  1OXB A;  2VCC A;  4A2N B;  1L3P A;  1UFB A;  3Q7L A;  1JRA A;  1OXK A;  2W4M A;  3HNK A;  2W9Y A;  1OKK D;  2HMZ A;  2XSE A;  1ORJ A;  5T1D B;  4MVZ A;  3GOR A;  3RYL A;  3SZR A;  3V5X A;  1NLX A;  4BPM A;  5L0C A;  1OR3 A;  2KQ9 A;  2MYS A;  4E0I A;  1EA8 A;  2WVQ A;  3S0X A;  1VK5 A;  2RD9 A;  2CNW D;  1BR2 A;  3CSK A;  2BC5 A;  1D1A A;  5DVW A;  1ZW2 A;  3NMJ A;  3QW1 A;  1Q0F A;  1XWJ A;  1Z3I X;  3TD7 A;  3V5Z A;  4DRJ B;  3EH2 A;  2MWQ A;  4E17 A;  3A11 A;  1LE4 A;  3M1C B;  4P9T A;  4EKW A;  3GM3 A;  4C7O A;  5B3S C;  1J8Y F;  2KGO A;  4MQ9 F;  5L0G A;  3Q6N A;  2CNW A;  1FMV A;  1KU2 A;  1Q0G A;  2IM8 A;  3K1I C;  3TUL A;  3X1O A;  5L0F A;  2EPK X;  2G3K A;  3W2W A;  4YWQ A;  2PP4 A;  1DOV A;  1BBH A;  4QI0 A;  4HFF B;  2V26 A;  3S27 A;  2Q00 A;  5E33 A;  3SXM A;  4AX2 A;  1LI5 A;  2QE9 A;  1D0X A;  3K1H A;  3L1M A;  1OW6 A;  3ECS A;  4F4B A;  4PFO A;  3WHN A;  4CX9 A;  5HV9 A;  1BR4 A;  1G4W R;  3DWW A;  2DYS C;  5KYW A;  2L6F A;  3U3B A;  2KK1 A;  2P0N A;  2UUI A;  3TJ5 A;  2R7R A;  3Q6M A;  1NG1 A;  4DXW A;  4G7O F;  4O6M A;  1SYQ A;  4IWB A;  4JC7 A;  2CGE A;  2EIJ C;  2HKV A;  3DE9 A;  2Y3D A;  4CDA A;  3L8J A;  4EBJ A;  2EPO A;  2XL4 A;  3MFN A;  2HUJ A;  4LLC A;  5A6B D;  4C3D A;  4GYT A;  1YYJ A;  5DS6 A;  5EGY A;  2PF4 E;  3SNH A;  3G4X A;  4BJ1 A;  3LNM B;  1JR8 A;  2F22 A;  4JVS A;  4K7B A;  5GPG B;  2R7W A;  1ZHY A;  3V5Y A;  5A6B A;  1SZI A;  3TJ6 A;  4AL0 A;  3CEX A;  3KL4 A;  3JCU Q;  2HV6 A;  1D0Y A;  5JP7 A;  2O9X A;  1RKC A;  4BEJ A;  3H65 A;  1YAR O;  4ZLC A;  1E84 A;  4JRZ A;  1SF8 A;  2IXO A;  2OCC C;  4YJW A;  2YEV A;  1R4T A;  4JEA A;  2MHR A;  4H54 A;  4OD4 A;  3POV A;  2XXA A;  2BL2 A;  2KC3 A;  2QY9 A;  1YDI A;  2GDC A;  3M15 A;  4H4K C;  4LDR A;  5COM A;  1V55 C;  1T9K A;  3M4C A;  4YT5 A;  4OIQ F;  1ZU5 A;  3U3F A;  3I5Q A;  3U0C A;  2J7P D;  2XRH A;  3ABL C;  1RKE A;  3UGP A;  1V4A A;  3LJB A;  2QNL A;  4J7Y A;  3S84 A;  2VB6 A;  1EI7 A;  3RKO F;  1O3U A;  3MYF A;  1OR2 A;  3ASN C;  4XLP F;  2XLM A;  4KI2 A;  4PJJ A;  2UUH A;  4RBN A;  4G0H A;  1FFH A;  3KKB A;  4HE8 D;  4O6N A;  1LI7 A;  3MLG A;  3OA1 A;  4IGG A;  5KYY B;  3GWN A;  1LPE A;  1T6Q A;  2OJQ A;  5DQZ A;  1RMV A;  4DRH B;  4L6R A;  1WTY A;  1G5Z A;  3AQC A;  1TFK B;  2RSE B;  3ITF A;  3L34 A;  4MND A;  2VCB A;  5F28 E;  1VB5 A;  1OCZ C;  1YZC A;  3NYJ A;  3JTL O;  4PJM A;  2H7B A;  4K0D A;  2LCH A;  3EPV A;  3EG9 B;  3C8Z A;  4PJN A;  1Q0K A;  3RQG A;  3DMD A;  1I4Y A;  5L0D A;  1D1C A;  4BJ6 A;  4PJL A;  2YL7 A;  4O79 A;  3NG1 A;  5BUO A;  4KC9 A;  4U5H A;  1Q0D A;  4CS8 C;  3SXY A;  2R7V A;  1VYI A;  1M56 C;  3IQC A;  1MMN A;  5T3W A;  3M4B A;  5D92 A;  3GEI A;  4CDY A;  1OW7 A;  2PFD A;  1GGQ A;  4K1O A;  3ASO C;  4G7Z F;  3ZC4 A;  3IQ6 A;  2R7T A;  2J8W A;  2NUT B;  5JRA A;  4G7H F;  1G4U S;  2JD3 A;  2WVN A;  2PX0 A;  2P1A A;  1N1C A;  1YYX A;  4MTG A;  4AE4 B;  2ZXR A;  3BEH A;  4NTF A;  2DGJ A;  2HS5 A;  2VAS A;  3HNL A;  4EBK A;  2OQM A;  4CSA C;  4FAP B;  2NSF A;  3NKD A;  2EPL X;  1R5I D;  2R25 A;  3EGD B;  2XLV A;  5KYY A;  2ZXW C;  3U2L A;  3AJM A;  3DJN B;  1H7I A;  4JCH A;  3R7C A;  5FZT A;  1HY5 A;  3SXZ A;  1CPQ A;  2J45 A;  3W8I A;  2QLA A;  3B0U X;  3FAJ A;  4OIR F;  4MVR A;  1ZZP A;  1GQA A;  1GS9 A;  4RDA A;  2XLW A;  3ABM C;  1E2X A;  1ZW3 A;  3NYL A;  3T6G B;  2LQG A;  2WZF A;  2XS8 A;  3JZ0 A;  3OWT A;  4I1M A;  4CDV A;  4BJ6 C;  2EIN C;  3G4Z A;  4Z9J A;  4B6I A;  1AVO B;  4CS8 A;  3JSE O;  1MMA A;  4KNW A;  2H7V C;  1MND A;  3JT1 A;  3B0P A;  3F46 A;  3JRM O;  2TMV P;  2JX0 A;  1LE2 A;  1V54 C;  2E87 A;  3DD7 A;  4D4X A;  1Z63 A;  2XXA B;  1NBB A;  3ATP A;  4N6H A;  5A6A A;  2CCY A;  4ANJ A;  1BZ4 A;  3EJN A;  1AUE A;  4XPX A;  2ZD9 A;  2A69 F;  2I15 A;  3MYI A;  4KBL A;  1HW1 A;  4JEB A;  3OEO A;  4N4W A;  5A69 A;  3IHU A;  3KMI A;  4I1O B;  1HE9 A;  2WZG A;  1KTM A;  2A1D D;  2J0W A;  2J9B A;  1A7V A;  1E85 A;  3DI5 A;  1WAS A;  2R7Q A;  3NKE A;  5EK0 A;  4OD5 A;  1QSP A;  2HJM A;  1ORS C;  4YL1 A;  5KYX A;  2NPU A;  3NDB B;  3DAF A;  3IQT A;  4MVS A;  2CYD A;  1M2V B;  2R7S A;  2GAQ A;  1FR0 A;  4WGZ A;  2IYL D;  3TOL A;  3DM9 B;  4N06 A;  3S29 A;  1K04 A;  2A0U A;  4CS7 A;  3QMK A;  1ZVZ A;  2ICW G;  4JZA A;  2G3V A;  5BQH A;  2IXP A;  1OQC A;  2AU5 A;  2XS1 A;  3ZTZ A;  4DVY P;  3RF3 A;  1Z7Q c;  4NCQ A;  4ER9 A;  2DI3 A;  2J7P A;  3AG4 C;  3IEE A;  3C8G A;  5KYX B;  3EFO B;  2A6H F;  4YL0 A;  2L6H A;  5KYU A;  2OJE D;  5KYN A;  2YHS A;  4ZLD A;  1OCC C;  3AG3 C;  2YLD A;  2Q7R A;  4EHP A;  5JVE A;  1CGM E;  4XLN F;  2LIG A;  3FAP B;  4D4N A;  3M79 A;  2YQY A;  3HJC A;  1Z6A A;  4ULV A;  1TKN A;  2C04 A;  3AOU A;  1KNY A;  3RW0 A;  3SP1 A;  3KH2 A;  1RKE B;  4QDL A;  3ZVR A;  1L7C A;  3JSZ A;  2D4U A;  2OU6 A;  3W2V A;  1B68 A;  2J0X A;  4E7Z A;  2L7A A;  3QW0 A;  3C8G D;  1S7Z A;  1PV3 A;  1AEP A;  2FGY A;  2Y3B A;  4W8K A;  3WG7 C;  2Y3H A;  3EH1 A;  3QTH A;  4MTO A;  1A7E A;  2I8B A;  2ZXO A;  4P9F A;  3IPM O;  3LEO A;  3L0I A;  1C02 A;  1QQ3 A;  3FHD A;  2LSE A;  3UMK A;  2QTV A;  4BJT A;  4EUK B;  1QKR A;  4IB4 A;  4CS9 C;  2PX3 A;  1Y4C A;  4XEF A;  4DVZ A;  3FOP A;  4CIH A;  2Q9C A;  3J06 A;  2IOQ A;  4LDK A;  4G78 A;  1ST6 A;  1VYK A;  4Z9H A;  1O87 A;  3BRJ A;  1U6H A;  4XEK A;  3EGX A;  3QVY A;  1NU7 D;  2BE5 F;  3EZI A;  2VH3 A;  4JE9 A;  5JS5 A;  1Y6D A;  1OW8 A;  3UMH A;  1M2O A;  3EQL F;  4UDV A;  2B0H A;  1D1B A;  3GM2 A;  3WOD F;  4LDQ A;  4ONS A;  3ZIB A;  1M2V A;  1NSG B;  1U89 A;  2OEV A;  4U5B E;  1H6G A;  3LEV A;  4NTB A;  4IJJ A;  4WGY A;  3VF0 A;  5COG A;  4OIP F;  3AG1 C;  2ZXP A;  1NFN A;  2NUT A;  1MMD A;  1G8X A;  1YAU O;  5E3A A;  3C63 A;  5TJ5 E;  3U8P A;  3UNG C;  5DLJ A;  1LS4 A;  2GA0 A;  2X0C A;  5DQT A;  2HMQ A;  1EKY A;  2WL8 A;  3N24 A;  2HSQ A;  1ZHW A;  1FAP B;  4LLE A;  1A7D A;  3H2U A;  1RJ9 A;  3ZSU A;  4YT4 A;  3O39 A;  1QZX A;  2YWA A;  4PAC A;  1UG7 A;  5K0I A;  3EFO A;  3O10 A;  3RFY A;  5A6J A;  5JT4 A;  5DS5 A;  1C17 M;  4XTK A;  4U9D A;  3U8V A;  4LER A;  4J7T A;  5IY5 C;  1I4Z A;  2L81 A;  5F5F A;  5B1A C;  2ASR A;  4O7G A;  2HV7 A;  3T9O A;  2M4E A;  3HTK C;  1OCO C;  1M6T A;  2Q9A A;  4GEH A;  5FCL A;  3T4R A;  2WVO A;  3UR3 C;  4QI2 A;  2AVK A;  4Q4Z F;  4OIO F;  5CI8 A;  2XLD A;  4DOZ A;  4C3B A;  3PDM P;  1IZM A;  1H9G A;  1TQG A;  2LFD A;  1YJG A;  3B9Q A;  4JKV A;  5T3T A;  3S9O A;  4A4A A;  1A41 A;  1ZHX A;  1T5O A;  4IAO A;  1U0B B;  2PNO A;  4YT8 A;  4NQF A;  3RQF A;  1YVI A;  3A9C A;  1RJ9 B;  1WOL A;  4CBE A;  5JLI A;  3ZDL A;  2L9J A;  4MTF A;  1FFT C;  2KYH A;  2G62 A;  2LK4 A;  4FX5 A;  4CJO A;  3HKK A;  2NSG A;  4LAC B;  3AQB A;  3C18 A;  3O55 A;  3T6B A;  4XPW A;  3ZG1 A;  4W8P A;  1XZP A;  4FES A;  3AGU A;  3O6X A;  2YL1 A;  2OKU A;  1TFO B;  2CDQ A;  2L6G A;  2Q9B A;  2EIK C;  3GEE A;  4FWV A;  1YLM A;  1HMD A;  4U5C E;  1BDJ B;  5E3C A;  2W45 A;  1ZHT A;  2NUP B;  2OG2 A;  2ETS A;  2DB4 A;  3T6J A;  3GAN A;  3I5P A;  3ZWI A;  4CJG A;  3FVY A;  3GM1 A;  5AC4 A;  2V3C C;  1MNE A;  1QLE C;  3I4U A;  3V7O A;  1LVK A;  2LP4 A;  3AG2 C;  3B71 A;  3HNI A;  4XPY A;  2EPM X;  3QZC A;  3R2P A;  2H7O A;  1DOW A;  1JOG A;  1Z23 A;  2J9W A;  3FXH A;  1K40 A;  4AK9 A;  3K33 A;  4DBR A;  4DJ9 A;  2DYR C;  5JUA A;  1E83 A;  3UGO A;  2HZ8 A;  4XQ1 A;  3SXK A;  3EHN A;  3FOO A;  4I3M A;  1LM3 B;  4N6C A;  5L0H A;  1XZQ A;  3PHF 2;  2FFH A;  2HSB A;  4P6I C;  3LUT B;  4U5G A;  5JSL A;  1ZU4 A;  1D0Z A;  1PD1 A;  2LFF A;  1WWP A;  2CW0 F;  3QVZ A;  3N2Z B;  2J46 A;  3W4Y A;  2IXM A;  4NTA A;  3LS1 A;  5L0J A;  5AC5 A;  4AE4 A;  4EBB A;  4MS2 A;  5CIV A;  5KYW B;  1A0B A;  2AP3 A;  4Q7C A;  2XL8 A;  1PCX A;  1Q0M A;  4PK4 A;  3DXJ F;  1J8M F;  2XM4 A;  4YT2 A;  3S28 A;  1LIH A;  5B1B C;  4U5D E;  3C62 A;  3U9J A;  3FDQ A;  3E9V A;  1WN0 A;  2P7V A;  1HE1 A;  2R03 A;  4JTD B;  1BR1 A;  2IXN A;  4I44 A;  4MVO A;  1QPU A;  4MVM A;  1RXQ A;  2B0J A;  1VLT A;  1OKK A;  3K66 A;  3GWL A;  3NRH A;  1ZYR F;  2P6V A;  3HNJ A;  5KYU B;  1WAT A;  2X51 A;  1GM5 A;  3RH3 A;  2JPU A;  4NY3 A;  1QVX A;  1CGN A;  3LLK A;  4HFK B;  4U9E A;  5L3Q A;  4IRU A;  2R7X A;  3VM6 A;  3EGX B;  4XEV A;  2J9V A;  1PD0 A;  4JCZ A;  2XLH A;  3K7D A;  3LAY A;  2OOC A;  3RVZ A;  4Q5S F;  1ZHZ A;  3KYI A;  3B0V C;  3DJU B;  1E86 A;  3VRC A;  2GFH A;  2P61 A;  1ORY A;  3RVY A;  2R7U A;  2YRF A;  2EIL C;  1K05 A;  2WB7 A;  1SMY F;  2Q3T A;  4CS9 A;  2H8A A;  5BQI A;  1FNT c;  1LS1 A;  2M64 A;  1C03 A;  1CGO A;  2XLE A;  2YVK A;  3B29 A;  3DZA A;  3MBG A;  4NC3 A;  4OIN F;  5EHH A;  3U2M A;  4R32 A;  2Y69 C;  2KNH A;  2R05 A;  4CIP A;  2Y3G A;  2KJG A;  4MVQ A;  3S90 A;  4JIO A;  5L0I A;  3H2V A;  4GQH A;  3GOD A;  3K1I A;  1MMG A;  3MX3 A;  1T01 A;  2IBF A;  4MW3 A;  4C3E A;  1VLS A;  2WZL A;  3DM5 A;  3AGT A;  1EQ1 A;  3NYM A;  2YLG A;  2PBE A;  1T6U A;  4Z9I A;  2HJ3 A;  3DKA A;  2R9R B;  4J30 B;  2Y39 A;  4JW1 A;  1APC A;  2LD6 A;  3W8H A;  2YL0 A;  4KNV A;  4BG0 A;  2VC9 A;  3IQ5 A;  2R7O A;  1TWH A;  1O5H A;  4E7S A;  3ZQV A;  1I5N A;  2J9U A;  1V74 B;  1M57 C;  3E70 C;  2QUP A;  3LES A;  3Q7G A;  4EIY A;  1LKX A;  3JRT A;  1H9T A;  3C7J A;  1VMA A;  4M63 A;  4U5E E;  5AGF A;  3N0T A;  3JYY A;  3NMK A;  4EWC A;  4MVU A;  3L8I A;  3TQO A;  2C03 A;  1SR2 A;  4JJF A;  3X2Q C;  1JMW A;  1TR2 A;  1NZE A;  3C8G B;  5COF A;  2AWC A;  3JYH A;  4C7O B;  2XM0 A;  3EG9 A;  3ABK C;  3EGD A;  3LNR A;  4ULW A;  4YN0 B;  5A6K A;  2Q4F A;  3RQE A;  3DAG A;  1Z5Z A;  1JPN A;  256B A;  2YLI A;  3LLI A;  5CI9 A;  5E2Q A;  3ZQY A;  1HW2 A;  2A68 F;  1IW7 F;  4JJG A;  3U9M A;  2OEX A;  2R02 A;  2EPN A;  2AWY A;  3CQZ A;  4HEA J;  4JUR I;  4BEM J;  5L3V A;  2KSF A;  2YKZ A;  4IAR A;  4IAQ A;  1JAF A;  5F5H A;  1VOM A;  1YA9 A;  4PR9 A;  3UMI A;  3HLZ A;  3KPH A;  4U5F E;  4WJ0 A;  3TOM A;  4X0R A;  3LS0 A;  1S05 A;  5DS4 A;  1HMO A;  3KYJ A; 
#chains in the Genus database with same CATH homology
 2D5R B;  2Z15 A;  2KW3 C;  4DBQ A;  4BJ5 C;  3CZ6 A;  4PFP A;  3PMR A;  4XWJ A;  3SEO A;  1TWG A;  4RD9 A;  4BJ5 A;  1NU9 C;  2YZS A;  2NUP A;  5D91 A;  1FTS A;  3K6B A;  1FMW A;  4CSA A;  1JPJ A;  4J32 B;  2W4B A;  3VYW A;  3SYN A;  3RIP A;  3EHM A;  1W2W A;  1WGW A;  4O6Y A;  3F47 A;  3EZH A;  2ZPA A;  1TWA A;  2NG1 A;  3VAY A;  5HSW A;  1TWC A;  2A6E F;  1OCR C;  2EIM C;  4A2N B;  3Q7L A;  2W4M A;  2W9Y A;  1OKK D;  2XSE A;  3SZR A;  5T1D B;  3RYL A;  2R7T A;  2KQ9 A;  2MYS A;  2WVQ A;  3S0X A;  1VK5 A;  2CNW D;  1BR2 A;  3CSK A;  1D1A A;  5DVW A;  1Z3I X;  3TD7 A;  3EH2 A;  2MWQ A;  3M1C B;  4C7O A;  5B3S C;  1J8Y F;  2KGO A;  4MQ9 F;  3Q6N A;  2CNW A;  1FMV A;  1KU2 A;  3K1I C;  3X1O A;  2G3K A;  3W2W A;  4YWQ A;  2PP4 A;  4QI0 A;  4HFF B;  2V26 A;  3S27 A;  5E33 A;  4AX2 A;  1D0X A;  3K1H A;  3ECS A;  4F4B A;  4PFO A;  5KYW A;  1BR4 A;  2DYS C;  2R7R A;  3Q6M A;  1NG1 A;  4G7O F;  4O6M A;  4IWB A;  2CGE A;  2EIJ C;  2Y3D A;  2XL4 A;  4LLC A;  4C3D A;  4GYT A;  5DS6 A;  5EGY A;  2PF4 E;  3SNH A;  4BJ1 A;  4JVS A;  4K7B A;  2R7W A;  1ZHY A;  1SZI A;  3KL4 A;  3JCU Q;  2HV6 A;  1D0Y A;  2O9X A;  4BEJ A;  3H65 A;  4ZLC A;  1SF8 A;  2IXO A;  2OCC C;  4YJW A;  2YEV A;  4OD4 A;  3POV A;  2XXA A;  2QY9 A;  4H4K C;  1V55 C;  4YT5 A;  4OIQ F;  1ZU5 A;  3I5Q A;  2J7P D;  2XRH A;  3ABL C;  3UGP A;  3LJB A;  2VB6 A;  3RKO F;  4XLP F;  3ASN C;  4KI2 A;  4PJJ A;  4RBN A;  4G0H A;  1FFH A;  3KKB A;  4HE8 D;  4O6N A;  3MLG A;  3OA1 A;  5KYY B;  5DQZ A;  3L34 A;  3AQC A;  4MND A;  3ITF A;  1OCZ C;  3NYJ A;  4PJM A;  2H7B A;  4K0D A;  3EPV A;  3EG9 B;  4PJN A;  3DMD A;  1D1C A;  4BJ6 A;  4PJL A;  4O79 A;  3NG1 A;  5BUO A;  4KC9 A;  4U5H A;  4CS8 C;  2R7V A;  1VYI A;  1M56 C;  1MMN A;  5T3W A;  5D92 A;  2PFD A;  3ASO C;  4G7Z F;  3ZC4 A;  2NUT B;  2JD3 A;  2WVN A;  2PX0 A;  1N1C A;  4AE4 B;  2ZXR A;  2DGJ A;  2VAS A;  4CSA C;  3NKD A;  3EGD B;  5KYY A;  2ZXW C;  3DJN B;  4JCH A;  2J45 A;  3W8I A;  3B0U X;  3FAJ A;  4OIR F;  4RDA A;  3ABM C;  3NYL A;  2WZF A;  4I1M A;  3OWT A;  4BJ6 C;  2EIN C;  4B6I A;  4CS8 A;  1MMA A;  4KNW A;  2H7V C;  1MND A;  3JT1 A;  3B0P A;  3F46 A;  1Z63 A;  1V54 C;  2E87 A;  3DD7 A;  2XXA B;  4ANJ A;  3EJN A;  2A69 F;  4KBL A;  3OEO A;  3KMI A;  4I1O B;  2WZG A;  2A1D D;  2J0W A;  2R7Q A;  3NKE A;  4OD5 A;  5KYX A;  3NDB B;  3DAF A;  1M2V B;  2R7S A;  2IYL D;  3DM9 B;  4N06 A;  3S29 A;  4CS7 A;  3QMK A;  4JZA A;  2G3V A;  2IXP A;  4DVY P;  2J7P A;  3AG4 C;  3IEE A;  5KYX B;  3EFO B;  2A6H F;  5KYU A;  5KYN A;  4ZLD A;  2YHS A;  1OCC C;  3AG3 C;  4XLN F;  3HJC A;  1Z6A A;  1TKN A;  2C04 A;  3SP1 A;  3KH2 A;  4QDL A;  3ZVR A;  3JSZ A;  3W2V A;  2J0X A;  4E7Z A;  1S7Z A;  2Y3B A;  4W8K A;  2FGY A;  3WG7 C;  2Y3H A;  3EH1 A;  2I8B A;  2ZXO A;  3L0I A;  3FHD A;  2LSE A;  3UMK A;  2QTV A;  4BJT A;  4CS9 C;  2PX3 A;  4DVZ A;  4CIH A;  2Q9C A;  2IOQ A;  1ST6 A;  1VYK A;  1O87 A;  3EGX A;  1NU7 D;  2BE5 F;  3EZI A;  2VH3 A;  3UMH A;  1M2O A;  3EQL F;  1D1B A;  3WOD F;  3ZIB A;  1M2V A;  4U5B E;  4OIP F;  3LEV A;  4IJJ A;  3AG1 C;  2ZXP A;  2NUT A;  1MMD A;  1G8X A;  5E3A A;  3UNG C;  5DLJ A;  5DQT A;  2WL8 A;  3N24 A;  1ZHW A;  4LLE A;  1RJ9 A;  3ZSU A;  4YT4 A;  3O39 A;  1QZX A;  3EFO A;  3RFY A;  5DS5 A;  4XTK A;  4LER A;  5IY5 C;  5F5F A;  2L81 A;  5B1A C;  4O7G A;  2HV7 A;  2M4E A;  3HTK C;  1OCO C;  2Q9A A;  4GEH A;  5FCL A;  3T4R A;  2WVO A;  3UR3 C;  4QI2 A;  4Q4Z F;  4OIO F;  5CI8 A;  4DOZ A;  4C3B A;  1IZM A;  5T3T A;  3B9Q A;  1ZHX A;  4IAO A;  4YT8 A;  1RJ9 B;  4CBE A;  2L9J A;  1FFT C;  4FX5 A;  2G62 A;  4LAC B;  3AQB A;  3T6B A;  3ZG1 A;  4FES A;  3O6X A;  4G7H F;  2CDQ A;  2Q9B A;  4FWV A;  2EIK C;  4U5C E;  5E3C A;  2W45 A;  1ZHT A;  2NUP B;  2OG2 A;  3T6J A;  3GAN A;  3I5P A;  2V3C C;  3FVY A;  1MNE A;  1QLE C;  3I4U A;  3V7O A;  1LVK A;  3AG2 C;  3QZC A;  2H7O A;  1Z23 A;  2J9W A;  4AK9 A;  3K33 A;  4DBR A;  2DYR C;  3UGO A;  3EHN A;  4I3M A;  3PHF 2;  2FFH A;  4P6I C;  4U5G A;  1ZU4 A;  1D0Z A;  1PD1 A;  2CW0 F;  3N2Z B;  2J46 A;  2IXM A;  3LS1 A;  4AE4 A;  4EBB A;  5KYW B;  4Q7C A;  1PCX A;  4PK4 A;  3DXJ F;  1J8M F;  4YT2 A;  3S28 A;  5B1B C;  4U5D E;  3FDQ A;  3E9V A;  2P7V A;  1BR1 A;  2IXN A;  4I44 A;  2B0J A;  1OKK A;  3K66 A;  3NRH A;  5KYU B;  1ZYR F;  2P6V A;  2X51 A;  3RH3 A;  4NY3 A;  3LLK A;  4HFK B;  5L3Q A;  4IRU A;  2R7X A;  3EGX B;  2J9V A;  1PD0 A;  3K7D A;  3LAY A;  4Q5S F;  1ZHZ A;  3B0V C;  3DJU B;  2GFH A;  2R7U A;  2EIL C;  2WB7 A;  1SMY F;  2Q3T A;  4CS9 A;  1LS1 A;  3DZA A;  5EHH A;  4OIN F;  2Y69 C;  2KNH A;  2Y3G A;  2KJG A;  3GOD A;  3MX3 A;  1MMG A;  4C3E A;  4E7S A;  2WZL A;  3DM5 A;  3NYM A;  4J30 B;  2Y39 A;  4JW1 A;  4BG0 A;  3W8H A;  4KNV A;  2R7O A;  1TWH A;  1O5H A;  2J9U A;  1M57 C;  3E70 C;  3LES A;  3Q7G A;  1LKX A;  3JRT A;  4U5E E;  1VMA A;  4M63 A;  3N0T A;  4EWC A;  2C03 A;  4JJF A;  3X2Q C;  1TR2 A;  1NZE A;  3JYH A;  4C7O B;  3EG9 A;  3ABK C;  3EGD A;  3LNR A;  4ULW A;  4YN0 B;  3DAG A;  1Z5Z A;  1JPN A;  3LLI A;  5CI9 A;  5E2Q A;  2A68 F;  1IW7 F;  4JJG A;  4HEA J;  4JUR I;  3CQZ A;  5L3V A;  5F5H A;  1VOM A;  3UMI A;  3HLZ A;  4U5F E;  4WJ0 A;  4X0R A;  3LS0 A;  5DS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...