3ZSUA

Structure of the cyanoq protein from thermosynechococcus elongatus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
118
structure length
118
Chain Sequence
PPTYSELQITRIQDYLRDIEKNAERFADLEVSVAKGDWQEARNIMRGPLGEMLMDMRALNRNLLAKDQPTPTALTRALTDDFLKIDQGADLDSVTVAQEGFREAEADFKAYLNSLPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TLL2057 PROTEIN
publication title Crystal Structure of Cyanoq from the Thermophilic Cyanobacterium Thermosynechococcus Elongatus and Detection in Isolated Photosystem II Complexes.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 54
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zsuA00
3ZSUA 1VYKA 3LS0A 2MWQA 3RFYA 3LS1A 3JCUQ 1NZEA
chains in the Genus database with same CATH superfamily
2R7SA 3DI5A 3L0IA 3AG1C 2R7WA 2PNOA 2R7TA 3A9CA 3AJMA 4LLEA 5KYXA 4C7OB 2A0UA 1Y6DA 1TWCA 5D91A 3LLKA 2DYRC 2EPMX 2FAPB 1WGWA 4D4NA 4DBQA 2NSGA 3LS0A 4F4BA 1ORYA 3AQBA 3CSKA 3ITFA 4JURI 2OEXA 3ZQVA 2R7OA 3DM5A 4OIPF 1A0BA 4JKVA 3TK0A 2R03A 3C18A 5DQZA 4J30B 1WOLA 1T5OA 2YKZA 3IQ6A 2J9WA 1D1AA 3JYHA 2OJQA 4OIQF 4Q7CA 2I8BA 4A4AA 4CBEA 2B0JA 4OD5A 1OKKD 1VB5A 2PF4E 3B0UX 3TQOA 3LLIA 1FFHA 3X2QC 4BJ6A 5L0FA 3GEHA 1A7EA 2J8WA 2P1AA 1FTSA 3G4XA 4YT5A 4BJ6C 1V54C 4C7OA 4O6MA 5AC4A 1A7VA 3I5PA 3U5SA 4AE4A 1EKYA 3RFYA 5JVEA 1H9GA 4IWBA 2LQGA 3K1HA 1VYIA 5KYYB 1YARO 4LDRA 4NCQA 2AWYA 1BR1A 1D0YA 1YA9A 5EHHA 1KU2A 3CAXA 3RKOF 1OCRC 4XEVA 4YT2A 4N4WA 2XLWA 1D1BA 1N1CA 1TWGA 2YQYA 2YEVA 2KYHA 3L34A 4G78A 3JCUQ 4DVZA 1TWHA 1MMNA 1ZHTA 3EH2A 4JTCB 1ZVZA 4OD4A 3FOOA 2CDQA 2UUIA 2Q4FA 4N6HA 2Y3GA 5DLJA 4JE9A 2HV6A 3UGOA 2TMVP 3ABMC 4K7BA 4RBNA 4MVSA 2V26A 2PX3A 3KH2A 3NG1A 4Z9IA 1Y4CA 2G3VA 3MYFA 3R7CA 4CSAA 3EZHA 3O10A 1ORSC 3EGXA 4FWVA 4DRHB 1ZHYA 2R7XA 4CSAC 2P6VA 1ZYRF 2D4UA 3CEXA 3N2ZB 4N06A 2R7VA 1VYKA 1UG7A 3ZVRA 3RVYA 3ASNC 2DI3A 2OKUA 3QMKA 4MTGA 4N6CA 5CIVA 3C8GB 2IXOA 3H2VA 3B0PA 2H8AA 4AK9A 3GM2A 5COMA 3TULA 3RW0A 3DKAA 4O6NA 1M2OA 2ZXPA 1YVIA 2J9VA 2C03A 3SP1A 3UMIA 3V5ZA 4C3EA 1BDJB 5E2QA 1E85A 4FESA 2P61A 4HFKB 1XWJA 2HV7A 2ZPAA 3B29A 1NFNA 5T1DB 4UDVA 2XSEA 1Z23A 4LDQA 5T3WA 4Z9JA 4P9FA 4WJ0A 2LIGA 5L0GA 1PD1A 3S27A 3EQLF 3Q7LA 3RQEA 5JS5A 4PJJA 3Q6MA 4YN0B 2A69F 2ETSA 3OEOA 4MVZA 2RSEB 1I5NA 3G50A 4JEBA 1BR4A 5T3TA 5IY5C 1MQVA 1HE9A 2HS5A 2ZXWC 2QY9A 1AVOB 2QTVA 1XZPA 2QNLA 4NTFA 4BJTA 5B1AC 1SMYF 1K04A 1MNDA 2A68F 4CS8A 4LERA 2F22A 3T4RA 1M57C 3ZIBA 1HY5A 3U0CA 3UGPA 2WZFA 2Y69C 2MWQA 1W2WA 2LK4A 3ATPA 4EIYA 5JSLA 4PJMA 4MS2A 3DJUB 3KKBA 3PCVA 4JW1A 2YL7A 5HSWA 2LFFA 2UUHA 2EINC 5B1BC 2MYSA 2NG1A 4YK5A 4H54A 2JPUA 2ASRA 3M4BA 4EWCA 1LVKA 2KNHA 4PK4A 3SZRA 3RQFA 1NBBA 2IOQA 2R25A 1QVXA 3NMIA 1H7IA 4JC7A 4E0IA 1PCXA 2VB6A 2M64A 3EHMA 2J0WA 3ABKC 3FAPB 3LS1A 1HW2A 2A6EF 2Q3TA 1CPQA 2IM8A 1OW8A 4NTAA 3K33A 1OCZC 2GAQA 3J06A 4YJWA 3RH3A 1V55C 2W9YA 5L0CA 2WVNA 3HJCA 2OCCC 4KBLA 4FX5A 3V7OA 1QSPA 1RKEA 4AL1A 5AGFA 4EUKB 3L8JA 4IB4A 1ZU5A 3NYJA 2CNWD 2HSQA 5COFA 3ZDLA 3EFOB 2NUPB 5AC5A 2W4BA 2NPUA 2KSFA 3UNGC 2AP3A 4A2NB 2WZLA 3JRTA 4JTDB 3U9JA 1OW7A 3DD7A 2NUTB 1A7DA 2PBEA 1FAPB 3HNKA 3KPHA 1L3PA 2L7AA 1BBHA 3T6BA 4C3BA 3GODA 1Z63A 3SEOA 3GWNA 3PHF2 1NZEA 2J7PA 4U5HA 2IBFA 3DM9B 4PACA 2LD6A 2Q00A 4RD9A 1QKRA 1V4AA 1OXKA 3AGUA 3G4ZA 5CI9A 3EHNA 3M4CA 3E70C 1H6GA 2IXMA 2KK1A 4J7YA 4CS9A 2WB7A 2EILC 3IHUA 4JVSA 1XZQA 4Z9HA 3RVZA 4CS9C 1ZW3A 4YWQA 4OIOF 2EPKX 3W8HA 5L0IA 1TKNA 5KYWB 4ULWA 1LI7A 5L0HA 4M63A 1NSGB 2XL4A 4IAOA 1G4US 1H9TA 4JJFA 4NY3A 1Z5ZA 3EGDB 3WHNA 2KC3A 1TR2A 2Q9CA 3DE9A 2IXNA 1R4TA 2KGOA 3S9OA 1M2VB 3PMRA 1R5ID 4LACB 3O39A 4AX2A 5B3SC 3ECSA 3F47A 1MMAA 1ZHXA 3S28A 2G3KA 2ZXRA 1LE4A 1T6IA 1SF8A 3S29A 3T9OA 2XLOA 3K66A 5L3VA 2XLDA 3QVZA 1JMWA 5KYNA 1MMDA 2OJED 2O9XA 4RDAA 4P6IC 4R32A 3HNLA 4IRUA 4U9DA 3I4UA 2A0BA 1WTYA 2J45A 4KI2A 1S05A 4PFOA 4KNVA 3MLGA 2EPNA 3KYJA 1WATA 4I1MA 5KYXB 4CIPA 3QZCA 3E9VA 3U3FA 2MHRA 1U89A 3EZIA 1VK5A 3HKKA 4XLNF 2H7BA 1TFKB 3AG4C 2HZ8A 3HTKC 3Q6NA 4ONSA 3VM6A 4D4XA 2NSFA 3B71A 2EIKC 2YL0A 2LCHA 2XM4A 2Y39A 3W4YA 1CGME 2XLMA 4JCHA 3UMKA 1IZMA 1JPNA 4YL1A 3S0XA 3SYNA 1G4WR 2DYSC 2YWAA 4NC3A 1Z6AA 3U8VA 3R2PA 3LESA 3EG9A 3A11A 1VMAA 1PD0A 3DWWA 4JJGA 5L0DA 5COGA 1CGOA 1D1CA 3TJ6A 2JD3A 4YT4A 2J46A 2HMQA 2RD9A 2XS8A 3OA1A 2PX0A 3N24A 5FZTA 4WGYA 4GQHA 5A6JA 5BQHA 2X0CA 4E18A 4LDKA 4U5GA 4DXWA 3KYIA 1K05A 3VRCA 1OKKA 4KC9A 3SXYA 5E33A 3U8PA 5DS5A 3C8ZA 1G8XA 4AE4B 1ORJA 2WZGA 4U5FE 1FNTc 4G0HA 5HV9A 4G7HF 3T6GB 3B0VC 3O6XA 3GM1A 4MW3A 5L3QA 4BJ1A 3PDMP 1YZAA 2Y3DA 3ZWIA 1E2XA 1J8YF 1YYXA 3MX3A 2L6HA 1APCA 1VOMA 1Q0KA 1TWAA 2LSEA 2R7QA 3LEVA 4MQ9F 3K1IC 3AQCA 1E84A 2OQMA 2W45A 3U3BA 1OR2A 3M79A 1V74B 3RQGA 4EBJA 1RJ9A 3POVA 2Y3HA 4IARA 2W4MA 1GS9A 4JTAB 1TFOB 1K40A 3TJ5A 1EI7A 3LEOA 2ZXOA 1O3UA 4ULVA 2KQ9A 3W8IA 3FMSA 4PJLA 2C04A 3EJNA 3QTHA 4AL0A 1D0XA 4E17A 1Z3IX 4X0RA 2EPOA 1RMVA 4I1OB 4DBRA 5GPGB 1EQ1A 2M4EA 4CIHA 5A69A 4FAPB 2A6HF 5F28E 2PP4A 4ZLDA 4MW8A 1Z7Qc 1ZW2A 1WN0A 3AOUA 4JIOA 3DZAA 1IW7F 1NFOA 2XLHA 1ZHWA 2CGEA 2GDCA 4JEAA 1VLTA 2Z15A 2WL8A 3LJBA 3V5XA 3L8IA 4J7TA 5JUAA 4U5CE 2J9UA 4EHPA 5KYUB 2XXAB 3NDBB 5A6BD 3SXMA 2YHSA 3IQ5A 3DMDA 3FVYA 2YL3A 2HKVA 4XTKA 5CI8A 3VYWA 4ZLCA 1Q0GA 2Q9AA 4O7GA 1BR2A 1D0ZA 2J0XA 1RKCA 4YL3A 2QLAA 4U5DE 3WAQA 4QI0A 1TQGA 2KW3C 2KJGA 4DJ9A 2WVOA 3JRMO 4E0HA 4CDYA 1DOVA 2H7OA 4U5BE 2P7VA 2GWWA 3K6BA 1YJGA 3LNRA 2CW0F 2XLEA 5TJ5E 3EPVA 4B6IA 1OQCA 3C8GD 4BJ5A 4CJOA 3NKEA 2FGYA 3JZ0A 3FXHA 2HMZA 3IEEA 1QZXA 4BJ5C 5JT4A 4XPYA 3U2MA 4MTFA 5D92A 1HE1A 2DGJA 2LP4A 3QW0A 1M2VA 3O55A 2ICWG 2P0NA 5JP7A 1NU9C 5K0IA 3ZSUA 4BG0A 2EIJC 2I15A 1SZIA 4CDVA 2R02A 2AWCA 3GWLA 1Q0FA 2YLIA 3TD7A 3LAYA 2Q9BA 2Q7RA 3VAYA 5DS4A 3JT1A 4WABA 1ST6A 4J32B 5B3IA 1LS1A 1L7CA 2G62A 4E7ZA 4XPXA 5KYYA 3TOMA 4XLPF 1YDIA 2HJMA 1LPEA 4QI2A 2VCAA 1HW1A 2AU5A 3F46A 2QE9A 2VCBA 3NMJA 3ASOC 3C62A 1S7ZA 3WG7C 4IAQA 4JRZA 2BC5A 3UR3C 1SR2A 1SYQA 3ZC4A 5A6BA 3ZTMA 3OWTA 1B68A 1RKEB 4MVOA 2L6GA 4EBKA 3LNMB 2V3CC 5FCLA 1J8MF 1C02A 5EGYA 2OOCA 3JTLO 3SNHA 1G5ZA 1OCOC 1Q0MA 3DXJF 1ZZPA 3ZG1A 4G7OF 4CS7A 3JSEO 1OW6A 1QQ3A 2CNWA 3BEHA 4G7ZF 3CQZA 4O79A 1RCPA 2HUJA 3NKDA 3U9MA 1JRAA 3DAFA 2X51A 4MVMA 3N0TA 1T9KA 5L0JA 4LLCA 3TOLA 5E3AA 1T6QA 2AVKA 2BE5F 4CX9A 4CJGA 4JZAA 4Q4ZF 1YYJA 3C8GA 2HSBA 2Y3BA 4GEHA 4I3MA 2BL2A 4E7SA 2XL6A 3FOPA 3JSZA 1M6TA 3GEIA 4I44A 4KNWA 2JX0A 4JCZA 3MFNA 3B9QA 2VASA 4QDLA 1U0BB 3M15A 5A6KA 2R7UA 3AG3C 4MTOA 4MVRA 3DE8A 1YLMA 4H4KC 4YL0A 4DOZA 5JLIA 4WGZA 2L81A 4PFPA 1O87A 1LI5A 5F5FA 5JRAA 3IQTA 5DVWA 4EKWA 1VTMP 1Q0DA 3T6JA 2IYLD 3DJNB 3I5QA 3RIPA 1OXBA 4C3DA 2YZSA 5BQGA 1VLSA 2CYDA 1HMDA 2J9BA 1CGNA 2R05A 2VCCA 3GM3A 3BRJA 1FFTC 3NRHA 3VF0A 3ZTZA 3NYMA 2R7RA 1GQAA 1O5HA 2OEVA 4U9EA 3C63A 3MYIA 1U6HA 3HNIA 2OG2A 3KMIA 4IGGA 2CCYA 2WVQA 3SXKA 3K1IA 1DOWA 3US6A 3L1MA 3HNJA 1JPJA 3FAJA 2XRHA 4K0DA 3EH1A 3FHDA 1ZHZA 3IPMO 5DS6A 4XWJA 3GORA 4HFFB 1GGQA 1NG1A 5E3CA 3WODF 1E86A 1WWPA 2FFHA 1GM5A 1A41A 2HFIA 3ZQYA 4W8KA 3JYYA 4Q5SF 2GFHA 1C03A 2OU6A 1BZ4A 3H65A 1I4YA 4BEMJ 1FMWA 1OR3A 2XXAA 5KYUA 3W2WA 4DVYP 4U5EE 4YT8A 2XS1A 3CZ6A 2YLDA 3K7DA 4DRJB 2E87A 3IQCA 3H2UA 1C17M 3AG2C 1QPUA 2VC9A 2XLVA 3EG9B 4ANJA 3W2VA 2YVKA 1YZCA 1QLEC 256BA 1MMGA 3EGXB 1KTMA 1NLXA 1AEPA 3EFOA 2NUPA 3AGTA 2YL1A 3GANA 3HLZA 2ZD9A 1MNEA 3QVYA 5A6AA 5DQTA 2L6FA 3LUTB 1CPRA 5F5HA 1WASA 1PV3A 4MVUA 4O6YA 2J7PD 3C7JA 2NUTA 1LIHA 1JR8A 1F1MA 4NTBA 3SXZA 2XL8A 4BEJA 2B0HA 3V5YA 2XM0A 1FR0A 1JAFA 2QUPA 2L9JA 3U2LA 4DRIB 1OCCC 4W8PA 1EA8A 3NYLA 4PJNA 2EIMC 3MBGA 4EBBA 4CS8C 1M56C 3M1CB 2PFDA 1YAUO 3UMHA 4L6RA 2YLGA 1KNYA 4XQ1A 3X1OA 2HJ3A 2YRFA 1AUEA 4K1OA 4GYTA 1UFBA 1JOGA 1RXQA 1RJ9B 1T01A 4MNDA 1E83A 4PR9A 1FMVA 3S90A 5KYWA 3NMKA 4BPMA 5BQIA 2DB4A 3KL4A 1LE2A 4MVQA 1T6UA 3EGDA 2IXPA 4XEKA 3DAGA 3RF3A 4P9TA 3ABLC 3QW1A 4HEAJ 3S84A 2VH3A 4XPWA 1HMOA 1I4ZA 1NU7D 3GEEA 3RYLA 1LKXA 2R9RB 4OIRF 2A1DD 1ZU4A 4OINF 4NQFA 2LFDA 1YA7O 1LS4A 5EK0A 5BUOA 3FDQA 4XEFA 1LM3B 3Q7GA 4IJJA 4CDAA 4ER9A 2GA0A 2EPLX 2H7VC 4HE8D 2D5RB
chains in the Genus database with same CATH topology
2R7SA 3L0IA 3AG1C 2R7TA 4LLEA 5KYXA 1TWCA 5D91A 3LLKA 2DYRC 1WGWA 4DBQA 3LS0A 4F4BA 4JURI 3AQBA 3CSKA 3ITFA 2R7OA 3DM5A 4OIPF 5DQZA 4J30B 2J9WA 1D1AA 3JYHA 4OIQF 4Q7CA 2I8BA 4CBEA 2B0JA 4OD5A 1OKKD 2PF4E 3B0UX 3LLIA 1FFHA 3X2QC 4BJ6A 1FTSA 4C7OA 4YT5A 4BJ6C 1V54C 4O6MA 4AE4A 3I5PA 3RFYA 4IWBA 3K1HA 1VYIA 5KYYB 1BR1A 1D0YA 5EHHA 1KU2A 3RKOF 1OCRC 4YT2A 1D1BA 1N1CA 1TWGA 3L34A 2YEVA 4DVZA 3JCUQ 1TWHA 1MMNA 1ZHTA 3EH2A 4OD4A 2CDQA 2Y3GA 5DLJA 3UGOA 2HV6A 3ABMC 4K7BA 4RBNA 2V26A 2PX3A 3KH2A 3NG1A 2G3VA 4CSAA 3EZHA 4FWVA 3EGXA 1ZHYA 2R7XA 4CSAC 2P6VA 1ZYRF 3N2ZB 4N06A 2R7VA 1VYKA 3ZVRA 3ASNC 3QMKA 2IXOA 3B0PA 4AK9A 4O6NA 1M2OA 2ZXPA 3UMIA 2J9VA 2C03A 3SP1A 4C3EA 5E2QA 4FESA 5T1DB 4HFKB 2HV7A 2ZPAA 4G7OF 2XSEA 1Z23A 5T3WA 4WJ0A 1PD1A 3S27A 3EQLF 3Q7LA 4PJJA 3Q6MA 4YN0B 2A69F 3OEOA 5T3TA 1BR4A 5IY5C 2ZXWC 2QY9A 2QTVA 4BJTA 5B1AC 1SMYF 1MNDA 2A68F 4CS8A 4LERA 3T4RA 1M57C 3ZIBA 3UGPA 2WZFA 2Y69C 2MWQA 1W2WA 4PJMA 3DJUB 3KKBA 4JW1A 5HSWA 2EINC 5B1BC 2MYSA 2NG1A 4EWCA 1LVKA 2KNHA 4PK4A 3SZRA 2R7WA 2IOQA 4EBBA 1PCXA 2VB6A 3EHMA 2J0WA 3ABKC 3LS1A 2A6EF 2Q3TA 3K33A 1OCZC 4YJWA 3RH3A 1V55C 2W9YA 2WVNA 3HJCA 2OCCC 4KBLA 4FX5A 3V7OA 1ZU5A 3NYJA 2CNWD 3EFOB 2NUPB 2W4BA 3UNGC 4A2NB 2WZLA 3JRTA 3DD7A 4DVYP 2NUTB 3T6BA 4C3BA 3GODA 1Z63A 3SEOA 3PHF2 1NZEA 2J7PA 4U5HA 3DM9B 4RD9A 5CI9A 3EHNA 3E70C 2IXMA 4CS9A 2WB7A 2EILC 4JVSA 4CS9C 4YWQA 4OIOF 3W8HA 1TKNA 5KYWB 4ULWA 4M63A 2XL4A 4IAOA 4JJFA 4NY3A 1Z5ZA 3EGDB 1TR2A 2Q9CA 2IXNA 2KGOA 1M2VB 3PMRA 4LACB 3O39A 4AX2A 5B3SC 3ECSA 3F47A 1MMAA 1ZHXA 3S28A 2G3KA 2ZXRA 1SF8A 3S29A 5L3VA 3K66A 5KYNA 1MMDA 2O9XA 4RDAA 4P6IC 4IRUA 3I4UA 2J45A 4KI2A 4PFOA 4KNVA 3MLGA 4I1MA 5KYXB 3QZCA 3E9VA 4XLNF 3EZIA 1VK5A 2H7BA 3HTKC 3AG4C 3Q6NA 2EIKC 2Y39A 4JCHA 3UMKA 1IZMA 1JPNA 3S0XA 3SYNA 2DYSC 1Z6AA 3LESA 3EG9A 1VMAA 1PD0A 4JJGA 1D1CA 2JD3A 4YT4A 2J46A 3OA1A 2PX0A 3N24A 4U5GA 1OKKA 4KC9A 5E33A 5DS5A 1G8XA 4AE4B 2WZGA 4U5FE 4G0HA 4G7HF 3B0VC 3O6XA 5L3QA 4BJ1A 2Y3DA 1J8YF 3MX3A 3LEVA 1VOMA 4MQ9F 1TWAA 2LSEA 2R7QA 2R7RA 3K1IC 3AQCA 2W45A 1RJ9A 3POVA 2Y3HA 2W4MA 2ZXOA 2KQ9A 3W8IA 4PJLA 2C04A 3EJNA 1D0XA 1Z3IX 4X0RA 4I1OB 4DBRA 2M4EA 4CIHA 2A6HF 4ZLDA 2PP4A 3DZAA 1IW7F 1ZHWA 2CGEA 2Z15A 2WL8A 3LJBA 4U5CE 2J9UA 5KYUB 2XXAB 3NDBB 2YHSA 3DMDA 3FVYA 4XTKA 5CI8A 3VYWA 4ZLCA 2Q9AA 4O7GA 1D0ZA 1BR2A 2J0XA 4U5DE 4QI0A 2KW3C 2KJGA 2WVOA 2H7OA 4U5BE 2P7VA 3K6BA 3LNRA 2CW0F 4BJ5A 4B6IA 3EPVA 3NKEA 2FGYA 4BJ5C 3IEEA 1QZXA 5D92A 2DGJA 1M2VA 1NU9C 3ZSUA 4BG0A 2EIJC 1SZIA 3TD7A 3LAYA 2Q9BA 3VAYA 5DS4A 3JT1A 1ST6A 4J32B 1LS1A 2G62A 4E7ZA 5KYYA 4XLPF 4QI2A 3F46A 3ASOC 1S7ZA 3WG7C 3UR3C 3ZC4A 3OWTA 2V3CC 5FCLA 1J8MF 5EGYA 3SNHA 1OCOC 3DXJF 3ZG1A 4CS7A 2CNWA 4G7ZF 3CQZA 4O79A 3NKDA 3DAFA 2X51A 3N0TA 4LLCA 5E3AA 4Q4ZF 2BE5F 4JZAA 2Y3BA 4GEHA 4I3MA 4E7SA 3JSZA 4I44A 4KNWA 4QDLA 3B9QA 2VASA 2R7UA 3AG3C 4H4KC 4DOZA 2L81A 4PFPA 1O87A 5F5FA 5DVWA 3T6JA 2IYLD 3DJNB 3I5QA 3RIPA 4C3DA 2YZSA 4C7OB 3NRHA 1FFTC 3NYMA 1O5HA 2OG2A 3KMIA 2WVQA 1JPJA 3FAJA 2XRHA 4K0DA 3EH1A 3FHDA 1ZHZA 5DS6A 4XWJA 4HFFB 1NG1A 5E3CA 3WODF 2FFHA 4W8KA 4Q5SF 2GFHA 3H65A 1FMWA 2XXAA 5KYUA 3W2WA 4U5EE 4YT8A 3CZ6A 3K7DA 2E87A 3AG2C 3EG9B 4ANJA 3W2VA 1QLEC 1MMGA 3EGXB 3EFOA 2NUPA 3HLZA 3GANA 1MNEA 5DQTA 5F5HA 4O6YA 2J7PD 2NUTA 4BEJA 2L9JA 1OCCC 3NYLA 4PJNA 2EIMC 4CS8C 1M56C 3M1CB 2PFDA 3UMHA 3X1OA 4GYTA 4MNDA 1RJ9B 1FMVA 5KYWA 3KL4A 3EGDA 2IXPA 3DAGA 3ABLC 4HEAJ 2VH3A 1NU7D 3RYLA 1LKXA 4OIRF 2A1DD 1ZU4A 4OINF 5BUOA 3FDQA 3Q7GA 4IJJA 2H7VC 4HE8D 2D5RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZSU A;  1VYK A;  3LS0 A;  2MWQ A;  3RFY A;  3LS1 A;  3JCU Q;  1NZE A; 
#chains in the Genus database with same CATH topology
 2R7S A;  3DI5 A;  3L0I A;  3AG1 C;  2R7W A;  2PNO A;  2R7T A;  3A9C A;  3AJM A;  4LLE A;  5KYX A;  4C7O B;  2A0U A;  1Y6D A;  1TWC A;  5D91 A;  3LLK A;  2DYR C;  2EPM X;  2FAP B;  1WGW A;  4D4N A;  4DBQ A;  2NSG A;  3LS0 A;  4F4B A;  1ORY A;  3AQB A;  3CSK A;  3ITF A;  4JUR I;  2OEX A;  3ZQV A;  2R7O A;  3DM5 A;  4OIP F;  1A0B A;  4JKV A;  3TK0 A;  2R03 A;  3C18 A;  5DQZ A;  4J30 B;  1WOL A;  1T5O A;  2YKZ A;  3IQ6 A;  2J9W A;  1D1A A;  3JYH A;  2OJQ A;  4OIQ F;  4Q7C A;  2I8B A;  4A4A A;  4CBE A;  2B0J A;  4OD5 A;  1OKK D;  1VB5 A;  2PF4 E;  3B0U X;  3TQO A;  3LLI A;  1FFH A;  3X2Q C;  4BJ6 A;  5L0F A;  3GEH A;  1A7E A;  2J8W A;  2P1A A;  1FTS A;  3G4X A;  4YT5 A;  4BJ6 C;  1V54 C;  4C7O A;  4O6M A;  5AC4 A;  1A7V A;  3I5P A;  3U5S A;  4AE4 A;  1EKY A;  3RFY A;  5JVE A;  1H9G A;  4IWB A;  2LQG A;  3K1H A;  1VYI A;  5KYY B;  1YAR O;  4LDR A;  4NCQ A;  2AWY A;  1BR1 A;  1D0Y A;  1YA9 A;  5EHH A;  1KU2 A;  3CAX A;  3RKO F;  1OCR C;  4XEV A;  4YT2 A;  4N4W A;  2XLW A;  1D1B A;  1N1C A;  1TWG A;  2YQY A;  2YEV A;  2KYH A;  3L34 A;  4G78 A;  3JCU Q;  4DVZ A;  1TWH A;  1MMN A;  1ZHT A;  3EH2 A;  4JTC B;  1ZVZ A;  4OD4 A;  3FOO A;  2CDQ A;  2UUI A;  2Q4F A;  4N6H A;  2Y3G A;  5DLJ A;  4JE9 A;  2HV6 A;  3UGO A;  2TMV P;  3ABM C;  4K7B A;  4RBN A;  4MVS A;  2V26 A;  2PX3 A;  3KH2 A;  3NG1 A;  4Z9I A;  1Y4C A;  2G3V A;  3MYF A;  3R7C A;  4CSA A;  3EZH A;  3O10 A;  1ORS C;  3EGX A;  4FWV A;  4DRH B;  1ZHY A;  2R7X A;  4CSA C;  2P6V A;  1ZYR F;  2D4U A;  3CEX A;  3N2Z B;  4N06 A;  2R7V A;  1VYK A;  1UG7 A;  3ZVR A;  3RVY A;  3ASN C;  2DI3 A;  2OKU A;  3QMK A;  4MTG A;  4N6C A;  5CIV A;  3C8G B;  2IXO A;  3H2V A;  3B0P A;  2H8A A;  4AK9 A;  3GM2 A;  5COM A;  3TUL A;  3RW0 A;  3DKA A;  4O6N A;  1M2O A;  2ZXP A;  1YVI A;  2J9V A;  2C03 A;  3SP1 A;  3UMI A;  3V5Z A;  4C3E A;  1BDJ B;  5E2Q A;  1E85 A;  4FES A;  2P61 A;  4HFK B;  1XWJ A;  2HV7 A;  2ZPA A;  3B29 A;  1NFN A;  5T1D B;  4UDV A;  2XSE A;  1Z23 A;  4LDQ A;  5T3W A;  4Z9J A;  4P9F A;  4WJ0 A;  2LIG A;  5L0G A;  1PD1 A;  3S27 A;  3EQL F;  3Q7L A;  3RQE A;  5JS5 A;  4PJJ A;  3Q6M A;  4YN0 B;  2A69 F;  2ETS A;  3OEO A;  4MVZ A;  2RSE B;  1I5N A;  3G50 A;  4JEB A;  1BR4 A;  5T3T A;  5IY5 C;  1MQV A;  1HE9 A;  2HS5 A;  2ZXW C;  2QY9 A;  1AVO B;  2QTV A;  1XZP A;  2QNL A;  4NTF A;  4BJT A;  5B1A C;  1SMY F;  1K04 A;  1MND A;  2A68 F;  4CS8 A;  4LER A;  2F22 A;  3T4R A;  1M57 C;  3ZIB A;  1HY5 A;  3U0C A;  3UGP A;  2WZF A;  2Y69 C;  2MWQ A;  1W2W A;  2LK4 A;  3ATP A;  4EIY A;  5JSL A;  4PJM A;  4MS2 A;  3DJU B;  3KKB A;  3PCV A;  4JW1 A;  2YL7 A;  5HSW A;  2LFF A;  2UUH A;  2EIN C;  5B1B C;  2MYS A;  2NG1 A;  4YK5 A;  4H54 A;  2JPU A;  2ASR A;  3M4B A;  4EWC A;  1LVK A;  2KNH A;  4PK4 A;  3SZR A;  3RQF A;  1NBB A;  2IOQ A;  2R25 A;  1QVX A;  3NMI A;  1H7I A;  4JC7 A;  4E0I A;  1PCX A;  2VB6 A;  2M64 A;  3EHM A;  2J0W A;  3ABK C;  3FAP B;  3LS1 A;  1HW2 A;  2A6E F;  2Q3T A;  1CPQ A;  2IM8 A;  1OW8 A;  4NTA A;  3K33 A;  1OCZ C;  2GAQ A;  3J06 A;  4YJW A;  3RH3 A;  1V55 C;  2W9Y A;  5L0C A;  2WVN A;  3HJC A;  2OCC C;  4KBL A;  4FX5 A;  3V7O A;  1QSP A;  1RKE A;  4AL1 A;  5AGF A;  4EUK B;  3L8J A;  4IB4 A;  1ZU5 A;  3NYJ A;  2CNW D;  2HSQ A;  5COF A;  3ZDL A;  3EFO B;  2NUP B;  5AC5 A;  2W4B A;  2NPU A;  2KSF A;  3UNG C;  2AP3 A;  4A2N B;  2WZL A;  3JRT A;  4JTD B;  3U9J A;  1OW7 A;  3DD7 A;  2NUT B;  1A7D A;  2PBE A;  1FAP B;  3HNK A;  3KPH A;  1L3P A;  2L7A A;  1BBH A;  3T6B A;  4C3B A;  3GOD A;  1Z63 A;  3SEO A;  3GWN A;  3PHF 2;  1NZE A;  2J7P A;  4U5H A;  2IBF A;  3DM9 B;  4PAC A;  2LD6 A;  2Q00 A;  4RD9 A;  1QKR A;  1V4A A;  1OXK A;  3AGU A;  3G4Z A;  5CI9 A;  3EHN A;  3M4C A;  3E70 C;  1H6G A;  2IXM A;  2KK1 A;  4J7Y A;  4CS9 A;  2WB7 A;  2EIL C;  3IHU A;  4JVS A;  1XZQ A;  4Z9H A;  3RVZ A;  4CS9 C;  1ZW3 A;  4YWQ A;  4OIO F;  2EPK X;  3W8H A;  5L0I A;  1TKN A;  5KYW B;  4ULW A;  1LI7 A;  5L0H A;  4M63 A;  1NSG B;  2XL4 A;  4IAO A;  1G4U S;  1H9T A;  4JJF A;  4NY3 A;  1Z5Z A;  3EGD B;  3WHN A;  2KC3 A;  1TR2 A;  2Q9C A;  3DE9 A;  2IXN A;  1R4T A;  2KGO A;  3S9O A;  1M2V B;  3PMR A;  1R5I D;  4LAC B;  3O39 A;  4AX2 A;  5B3S C;  3ECS A;  3F47 A;  1MMA A;  1ZHX A;  3S28 A;  2G3K A;  2ZXR A;  1LE4 A;  1T6I A;  1SF8 A;  3S29 A;  3T9O A;  2XLO A;  3K66 A;  5L3V A;  2XLD A;  3QVZ A;  1JMW A;  5KYN A;  1MMD A;  2OJE D;  2O9X A;  4RDA A;  4P6I C;  4R32 A;  3HNL A;  4IRU A;  4U9D A;  3I4U A;  2A0B A;  1WTY A;  2J45 A;  4KI2 A;  1S05 A;  4PFO A;  4KNV A;  3MLG A;  2EPN A;  3KYJ A;  1WAT A;  4I1M A;  5KYX B;  4CIP A;  3QZC A;  3E9V A;  3U3F A;  2MHR A;  1U89 A;  3EZI A;  1VK5 A;  3HKK A;  4XLN F;  2H7B A;  1TFK B;  3AG4 C;  2HZ8 A;  3HTK C;  3Q6N A;  4ONS A;  3VM6 A;  4D4X A;  2NSF A;  3B71 A;  2EIK C;  2YL0 A;  2LCH A;  2XM4 A;  2Y39 A;  3W4Y A;  1CGM E;  2XLM A;  4JCH A;  3UMK A;  1IZM A;  1JPN A;  4YL1 A;  3S0X A;  3SYN A;  1G4W R;  2DYS C;  2YWA A;  4NC3 A;  1Z6A A;  3U8V A;  3R2P A;  3LES A;  3EG9 A;  3A11 A;  1VMA A;  1PD0 A;  3DWW A;  4JJG A;  5L0D A;  5COG A;  1CGO A;  1D1C A;  3TJ6 A;  2JD3 A;  4YT4 A;  2J46 A;  2HMQ A;  2RD9 A;  2XS8 A;  3OA1 A;  2PX0 A;  3N24 A;  5FZT A;  4WGY A;  4GQH A;  5A6J A;  5BQH A;  2X0C A;  4E18 A;  4LDK A;  4U5G A;  4DXW A;  3KYI A;  1K05 A;  3VRC A;  1OKK A;  4KC9 A;  3SXY A;  5E33 A;  3U8P A;  5DS5 A;  3C8Z A;  1G8X A;  4AE4 B;  1ORJ A;  2WZG A;  4U5F E;  1FNT c;  4G0H A;  5HV9 A;  4G7H F;  3T6G B;  3B0V C;  3O6X A;  3GM1 A;  4MW3 A;  5L3Q A;  4BJ1 A;  3PDM P;  1YZA A;  2Y3D A;  3ZWI A;  1E2X A;  1J8Y F;  1YYX A;  3MX3 A;  2L6H A;  1APC A;  1VOM A;  1Q0K A;  1TWA A;  2LSE A;  2R7Q A;  3LEV A;  4MQ9 F;  3K1I C;  3AQC A;  1E84 A;  2OQM A;  2W45 A;  3U3B A;  1OR2 A;  3M79 A;  1V74 B;  3RQG A;  4EBJ A;  1RJ9 A;  3POV A;  2Y3H A;  4IAR A;  2W4M A;  1GS9 A;  4JTA B;  1TFO B;  1K40 A;  3TJ5 A;  1EI7 A;  3LEO A;  2ZXO A;  1O3U A;  4ULV A;  2KQ9 A;  3W8I A;  3FMS A;  4PJL A;  2C04 A;  3EJN A;  3QTH A;  4AL0 A;  1D0X A;  4E17 A;  1Z3I X;  4X0R A;  2EPO A;  1RMV A;  4I1O B;  4DBR A;  5GPG B;  1EQ1 A;  2M4E A;  4CIH A;  5A69 A;  4FAP B;  2A6H F;  5F28 E;  2PP4 A;  4ZLD A;  4MW8 A;  1Z7Q c;  1ZW2 A;  1WN0 A;  3AOU A;  4JIO A;  3DZA A;  1IW7 F;  1NFO A;  2XLH A;  1ZHW A;  2CGE A;  2GDC A;  4JEA A;  1VLT A;  2Z15 A;  2WL8 A;  3LJB A;  3V5X A;  3L8I A;  4J7T A;  5JUA A;  4U5C E;  2J9U A;  4EHP A;  5KYU B;  2XXA B;  3NDB B;  5A6B D;  3SXM A;  2YHS A;  3IQ5 A;  3DMD A;  3FVY A;  2YL3 A;  2HKV A;  4XTK A;  5CI8 A;  3VYW A;  4ZLC A;  1Q0G A;  2Q9A A;  4O7G A;  1BR2 A;  1D0Z A;  2J0X A;  1RKC A;  4YL3 A;  2QLA A;  4U5D E;  3WAQ A;  4QI0 A;  1TQG A;  2KW3 C;  2KJG A;  4DJ9 A;  2WVO A;  3JRM O;  4E0H A;  4CDY A;  1DOV A;  2H7O A;  4U5B E;  2P7V A;  2GWW A;  3K6B A;  1YJG A;  3LNR A;  2CW0 F;  2XLE A;  5TJ5 E;  3EPV A;  4B6I A;  1OQC A;  3C8G D;  4BJ5 A;  4CJO A;  3NKE A;  2FGY A;  3JZ0 A;  3FXH A;  2HMZ A;  3IEE A;  1QZX A;  4BJ5 C;  5JT4 A;  4XPY A;  3U2M A;  4MTF A;  5D92 A;  1HE1 A;  2DGJ A;  2LP4 A;  3QW0 A;  1M2V A;  3O55 A;  2ICW G;  2P0N A;  5JP7 A;  1NU9 C;  5K0I A;  3ZSU A;  4BG0 A;  2EIJ C;  2I15 A;  1SZI A;  4CDV A;  2R02 A;  2AWC A;  3GWL A;  1Q0F A;  2YLI A;  3TD7 A;  3LAY A;  2Q9B A;  2Q7R A;  3VAY A;  5DS4 A;  3JT1 A;  4WAB A;  1ST6 A;  4J32 B;  5B3I A;  1LS1 A;  1L7C A;  2G62 A;  4E7Z A;  4XPX A;  5KYY A;  3TOM A;  4XLP F;  1YDI A;  2HJM A;  1LPE A;  4QI2 A;  2VCA A;  1HW1 A;  2AU5 A;  3F46 A;  2QE9 A;  2VCB A;  3NMJ A;  3ASO C;  3C62 A;  1S7Z A;  3WG7 C;  4IAQ A;  4JRZ A;  2BC5 A;  3UR3 C;  1SR2 A;  1SYQ A;  3ZC4 A;  5A6B A;  3ZTM A;  3OWT A;  1B68 A;  1RKE B;  4MVO A;  2L6G A;  4EBK A;  3LNM B;  2V3C C;  5FCL A;  1J8M F;  1C02 A;  5EGY A;  2OOC A;  3JTL O;  3SNH A;  1G5Z A;  1OCO C;  1Q0M A;  3DXJ F;  1ZZP A;  3ZG1 A;  4G7O F;  4CS7 A;  3JSE O;  1OW6 A;  1QQ3 A;  2CNW A;  3BEH A;  4G7Z F;  3CQZ A;  4O79 A;  1RCP A;  2HUJ A;  3NKD A;  3U9M A;  1JRA A;  3DAF A;  2X51 A;  4MVM A;  3N0T A;  1T9K A;  5L0J A;  4LLC A;  3TOL A;  5E3A A;  1T6Q A;  2AVK A;  2BE5 F;  4CX9 A;  4CJG A;  4JZA A;  4Q4Z F;  1YYJ A;  3C8G A;  2HSB A;  2Y3B A;  4GEH A;  4I3M A;  2BL2 A;  4E7S A;  2XL6 A;  3FOP A;  3JSZ A;  1M6T A;  3GEI A;  4I44 A;  4KNW A;  2JX0 A;  4JCZ A;  3MFN A;  3B9Q A;  2VAS A;  4QDL A;  1U0B B;  3M15 A;  5A6K A;  2R7U A;  3AG3 C;  4MTO A;  4MVR A;  3DE8 A;  1YLM A;  4H4K C;  4YL0 A;  4DOZ A;  5JLI A;  4WGZ A;  2L81 A;  4PFP A;  1O87 A;  1LI5 A;  5F5F A;  5JRA A;  3IQT A;  5DVW A;  4EKW A;  1VTM P;  1Q0D A;  3T6J A;  2IYL D;  3DJN B;  3I5Q A;  3RIP A;  1OXB A;  4C3D A;  2YZS A;  5BQG A;  1VLS A;  2CYD A;  1HMD A;  2J9B A;  1CGN A;  2R05 A;  2VCC A;  3GM3 A;  3BRJ A;  1FFT C;  3NRH A;  3VF0 A;  3ZTZ A;  3NYM A;  2R7R A;  1GQA A;  1O5H A;  2OEV A;  4U9E A;  3C63 A;  3MYI A;  1U6H A;  3HNI A;  2OG2 A;  3KMI A;  4IGG A;  2CCY A;  2WVQ A;  3SXK A;  3K1I A;  1DOW A;  3US6 A;  3L1M A;  3HNJ A;  1JPJ A;  3FAJ A;  2XRH A;  4K0D A;  3EH1 A;  3FHD A;  1ZHZ A;  3IPM O;  5DS6 A;  4XWJ A;  3GOR A;  4HFF B;  1GGQ A;  1NG1 A;  5E3C A;  3WOD F;  1E86 A;  1WWP A;  2FFH A;  1GM5 A;  1A41 A;  2HFI A;  3ZQY A;  4W8K A;  3JYY A;  4Q5S F;  2GFH A;  1C03 A;  2OU6 A;  1BZ4 A;  3H65 A;  1I4Y A;  4BEM J;  1FMW A;  1OR3 A;  2XXA A;  5KYU A;  3W2W A;  4DVY P;  4U5E E;  4YT8 A;  2XS1 A;  3CZ6 A;  2YLD A;  3K7D A;  4DRJ B;  2E87 A;  3IQC A;  3H2U A;  1C17 M;  3AG2 C;  1QPU A;  2VC9 A;  2XLV A;  3EG9 B;  4ANJ A;  3W2V A;  2YVK A;  1YZC A;  1QLE C;  256B A;  1MMG A;  3EGX B;  1KTM A;  1NLX A;  1AEP A;  3EFO A;  2NUP A;  3AGT A;  2YL1 A;  3GAN A;  3HLZ A;  2ZD9 A;  1MNE A;  3QVY A;  5A6A A;  5DQT A;  2L6F A;  3LUT B;  1CPR A;  5F5H A;  1WAS A;  1PV3 A;  4MVU A;  4O6Y A;  2J7P D;  3C7J A;  2NUT A;  1LIH A;  1JR8 A;  1F1M A;  4NTB A;  3SXZ A;  2XL8 A;  4BEJ A;  2B0H A;  3V5Y A;  2XM0 A;  1FR0 A;  1JAF A;  2QUP A;  2L9J A;  3U2L A;  4DRI B;  1OCC C;  4W8P A;  1EA8 A;  3NYL A;  4PJN A;  2EIM C;  3MBG A;  4EBB A;  4CS8 C;  1M56 C;  3M1C B;  2PFD A;  1YAU O;  3UMH A;  4L6R A;  2YLG A;  1KNY A;  4XQ1 A;  3X1O A;  2HJ3 A;  2YRF A;  1AUE A;  4K1O A;  4GYT A;  1UFB A;  1JOG A;  1RXQ A;  1RJ9 B;  1T01 A;  4MND A;  1E83 A;  4PR9 A;  1FMV A;  3S90 A;  5KYW A;  3NMK A;  4BPM A;  5BQI A;  2DB4 A;  3KL4 A;  1LE2 A;  4MVQ A;  1T6U A;  3EGD A;  2IXP A;  4XEK A;  3DAG A;  3RF3 A;  4P9T A;  3ABL C;  3QW1 A;  4HEA J;  3S84 A;  2VH3 A;  4XPW A;  1HMO A;  1I4Z A;  1NU7 D;  3GEE A;  3RYL A;  1LKX A;  2R9R B;  4OIR F;  2A1D D;  1ZU4 A;  4OIN F;  4NQF A;  2LFD A;  1YA7 O;  1LS4 A;  5EK0 A;  5BUO A;  3FDQ A;  4XEF A;  1LM3 B;  3Q7G A;  4IJJ A;  4CDA A;  4ER9 A;  2GA0 A;  2EPL X;  2H7V C;  4HE8 D;  2D5R B; 
#chains in the Genus database with same CATH homology
 2R7S A;  3L0I A;  3AG1 C;  2R7T A;  4LLE A;  5KYX A;  1TWC A;  5D91 A;  3LLK A;  2DYR C;  1WGW A;  4DBQ A;  3LS0 A;  4F4B A;  4JUR I;  3AQB A;  3CSK A;  3ITF A;  2R7O A;  3DM5 A;  4OIP F;  5DQZ A;  4J30 B;  2J9W A;  1D1A A;  3JYH A;  4OIQ F;  4Q7C A;  2I8B A;  4CBE A;  2B0J A;  4OD5 A;  1OKK D;  2PF4 E;  3B0U X;  3LLI A;  1FFH A;  3X2Q C;  4BJ6 A;  1FTS A;  4C7O A;  4YT5 A;  4BJ6 C;  1V54 C;  4O6M A;  4AE4 A;  3I5P A;  3RFY A;  4IWB A;  3K1H A;  1VYI A;  5KYY B;  1BR1 A;  1D0Y A;  5EHH A;  1KU2 A;  3RKO F;  1OCR C;  4YT2 A;  1D1B A;  1N1C A;  1TWG A;  3L34 A;  2YEV A;  4DVZ A;  3JCU Q;  1TWH A;  1MMN A;  1ZHT A;  3EH2 A;  4OD4 A;  2CDQ A;  2Y3G A;  5DLJ A;  3UGO A;  2HV6 A;  3ABM C;  4K7B A;  4RBN A;  2V26 A;  2PX3 A;  3KH2 A;  3NG1 A;  2G3V A;  4CSA A;  3EZH A;  4FWV A;  3EGX A;  1ZHY A;  2R7X A;  4CSA C;  2P6V A;  1ZYR F;  3N2Z B;  4N06 A;  2R7V A;  1VYK A;  3ZVR A;  3ASN C;  3QMK A;  2IXO A;  3B0P A;  4AK9 A;  4O6N A;  1M2O A;  2ZXP A;  3UMI A;  2J9V A;  2C03 A;  3SP1 A;  4C3E A;  5E2Q A;  4FES A;  5T1D B;  4HFK B;  2HV7 A;  2ZPA A;  4G7O F;  2XSE A;  1Z23 A;  5T3W A;  4WJ0 A;  1PD1 A;  3S27 A;  3EQL F;  3Q7L A;  4PJJ A;  3Q6M A;  4YN0 B;  2A69 F;  3OEO A;  5T3T A;  1BR4 A;  5IY5 C;  2ZXW C;  2QY9 A;  2QTV A;  4BJT A;  5B1A C;  1SMY F;  1MND A;  2A68 F;  4CS8 A;  4LER A;  3T4R A;  1M57 C;  3ZIB A;  3UGP A;  2WZF A;  2Y69 C;  2MWQ A;  1W2W A;  4PJM A;  3DJU B;  3KKB A;  4JW1 A;  5HSW A;  2EIN C;  5B1B C;  2MYS A;  2NG1 A;  4EWC A;  1LVK A;  2KNH A;  4PK4 A;  3SZR A;  2R7W A;  2IOQ A;  4EBB A;  1PCX A;  2VB6 A;  3EHM A;  2J0W A;  3ABK C;  3LS1 A;  2A6E F;  2Q3T A;  3K33 A;  1OCZ C;  4YJW A;  3RH3 A;  1V55 C;  2W9Y A;  2WVN A;  3HJC A;  2OCC C;  4KBL A;  4FX5 A;  3V7O A;  1ZU5 A;  3NYJ A;  2CNW D;  3EFO B;  2NUP B;  2W4B A;  3UNG C;  4A2N B;  2WZL A;  3JRT A;  3DD7 A;  4DVY P;  2NUT B;  3T6B A;  4C3B A;  3GOD A;  1Z63 A;  3SEO A;  3PHF 2;  1NZE A;  2J7P A;  4U5H A;  3DM9 B;  4RD9 A;  5CI9 A;  3EHN A;  3E70 C;  2IXM A;  4CS9 A;  2WB7 A;  2EIL C;  4JVS A;  4CS9 C;  4YWQ A;  4OIO F;  3W8H A;  1TKN A;  5KYW B;  4ULW A;  4M63 A;  2XL4 A;  4IAO A;  4JJF A;  4NY3 A;  1Z5Z A;  3EGD B;  1TR2 A;  2Q9C A;  2IXN A;  2KGO A;  1M2V B;  3PMR A;  4LAC B;  3O39 A;  4AX2 A;  5B3S C;  3ECS A;  3F47 A;  1MMA A;  1ZHX A;  3S28 A;  2G3K A;  2ZXR A;  1SF8 A;  3S29 A;  5L3V A;  3K66 A;  5KYN A;  1MMD A;  2O9X A;  4RDA A;  4P6I C;  4IRU A;  3I4U A;  2J45 A;  4KI2 A;  4PFO A;  4KNV A;  3MLG A;  4I1M A;  5KYX B;  3QZC A;  3E9V A;  4XLN F;  3EZI A;  1VK5 A;  2H7B A;  3HTK C;  3AG4 C;  3Q6N A;  2EIK C;  2Y39 A;  4JCH A;  3UMK A;  1IZM A;  1JPN A;  3S0X A;  3SYN A;  2DYS C;  1Z6A A;  3LES A;  3EG9 A;  1VMA A;  1PD0 A;  4JJG A;  1D1C A;  2JD3 A;  4YT4 A;  2J46 A;  3OA1 A;  2PX0 A;  3N24 A;  4U5G A;  1OKK A;  4KC9 A;  5E33 A;  5DS5 A;  1G8X A;  4AE4 B;  2WZG A;  4U5F E;  4G0H A;  4G7H F;  3B0V C;  3O6X A;  5L3Q A;  4BJ1 A;  2Y3D A;  1J8Y F;  3MX3 A;  3LEV A;  1VOM A;  4MQ9 F;  1TWA A;  2LSE A;  2R7Q A;  2R7R A;  3K1I C;  3AQC A;  2W45 A;  1RJ9 A;  3POV A;  2Y3H A;  2W4M A;  2ZXO A;  2KQ9 A;  3W8I A;  4PJL A;  2C04 A;  3EJN A;  1D0X A;  1Z3I X;  4X0R A;  4I1O B;  4DBR A;  2M4E A;  4CIH A;  2A6H F;  4ZLD A;  2PP4 A;  3DZA A;  1IW7 F;  1ZHW A;  2CGE A;  2Z15 A;  2WL8 A;  3LJB A;  4U5C E;  2J9U A;  5KYU B;  2XXA B;  3NDB B;  2YHS A;  3DMD A;  3FVY A;  4XTK A;  5CI8 A;  3VYW A;  4ZLC A;  2Q9A A;  4O7G A;  1D0Z A;  1BR2 A;  2J0X A;  4U5D E;  4QI0 A;  2KW3 C;  2KJG A;  2WVO A;  2H7O A;  4U5B E;  2P7V A;  3K6B A;  3LNR A;  2CW0 F;  4BJ5 A;  4B6I A;  3EPV A;  3NKE A;  2FGY A;  4BJ5 C;  3IEE A;  1QZX A;  5D92 A;  2DGJ A;  1M2V A;  1NU9 C;  3ZSU A;  4BG0 A;  2EIJ C;  1SZI A;  3TD7 A;  3LAY A;  2Q9B A;  3VAY A;  5DS4 A;  3JT1 A;  1ST6 A;  4J32 B;  1LS1 A;  2G62 A;  4E7Z A;  5KYY A;  4XLP F;  4QI2 A;  3F46 A;  3ASO C;  1S7Z A;  3WG7 C;  3UR3 C;  3ZC4 A;  3OWT A;  2V3C C;  5FCL A;  1J8M F;  5EGY A;  3SNH A;  1OCO C;  3DXJ F;  3ZG1 A;  4CS7 A;  2CNW A;  4G7Z F;  3CQZ A;  4O79 A;  3NKD A;  3DAF A;  2X51 A;  3N0T A;  4LLC A;  5E3A A;  4Q4Z F;  2BE5 F;  4JZA A;  2Y3B A;  4GEH A;  4I3M A;  4E7S A;  3JSZ A;  4I44 A;  4KNW A;  4QDL A;  3B9Q A;  2VAS A;  2R7U A;  3AG3 C;  4H4K C;  4DOZ A;  2L81 A;  4PFP A;  1O87 A;  5F5F A;  5DVW A;  3T6J A;  2IYL D;  3DJN B;  3I5Q A;  3RIP A;  4C3D A;  2YZS A;  4C7O B;  3NRH A;  1FFT C;  3NYM A;  1O5H A;  2OG2 A;  3KMI A;  2WVQ A;  1JPJ A;  3FAJ A;  2XRH A;  4K0D A;  3EH1 A;  3FHD A;  1ZHZ A;  5DS6 A;  4XWJ A;  4HFF B;  1NG1 A;  5E3C A;  3WOD F;  2FFH A;  4W8K A;  4Q5S F;  2GFH A;  3H65 A;  1FMW A;  2XXA A;  5KYU A;  3W2W A;  4U5E E;  4YT8 A;  3CZ6 A;  3K7D A;  2E87 A;  3AG2 C;  3EG9 B;  4ANJ A;  3W2V A;  1QLE C;  1MMG A;  3EGX B;  3EFO A;  2NUP A;  3HLZ A;  3GAN A;  1MNE A;  5DQT A;  5F5H A;  4O6Y A;  2J7P D;  2NUT A;  4BEJ A;  2L9J A;  1OCC C;  3NYL A;  4PJN A;  2EIM C;  4CS8 C;  1M56 C;  3M1C B;  2PFD A;  3UMH A;  3X1O A;  4GYT A;  4MND A;  1RJ9 B;  1FMV A;  5KYW A;  3KL4 A;  3EGD A;  2IXP A;  3DAG A;  3ABL C;  4HEA J;  2VH3 A;  1NU7 D;  3RYL A;  1LKX A;  4OIR F;  2A1D D;  1ZU4 A;  4OIN F;  5BUO A;  3FDQ A;  3Q7G A;  4IJJ A;  2H7V C;  4HE8 D;  2D5R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...