3ZSUA

Structure of the cyanoq protein from thermosynechococcus elongatus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
118
structure length
118
Chain Sequence
b'PPTYSELQITRIQDYLRDIEKNAERFADLEVSVAKGDWQEARNIMRGPLGEMLMDMRALNRNLLAKDQPTPTALTRALTDDFLKIDQGADLDSVTVAQEGFREAEADFKAYLNSLPEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TLL2057 PROTEIN
publication title Crystal Structure of Cyanoq from the Thermophilic Cyanobacterium Thermosynechococcus Elongatus and Detection in Isolated Photosystem II Complexes.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 54
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zsuA00
3LS0A 1NZEA 3JCUQ 3RFYA 3LS1A 1VYKA 2MWQA 3ZSUA
chains in the Genus database with same CATH superfamily
1I5NA 3EFOA 1K40A 2FFHA 3U3BA 1H9TA 3U5SA 2RD9A 3OEOA 1TFKB 3TD7A 1YDIA 4YT5A 3RVYA 4G7ZF 3WG7C 4CBEA 2VC9A 3ZG1A 1NFOA 3LLIA 1MMGA 3A9CA 3GM3A 2YEVA 5B1BC 5KYWB 3SZRA 1SF8A 2GDCA 3FMSA 1FR0A 1PD0A 5A6KA 2OG2A 4LDQA 3PDMP 3W4YA 3B0PA 3EZHA 4OIRF 1PD1A 2QE9A 3LEOA 3KL4A 2R7VA 1YVIA 4W8PA 5EK0A 4N6CA 1YA9A 3AQBA 2YL1A 1LS4A 2WB7A 3GORA 3JZ0A 3W2VA 1D1AA 1HMDA 3ASOC 2HMQA 4CS8C 2Q9BA 2L9JA 4L6RA 4LLEA 4OIOF 1I4YA 2XRHA 4JW1A 1NG1A 1A7VA 1T01A 5FZTA 4CS9C 3NDBB 3FAPB 4LDRA 3QW1A 1QLEC 5EGYA 2P1AA 4MTOA 1NBBA 2BC5A 2WVOA 1FFHA 1FAPB 1Z7Qc 3J06A 2EINC 2WVQA 3M4CA 2EPNA 4F4BA 2MWQA 1OKKA 2EPMX 3ZSUA 2J45A 1NSGB 4DRJB 4Q4ZF 2R7XA 1WGWA 2YHSA 2J7PA 4K1OA 1QQ3A 1OCCC 1TR2A 3SP1A 3T4RA 3GANA 5KYYA 1RXQA 1CGOA 1ST6A 3T6GB 1OCRC 1DOWA 2XLWA 4HEAJ 3ZTZA 4MNDA 4BPMA 4ANJA 1Q0MA 4I1MA 3TULA 1ZHXA 4K7BA 2R03A 4E7SA 1VYIA 3ZTMA 5JVEA 4OD5A 2Q00A 2AWYA 4KNVA 4CSAC 3DZAA 4YT8A 5A6BA 4YL0A 1VTMP 4NC3A 2P0NA 4BG0A 1YZCA 2WVNA 2FGYA 3W8HA 3C63A 3AOUA 3G4ZA 4BJ5C 1TWGA 1Q0KA 2WZFA 3T6BA 1D0YA 2QLAA 3KYIA 4JC7A 3DAGA 3UMHA 2R7WA 3EHNA 4P6IC 3QVZA 2DYSC 3U0CA 1PCXA 2Q9CA 4G7OF 1QSPA 5JT4A 3DE9A 3K7DA 1Q0GA 4ONSA 1T9KA 4Z9HA 2J8WA 4U5EE 4XEVA 4ZLCA 2I8BA 1UG7A 2Y3HA 4AL0A 3V7OA 4IRUA 5L0CA 3K1HA 2ETSA 4MS2A 3G4XA 4NTAA 4RD9A 1CPRA 2EPLX 1XZQA 2YLDA 3G50A 4BJ6C 4PK4A 1ZW3A 3GWLA 2X51A 1TQGA 2XM4A 5L0HA 2R25A 2HSQA 4OD4A 3O6XA 5A6JA 4J7TA 4ER9A 5FCLA 3AJMA 1OXBA 3C8GD 1JOGA 2G62A 3POVA 2Y69C 1FMWA 4DRHB 5T3WA 4DXWA 4G7HF 4U9DA 5A69A 5F5HA 1SYQA 2KW3C 3RQEA 3S90A 1OCOC 1GS9A 3RQFA 2JX0A 2HJ3A 3KH2A 1YAUO 4WABA 3FVYA 4CS9A 3BEHA 5KYWA 3TOLA 2A6EF 2HJMA 3W8IA 3X1OA 1M2OA 4BJTA 4BJ1A 3DAFA 1AVOB 2J9WA 3DM9B 4E0IA 1VB5A 5DS5A 3F46A 4PACA 4WJ0A 4IAOA 2NUTB 1RJ9A 2J0XA 3MYIA 2CCYA 4DVZA 3U9JA 2TMVP 3VF0A 2L6HA 2NSFA 4IGGA 3TK0A 3S84A 1DOVA 2RSEB 1Y6DA 3KPHA 4C3EA 4MW3A 3V5XA 4XPXA 2HMZA 1T6QA 1ORYA 1ZVZA 2JPUA 1TKNA 2CYDA 4XWJA 3N0TA 3Q6MA 3PHF2 1BDJB 1BR2A 1VMAA 3LESA 2M4EA 4JVSA 4D4NA 2LK4A 3U8PA 3WAQA 4CSAA 4P9TA 3CZ6A 4O6MA 1RCPA 4DOZA 2Y3GA 1PV3A 2GFHA 1EI7A 1K05A 1OR2A 2Q4FA 2ZXRA 3CAXA 3L8JA 4JJGA 3C7JA 3HNIA 4JTCB 4MQ9F 5DS6A 4BJ5A 3DJNB 3VYWA 1JPNA 1ZU4A 3CEXA 3WODF 3NYJA 1M56C 4Q5SF 3ABKC 1UFBA 2KJGA 3RQGA 2A68F 3SNHA 3RW0A 2BL2A 2HS5A 1NZEA 4FX5A 3NKEA 1EKYA 1E83A 5F28E 3VAYA 4EHPA 1U0BB 1KNYA 2OQMA 2QNLA 5DLJA 1SR2A 1WOLA 4BJ6A 2AVKA 1E86A 3BRJA 1YZAA 3V5YA 2V26A 1HW2A 3JTLO 3DD7A 1JMWA 1JAFA 1F1MA 3HLZA 3LEVA 4PJNA 3K66A 3UMKA 1CPQA 1LE2A 3RH3A 2KQ9A 3E9VA 1M2VB 1ZHYA 5L0DA 2HZ8A 1SZIA 2R05A 3JSZA 2PX0A 1AUEA 4ULVA 1FTSA 4JKVA 3HNJA 3S27A 4Z9IA 3UNGC 1BBHA 3R7CA 4A4AA 1O87A 4JTDB 1HMOA 4JURI 3FAJA 1RKEB 4CDVA 2DI3A 4WGYA 1OQCA 2HUJA 3M79A 4KBLA 2H7BA 2W9YA 4RBNA 3M4BA 4AL1A 2D5RB 4CJGA 4Z9JA 5E2QA 2A1DD 4BEJA 3K6BA 3NMKA 5KYXB 4H4KC 3GWNA 2NUPA 1LM3B 2B0JA 2Q7RA 3Q6NA 4PFOA 5KYUB 1KTMA 1G8XA 3O39A 2NPUA 4IB4A 3C8ZA 5T1DB 1ZHTA 2IXNA 3GODA 2OCCC 4DBRA 3K33A 3KKBA 4YL1A 2W45A 1ZHWA 3X2QC 3LUTB 2QY9A 3ZIBA 3IQ5A 2J46A 2B0HA 3IQ6A 1ORSC 4MTFA 4GQHA 4MVQA 3QW0A 2EIMC 2NUTA 1OW7A 2XL4A 3C62A 4OINF 2H7OA 4U5BE 2BE5F 2OEXA 2XLOA 2EPKX 5F5FA 4IAQA 1NU9C 3A11A 3VRCA 3GM1A 1T6IA 4I3MA 4MVUA 4U5FE 1Y4CA 2VCBA 1LVKA 1IW7F 4EBKA 3KYJA 4LACB 1AEPA 5CI9A 5A6AA 2KK1A 1D0XA 2R7UA 2IYLD 4O6YA 3QVYA 4U5GA 3EGXA 5JUAA 2HV7A 2QTVA 4XLPF 2KNHA 4U5HA 3CQZA 4B6IA 2PFDA 2XL8A 2OU6A 3AGUA 1VLTA 2I15A 4I1OB 3GM2A 1NLXA 4PR9A 2L6GA 3S0XA 3SXYA 3E70C 3SXZA 1A0BA 3DXJF 3M1CB 1H9GA 1FFTC 2NG1A 2VCAA 4GYTA 1A7EA 3ZDLA 2O9XA 2YL0A 4J30B 3U9MA 4AK9A 3U3FA 1EA8A 4C3DA 2XLEA 4WGZA 2C04A 1CGNA 2E87A 2XLMA 4MVMA 2XLDA 4R32A 3ZWIA 4E18A 4DVYP 1ORJA 2PBEA 1BR1A 2ICWG 1TWAA 4O7GA 3GEEA 3LNRA 5DVWA 5K0IA 4ZLDA 1HW1A 1XZPA 1HY5A 3C8GB 3U2MA 1B68A 3QZCA 1Z5ZA 3FXHA 3TOMA 3CSKA 3T6JA 3TJ6A 1LE4A 2A0UA 3QTHA 3JSEO 2IM8A 3EH2A 3PCVA 2R7TA 4MW8A 2W4BA 3O10A 3SXKA 2YWAA 1BR4A 3EGDB 5E33A 1M2VA 2YLGA 1VK5A 3AGTA 3S28A 2XLVA 4KI2A 2J9BA 2AWCA 4W8KA 2OEVA 3RF3A 4EWCA 1H7IA 4YK5A 3UGOA 2H7VC 1YLMA 5L3VA 3UMIA 5E3CA 4Q7CA 5AC4A 1YYJA 4JRZA 3Q7LA 2Q3TA 4HFKB 5JLIA 2J9VA 1RKEA 3H2VA 5D91A 3VM6A 2R7RA 3NYMA 3I4UA 4CDAA 3DKAA 2ASRA 4U9EA 2PNOA 4LLCA 5AC5A 4LERA 5JSLA 1O3UA 2L6FA 3ECSA 5KYXA 2IXPA 4DBQA 2ZXOA 5JRAA 2H8AA 2CNWD 2C03A 2XXAB 4NTBA 3TQOA 3HNKA 1OXKA 3LLKA 2GA0A 1C17M 4MVRA 4CX9A 2R02A 4O79A 2IXMA 5COMA 4EIYA 1D1CA 5BQGA 4E17A 1C02A 1ZHZA 2J7PD 4JCHA 2KSFA 3JT1A 1Q0FA 3I5QA 4MVOA 2P7VA 4J32B 4DRIB 2UUIA 4C3BA 1WN0A 3LNMB 3Q7GA 3S9OA 5DQZA 2R7SA 1V55C 2GAQA 1G4WR 5E3AA 4DJ9A 4KNWA 2NSGA 1LIHA 4E0HA 5AGFA 4UDVA 3DWWA 1R4TA 3EQLF 2XS1A 3ASNC 4CS7A 5IY5C 2Y3BA 2KC3A 1JPJA 3KMIA 1G4US 1U6HA 4A2NB 4MVSA 1SMYF 3U2LA 4YT4A 2HKVA 3JRTA 1YARO 2J0WA 2L7AA 3DM5A 1J8YF 2UUHA 3IQCA 5B3SC 3MLGA 1QZXA 1Z63A 3H65A 4J7YA 3U8VA 2VB6A 4CJOA 1L7CA 5L0FA 2A69F 2DGJA 4N6HA 3LS0A 4YT2A 4C7OB 2J9UA 2QUPA 3IPMO 2XSEA 4CS8A 2W4MA 2P61A 1IZMA 2CDQA 2G3VA 4NCQA 2X0CA 2WZLA 4CIHA 1W2WA 3NMIA 1Z23A 2HV6A 4NQFA 4EBJA 2WL8A 3IEEA 1LI7A 3L34A 1VLSA 4XEKA 3C8GA 1MMNA 2ZD9A 1OR3A 2WZGA 3EG9B 5JP7A 4AE4B 1LS1A 2GWWA 3UGPA 4U5CE 1QKRA 1WWPA 3L0IA 2YZSA 1T5OA 2CGEA 3EZIA 3TJ5A 1MQVA 2YLIA 3GEHA 2HFIA 4ULWA 4BEMJ 3EGDA 1YA7O 1Z6AA 4NY3A 3B71A 1RJ9B 1Q0DA 3ATPA 4K0DA 1E84A 4QI2A 1S7ZA 3S29A 4MVZA 2G3KA 2MYSA 3OWTA 2EILC 4MTGA 3HTKC 2OJQA 4XTKA 1LPEA 5T3TA 3EJNA 2A6HF 1U89A 5GPGB 2F22A 3QMKA 1S05A 2EIKC 4PJJA 5HV9A 1MMDA 3O55A 5BQHA 2FAPB 1TWHA 3RFYA 5CI8A 4JJFA 4PFPA 2CNWA 2XM0A 2XXAA 4IJJA 1WASA 3GEIA 3EHMA 3FOPA 3H2UA 3US6A 5HSWA 1RKCA 5CIVA 4AX2A 2PX3A 3JYHA 3V5ZA 2P6VA 1XWJA 3ABMC 1QPUA 2LCHA 1JRAA 3W2WA 1A7DA 1HE1A 1TWCA 3L1MA 3PMRA 4YJWA 1M6TA 1GM5A 2LP4A 3JRMO 4N06A 4JEBA 1ZYRF 4LDKA 4RDAA 1OW6A 3K1IA 1C03A 3MYFA 2R7QA 3AG2C 4G0HA 5B3IA 1NFNA 1NU7D 1V54C 3EFOB 3N24A 3NG1A 1A41A 2YVKA 1E85A 2LSEA 1I4ZA 3LS1A 3NKDA 3HNLA 2DB4A 4D4XA 4XLNF 2V3CC 3ABLC 1APCA 3LJBA 3RYLA 1CGME 4U5DE 4PJLA 2YKZA 2AU5A 4H54A 2XL6A 4M63A 1M57C 2XLHA 1LI5A 2XS8A 4O6NA 1MNDA 1N1CA 2IOQA 4XQ1A 4XPWA 4EUKB 4YN0B 2Y39A 2LFFA 1K04A 3DE8A 3ITFA 4C7OA 2R9RB 3HKKA 1ZZPA 3OA1A 4IWBA 2HSBA 5B1AC 3ZQYA 5L0JA 3FOOA 2JD3A 3AG4C 3F47A 4PJMA 3MX3A 1MMAA 1LKXA 2YRFA 2R7OA 3L8IA 4FWVA 4JEAA 1ZU5A 2OJED 5EHHA 3JYYA 3NYLA 3FDQA 2EIJC 2NUPB 5BUOA 2KYHA 2CW0F 3DJUB 2Y3DA 5DQTA 1OCZC 4XPYA 5BQIA 4P9FA 4OIPF 4I44A 3MFNA 1D0ZA 2L81A 4AE4A 3EG9A 5L3QA 5KYUA 3RKOF 4GEHA 2PP4A 3NRHA 4YWQA 3SXMA 3AG1C 3IHUA 1EQ1A 4OIQF 1OKKD 4YL3A 3ZQVA 1VOMA 1O5HA 2YL7A 2ZPAA 3C18A 5KYNA 5DS4A 2IBFA 2Q9AA 1R5ID 2AP3A 2Z15A 1T6UA 1WTYA 256BA 5KYYB 3IQTA 1VYKA 1RMVA 1FMVA 5JS5A 1V4AA 4HFFB 4N4WA 5TJ5E 3SEOA 1OW8A 1WATA 1L3PA 3B9QA 5L0IA 1GGQA 3SYNA 4E7ZA 2LFDA 4CIPA 2ZXPA 1YJGA 3I5PA 3AQCA 2LQGA 2OOCA 4JZAA 1E2XA 2D4UA 4QI0A 2OKUA 5A6BD 1FNTc 3RIPA 3EGXB 4IARA 4JE9A 4XEFA 3UR3C 3ZVRA 2KGOA 4FAPB 1MNEA 1J8MF 5COGA 4JTAB 2LD6A 3DMDA 3HJCA 3WHNA 3B0UX 3RVZA 5COFA 2YQYA 1GQAA 2VH3A 3DI5A 4G78A 3R2PA 3M15A 4NTFA 4HE8D 4FESA 4EKWA 2DYRC 1QVXA 3B29A 1V74B 3NMJA 1D1BA 1KU2A 2LIGA 4QDLA 4X0RA 1Z3IX 2VCCA 1ZW2A 3K1IC 3JCUQ 3N2ZB 1G5ZA 3B0VC 2A0BA 3EPVA 4JIOA 5D92A 5L0GA 3AG3C 1YYXA 3LAYA 1HE9A 1JR8A 1TFOB 2MHRA 2VASA 4EBBA 4JCZA 2IXOA 1BZ4A 2M64A 3FHDA 3T9OA 2EPOA 2ZXWC 3EH1A 1H6GA 2PF4E 4CDYA 2YL3A 3MBGA 3ZC4A 4KC9A
chains in the Genus database with same CATH topology
3EFOA 2FFHA 3OEOA 3TD7A 4YT5A 4G7ZF 3WG7C 4CBEA 3ZG1A 5B1BC 3LLIA 1MMGA 5KYWB 2YEVA 3SZRA 1SF8A 1PD0A 2OG2A 3B0PA 3EZHA 4OIRF 1PD1A 3KL4A 2R7VA 3AQBA 2WB7A 3W2VA 1D1AA 3ASOC 2Q9BA 2L9JA 4LLEA 4OIOF 2XRHA 4JW1A 1NG1A 4CS9C 3NDBB 1QLEC 5EGYA 2WVOA 1FFHA 2EINC 2WVQA 4F4BA 2MWQA 1OKKA 3ZSUA 2J45A 2R7XA 4Q4ZF 1WGWA 2YHSA 2J7PA 1OCCC 1TR2A 3SP1A 3T4RA 3GANA 5KYYA 1ST6A 1OCRC 4HEAJ 4MNDA 4ANJA 4I1MA 1ZHXA 4K7BA 4E7SA 1VYIA 4OD5A 4KNVA 4CSAC 3DZAA 4YT8A 2WVNA 2FGYA 3W8HA 4BJ5C 1TWGA 2WZFA 3T6BA 1D0YA 3DAGA 3UMHA 2R7WA 3EHNA 4P6IC 2DYSC 1PCXA 2Q9CA 4G7OF 3K7DA 4U5EE 4ZLCA 2I8BA 2Y3HA 3V7OA 4IRUA 3K1HA 4RD9A 4BJ6C 4PK4A 2X51A 4OD4A 3O6XA 5FCLA 2G62A 3POVA 2Y69C 1FMWA 4G7HF 5T3WA 5F5HA 2KW3C 1OCOC 3KH2A 5KYWA 3FVYA 4CS9A 2A6EF 3W8IA 3X1OA 1M2OA 4BJTA 4BJ1A 3DAFA 2J9WA 3DM9B 5DS5A 3F46A 4WJ0A 4IAOA 2NUTB 1RJ9A 2J0XA 4DVZA 4C3EA 1TKNA 4XWJA 3N0TA 3Q6MA 3PHF2 1BR2A 1VMAA 3LESA 2M4EA 4JVSA 4CSAA 3CZ6A 4O6MA 4DOZA 2Y3GA 2ZXRA 2GFHA 4BG0A 4JJGA 4MQ9F 5DS6A 4BJ5A 3DJNB 3VYWA 1JPNA 1ZU4A 3WODF 3NYJA 1M56C 4Q5SF 3ABKC 2KJGA 2A68F 3SNHA 1NZEA 4FX5A 3NKEA 3VAYA 5DLJA 4BJ6A 2V26A 3DD7A 3HLZA 3LEVA 3UMKA 4PJNA 3K66A 3RH3A 2KQ9A 3E9VA 1M2VB 1ZHYA 1SZIA 3JSZA 2PX0A 1FTSA 3S27A 3UNGC 1O87A 4JURI 3FAJA 4KBLA 2H7BA 2W9YA 4RBNA 2D5RB 5E2QA 2A1DD 4BEJA 3K6BA 5KYXB 4H4KC 2NUPA 2B0JA 3Q6NA 4PFOA 5KYUB 1G8XA 3O39A 5T1DB 1ZHTA 2IXNA 3GODA 2OCCC 4DBRA 3K33A 3KKBA 2W45A 1ZHWA 3X2QC 2QY9A 3ZIBA 2J46A 2EIMC 2NUTA 2XL4A 4OINF 2H7OA 4U5BE 2BE5F 5F5FA 1NU9C 4I3MA 4U5FE 1LVKA 1IW7F 4LACB 5CI9A 1D0XA 2IYLD 4O6YA 4U5GA 3EGXA 2HV7A 2QTVA 4XLPF 2KNHA 4U5HA 3CQZA 4B6IA 2PFDA 4I1OB 3S0XA 3E70C 4GYTA 3DXJF 3M1CB 1FFTC 2NG1A 5BUOA 2O9XA 4J30B 4AK9A 4C3DA 2C04A 2E87A 4DVYP 2R7UA 4O7GA 1BR1A 1TWAA 5DVWA 3LNRA 4ZLDA 3QZCA 1Z5ZA 3CSKA 3T6JA 2R7TA 3EH2A 2W4BA 1BR4A 3EGDB 5E33A 1M2VA 3S28A 1VK5A 4KI2A 4W8KA 4EWCA 3UGOA 2H7VC 5L3VA 3UMIA 5E3CA 4Q7CA 3Q7LA 2Q3TA 4HFKB 2J9VA 5D91A 2R7RA 3NYMA 3I4UA 4LLCA 4LERA 3ECSA 5KYXA 2IXPA 4DBQA 2ZXOA 2CNWD 2C03A 2XXAB 3LLKA 4O79A 2IXMA 1D1CA 1ZHZA 2J7PD 4JCHA 3SEOA 3JT1A 3I5QA 2P7VA 4J32B 4C3BA 2R7SA 3Q7GA 5DQZA 1V55C 5E3AA 4KNWA 3EQLF 3ASNC 4CS7A 5IY5C 2Y3BA 1JPJA 3KMIA 4A2NB 1SMYF 4YT4A 3JRTA 2J0WA 5B3SC 3DM5A 1J8YF 3MLGA 1QZXA 1Z63A 3H65A 2VB6A 2A69F 2DGJA 3LS0A 4YT2A 4C7OB 2J9UA 2XSEA 4CS8A 2W4MA 1IZMA 2CDQA 2G3VA 2WZLA 4CIHA 1W2WA 1Z23A 2HV6A 2WL8A 3IEEA 3L34A 1MMNA 4AE4B 3EG9B 2WZGA 1LS1A 3UGPA 4U5CE 3L0IA 2YZSA 2CGEA 3EZIA 4ULWA 3EGDA 1Z6AA 4NY3A 1RJ9B 4K0DA 4QI2A 1S7ZA 3S29A 2G3KA 2MYSA 3OWTA 2EILC 3HTKC 4XTKA 5T3TA 3EJNA 2A6HF 3QMKA 2EIKC 4PJJA 1MMDA 1TWHA 3RFYA 5CI8A 4JJFA 4PFPA 2CNWA 2XXAA 4IJJA 3EHMA 5HSWA 4AX2A 2PX3A 3JYHA 2P6VA 3ABMC 3W2WA 1TWCA 3PMRA 4YJWA 4N06A 4RDAA 1ZYRF 2R7QA 3AG2C 4G0HA 1NU7D 1V54C 3EFOB 3N24A 3NG1A 2LSEA 3LS1A 3NKDA 4XLNF 2V3CC 3ABLC 3LJBA 3RYLA 4U5DE 4PJLA 4CS8C 4M63A 4O6NA 1M57C 1MNDA 1N1CA 2IOQA 4YN0B 2Y39A 3ITFA 4C7OA 3OA1A 4IWBA 5B1AC 2JD3A 3AG4C 3F47A 4PJMA 3MX3A 1MMAA 1LKXA 2R7OA 4FWVA 1ZU5A 5EHHA 3NYLA 3FDQA 2EIJC 2NUPB 2CW0F 3DJUB 2Y3DA 5DQTA 1OCZC 4OIPF 4I44A 1D0ZA 2L81A 4AE4A 3EG9A 5L3QA 5KYUA 3RKOF 4GEHA 2PP4A 3NRHA 4YWQA 3AG1C 4OIQF 1OKKD 5KYNA 1VOMA 1O5HA 2ZPAA 5DS4A 2Q9AA 5KYYB 2Z15A 1VYKA 1FMVA 4HFFB 3B9QA 3SYNA 4E7ZA 2ZXPA 4QI0A 3I5PA 3AQCA 4JZAA 3RIPA 3EGXB 3UR3C 3ZVRA 2KGOA 1MNEA 1J8MF 3HJCA 3DMDA 3B0UX 2VH3A 4HE8D 4FESA 2DYRC 1D1BA 1KU2A 4QDLA 4X0RA 1Z3IX 3K1IC 3JCUQ 3N2ZB 3B0VC 3EPVA 5D92A 3AG3C 3LAYA 2VASA 4EBBA 2IXOA 3FHDA 2ZXWC 3EH1A 2PF4E 3ZC4A 4KC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LS0 A;  1NZE A;  3JCU Q;  3RFY A;  3LS1 A;  1VYK A;  2MWQ A;  3ZSU A; 
#chains in the Genus database with same CATH topology
 1I5N A;  3EFO A;  1K40 A;  2FFH A;  3U3B A;  1H9T A;  3U5S A;  2RD9 A;  3OEO A;  1TFK B;  3TD7 A;  1YDI A;  4YT5 A;  3RVY A;  4G7Z F;  3WG7 C;  4CBE A;  2VC9 A;  3ZG1 A;  1NFO A;  3LLI A;  1MMG A;  3A9C A;  3GM3 A;  2YEV A;  5B1B C;  5KYW B;  3SZR A;  1SF8 A;  2GDC A;  3FMS A;  1FR0 A;  1PD0 A;  5A6K A;  2OG2 A;  4LDQ A;  3PDM P;  3W4Y A;  3B0P A;  3EZH A;  4OIR F;  1PD1 A;  2QE9 A;  3LEO A;  3KL4 A;  2R7V A;  1YVI A;  4W8P A;  5EK0 A;  4N6C A;  1YA9 A;  3AQB A;  2YL1 A;  1LS4 A;  2WB7 A;  3GOR A;  3JZ0 A;  3W2V A;  1D1A A;  1HMD A;  3ASO C;  2HMQ A;  4CS8 C;  2Q9B A;  2L9J A;  4L6R A;  4LLE A;  4OIO F;  1I4Y A;  2XRH A;  4JW1 A;  1NG1 A;  1A7V A;  1T01 A;  5FZT A;  4CS9 C;  3NDB B;  3FAP B;  4LDR A;  3QW1 A;  1QLE C;  5EGY A;  2P1A A;  4MTO A;  1NBB A;  2BC5 A;  2WVO A;  1FFH A;  1FAP B;  1Z7Q c;  3J06 A;  2EIN C;  2WVQ A;  3M4C A;  2EPN A;  4F4B A;  2MWQ A;  1OKK A;  2EPM X;  3ZSU A;  2J45 A;  1NSG B;  4DRJ B;  4Q4Z F;  2R7X A;  1WGW A;  2YHS A;  2J7P A;  4K1O A;  1QQ3 A;  1OCC C;  1TR2 A;  3SP1 A;  3T4R A;  3GAN A;  5KYY A;  1RXQ A;  1CGO A;  1ST6 A;  3T6G B;  1OCR C;  1DOW A;  2XLW A;  4HEA J;  3ZTZ A;  4MND A;  4BPM A;  4ANJ A;  1Q0M A;  4I1M A;  3TUL A;  1ZHX A;  4K7B A;  2R03 A;  4E7S A;  1VYI A;  3ZTM A;  5JVE A;  4OD5 A;  2Q00 A;  2AWY A;  4KNV A;  4CSA C;  3DZA A;  4YT8 A;  5A6B A;  4YL0 A;  1VTM P;  4NC3 A;  2P0N A;  4BG0 A;  1YZC A;  2WVN A;  2FGY A;  3W8H A;  3C63 A;  3AOU A;  3G4Z A;  4BJ5 C;  1TWG A;  1Q0K A;  2WZF A;  3T6B A;  1D0Y A;  2QLA A;  3KYI A;  4JC7 A;  3DAG A;  3UMH A;  2R7W A;  3EHN A;  4P6I C;  3QVZ A;  2DYS C;  3U0C A;  1PCX A;  2Q9C A;  4G7O F;  1QSP A;  5JT4 A;  3DE9 A;  3K7D A;  1Q0G A;  4ONS A;  1T9K A;  4Z9H A;  2J8W A;  4U5E E;  4XEV A;  4ZLC A;  2I8B A;  1UG7 A;  2Y3H A;  4AL0 A;  3V7O A;  4IRU A;  5L0C A;  3K1H A;  2ETS A;  4MS2 A;  3G4X A;  4NTA A;  4RD9 A;  1CPR A;  2EPL X;  1XZQ A;  2YLD A;  3G50 A;  4BJ6 C;  4PK4 A;  1ZW3 A;  3GWL A;  2X51 A;  1TQG A;  2XM4 A;  5L0H A;  2R25 A;  2HSQ A;  4OD4 A;  3O6X A;  5A6J A;  4J7T A;  4ER9 A;  5FCL A;  3AJM A;  1OXB A;  3C8G D;  1JOG A;  2G62 A;  3POV A;  2Y69 C;  1FMW A;  4DRH B;  5T3W A;  4DXW A;  4G7H F;  4U9D A;  5A69 A;  5F5H A;  1SYQ A;  2KW3 C;  3RQE A;  3S90 A;  1OCO C;  1GS9 A;  3RQF A;  2JX0 A;  2HJ3 A;  3KH2 A;  1YAU O;  4WAB A;  3FVY A;  4CS9 A;  3BEH A;  5KYW A;  3TOL A;  2A6E F;  2HJM A;  3W8I A;  3X1O A;  1M2O A;  4BJT A;  4BJ1 A;  3DAF A;  1AVO B;  2J9W A;  3DM9 B;  4E0I A;  1VB5 A;  5DS5 A;  3F46 A;  4PAC A;  4WJ0 A;  4IAO A;  2NUT B;  1RJ9 A;  2J0X A;  3MYI A;  2CCY A;  4DVZ A;  3U9J A;  2TMV P;  3VF0 A;  2L6H A;  2NSF A;  4IGG A;  3TK0 A;  3S84 A;  1DOV A;  2RSE B;  1Y6D A;  3KPH A;  4C3E A;  4MW3 A;  3V5X A;  4XPX A;  2HMZ A;  1T6Q A;  1ORY A;  1ZVZ A;  2JPU A;  1TKN A;  2CYD A;  4XWJ A;  3N0T A;  3Q6M A;  3PHF 2;  1BDJ B;  1BR2 A;  1VMA A;  3LES A;  2M4E A;  4JVS A;  4D4N A;  2LK4 A;  3U8P A;  3WAQ A;  4CSA A;  4P9T A;  3CZ6 A;  4O6M A;  1RCP A;  4DOZ A;  2Y3G A;  1PV3 A;  2GFH A;  1EI7 A;  1K05 A;  1OR2 A;  2Q4F A;  2ZXR A;  3CAX A;  3L8J A;  4JJG A;  3C7J A;  3HNI A;  4JTC B;  4MQ9 F;  5DS6 A;  4BJ5 A;  3DJN B;  3VYW A;  1JPN A;  1ZU4 A;  3CEX A;  3WOD F;  3NYJ A;  1M56 C;  4Q5S F;  3ABK C;  1UFB A;  2KJG A;  3RQG A;  2A68 F;  3SNH A;  3RW0 A;  2BL2 A;  2HS5 A;  1NZE A;  4FX5 A;  3NKE A;  1EKY A;  1E83 A;  5F28 E;  3VAY A;  4EHP A;  1U0B B;  1KNY A;  2OQM A;  2QNL A;  5DLJ A;  1SR2 A;  1WOL A;  4BJ6 A;  2AVK A;  1E86 A;  3BRJ A;  1YZA A;  3V5Y A;  2V26 A;  1HW2 A;  3JTL O;  3DD7 A;  1JMW A;  1JAF A;  1F1M A;  3HLZ A;  3LEV A;  4PJN A;  3K66 A;  3UMK A;  1CPQ A;  1LE2 A;  3RH3 A;  2KQ9 A;  3E9V A;  1M2V B;  1ZHY A;  5L0D A;  2HZ8 A;  1SZI A;  2R05 A;  3JSZ A;  2PX0 A;  1AUE A;  4ULV A;  1FTS A;  4JKV A;  3HNJ A;  3S27 A;  4Z9I A;  3UNG C;  1BBH A;  3R7C A;  4A4A A;  1O87 A;  4JTD B;  1HMO A;  4JUR I;  3FAJ A;  1RKE B;  4CDV A;  2DI3 A;  4WGY A;  1OQC A;  2HUJ A;  3M79 A;  4KBL A;  2H7B A;  2W9Y A;  4RBN A;  3M4B A;  4AL1 A;  2D5R B;  4CJG A;  4Z9J A;  5E2Q A;  2A1D D;  4BEJ A;  3K6B A;  3NMK A;  5KYX B;  4H4K C;  3GWN A;  2NUP A;  1LM3 B;  2B0J A;  2Q7R A;  3Q6N A;  4PFO A;  5KYU B;  1KTM A;  1G8X A;  3O39 A;  2NPU A;  4IB4 A;  3C8Z A;  5T1D B;  1ZHT A;  2IXN A;  3GOD A;  2OCC C;  4DBR A;  3K33 A;  3KKB A;  4YL1 A;  2W45 A;  1ZHW A;  3X2Q C;  3LUT B;  2QY9 A;  3ZIB A;  3IQ5 A;  2J46 A;  2B0H A;  3IQ6 A;  1ORS C;  4MTF A;  4GQH A;  4MVQ A;  3QW0 A;  2EIM C;  2NUT A;  1OW7 A;  2XL4 A;  3C62 A;  4OIN F;  2H7O A;  4U5B E;  2BE5 F;  2OEX A;  2XLO A;  2EPK X;  5F5F A;  4IAQ A;  1NU9 C;  3A11 A;  3VRC A;  3GM1 A;  1T6I A;  4I3M A;  4MVU A;  4U5F E;  1Y4C A;  2VCB A;  1LVK A;  1IW7 F;  4EBK A;  3KYJ A;  4LAC B;  1AEP A;  5CI9 A;  5A6A A;  2KK1 A;  1D0X A;  2R7U A;  2IYL D;  4O6Y A;  3QVY A;  4U5G A;  3EGX A;  5JUA A;  2HV7 A;  2QTV A;  4XLP F;  2KNH A;  4U5H A;  3CQZ A;  4B6I A;  2PFD A;  2XL8 A;  2OU6 A;  3AGU A;  1VLT A;  2I15 A;  4I1O B;  3GM2 A;  1NLX A;  4PR9 A;  2L6G A;  3S0X A;  3SXY A;  3E70 C;  3SXZ A;  1A0B A;  3DXJ F;  3M1C B;  1H9G A;  1FFT C;  2NG1 A;  2VCA A;  4GYT A;  1A7E A;  3ZDL A;  2O9X A;  2YL0 A;  4J30 B;  3U9M A;  4AK9 A;  3U3F A;  1EA8 A;  4C3D A;  2XLE A;  4WGZ A;  2C04 A;  1CGN A;  2E87 A;  2XLM A;  4MVM A;  2XLD A;  4R32 A;  3ZWI A;  4E18 A;  4DVY P;  1ORJ A;  2PBE A;  1BR1 A;  2ICW G;  1TWA A;  4O7G A;  3GEE A;  3LNR A;  5DVW A;  5K0I A;  4ZLD A;  1HW1 A;  1XZP A;  1HY5 A;  3C8G B;  3U2M A;  1B68 A;  3QZC A;  1Z5Z A;  3FXH A;  3TOM A;  3CSK A;  3T6J A;  3TJ6 A;  1LE4 A;  2A0U A;  3QTH A;  3JSE O;  2IM8 A;  3EH2 A;  3PCV A;  2R7T A;  4MW8 A;  2W4B A;  3O10 A;  3SXK A;  2YWA A;  1BR4 A;  3EGD B;  5E33 A;  1M2V A;  2YLG A;  1VK5 A;  3AGT A;  3S28 A;  2XLV A;  4KI2 A;  2J9B A;  2AWC A;  4W8K A;  2OEV A;  3RF3 A;  4EWC A;  1H7I A;  4YK5 A;  3UGO A;  2H7V C;  1YLM A;  5L3V A;  3UMI A;  5E3C A;  4Q7C A;  5AC4 A;  1YYJ A;  4JRZ A;  3Q7L A;  2Q3T A;  4HFK B;  5JLI A;  2J9V A;  1RKE A;  3H2V A;  5D91 A;  3VM6 A;  2R7R A;  3NYM A;  3I4U A;  4CDA A;  3DKA A;  2ASR A;  4U9E A;  2PNO A;  4LLC A;  5AC5 A;  4LER A;  5JSL A;  1O3U A;  2L6F A;  3ECS A;  5KYX A;  2IXP A;  4DBQ A;  2ZXO A;  5JRA A;  2H8A A;  2CNW D;  2C03 A;  2XXA B;  4NTB A;  3TQO A;  3HNK A;  1OXK A;  3LLK A;  2GA0 A;  1C17 M;  4MVR A;  4CX9 A;  2R02 A;  4O79 A;  2IXM A;  5COM A;  4EIY A;  1D1C A;  5BQG A;  4E17 A;  1C02 A;  1ZHZ A;  2J7P D;  4JCH A;  2KSF A;  3JT1 A;  1Q0F A;  3I5Q A;  4MVO A;  2P7V A;  4J32 B;  4DRI B;  2UUI A;  4C3B A;  1WN0 A;  3LNM B;  3Q7G A;  3S9O A;  5DQZ A;  2R7S A;  1V55 C;  2GAQ A;  1G4W R;  5E3A A;  4DJ9 A;  4KNW A;  2NSG A;  1LIH A;  4E0H A;  5AGF A;  4UDV A;  3DWW A;  1R4T A;  3EQL F;  2XS1 A;  3ASN C;  4CS7 A;  5IY5 C;  2Y3B A;  2KC3 A;  1JPJ A;  3KMI A;  1G4U S;  1U6H A;  4A2N B;  4MVS A;  1SMY F;  3U2L A;  4YT4 A;  2HKV A;  3JRT A;  1YAR O;  2J0W A;  2L7A A;  3DM5 A;  1J8Y F;  2UUH A;  3IQC A;  5B3S C;  3MLG A;  1QZX A;  1Z63 A;  3H65 A;  4J7Y A;  3U8V A;  2VB6 A;  4CJO A;  1L7C A;  5L0F A;  2A69 F;  2DGJ A;  4N6H A;  3LS0 A;  4YT2 A;  4C7O B;  2J9U A;  2QUP A;  3IPM O;  2XSE A;  4CS8 A;  2W4M A;  2P61 A;  1IZM A;  2CDQ A;  2G3V A;  4NCQ A;  2X0C A;  2WZL A;  4CIH A;  1W2W A;  3NMI A;  1Z23 A;  2HV6 A;  4NQF A;  4EBJ A;  2WL8 A;  3IEE A;  1LI7 A;  3L34 A;  1VLS A;  4XEK A;  3C8G A;  1MMN A;  2ZD9 A;  1OR3 A;  2WZG A;  3EG9 B;  5JP7 A;  4AE4 B;  1LS1 A;  2GWW A;  3UGP A;  4U5C E;  1QKR A;  1WWP A;  3L0I A;  2YZS A;  1T5O A;  2CGE A;  3EZI A;  3TJ5 A;  1MQV A;  2YLI A;  3GEH A;  2HFI A;  4ULW A;  4BEM J;  3EGD A;  1YA7 O;  1Z6A A;  4NY3 A;  3B71 A;  1RJ9 B;  1Q0D A;  3ATP A;  4K0D A;  1E84 A;  4QI2 A;  1S7Z A;  3S29 A;  4MVZ A;  2G3K A;  2MYS A;  3OWT A;  2EIL C;  4MTG A;  3HTK C;  2OJQ A;  4XTK A;  1LPE A;  5T3T A;  3EJN A;  2A6H F;  1U89 A;  5GPG B;  2F22 A;  3QMK A;  1S05 A;  2EIK C;  4PJJ A;  5HV9 A;  1MMD A;  3O55 A;  5BQH A;  2FAP B;  1TWH A;  3RFY A;  5CI8 A;  4JJF A;  4PFP A;  2CNW A;  2XM0 A;  2XXA A;  4IJJ A;  1WAS A;  3GEI A;  3EHM A;  3FOP A;  3H2U A;  3US6 A;  5HSW A;  1RKC A;  5CIV A;  4AX2 A;  2PX3 A;  3JYH A;  3V5Z A;  2P6V A;  1XWJ A;  3ABM C;  1QPU A;  2LCH A;  1JRA A;  3W2W A;  1A7D A;  1HE1 A;  1TWC A;  3L1M A;  3PMR A;  4YJW A;  1M6T A;  1GM5 A;  2LP4 A;  3JRM O;  4N06 A;  4JEB A;  1ZYR F;  4LDK A;  4RDA A;  1OW6 A;  3K1I A;  1C03 A;  3MYF A;  2R7Q A;  3AG2 C;  4G0H A;  5B3I A;  1NFN A;  1NU7 D;  1V54 C;  3EFO B;  3N24 A;  3NG1 A;  1A41 A;  2YVK A;  1E85 A;  2LSE A;  1I4Z A;  3LS1 A;  3NKD A;  3HNL A;  2DB4 A;  4D4X A;  4XLN F;  2V3C C;  3ABL C;  1APC A;  3LJB A;  3RYL A;  1CGM E;  4U5D E;  4PJL A;  2YKZ A;  2AU5 A;  4H54 A;  2XL6 A;  4M63 A;  1M57 C;  2XLH A;  1LI5 A;  2XS8 A;  4O6N A;  1MND A;  1N1C A;  2IOQ A;  4XQ1 A;  4XPW A;  4EUK B;  4YN0 B;  2Y39 A;  2LFF A;  1K04 A;  3DE8 A;  3ITF A;  4C7O A;  2R9R B;  3HKK A;  1ZZP A;  3OA1 A;  4IWB A;  2HSB A;  5B1A C;  3ZQY A;  5L0J A;  3FOO A;  2JD3 A;  3AG4 C;  3F47 A;  4PJM A;  3MX3 A;  1MMA A;  1LKX A;  2YRF A;  2R7O A;  3L8I A;  4FWV A;  4JEA A;  1ZU5 A;  2OJE D;  5EHH A;  3JYY A;  3NYL A;  3FDQ A;  2EIJ C;  2NUP B;  5BUO A;  2KYH A;  2CW0 F;  3DJU B;  2Y3D A;  5DQT A;  1OCZ C;  4XPY A;  5BQI A;  4P9F A;  4OIP F;  4I44 A;  3MFN A;  1D0Z A;  2L81 A;  4AE4 A;  3EG9 A;  5L3Q A;  5KYU A;  3RKO F;  4GEH A;  2PP4 A;  3NRH A;  4YWQ A;  3SXM A;  3AG1 C;  3IHU A;  1EQ1 A;  4OIQ F;  1OKK D;  4YL3 A;  3ZQV A;  1VOM A;  1O5H A;  2YL7 A;  2ZPA A;  3C18 A;  5KYN A;  5DS4 A;  2IBF A;  2Q9A A;  1R5I D;  2AP3 A;  2Z15 A;  1T6U A;  1WTY A;  256B A;  5KYY B;  3IQT A;  1VYK A;  1RMV A;  1FMV A;  5JS5 A;  1V4A A;  4HFF B;  4N4W A;  5TJ5 E;  3SEO A;  1OW8 A;  1WAT A;  1L3P A;  3B9Q A;  5L0I A;  1GGQ A;  3SYN A;  4E7Z A;  2LFD A;  4CIP A;  2ZXP A;  1YJG A;  3I5P A;  3AQC A;  2LQG A;  2OOC A;  4JZA A;  1E2X A;  2D4U A;  4QI0 A;  2OKU A;  5A6B D;  1FNT c;  3RIP A;  3EGX B;  4IAR A;  4JE9 A;  4XEF A;  3UR3 C;  3ZVR A;  2KGO A;  4FAP B;  1MNE A;  1J8M F;  5COG A;  4JTA B;  2LD6 A;  3DMD A;  3HJC A;  3WHN A;  3B0U X;  3RVZ A;  5COF A;  2YQY A;  1GQA A;  2VH3 A;  3DI5 A;  4G78 A;  3R2P A;  3M15 A;  4NTF A;  4HE8 D;  4FES A;  4EKW A;  2DYR C;  1QVX A;  3B29 A;  1V74 B;  3NMJ A;  1D1B A;  1KU2 A;  2LIG A;  4QDL A;  4X0R A;  1Z3I X;  2VCC A;  1ZW2 A;  3K1I C;  3JCU Q;  3N2Z B;  1G5Z A;  3B0V C;  2A0B A;  3EPV A;  4JIO A;  5D92 A;  5L0G A;  3AG3 C;  1YYX A;  3LAY A;  1HE9 A;  1JR8 A;  1TFO B;  2MHR A;  2VAS A;  4EBB A;  4JCZ A;  2IXO A;  1BZ4 A;  2M64 A;  3FHD A;  3T9O A;  2EPO A;  2ZXW C;  3EH1 A;  1H6G A;  2PF4 E;  4CDY A;  2YL3 A;  3MBG A;  3ZC4 A;  4KC9 A; 
#chains in the Genus database with same CATH homology
 3EFO A;  2FFH A;  3OEO A;  3TD7 A;  4YT5 A;  4G7Z F;  3WG7 C;  4CBE A;  3ZG1 A;  5B1B C;  3LLI A;  1MMG A;  5KYW B;  2YEV A;  3SZR A;  1SF8 A;  1PD0 A;  2OG2 A;  3B0P A;  3EZH A;  4OIR F;  1PD1 A;  3KL4 A;  2R7V A;  3AQB A;  2WB7 A;  3W2V A;  1D1A A;  3ASO C;  2Q9B A;  2L9J A;  4LLE A;  4OIO F;  2XRH A;  4JW1 A;  1NG1 A;  4CS9 C;  3NDB B;  1QLE C;  5EGY A;  2WVO A;  1FFH A;  2EIN C;  2WVQ A;  4F4B A;  2MWQ A;  1OKK A;  3ZSU A;  2J45 A;  2R7X A;  4Q4Z F;  1WGW A;  2YHS A;  2J7P A;  1OCC C;  1TR2 A;  3SP1 A;  3T4R A;  3GAN A;  5KYY A;  1ST6 A;  1OCR C;  4HEA J;  4MND A;  4ANJ A;  4I1M A;  1ZHX A;  4K7B A;  4E7S A;  1VYI A;  4OD5 A;  4KNV A;  4CSA C;  3DZA A;  4YT8 A;  2WVN A;  2FGY A;  3W8H A;  4BJ5 C;  1TWG A;  2WZF A;  3T6B A;  1D0Y A;  3DAG A;  3UMH A;  2R7W A;  3EHN A;  4P6I C;  2DYS C;  1PCX A;  2Q9C A;  4G7O F;  3K7D A;  4U5E E;  4ZLC A;  2I8B A;  2Y3H A;  3V7O A;  4IRU A;  3K1H A;  4RD9 A;  4BJ6 C;  4PK4 A;  2X51 A;  4OD4 A;  3O6X A;  5FCL A;  2G62 A;  3POV A;  2Y69 C;  1FMW A;  4G7H F;  5T3W A;  5F5H A;  2KW3 C;  1OCO C;  3KH2 A;  5KYW A;  3FVY A;  4CS9 A;  2A6E F;  3W8I A;  3X1O A;  1M2O A;  4BJT A;  4BJ1 A;  3DAF A;  2J9W A;  3DM9 B;  5DS5 A;  3F46 A;  4WJ0 A;  4IAO A;  2NUT B;  1RJ9 A;  2J0X A;  4DVZ A;  4C3E A;  1TKN A;  4XWJ A;  3N0T A;  3Q6M A;  3PHF 2;  1BR2 A;  1VMA A;  3LES A;  2M4E A;  4JVS A;  4CSA A;  3CZ6 A;  4O6M A;  4DOZ A;  2Y3G A;  2ZXR A;  2GFH A;  4BG0 A;  4JJG A;  4MQ9 F;  5DS6 A;  4BJ5 A;  3DJN B;  3VYW A;  1JPN A;  1ZU4 A;  3WOD F;  3NYJ A;  1M56 C;  4Q5S F;  3ABK C;  2KJG A;  2A68 F;  3SNH A;  1NZE A;  4FX5 A;  3NKE A;  3VAY A;  5DLJ A;  4BJ6 A;  2V26 A;  3DD7 A;  3HLZ A;  3LEV A;  3UMK A;  4PJN A;  3K66 A;  3RH3 A;  2KQ9 A;  3E9V A;  1M2V B;  1ZHY A;  1SZI A;  3JSZ A;  2PX0 A;  1FTS A;  3S27 A;  3UNG C;  1O87 A;  4JUR I;  3FAJ A;  4KBL A;  2H7B A;  2W9Y A;  4RBN A;  2D5R B;  5E2Q A;  2A1D D;  4BEJ A;  3K6B A;  5KYX B;  4H4K C;  2NUP A;  2B0J A;  3Q6N A;  4PFO A;  5KYU B;  1G8X A;  3O39 A;  5T1D B;  1ZHT A;  2IXN A;  3GOD A;  2OCC C;  4DBR A;  3K33 A;  3KKB A;  2W45 A;  1ZHW A;  3X2Q C;  2QY9 A;  3ZIB A;  2J46 A;  2EIM C;  2NUT A;  2XL4 A;  4OIN F;  2H7O A;  4U5B E;  2BE5 F;  5F5F A;  1NU9 C;  4I3M A;  4U5F E;  1LVK A;  1IW7 F;  4LAC B;  5CI9 A;  1D0X A;  2IYL D;  4O6Y A;  4U5G A;  3EGX A;  2HV7 A;  2QTV A;  4XLP F;  2KNH A;  4U5H A;  3CQZ A;  4B6I A;  2PFD A;  4I1O B;  3S0X A;  3E70 C;  4GYT A;  3DXJ F;  3M1C B;  1FFT C;  2NG1 A;  5BUO A;  2O9X A;  4J30 B;  4AK9 A;  4C3D A;  2C04 A;  2E87 A;  4DVY P;  2R7U A;  4O7G A;  1BR1 A;  1TWA A;  5DVW A;  3LNR A;  4ZLD A;  3QZC A;  1Z5Z A;  3CSK A;  3T6J A;  2R7T A;  3EH2 A;  2W4B A;  1BR4 A;  3EGD B;  5E33 A;  1M2V A;  3S28 A;  1VK5 A;  4KI2 A;  4W8K A;  4EWC A;  3UGO A;  2H7V C;  5L3V A;  3UMI A;  5E3C A;  4Q7C A;  3Q7L A;  2Q3T A;  4HFK B;  2J9V A;  5D91 A;  2R7R A;  3NYM A;  3I4U A;  4LLC A;  4LER A;  3ECS A;  5KYX A;  2IXP A;  4DBQ A;  2ZXO A;  2CNW D;  2C03 A;  2XXA B;  3LLK A;  4O79 A;  2IXM A;  1D1C A;  1ZHZ A;  2J7P D;  4JCH A;  3SEO A;  3JT1 A;  3I5Q A;  2P7V A;  4J32 B;  4C3B A;  2R7S A;  3Q7G A;  5DQZ A;  1V55 C;  5E3A A;  4KNW A;  3EQL F;  3ASN C;  4CS7 A;  5IY5 C;  2Y3B A;  1JPJ A;  3KMI A;  4A2N B;  1SMY F;  4YT4 A;  3JRT A;  2J0W A;  5B3S C;  3DM5 A;  1J8Y F;  3MLG A;  1QZX A;  1Z63 A;  3H65 A;  2VB6 A;  2A69 F;  2DGJ A;  3LS0 A;  4YT2 A;  4C7O B;  2J9U A;  2XSE A;  4CS8 A;  2W4M A;  1IZM A;  2CDQ A;  2G3V A;  2WZL A;  4CIH A;  1W2W A;  1Z23 A;  2HV6 A;  2WL8 A;  3IEE A;  3L34 A;  1MMN A;  4AE4 B;  3EG9 B;  2WZG A;  1LS1 A;  3UGP A;  4U5C E;  3L0I A;  2YZS A;  2CGE A;  3EZI A;  4ULW A;  3EGD A;  1Z6A A;  4NY3 A;  1RJ9 B;  4K0D A;  4QI2 A;  1S7Z A;  3S29 A;  2G3K A;  2MYS A;  3OWT A;  2EIL C;  3HTK C;  4XTK A;  5T3T A;  3EJN A;  2A6H F;  3QMK A;  2EIK C;  4PJJ A;  1MMD A;  1TWH A;  3RFY A;  5CI8 A;  4JJF A;  4PFP A;  2CNW A;  2XXA A;  4IJJ A;  3EHM A;  5HSW A;  4AX2 A;  2PX3 A;  3JYH A;  2P6V A;  3ABM C;  3W2W A;  1TWC A;  3PMR A;  4YJW A;  4N06 A;  4RDA A;  1ZYR F;  2R7Q A;  3AG2 C;  4G0H A;  1NU7 D;  1V54 C;  3EFO B;  3N24 A;  3NG1 A;  2LSE A;  3LS1 A;  3NKD A;  4XLN F;  2V3C C;  3ABL C;  3LJB A;  3RYL A;  4U5D E;  4PJL A;  4CS8 C;  4M63 A;  4O6N A;  1M57 C;  1MND A;  1N1C A;  2IOQ A;  4YN0 B;  2Y39 A;  3ITF A;  4C7O A;  3OA1 A;  4IWB A;  5B1A C;  2JD3 A;  3AG4 C;  3F47 A;  4PJM A;  3MX3 A;  1MMA A;  1LKX A;  2R7O A;  4FWV A;  1ZU5 A;  5EHH A;  3NYL A;  3FDQ A;  2EIJ C;  2NUP B;  2CW0 F;  3DJU B;  2Y3D A;  5DQT A;  1OCZ C;  4OIP F;  4I44 A;  1D0Z A;  2L81 A;  4AE4 A;  3EG9 A;  5L3Q A;  5KYU A;  3RKO F;  4GEH A;  2PP4 A;  3NRH A;  4YWQ A;  3AG1 C;  4OIQ F;  1OKK D;  5KYN A;  1VOM A;  1O5H A;  2ZPA A;  5DS4 A;  2Q9A A;  5KYY B;  2Z15 A;  1VYK A;  1FMV A;  4HFF B;  3B9Q A;  3SYN A;  4E7Z A;  2ZXP A;  4QI0 A;  3I5P A;  3AQC A;  4JZA A;  3RIP A;  3EGX B;  3UR3 C;  3ZVR A;  2KGO A;  1MNE A;  1J8M F;  3HJC A;  3DMD A;  3B0U X;  2VH3 A;  4HE8 D;  4FES A;  2DYR C;  1D1B A;  1KU2 A;  4QDL A;  4X0R A;  1Z3I X;  3K1I C;  3JCU Q;  3N2Z B;  3B0V C;  3EPV A;  5D92 A;  3AG3 C;  3LAY A;  2VAS A;  4EBB A;  2IXO A;  3FHD A;  2ZXW C;  3EH1 A;  2PF4 E;  3ZC4 A;  4KC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...