3ZSVA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsvA00
4CJWA 1A5XA 1GOBA 4W5OA 3AVFA 1BQNA 4E89A 1ASWA 3PUFA 4DU4A 4AILC 4DMNA 3ZSWA 4DQSA 5C42A 5I42A 4KHSA 4IFVA 5KGWA 3I0SA 3OYGA 2YHAA 3M8SA 1S5JA 4FJKA 3P83D 3KLHA 1SUQA 3ZSOA 5SWMA 1BQMA 2IGIA 4CJFA 1RTHA 4DTOA 1RDBA 1ZYQA 3KLGA 4HCBA 2DY4A 1CXUA 1J5OA 4DTMA 3NF6A 4LSLA 4B9TA 1SKRA 4QOZB 1XWLA 1CLQA 4CJQA 4ZTJA 3NFAA 4FLXA 1IG9A 2OPRA 3JYTA 3VQ7A 1NKCA 1LWEA 4HVJA 5KTQA 3B6PA 4JRQA 1C1CA 3SZ2A 4BDPA 3V9SA 3TAGA 3DRSA 3NF9A 1EXQA 4HUFA 4LSNA 5HP1A 4CF9A 2A1RA 4KB0A 2XY7A 3OS1A 1NKBA 3KLIA 1HNIA 1BGXT 2GV9A 3ASMA 3HSTB 3IG1A 4CIEA 1JL2A 1QSLA 3U3GA 1NK8A 4Z4IA 3MAQA 3SQ1A 4LD0A 3ZSRA 1HRHA 3AO3A 1NKEA 4DFPA 4IDKA 4CJ5A 2Z1JA 3EYZA 2NUBA 3AO4A 3NGZA 3S3MA 4OLAA 4K8ZA 2HHXA 3RTVA 3OYEA 2G8HA 1VSFA 3ZSVA 2B4JA 3RMCA 4PWDA 3AVIA 2P1JA 4RW7A 3MXIA 4M3YA 1ZBLA 4PQUA 3C6TA 3K2PA 5FROA 2Y1JA 4DU1A 2PY5A 1RT4A 1L3UA 4FLZA 1BHLA 5HRRA 1D9DA 3VQBA 3QNOA 3VN5A 2JLEA 4PA1A 1C1AA 1TAUA 3AA2A 4CFAA 1IKYA 1WSIA 3OYAA 4TSXA 4CK2A 4DTUA 1SL2A 1I3AA 4DF4A 4H4OA 4FLVA 1QSYA 2Y1IA 5HRPA 4G1QA 3ZT0A 3OYIA 1X1PA 4DS4A 1RT7A 1ZBIA 2E6MA 3O3GA 3JSMA 5KRSA 1TVRA 3TARA 2KW4A 1X9WA 1L3SA 1U48A 3OYHA 3OYNA 1RBTA 1C0MA 1KCFA 1KVCA 3LDSA 1S9EA 3U6FA 3RRGA 3EZ5A 3V9UA 2D0CA 2X6NA 3CM6A 1C6VA 2HVHA 3QEWA 1RTIA 3V9XA 4FZZA 2OYQA 4M3TA 2QKBA 4GW6A 1JLFA 4CEFA 4CJRA 1ASVA 3TR8A 4JS5A 5J2PA 3ZCMA 4RG8A 1XI1A 3RR7A 2XHBA 1LAWA 3HYFA 3QEIA 2F8SA 4E1NA 3RRHA 4F3OA 1J54A 3LWLA 4KO0A 2VWJA 1KLNA 1HMVA 3DLKA 2RKIA 2KZZA 4EP5A 1IKXA 2R7YA 2HHUA 4EZ9A 3MXJA 2YNGA 5FRNA 3V1QA 2Q3SA 1WN7A 2O4GA 4ICLA 3D0PA 1VSMA 4RW9A 3DOLA 4AHTA 1O1WA 4CIGA 3OYFA 3I0RA 3KJVA 3RMAA 2YNFA 4DLGA 2D0BA 2KQ2A 4DTSA 1WSEA 4DQRA 2ETJA 3T19A 2ZE2A 3L3VA 3QNNA 4CJ3A 4O44A 3AVBA 2FC0A 2G8VA 4N56A 5KI6A 3O3HA 1KSPA 1JLBA 4MFBA 2HHVA 2G8WA 2HMIA 3OYDA 1XHXA 3M8RA 4FK2A 3DLGA 2G8KA 3V1RA 5JS1A 4CGGA 3VA0A 3VQDA 4CEQA 3AVMA 1VSHA 4FM0A 1B9FA 5D3GA 4ID5A 2X74A 1BL3A 3V4IA 1VK0A 4FCYA 3WNEA 2DFFA 3KK1A 4KHWA 1KVBA 1U49A 4H4MA 4KTWA 5C24A 4CEZA 4ZHRA 4CJLA 4DFKA 3HP6A 2HHQA 2ITGA 2F8TA 4FYDA 1JL1A 3KLFA 3SYZA 1IH7A 3K57A 1DLOA 4Z4CA 1S1UA 4DSIA 3AO5A 3K58A 4DSEA 2IS3A 1ITGA 3IS9A 3VQ8A 3V9WA 1X9SA 3CM5A 3DM2A 2FBTA 1HJRA 2RPIA 3L2QA 1UA0A 4PUOA 3AV9A 4L8RB 5HRNA 4DLEA 4AH9A 4FLYA 4FJ9A 3AO2A 4RW4A 4E7IA 1XHZA 3SUOA 1GOAA 1TK8A 1CZ9A 2Z1IA 3T1AA 1L3TA 1WAJA 3DLHA 3LANA 1HNVA 4H8KA 3E01A 4CJTA 3DMJA 4FK4A 5FRMA 3HJFA 4FLTA 3VQEA 3AVGA 4CJ4A 2BDPA 5CYMA 1U4BA 2P5OA 2EX3A 4CGFA 3OJSA 3NBPA 1CXQA 2YHBA 4CJSA 2XO7A 5I3UA 1WSHA 3K5NA 2F96A 3THVA 3SNNA 4BWMA 4FJ8A 3NH1A 3SPZA 3P5JA 3TABA 3IRXA 2QXFA 4W5RA 3S3OA 4C8NA 4J2AA 5KRTA 3ZSYA 2KFNA 5J1EA 3HPGA 2ZQBA 3OJUA 4DTJA 1D9FA 1DTTA 3F9KA 3ISNC 4I2QA 3TAMA 1TKTA 5HRSA 3TAEA 3PX6A 1ZBUA 4M41A 1N6QA 3SQ2A 1BISA 1RILA 1NK0A 1EETA 3G0ZA 4DWIA 5CY4A 4M3RA 4CK1A 4I7FA 3TANA 1HYZA 4EZ6A 3VQAA 3C6UA 3MEDA 4AHVA 5HROA 4M3UA 1SL0A 2BANA 3KKRA 1NK9A 1RDCA 4KKOA 1KFDA 4OKKA 1Q9XA 4W5QA 1FKPA 5CZ2A 4DQQA 2RN2A 4FJHA 3PX4A 3OVNA 4CHZA 1Q8IA 1SKWA 3AVKA 4B9VA 4KB1A 4K8XA 2HW3A 2DFEA 3NHGA 4CGIA 4FJGA 3QIOA 3VQ6A 4Z4HA 4RW6A 1VSLA 3CQ8A 3KLEA 2BGGA 4CFBA 1C0UA 2ZD1A 4DQPA 1RBUA 1J53A 3S3NA 1LW0A 4AHRA 2OZSA 4F4KA 3A2FA 4IBNA 3NF7A 4GVMA 1KFSA 1EKEA 3V6DA 1S6PA 1RT2A 3AA5X 3CFOA 4CCHA 2DTUA 3AVJA 4NYFA 4BWJA 3SV3A 3LAKA 2XY5A 4F8RA 3DYAA 1VRTA 2XY8A 1S9GA 3RMDA 2I5JA 3WNHA 4Z4FA 5JS2A 4F2SA 3OS0A 4FJ7A 4I2PA 1FK9A 5DMRA 4HCCA 4GMJB 1W0HA 3C95A 4DSKA 1QS4A 3WNFA 3QETA 1WSFA 4FW1A 4J2DA 1I39A 2HNYA 3CFPA 4OKJA 3ZSZA 1Q9YA 3LZIA 4OPKA 2Z1HA 3NF8A 4NCAA 4FZXC 4J2BA 3MXMA 3VQQA 1D8YA 4C8LA 4RW8A 2PZSA 1YT3A 1BIUA 3C94A 3FFIA 3HVTA 4R5PA 4N47A 4DSLA 4ELVA 3MEGA 4FXDA 2GUIA 5E41A 3OYLA 4E3SA 3OYMA 2JGUA 2IC3A 4DTPA 1RNHA 4HUGA 4DS5A 3SUPA 1YTUA 2G8IA 1RCHA 3SPYA 4QCLA 1TKZA 1HYSA 2OPQA 1KVAA 4W5NA 4I9LA 4KI4A 2YKNA 2VG5A 4HTUA 5KGXA 4NCBA 4KI6A 2VG7A 3NCIA 1BCMA 1NJXA 4KHNA 3M8PA 4BDYA 3LP3A 3LPUA 3VQ5A 4FM2A 3U3YA 3LP0A 3HP9A 3QESA 1B92A 1A5WA 1F21A 2WONA 1XC9A 3VQ9A 1NK6A 1Z26A 2VG6A 1IO2A 4AHSA 3LALA 2G8FA 5HBMA 3TAPA 3QEVA 2IDOA 1R0AA 3AVHA 4KV8A 2D5RA 4CJVA 1RDDA 4YFUA 4XIUA 1TK0A 1RBSA 3NH2A 4IKFA 3HM9A 4BE1A 1G15A 3VA3A 1X9MA 3HK2A 1QTMA 3KTQA 4B8CA 4DFJA 4CEBA 1T8EA 4CJUA 3T3FA 3NH0A 2O4IA 4UQGA 2GBZA 3PO5A 3L3UA 4KREA 2D0AA 3ITHA 1K6YA 1MU2A 4CHPA 2IOCA 2WOMA 1NJZA 3TAQA 2A1SA 1SKSA 1KTQA 3AA4A 3ULDA 3ZSXA 1HPZA 1JLEA 4QAGA 4JS4A 3QEPA 1LWCA 2DFHA 5SZTA 4E7KA 1WAFA 4FJIA 3KD5E 2OA8A 1S1TA 1QE1A 3LWMA 4CHQA 3MEEA 3DOKA 1BCOA 3ZT4A 1NK7A 3VQCA 2HVIA 3KKSA 1IKVA 1CZBA 1VSDA 4E7LA 4F3TA 1UWBA 4OKEA 4CEOA 4CJPA 3HL8A 4KHYA 4LY7A 4Z4EA 1FKOA 4CGJA 2YNIA 3KK2A 4FLWA 4KRFA 1TAQA 2RF2A 5C25A 4BACA 4FM1A 1NK5A 1T05A 4CF8A 4B9SA 3QEXA 3DLBA 1VSEA 2ATQA 2QKKA 4B9UA 4FK0A 1RDAA 4CERA 3NE6A 2XY6A 4KHUA 4OGEA 3NDKA 4FJ5A 5T7BA 4DFMA 4CESA 3SUQA 4M3WA 1WNSA 3O4NA 4CF0A 4KHQA 1TGOA 3HPHA 1RBRA 3ALYA 2FBVA 4C8MA 1TL3A 4BE2A 3RR8A 1YTAA 1TKXA 1WLJA 4CHYA 2KZMA 3OYJA 2HHSA 3G10A 4CHNA 4CK3A 3UIQA 4FVMA 3L2UA 3V9ZA 4PY5A 4O5BA 2HNDA 3HVRA 3H08A 3M8QA 5HLFA 3DI6A 1J9AA 1JLAA 3LP2A 1W9HA 3SQ4A 1T03A 4Q0BA 3IAYA 5CYQA 1A5VA 4ID1A 2B6AA 1JXEA 3VQPA 1BI4B 2OPPA 4HHTA 3O3FA 4B08A 4O55A 4M45A 1KRPA 2YNHA 2B5JA 1NOYA 1NK4A 1SV5A 1S1WA 4NYNA 1YVUA 2X6SA 4DSJA 4CGDA 1LWFA 1ZBFA 2FBXA 1HYVA 2P51A 3CYMA 3AO1A 2PYLA 3DRRA 3NGIA 4B9NA 3SI6A 2E4LA 4C8KA 3HXMA 4OJRA 4DQIA 2YKMA 4FJMA 4HUEA 4LH5A 4CE9A 3OS2A 4KPYA 2KFZA 3K59A 3QINA 4N5SA 4M3XA 2OPSA 5FDLA 3QLHA 4CF1A 4Q5VA 3HO1A 3OYKA 4E7JA 3AA3A 1TL1A 1Y97A 4CEAA 3KK3A 3WNGA 4DTNA 1VSKA 3RWUA 3KIOA 1ASUA 2G8UA 3S9HA 4FJJA 4CHOA 3K5OA 3L8BA 4FJNA 2LSNA 3CG7A 4O4GA 1FXXA 1NJYA 1EX4A 3TWHA 4O0IA 4ELTA 1KLMA 3QIPA 3O4QA 3L2RA 1U04A 1HQUA 1LAVA 4AHUA 3OY9A 1D5AA 4DSFA 1TK5A 5J2MA 3ZT1A 4FW2A 1C1BA 1LW2A 1UAXA 4DU3A 3SQ0A 3DLRA 4FJLA 1BI4A 3HT3A 4ELUA 3ZT3A 1REVA 4MQ3A 1RT1A 2Z1GA 4AHCA 2HHWA 4CJKA 1U45A 2QK9A 1TV6A 3NGYA 2VWKA 1L5UA 1VSIA 1JLGA 4CEDA 3KD1E 4IG0A 1JLCA 4IFYA 4ZTFA 4C8OA 1UA1A 4I9QA 3TI0A 1JXBA 1WSJA 3F73A 4F2RA 1RT3A 1WSGA 1VRUA 2FBYA 2HNZA 3QO9A 4OGCA 3I8DA 4JLHA 4DTRA 3PV8A 4Y1DA 4CEEA 4WE1A 4E0DA 3AVNA 5J2QA 2E6LA 1U47A 2W42A 1QHTA 4CECA 1JKHA 4FJXA 2HHTA 3DLEA 3EY1A 3B6OA 5DK5A 1NOZA 4OLBA 3LAMA 4IG3A 1UOCA 3SV4A 3LPTA 3P1GA 1GOCA 3OYCA 3SUNA 4O0JA 5CZ1A 1HQEA 1BIZA 3VQ4A 1B9DA 4B9MA 4M42A 1SL1A 1N5YA 1S6QA 1QSSA 2AJQA 1L3VA 3K5LA 3V1OA 4EP4A 1RBVA 4KFBA 3HPOA 3CFRA 4B8AB 1TKDA 3L2VA 1NJWA 4BDZA 4DF8A 4N41A 2YV0X 1T7PA 4B9LA 3ZSQA 5K14A 3K5MA 3PO4A 4LH4A 5EU7A 3ZT2A 4CFCA 3QERA 4N76A 1S1VA 3PX0A 4KTQA 2KTQA 1LV5A 2IAJA 4CFDA 4M3ZA 2HB5A 1RTDA 4CGHA 1RTJA 4NCGA 4OVLA 4CF2A 3OYBA 3DRPA 4FLUA 4J2EA 1ZBHA 1RT5A 4E19A 4E1MA 4OPJA 4W5TA 1QQCA 4CIFA 4FZYA 3D45A 3L2WA 4Z4GA 4BE0A 1DTQA 1RT6A 1S1XA 2EHGA 4Z0UA 4CJEA 3NAEA 3AVAA 3SCXA 1IKWA 4DG1A 3V81A 1EP4A 2XRIA 4YNQA 2P5GA 4B3OA 3TAFA 3LP1A 1Z25A 4DTXA 3AVLA 3SJJA 1VSJA 4Y1CA 1JLQA 2X78A 3LZJA 2OZMA 4JRPA 2BE2A 3PY8A 4KAZA 1C0TA 3AVCA 3RMBA 4KTZA 2PYJA 5J2NA 3BGRA 4E7HA 3MECA 3BDPA
chains in the Genus database with same CATH superfamily
4CJWA 1A5XA 4CD1A 4W5OA 3M6GA 1GLEG 4NXMK 3B8AX 5M1NA 2QW9A 4DMNA 3VGKA 5I42A 4KHSA 2ASOA 3CIPA 3OYGA 3P83D 2YCHA 3KLHA 1SUQA 3R9PA 1ZYQA 3KLGA 1CXUA 4B3SK 3IMXA 4B9TA 1JCFA 3HM8A 3CHWA 4QOZB 1XWLA 2BUPA 4KH4A 4CJQA 3TSUA 4ZTJA 1K8KB 2QA4N 1EQYA 3T1HK 3B6PA 4JRQA 3NF9A 4CF9A 3OS1A 1NKBA 1HNIA 1BGXT 3SBGA 1JL2A 3U3GA 4H5TA 3SQ1A 3H1VX 2D4WA 1VQ9N 3AO3A 1NKEA 4DFPA 2NUBA 3NGZA 2HHHK 4K8ZA 3RTVA 3OYEA 2B4JA 1M1KO 4M63C 4EHUA 4FO0A 3C6TA 2Y1JA 4DU1A 4A5AA 4BRMA 4FLZA 3VN5A 2JLEA 5CE3A 3AA2A 1IKYA 1WSIA 3OYAA 3J81O 2V52B 5E26A 3SJHA 5HRPA 3KWIA 4X65K 2P9LA 3FZKA 3TARA 1X9WA 1U48A 5AQTA 5AQYA 1C0MA 3T7ZA 1VQ8N 4RCHA 3TTDA 2Q1NA 2X6NA 4GVEA 1GLLO 1C6VA 2HVHA 4BC4A 3QEWA 4FZZA 4BRQA 3HOTA 1JLFA 4CEFA 3TR8A 1IBKK 1E4FT 1RDUA 3ZCMA 4A2AA 5M1KA 2V7YA 4E1NA 1QQMA 3QMLA 4JKGB 3RRHA 4F3OA 3AGKA 3DLKA 4EP5A 1IKXA 5LL6Z 2R7YA 3MXJA 1IG8A 1MA9B 1VSMA 3DOLA 2HBMA 1O1WA 3CCQN 2D0BA 2KQ2A 4B1UB 1WSEA 5LY3A 2ETJA 1GLJO 2ZE2A 3L3VA 3PIOL 1VQON 3ZX3A 3MX5A 3CCVN 2D0PA 4I6MA 4NXNK 5C10A 2G8WA 3H6EA 1MWMA 3ZEUB 3CCLN 3DLGA 2G8KA 4CGGA 3VQDA 4CEQA 1VSHA 4O5FA 2X74A 3V4IA 2VGMA 5AQSA 3WNEA 4FCYA 1KVBA 2F9TA 4H4MA 4CEZA 3O80A 5EOYA 4CJLA 2IVPA 2HHQA 1JL1A 3KLFA 1N36K 5AQXA 3LM2A 5BR9A 1IH7A 4HTLA 3TSQA 3A5LC 1VAZA 3IS9A 3VQ8A 1X9SA 1TYQB 3DM2A 1EO1A 3E66A 3QFPA 3BUZB 2FLOA 4DLEA 2QTDA 4LFAK 4JKFA 4H0PA 1GOAA 1WBDA 2Z1IA 3T1AA 3WXKA 4BROA 4G9ZA 4ISFA 2VQFK 3A0IX 3LANA 3VEOA 4CJTA 3E01A 3DLHA 4FLTA 3VQEA 4CJ4A 3ID6A 3T69A 3UKUB 1HX1A 2VQEK 4CGFA 3D2FA 1CXQA 2E2PA 5I3UA 3SNNA 3NH1A 3SPZA 3TABA 1RGIA 4FWOA 3S3OA 1G99A 5KRTA 5J1EA 3HPGA 2D1KA 3OJUA 1D9FA 1BWFO 4EFHA 3TAEA 4M41A 3BY5A 3SQ2A 2O8BB 4DWIA 5CY4A 2P9PA 3ATUA 1ZC6A 3C6UA 4KKOA 4W5QA 4DQQA 2RN2A 4BRAA 3OVNA 3SBTA 4KB1A 4B9VA 2DFEA 3QIOA 4Z4HA 4RW6A 1VSLA 2BGGA 3F9MA 4DQPA 2CH6A 4L3QA 2HMPA 2QWOA 1EKEA 3H46O 5AFUH 3V6DA 2P9SA 3AA5X 4CCHA 2FSKA 2DTUA 3AVJA 4NYFA 2NRXA 1BDGA 3DJCA 4DR4K 3F5TA 4F2SA 3OS0A 1FK9A 4QS7A 4JI4K 2Q31A 4J2DA 1I39A 3G71N 3LZIA 1NU0A 2W41A 4CZIA 3HVTA 5EY4A 4BRIA 5TKWA 4DSLA 2GUIA 3CPWM 3OYMA 3K0SA 1HUXA 4A62A 2P9NA 2VG5A 1TUYA 2W40A 3PSFA 5JICA 5KGXA 4KI6A 2GX9A 4IJAA 1BCMA 3NCIA 4BDYA 2GELA 3ENHA 3FE1A 3LALA 2G8FA 2IDOA 4BRLA 5AQOA 1RDDA 4YFUA 2UXDK 4IKFA 4BE1A 1G15A 1QTMA 4B8CA 4BRPA 4IXCA 5MLCQ 3L3UA 2D0AA 4CHPA 2E2QA 2IOCA 1GLDG 3MCAB 1NJZA 1JLEA 3CI5A 3QDKA 1LWCA 5SZTA 5JVHL 3KD5E 2OA8A 2VGNA 4CHQA 3VERA 3DOKA 1BCOA 1NBWA 3VQCA 3BZCA 4E7LA 1UWBA 1MWKA 3LL3A 3VEXA 2P9UA 4CF8A 4M3UA 3QEXA 1VSEA 2QKKA 2XY6A 1YITN 1M90O 4FJ5A 4M3WA 4CESA 3SUQA 3CJ1A 4KHQA 1TGOA 3EEQA 4C8MA 1TL3A 4NO7A 1TKXA 1KD1O 1K8AO 2HHSA 3M1FA 4FVMA 3V9ZA 1Q18A 3HVRA 3H08A 5LMUK 2P9KB 5HLFA 3DI6A 3SQ4A 4FSVA 4HHTA 1BI4B 3LDLA 3RSEB 1KXPA 3GBTA 2QWMA 4CGDA 1LWFA 2O8DB 2F9WA 3AO1A 3NGIA 1SZ2A 3OS2A 1Y64A 4H0TB 4N5SA 4M3XA 2OPSA 3HO1A 4CEAA 4DTNA 3KIOA 1ASUA 5BPMA 3S9HA 3O9UA 2NRWA 3K5OA 2AP1A 3CG7A 4ISEA 3CCEN 4BRCA 4O4GA 1NJYA 5KPTA 4O0IA 1LAVA 4DSFA 1D5AA 1ZBSA 4CBWA 5A2QO 1NM1A 3SAHA 3BF3A 4JKCA 3ZT3A 3CCJN 1RT1A 1NGBA 2FF6A 2Z1GA 4CJKA 1U45A 5GAGP 1Q86O 2QK9A 1TV6A 2NNWA 1JLGA 3KD1E 1K73O 1JCEA 4C8OA 4I9QA 1WSJA 2A6AA 1RT3A 1VRUA 2FBYA 3QO9A 2KZMA 5EXWA 4BR9A 5J2QA 4CECA 1JKHA 3W3DA 4WCEL 1HPMA 1NOZA 1OH5A 3LAMA 3SV4A 3OYCA 5CZ1A 3K9JA 4XH1A 3VQ4A 4B9MA 3MN9A 1SL1A 5F1XA 5GINA 3O9TA 1YF5L 4JI2K 3L4IA 3E9PA 4DB3A 3CFRA 4CI6A 4N41A 1H1VA 3ZSQA 5EU7A 3QERA 1J5EK 1VQMN 4N76A 4KTQA 2IAJA 2HB5A 1RTJA 5GAEP 1ZBHA 4W5TA 3MN6A 3LDOA 4E19A 1QQCA 4CIFA 3LDQA 1RT6A 4Z0UA 4CJEA 3NAEA 3AVAA 4CZGA 3V81A 3F2KA 3IKMA 4PKGA 1Z25A 3SJJA 4MLHA 2VYPA 3PY8A 4KAZA 1HKBA 3AVCA 3H3OB 3RMBA 2PYJA 3BGRA 3VF2A 3L4QA 5F2RA 3J7ZO 2ASMA 2JWKA 1BQNA 4E89A 1ASWA 3PUFA 2V51B 1E4GT 3I0SA 2YHAA 4CJ7A 4FJKA 3U9DA 3ZSOA 2E2NA 5SWMA 2IGIA 1RDBA 4BC3A 4WFBL 1J5OA 4DTMA 3NF6A 4LSLA 1YJNN 2OTLN 2QEXN 3VQ7A 4BDPA 1U6ZA 2GUPA 4KB0A 4LSNA 1RDWX 4A5BA 5HP1A 5M1PA 3IG1A 4JK8A 1QSLA 3PSIA 4FWRA 4Z4IA 3EKUA 2IVOA 4LD0A 1ATRA 1NGGA 3UKRB 4AF1A 4CJ5A 3EYZA 3CETA 1W2BM 1GLCG 3AO4A 3S3MA 4OLAA 4BR0A 4DHYA 1VSFA 3ZSVA 3RMCA 4PWDA 4LFBK 4RW7A 1ZBLA 4KBOA 1ZXOA 5AZIB 1P8ZA 4FWNA 3VQBA 2GWKA 4PA1A 1TAUA 3KK7A 4CFAA 1KSPA 1QSYA 4H4OA 4FLVA 1K8KA 2QWNA 4G1QA 4XH4A 3OYIA 2A40A 1X1PA 4DR5K 1RT7A 1ZBIA 3JSMA 2KW4A 4JYAK 3CJBA 3ZX2A 1KVCA 3U6FA 1OH6A 4UY8O 3CM6A 1QQNA 5KPRA 1RTIA 2OYQA 4M3TA 4JS5A 2XHBA 2ZGZA 3CQYA 2F8SA 1SAZA 4F9OA 4KO0A 2VWJA 1KLNA 3DXKB 1HMVA 2RKIA 2KZZA 5C2DA 4EZ9A 4BREA 2YNGA 3V1QA 1WN7A 2O4GA 4ICLA 4AHTA 3RMAA 3I0RA 1Q7YO 1DEJA 4DQRA 3WEEB 3QNNA 4CJ3A 2FC0A 2HHVA 5CR4A 1XHXA 5ELZA 2UU9K 3VF6A 5JS1A 4FK2A 4DQ8A 4FM0A 1YAGA 5BPLA 4DUZK 4KTWA 5C24A 1NNEA 1DKGD 3VTIA 1HNWK 1HNXK 2PFUA 2F8TA 4WQ5A 1IBLK 3SYZA 4LF7K 4DSIA 3K58A 4BC2A 4EAHD 3V9WA 4GKJK 3ZX0A 2CGLA 2RPIA 1HJRA 1NGAA 4AH9A 3TTCA 4DKWA 1XHZA 2E1YA 4DV6K 1L3TA 3AARA 1WAJA 4WQ4C 4E1JA 3HJFA 4FK4A 3THYA 2I7NA 5CYMA 1U4BA 2P5OA 4IEEA 3NBPA 2XO7A 3K5NA 2ZGYA 3P5JA 2WC9A 2F7TA 2QXFA 4B1ZA 3ZSYA 5BPNA 3ISNC 3O6WA 1ZBUA 1N6QA 1RILA 1NK0A 3OA9A 1TYQA 4M3RA 4I7FA 1P90A 4AQYK 3TANA 5AQNA 4EZ6A 3MEDA 1SL0A 1NK9A 1Q9XA 1FKPA 2CGJA 4FJHA 3U8XA 4CHZA 1Q8IA 1SKWA 3CJ7A 4FJGA 3VQ6A 3KLEA 2ZM6K 3UKUA 4GV9A 1RBUA 3S3NA 2OZSA 4B1VA 4F4KA 3SAFA 3A2FA 4IBNA 1KAYA 4GVMA 4H03B 1RT2A 4JD2A 4F8RA 3O9RA 1S9GA 1BOTO 2I5JA 4H5WA 3WNHA 3MWTA 4HCCA 4IJNA 3A5NC 1W0HA 2O8BA 4CBUA 5FPMA 3QETA 1WSFA 4PL8A 1OVYA 2QM1A 4OKJA 3ZSZA 3HZ6A 4H5RA 4NCAA 5FPNA 3MXMA 3VQQA 1D8YA 3CD6N 4FJ7A 4R5PA 2JWLA 4FXDA 5E41A 4QS9A 1HYSA 1KVAA 5LJVA 3J7YP 4I9LA 2YKNA 3KHYA 1LOTB 4HTUA 3DXMB 1NJXA 3LP3A 3VQ5A 4FM2A 1B92A 1A5WA 1J6ZA 1NK6A 1IO2A 4AHSA 4BR2A 5HBMA 3TAPA 3QEVA 4H0VB 1R0AA 4KV8A 5AZJB 4FL9A 4CJVA 1GLAG 1TK0A 3HM9A 4GY2B 4DFJA 4OPAA 4CJUA 3T3FA 3ZETA 2P9IB 3WXIA 1K6YA 1YVNA 2A1SA 2O8CB 3AA4A 1KC8O 3QEPA 2YJEA 4E7KA 3TSPA 3LWMA 3MEEA 4H5NA 2FF3B 3WXJA 1VSDA 1K9MO 4CEOA 3HL8A 3FZFA 4LY7A 3KK2A 4KRFA 1TAQA 2RE2A 5C25A 1T05A 4B9UA 1Q81O 4KHUA 4OGEA 3NDKA 3U4LA 1C0FA 4DFMA 3O4NA 5C15A 4CF0A 3ALYA 4BRHA 4CZJA 4JI8K 4K42A 2NRRA 4CHYA 3OYJA 3L2UA 2O8FB 3GOIA 4FPAA 1JLAA 4B1WB 1JJ2M 1A5VA 4ID1A 3O3FA 2ITMA 1NOYA 1S1WA 4NYNA 1YVUA 1ZBFA 1HYVA 2PYLA 4B9NA 3DRRA 4FJMA 3EKSA 4DQIA 4OJRA 2YKMA 2VWBA 5AQRA 3OW2M 1V4TA 4YOWA 5FDLA 3QLHA 4A59A 1Z6RA 3WT0A 3AA3A 3C6AA 1TL1A 3KK3A 4FOEA 1VSKA 3M3ZA 2G8UA 4JI0K 1NGHA 4GNIA 4FJNA 3D6RA 3N4QA 3G6EN 3O4QA 2CGKA 1U04A 2OTJN 2P9KA 5J2MA 3ZT1A 4FW2A 3NVKA 1LW2A 1UAXA 4YORA 4DU3A 4FJLA 1BI4A 2HF3A 4ELUA 4R79A 3RSEA 4AHCA 4HWIA 1Z05A 2VWKA 1L5UA 1VSIA 1W7AA 2O8DA 3TI0A 3F73A 4F2RA 1WSGA 3I8DA 3PV8A 3C7NB 4WFNL 2I7PA 3AVNA 1U47A 5BRHA 2W42A 3OTOK 3EN9A 4B1YB 2HHTA 5AQWA 2D0OA 2QWLA 3ZYYX 1S72N 1LCUA 2NRVA 2BTFA 5DK5A 1T44A 1W97L 4OLBA 4IFEA 3UB5A 4O8UA 3LPTA 1XUPO 3P1GA 4O0JA 2HSTA 4XH5A 2IIRA 1S6QA 3O5BA 2WUSA 2AJQA 3HPOA 2ZWHA 1TKDA 1NJWA 4U7BA 4DF8A 1O13A 4XEIA 4B9LA 3PO4A 2A5XA 3CPEA 2QWRA 1S1VA 3JAMO 4DUYK 3PX0A 4CFDA 4M3ZA 3MWPA 3I33A 1RT5A 4E1MA 4Z4GA 3H1QA 2EHGA 3VMFB 2HBLA 2P5GA 4DG1A 3L6QA 2XRIA 1N32K 5BRDA 4Y1CA 3Q7CA 4JRPA 3MN7A 5J2NA 2GEMA 3AVFA 3AY9A 3VEWA 4LF6K 4DQSA 5C42A 2QWQA 5BREA 1S5JA 1ATNA 4JKHA 2WBNA 2DY4A 4ISGA 3C65A 1SKRA 3R3LA 1CLQA 3NFAA 1NKCA 1LWEA 4HVJA 1C1CA 3TAGA 3GL1A 3DRSA 4HUFA 2A1RA 4BR5A 4IOCL 4CIEA 1NK8A 1NMNA 3MAQA 3I55N 1GLFO 2UXBK 1VQNN 4MDAA 3VESA 3RVCA 5AQJA 3E9OA 4DR7K 3K2PA 5FROA 4EIAA 4OPHA 3ULEB 1YUWA 1BHLA 1D9DA 1C1AA 3GE1A 4DTUA 5HL7L 4CK2A 1SL2A 1I3AA 2YX6A 2Y1IA 4DV2K 3PIPL 4IO9L 2RHKA 4JHDB 2E6MA 3O3GA 5KRSA 1TVRA 5AQVA 1YJWN 1L3SA 1MDUB 3OYHA 3LDSA 3E1YA 3CCUN 3RRGA 2E1ZA 1T3VA 3UKRA 4X64K 3N4PA 3D2EB 4GW6A 4CJRA 1ASVA 3O9QA 3VEZA 4BGAA 5AQGA 5J2PA 4IZ9A 3RR7A 1U2VB 1LAWA 4M7XA 4IEIA 1J54A 1BO5O 3LWLA 3CCSN 3GDQA 2HHUA 1QZ6A 1NGDA 4CZLA 2QI2A 1DT9A 3D0PA 2ZF5O 5CHIA 3KJVA 3J8AA 4DR3K 2FSJA 3CCMN 1S22A 3T19A 4DR1K 3H45C 4O44A 1NGIA 4N56A 5KI6A 1JLBA 4MFBA 2HMIA 3OYDA 1CZAN 4GV3A 3M8RA 3AVMA 1BL3A 4OO1J 1U49A 3BP8A 4JK9A 4ZHRA 4QS8A 2ZJPL 3WXLA 2YHXA 5C0YA 3ENBA 3HP6A 2ITGA 4FYDA 3OHRA 4PL7A 3K57A 4Z4CA 4DSEA 4LF9K 2IS3A 1ITGA 3FGUA 3CM5A 2FBTA 4NB4A 3L2QA 1UA0A 3PLAA 1E3MA 3AV9A 5IT9O 4L8RB 4LF5K 3WEEA 3SAGA 4YOVA 4BRKA 4RW4A 4YDUC 3WUHA 3IDHA 1TK8A 1CZ9A 5FRMA 3DMJA 1VQ6N 4BQLA 2BDPA 3AVGA 4WYBA 5JVGL 2EX3A 3CCRN 3OJSA 5AR0A 1WBBA 2YHBA 3MX2A 2FSNA 4CJSA 1WSHA 2F96A 4FJ8A 3CC4N 4BWMA 3O08A 3IRXA 3QB0A 1NGFA 4C8NA 3VEYA 4AM6A 4DTJA 2ZQBA 4C1NI 3F9KA 4I2QA 1TKTA 5HRSA 4YOTA 3PX6A 3OBWA 1RFQA 1BISA 1IJJA 3G0ZA 4FWPA 5AQFA 4BQZA 4CK1A 4OX9K 1HYZA 4IDHA 3VQAA 4AHVA 2BANA 3KKRA 1KFDA 3ENOA 1QHAA 3MN5A 5CZ2A 4NLCA 4BR7A 1C0UA 2ZD1A 1J53A 1HKGA 1LW0A 4AHRA 4A61A 3NF7A 1KFSA 1KAXA 1S6PA 3TU5A 3CFOA 4BWJA 3SV3A 2XY5A 3RMDA 3HSCA 5JS2A 4CZHA 5DMRA 4GMJB 3R8EA 3C95A 2J4RA 2Q97A 4O8KA 3WNFA 4FW1A 4BRFA 3CFPA 1Q9YA 4OPKA 2Z1HA 4JI3K 2GWJA 4FZXC 3O1WA 4J2BA 4C8LA 4RW8A 1KAZA 1BIUA 1QVGM 4JI7K 3OYLA 4E3SA 2JGUA 4HUGA 4QCLA 4ILJA 3CMAN 1RCHA 1TKZA 5FPDA 2OPQA 4RTFD 5AQHA 4W5NA 4NLBA 1QZ5A 3IFRA 3G25A 4CW7B 4DR2K 2VG7A 2PBDA 3DLLL 3M8PA 1DGKN 3LP0A 1NG9A 3QESA 2O8EB 1F21A 3VQ9A 3Q7BA 1Z26A 2VG6A 5AQZA 1XNRK 2GTDA 4XIUA 3NH2A 3C0BA 3VA3A 3HK2A 3LM9A 4CZEA 3KTQA 2ZJQL 4CEBA 4JI1K 2Q0UA 4JKGA 3NH0A 3EL2A 4UQGA 2O4IA 3PO5A 3MCPA 1X3MA 2OCEA 1Q82O 5M1OA 4BR4A 3TAQA 1SKSA 1KTQA 5F0XA 4FWLA 4BRDA 1HPZA 4JS4A 2DFHA 4FJIA 2OANA 3AGRA 3ZT4A 1C0GA 1VQLN 4F3TA 3P39A 3DXMA 3HI0A 4CJPA 4DV7K 3DAWA 4Z4EA 4CGJA 2YNIA 3DWLA 4FLWA 3ZEUA 4BACA 4B9SA 4FK0A 3NE6A 3SMSA 5T7BA 3O8MA 4YDUA 1WNSA 5AZJA 3HPHA 4BE2A 4M7YA 3A5OC 1NMDA 1QQOA 2H3GX 3UIQA 4PY5A 2KHOA 4O5BA 5JLFA 2F4VK 1S3XA 1J9AA 3LP2A 2P9IA 5CYQA 4EHTA 2O8CA 4KH6A 4M45A 1BA0A 4GV6A 1SV5A 3R1XA 2X6SA 4DSJA 2FBXA 3BZKA 4PQUA 5M1QA 3SI6A 3HXMA 4JKAA 4JNEA 3THWB 4HUEA 4KPYA 2KFZA 2NRTA 3MDQA 4PKIA 4E7JA 3WNGA 3THXB 4LFCK 3RWUA 4MO5A 4FJJA 3VGLA 4JI5K 1FXXA 2QXLA 1EX4A 2Q0RA 4ELTA 4C23A 1D4XA 3HBTA 4ILHA 2O8FA 4AHUA 4J8FA 3OY9A 1XMQK 1BUPA 1TK5A 1C1BA 1VQPN 3DLRA 2FXUA 3HT3A 4MQ3A 1OH8A 2HHWA 1NGEA 2E8AA 4DV1K 4C1NK 4IG0A 1JLCA 4IFYA 3EE8A 3QBXA 4DTRA 4OGCA 4Y1DA 4CEEA 4WE1A 4LF4K 5AQLA 1QHTA 4FJXA 3CC2N 3VGMA 3B6OA 1ESVA 1UOCA 4JEPA 1HR0K 1GOCA 1TUUA 1I94K 5JMVA 2A3ZA 4M42A 1NGJA 4K43A 1N5YA 1NGCA 1WUAA 2HBJA 1QSSA 3I56N 1L3VA 3K5LA 4KFBA 4B8AB 5LJWA 3L2VA 3A5MC 2YV0X 1R59O 2W6KA 4LH4A 4Z94A 4CFCA 3BF1A 2ASPA 2KTQA 1OKJA 1LV5A 5EVZA 1HNZK 3C7NA 4NCGA 4OVLA 3SK3A 3OYBA 3THYB 3DRPA 4FLUA 4J2EA 4OPJA 5AQPA 4FZYA 3D45A 3L2WA 3EE9A 3HRGA 5KPZA 1DTQA 2YI1A 3SCXA 4B3OA 1VQKN 1EP4A 4YNQA 3TTFA 3TAFA 4DTXA 3LZJA 3TPQA 1C0TA 3CC7N 1IV0A 1GOBA 4A2BA 1N34K 4DU4A 4AILC 4PKHA 5M1FA 3ZSWA 5I9EB 4IFVA 5KGWA 4WQ4A 3CERA 3M8SA 1HKCA 3EO3A 2HF4A 4GKKK 5ADXA 2A41A 5BN9A 5DM6L 1BQMA 3W0LA 4CJFA 1RTHA 4CZKA 5FPEA 4DTOA 4HCBA 1XNQK 2CH5A 3VTHA 4WF9L 3KVGA 1YJ9N 3VOVA 2WFBA 3P4IA 3OBYA 3O4WA 4FLXA 1YIJN 2OPRA 3JYTA 1IG9A 2YHWA 5KTQA 3SZ2A 1NJIO 3V9SA 2P9LB 3CMEN 1SQKA 4CBXA 1EXQA 3HOSA 2XY7A 1OVQA 2V7ZA 4BG8A 4JD2B 3KLIA 2GV9A 3ASMA 2UXCK 3HSTB 4DV5K 3ZSRA 1HRHA 2HBKA 3FZLA 4IDKA 2Z1JA 4YHHK 2HHXA 2G8HA 3QBWA 3AAPA 4K0KK 4BGBA 3AVIA 2P1JA 3MXIA 4M3YA 4BC5A 2PY5A 1RT4A 2E2OA 1L3UA 5HRRA 3QNOA 5GAHP 1YXQA 3K9KA 4TSXA 4DF4A 3ZT0A 4DS4A 4K41A 4RWTA 4IOXA 5C2FA 4I6MB 4MO4A 4B1XB 3OYNA 1RBTA 3O1BA 1KCFA 1S9EA 3EZ5A 3V9UA 3UE5A 2D0CA 4KHPK 3V9XA 4JI6K 2QKBA 2QWPA 4RG8A 1XI1A 3HYFA 4BRNA 3D7EO 5TKYA 3QEIA 4H0YB 4B9QA 5EX5A 3VENA 4B3TK 1FJGK 1BA1A 4JV5K 3KZBA 3ZETB 3FZHA 3R6MA 3ULEA 5FRNA 2Q3SA 2W6LA 4RW9A 4CIGA 3OYFA 2YNFA 5AQQA 4DLGA 2DPNA 4DTSA 2YJFA 1YHQN 3HTVA 4KH5A 4CZMA 3GG4A 3KWGA 3AVBA 4JHDA 2G8VA 2NRHA 3O3HA 4JK7A 4CZFA 3V1RA 3VA0A 5B8HA 1B9FA 5D3GA 1FW6A 4ID5A 3D2FB 1VK0A 1VQ4N 5AQKA 2DFFA 3D2EA 4H5VA 3KK1A 4KHWA 1U2VA 3J7AP 2E88A 3EZWA 2NRZA 3ATVA 4DFKA 1X9JA 4Y0WA 1DLOA 1S1UA 4H0OA 3AO5A 4FWQA 3CJCA 2Q2RA 2P9PB 5H1SQ 4PUOA 4YOXA 5HRNA 2KLAA 4FLYA 4FJ9A 3AO2A 4E7IA 3SUOA 3T1YK 1HNVA 4H8KA 1VQ7N 5BRFA 1BU6O 1HLUA 1EWQA 3CJAA 3FLCO 2P9SB 3THVA 3U9ZA 1WB9A 5KQDA 4W5RA 1JCGA 3WXMB 4J2AA 2KFNA 1DTTA 3BEXA 3TAMA 3J80O 3VEVA 3A8YA 1EETA 4IWVA 2KKZA 5HROA 3NVMA 5DM7L 1RDCA 4OKKA 3P38A 4FVUA 2YHYA 1N33K 3PX4A 3AVKA 4K8XA 1NLVA 2HW3A 4FOIA 3NHGA 4JKBA 4CGIA 5GIOA 3CQ8A 4CFBA 1SS6A 3ZLJA 2P9NB 1X3NA 4H0XB 4DR6K 2E20A 2Q36A 1GLBG 5E84A 3LAKA 3DYAA 1VRTA 2XY8A 4FWKA 4Z4FA 4I2PA 3O9SA 4B3RK 4DSKA 4DV0K 1QS4A 2IVNA 2UYTA 1KQSM 4AM7A 2HNYA 1QVFM 3NF8A 4IOAL 4B3MK 5AZIA 3QFUA 4BVOA 2PZSA 1YT3A 3FFIA 3C94A 4ELVA 4N47A 5GADP 3MEGA 1BG3A 3SMPA 2IC3A 4DTPA 1RNHA 3I8BA 4DS5A 3SUPA 1YTUA 2G8IA 3SPYA 2PAVA 5C12A 4BVPA 4KI4A 4NCBA 3E9LA 4MLEA 4KHNA 4JKEA 3LPUA 3U3YA 5GIPA 3HP9A 2P9UB 1VHXA 2VCPA 2WONA 1XC9A 1XC3A 2NLXA 2AA4A 3AVHA 4ILGB 4IO8A 2D5RA 3VETA 1RBSA 1X9MA 1V4SA 1T8EA 1XQSC 4A57A 3H3NO 3M5RA 2GBZA 3DXKA 4KREA 3ITHA 1MU2A 3WQUA 2WOMA 3ULDA 3ZSXA 4K25A 4QAGA 1IBMK 1WAFA 4WQ5C 2E5LK 1S1TA 1QE1A 5ADXH 2WTUA 1NK7A 2HVIA 3KKSA 1IKVA 1CZBA 2A42A 1T6CA 2UUAK 4OKEA 4BRGA 5JLHA 4KHYA 1FKOA 1ATSA 2RF2A 2O8EA 4FM1A 3LDNA 1NK5A 3DLBA 2ATQA 3CJ9A 4V19S 1RDAA 4CERA 5BR8K 4LF8K 3QICA 4JN4A 1RBRA 3CF5L 2FBVA 1HJOA 3RR8A 3FZMA 1YTAA 1WLJA 3C6HA 4MDBA 4BY9C 3G10A 4CHNA 4CK3A 4FWSA 5BN8A 2HNDA 3M8QA 1T03A 4Q0BA 1W9HA 2ZJRL 1YI2N 3IAYA 2B6AA 1JXEA 3VQPA 2OPPA 1KRPA 4B08A 4O55A 1XMOK 3SLCA 1N8RO 2YNHA 2B5JA 5IWAK 3FFKB 3CXCM 1NK4A 2UUCK 2BH1A 3JS6A 3JXUA 1T6DA 3CYMA 2P51A 4C8KA 2E4LA 4LH5A 4CE9A 3K59A 3QINA 1WOQA 4CF1A 3L0QA 4Q5VA 3OYKA 2NZTA 1NWKA 1Y97A 1VQ5N 4YOYA 3MK6A 4CHOA 3L8BA 2UUBK 2LSNA 3MMVA 3TWHA 1KLMA 3QIPA 4CD3A 3ID8A 3L2RA 5AQMA 1HQUA 3S41A 4DV4K 3SQ0A 1REVA 4FPBA 3NMUA 3CQXA 3NGYA 4DV3K 4X62K 3AAQA 4CEDA 4FWMA 4YY3K 4X66K 4ZTFA 1ILYA 1UA1A 1JXBA 5AFUA 3THWA 2HNZA 4JLHA 4E0DA 2E6LA 4DCHA 3DLEA 3THXA 1OH7A 3EY1A 4LC9B 5HOOA 4IG3A 3VF4A 4JAXA 2EWSA 3SUNA 1HQEA 1BIZA 1B9DA 4U67L 2HOEA 3LDPA 1EWRA 4CVNE 4PHTX 4JKDA 3P31A 3V1OA 4BG9A 4EP4A 1RBVA 4BDZA 1T7PA 5K14A 3K5MA 5FLXO 3ZT2A 5KQ8A 3IUCA 4YOUA 3WQTA 1RTDA 4CGHA 4CF2A 4WFAL 5AJ3K 5AQIA 4BE0A 1S1XA 1IKWA 3VPZA 3LP1A 3AVLA 5LMNK 1VSJA 1JLQA 2X78A 2OZMA 2BE2A 3FR0A 5AQUA 4KTZA 4E7HA 3MECA 3G4SN 3BDPA
chains in the Genus database with same CATH topology
4CJWA 1A5XA 1GOBA 4W5OA 3AVFA 1BQNA 4E89A 1ASWA 3PUFA 4DU4A 4AILC 4DMNA 3ZSWA 4DQSA 5C42A 5I42A 4KHSA 4IFVA 5KGWA 3I0SA 3OYGA 2YHAA 3M8SA 1S5JA 4FJKA 3P83D 3KLHA 1SUQA 3ZSOA 5SWMA 1BQMA 2IGIA 4CJFA 1RTHA 4DTOA 1RDBA 1ZYQA 3KLGA 4HCBA 2DY4A 1CXUA 1J5OA 4DTMA 3NF6A 4LSLA 4B9TA 1SKRA 4QOZB 1XWLA 1CLQA 4CJQA 4ZTJA 3NFAA 4FLXA 1IG9A 2OPRA 3JYTA 3VQ7A 1NKCA 1LWEA 4HVJA 5KTQA 3B6PA 4JRQA 1C1CA 3SZ2A 4BDPA 3V9SA 3TAGA 3DRSA 3NF9A 1EXQA 4HUFA 4LSNA 5HP1A 4CF9A 2A1RA 4KB0A 2XY7A 3OS1A 1NKBA 3KLIA 1HNIA 1BGXT 2GV9A 3ASMA 3HSTB 3IG1A 4CIEA 1JL2A 1QSLA 3U3GA 1NK8A 4Z4IA 3MAQA 3SQ1A 4LD0A 3ZSRA 1HRHA 3AO3A 1NKEA 4DFPA 4IDKA 4CJ5A 2Z1JA 3EYZA 2NUBA 3AO4A 3NGZA 3S3MA 4OLAA 4K8ZA 2HHXA 3RTVA 3OYEA 2G8HA 1VSFA 3ZSVA 2B4JA 3RMCA 4PWDA 3AVIA 2P1JA 4RW7A 3MXIA 4M3YA 1ZBLA 4PQUA 3C6TA 3K2PA 5FROA 2Y1JA 4DU1A 2PY5A 1RT4A 1L3UA 4FLZA 1BHLA 5HRRA 1D9DA 3VQBA 3QNOA 3VN5A 2JLEA 4PA1A 1C1AA 1TAUA 3AA2A 4CFAA 1IKYA 1WSIA 3OYAA 4TSXA 4CK2A 4DTUA 1SL2A 1I3AA 4DF4A 4H4OA 4FLVA 1QSYA 2Y1IA 5HRPA 4G1QA 3ZT0A 3OYIA 1X1PA 4DS4A 1RT7A 1ZBIA 2E6MA 3O3GA 3JSMA 5KRSA 1TVRA 3TARA 2KW4A 1X9WA 1L3SA 1U48A 3OYHA 3OYNA 1RBTA 1C0MA 1KCFA 1KVCA 3LDSA 1S9EA 3U6FA 3RRGA 3EZ5A 3V9UA 2D0CA 2X6NA 3CM6A 1C6VA 2HVHA 3QEWA 1RTIA 3V9XA 4FZZA 2OYQA 4M3TA 2QKBA 4GW6A 1JLFA 4CEFA 4CJRA 1ASVA 3TR8A 4JS5A 5J2PA 3ZCMA 4RG8A 1XI1A 3RR7A 2XHBA 1LAWA 3HYFA 3QEIA 2F8SA 4E1NA 3RRHA 4F3OA 1J54A 3LWLA 4KO0A 2VWJA 1KLNA 1HMVA 3DLKA 2RKIA 2KZZA 4EP5A 1IKXA 2R7YA 2HHUA 4EZ9A 3MXJA 2YNGA 5FRNA 3V1QA 2Q3SA 1WN7A 2O4GA 4ICLA 3D0PA 1VSMA 4RW9A 3DOLA 4AHTA 1O1WA 4CIGA 3OYFA 3I0RA 3KJVA 3RMAA 2YNFA 4DLGA 2D0BA 2KQ2A 4DTSA 1WSEA 4DQRA 2ETJA 3T19A 2ZE2A 3L3VA 3QNNA 4CJ3A 4O44A 3AVBA 2FC0A 2G8VA 4N56A 5KI6A 3O3HA 1KSPA 1JLBA 4MFBA 2HHVA 2G8WA 2HMIA 3OYDA 1XHXA 3M8RA 4FK2A 3DLGA 2G8KA 3V1RA 5JS1A 4CGGA 3VA0A 3VQDA 4CEQA 3AVMA 1VSHA 4FM0A 1B9FA 5D3GA 4ID5A 2X74A 1BL3A 3V4IA 1VK0A 4FCYA 3WNEA 2DFFA 3KK1A 4KHWA 1KVBA 1U49A 4H4MA 4KTWA 5C24A 4CEZA 4ZHRA 4CJLA 4DFKA 3HP6A 2HHQA 2ITGA 2F8TA 4FYDA 1JL1A 3KLFA 3SYZA 1IH7A 3K57A 1DLOA 4Z4CA 1S1UA 4DSIA 3AO5A 3K58A 4DSEA 2IS3A 1ITGA 3IS9A 3VQ8A 3V9WA 1X9SA 3CM5A 3DM2A 2FBTA 1HJRA 2RPIA 3L2QA 1UA0A 4PUOA 3AV9A 4L8RB 5HRNA 4DLEA 4AH9A 4FLYA 4FJ9A 3AO2A 4RW4A 4E7IA 1XHZA 3SUOA 1GOAA 1TK8A 1CZ9A 2Z1IA 3T1AA 1L3TA 1WAJA 3DLHA 3LANA 1HNVA 4H8KA 3E01A 4CJTA 3DMJA 4FK4A 5FRMA 3HJFA 4FLTA 3VQEA 3AVGA 4CJ4A 2BDPA 5CYMA 1U4BA 2P5OA 2EX3A 4CGFA 3OJSA 3NBPA 1CXQA 2YHBA 4CJSA 2XO7A 5I3UA 1WSHA 3K5NA 2F96A 3THVA 3SNNA 4BWMA 4FJ8A 3NH1A 3SPZA 3P5JA 3TABA 3IRXA 2QXFA 4W5RA 3S3OA 4C8NA 4J2AA 5KRTA 3ZSYA 2KFNA 5J1EA 3HPGA 2ZQBA 3OJUA 4DTJA 1D9FA 1DTTA 3F9KA 3ISNC 4I2QA 3TAMA 1TKTA 5HRSA 3TAEA 3PX6A 1ZBUA 4M41A 1N6QA 3SQ2A 1BISA 1RILA 1NK0A 1EETA 3G0ZA 4DWIA 5CY4A 4M3RA 4CK1A 4I7FA 3TANA 1HYZA 4EZ6A 3VQAA 3C6UA 3MEDA 4AHVA 5HROA 4M3UA 1SL0A 2BANA 3KKRA 1NK9A 1RDCA 4KKOA 1KFDA 4OKKA 1Q9XA 4W5QA 1FKPA 5CZ2A 4DQQA 2RN2A 4FJHA 3PX4A 3OVNA 4CHZA 1Q8IA 1SKWA 3AVKA 4B9VA 4KB1A 4K8XA 2HW3A 2DFEA 3NHGA 4CGIA 4FJGA 3QIOA 3VQ6A 4Z4HA 4RW6A 1VSLA 3CQ8A 3KLEA 2BGGA 4CFBA 1C0UA 2ZD1A 4DQPA 1RBUA 1J53A 3S3NA 1LW0A 4AHRA 2OZSA 4F4KA 3A2FA 4IBNA 3NF7A 4GVMA 1KFSA 1EKEA 3V6DA 1S6PA 1RT2A 3AA5X 3CFOA 4CCHA 2DTUA 3AVJA 4NYFA 4BWJA 3SV3A 3LAKA 2XY5A 4F8RA 3DYAA 1VRTA 2XY8A 1S9GA 3RMDA 2I5JA 3WNHA 4Z4FA 5JS2A 4F2SA 3OS0A 4FJ7A 4I2PA 1FK9A 5DMRA 4HCCA 4GMJB 1W0HA 3C95A 4DSKA 1QS4A 3WNFA 3QETA 1WSFA 4FW1A 4J2DA 1I39A 2HNYA 3CFPA 4OKJA 3ZSZA 1Q9YA 3LZIA 4OPKA 2Z1HA 3NF8A 4NCAA 4FZXC 4J2BA 3MXMA 3VQQA 1D8YA 4C8LA 4RW8A 2PZSA 1YT3A 1BIUA 3C94A 3FFIA 3HVTA 4R5PA 4N47A 4DSLA 4ELVA 3MEGA 4FXDA 2GUIA 5E41A 3OYLA 4E3SA 3OYMA 2JGUA 2IC3A 4DTPA 1RNHA 4HUGA 4DS5A 3SUPA 1YTUA 2G8IA 1RCHA 3SPYA 4QCLA 1TKZA 1HYSA 2OPQA 1KVAA 4W5NA 4I9LA 4KI4A 2YKNA 2VG5A 4HTUA 5KGXA 4NCBA 4KI6A 2VG7A 3NCIA 1BCMA 1NJXA 4KHNA 3M8PA 4BDYA 3LP3A 3LPUA 3VQ5A 4FM2A 3U3YA 3LP0A 3HP9A 3QESA 1B92A 1A5WA 1F21A 2WONA 1XC9A 3VQ9A 1NK6A 1Z26A 2VG6A 1IO2A 4AHSA 3LALA 2G8FA 5HBMA 3TAPA 3QEVA 2IDOA 1R0AA 3AVHA 4KV8A 2D5RA 4CJVA 1RDDA 4YFUA 4XIUA 1TK0A 1RBSA 3NH2A 4IKFA 3HM9A 4BE1A 1G15A 3VA3A 1X9MA 3HK2A 1QTMA 3KTQA 4B8CA 4DFJA 4CEBA 1T8EA 4CJUA 3T3FA 3NH0A 2O4IA 4UQGA 2GBZA 3PO5A 3L3UA 4KREA 2D0AA 3ITHA 1K6YA 1MU2A 4CHPA 2IOCA 2WOMA 1NJZA 3TAQA 2A1SA 1SKSA 1KTQA 3AA4A 3ULDA 3ZSXA 1HPZA 1JLEA 4QAGA 4JS4A 3QEPA 1LWCA 2DFHA 5SZTA 4E7KA 1WAFA 4FJIA 3KD5E 2OA8A 1S1TA 1QE1A 3LWMA 4CHQA 3MEEA 3DOKA 1BCOA 3ZT4A 1NK7A 3VQCA 2HVIA 3KKSA 1IKVA 1CZBA 1VSDA 4E7LA 4F3TA 1UWBA 4OKEA 4CEOA 4CJPA 3HL8A 4KHYA 4LY7A 4Z4EA 1FKOA 4CGJA 2YNIA 3KK2A 4FLWA 4KRFA 1TAQA 2RF2A 5C25A 4BACA 4FM1A 1NK5A 1T05A 4CF8A 4B9SA 3QEXA 3DLBA 1VSEA 2ATQA 2QKKA 4B9UA 4FK0A 1RDAA 4CERA 3NE6A 2XY6A 4KHUA 4OGEA 3NDKA 4FJ5A 5T7BA 4DFMA 4CESA 3SUQA 4M3WA 1WNSA 3O4NA 4CF0A 4KHQA 1TGOA 3HPHA 1RBRA 3ALYA 2FBVA 4C8MA 1TL3A 4BE2A 3RR8A 1YTAA 1TKXA 1WLJA 4CHYA 2KZMA 3OYJA 2HHSA 3G10A 4CHNA 4CK3A 3UIQA 4FVMA 3L2UA 3V9ZA 4PY5A 4O5BA 2HNDA 3HVRA 3H08A 3M8QA 5HLFA 3DI6A 1J9AA 1JLAA 3LP2A 1W9HA 3SQ4A 1T03A 4Q0BA 3IAYA 5CYQA 1A5VA 4ID1A 2B6AA 1JXEA 3VQPA 1BI4B 2OPPA 4HHTA 3O3FA 4B08A 4O55A 4M45A 1KRPA 2YNHA 2B5JA 1NOYA 1NK4A 1SV5A 1S1WA 4NYNA 1YVUA 2X6SA 4DSJA 4CGDA 1LWFA 1ZBFA 2FBXA 1HYVA 2P51A 3CYMA 3AO1A 2PYLA 3DRRA 3NGIA 4B9NA 3SI6A 2E4LA 4C8KA 3HXMA 4OJRA 4DQIA 2YKMA 4FJMA 4HUEA 4LH5A 4CE9A 3OS2A 4KPYA 2KFZA 3K59A 3QINA 4N5SA 4M3XA 2OPSA 5FDLA 3QLHA 4CF1A 4Q5VA 3HO1A 3OYKA 4E7JA 3AA3A 1TL1A 1Y97A 4CEAA 3KK3A 3WNGA 4DTNA 1VSKA 3RWUA 3KIOA 1ASUA 2G8UA 3S9HA 4FJJA 4CHOA 3K5OA 3L8BA 4FJNA 2LSNA 3CG7A 4O4GA 1FXXA 1NJYA 1EX4A 3TWHA 4O0IA 4ELTA 1KLMA 3QIPA 3O4QA 3L2RA 1U04A 1HQUA 1LAVA 4AHUA 3OY9A 1D5AA 4DSFA 1TK5A 5J2MA 3ZT1A 4FW2A 1C1BA 1LW2A 1UAXA 4DU3A 3SQ0A 3DLRA 4FJLA 1BI4A 3HT3A 4ELUA 3ZT3A 1REVA 4MQ3A 1RT1A 2Z1GA 4AHCA 2HHWA 4CJKA 1U45A 2QK9A 1TV6A 3NGYA 2VWKA 1L5UA 1VSIA 1JLGA 4CEDA 3KD1E 4IG0A 1JLCA 4IFYA 4ZTFA 4C8OA 1UA1A 4I9QA 3TI0A 1JXBA 1WSJA 3F73A 4F2RA 1RT3A 1WSGA 1VRUA 2FBYA 2HNZA 3QO9A 4OGCA 3I8DA 4JLHA 4DTRA 3PV8A 4Y1DA 4CEEA 4WE1A 4E0DA 3AVNA 5J2QA 2E6LA 1U47A 2W42A 1QHTA 4CECA 1JKHA 4FJXA 2HHTA 3DLEA 3EY1A 3B6OA 5DK5A 1NOZA 4OLBA 3LAMA 4IG3A 1UOCA 3SV4A 3LPTA 3P1GA 1GOCA 3OYCA 3SUNA 4O0JA 5CZ1A 1HQEA 1BIZA 3VQ4A 1B9DA 4B9MA 4M42A 1SL1A 1N5YA 1S6QA 1QSSA 2AJQA 1L3VA 3K5LA 3V1OA 4EP4A 1RBVA 4KFBA 3HPOA 3CFRA 4B8AB 1TKDA 3L2VA 1NJWA 4BDZA 4DF8A 4N41A 2YV0X 1T7PA 4B9LA 3ZSQA 5K14A 3K5MA 3PO4A 4LH4A 5EU7A 3ZT2A 4CFCA 3QERA 4N76A 1S1VA 3PX0A 4KTQA 2KTQA 1LV5A 2IAJA 4CFDA 4M3ZA 2HB5A 1RTDA 4CGHA 1RTJA 4NCGA 4OVLA 4CF2A 3OYBA 3DRPA 4FLUA 4J2EA 1ZBHA 1RT5A 4E19A 4E1MA 4OPJA 4W5TA 1QQCA 4CIFA 4FZYA 3D45A 3L2WA 4Z4GA 4BE0A 1DTQA 1RT6A 1S1XA 2EHGA 4Z0UA 4CJEA 3NAEA 3AVAA 3SCXA 1IKWA 4DG1A 3V81A 1EP4A 2XRIA 4YNQA 2P5GA 4B3OA 3TAFA 3LP1A 1Z25A 4DTXA 3AVLA 3SJJA 1VSJA 4Y1CA 1JLQA 2X78A 3LZJA 2OZMA 4JRPA 2BE2A 3PY8A 4KAZA 1C0TA 3AVCA 3RMBA 4KTZA 2PYJA 5J2NA 3BGRA 4E7HA 3MECA 3BDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJW A;  1A5X A;  1GOB A;  4W5O A;  3AVF A;  1BQN A;  4E89 A;  1ASW A;  3PUF A;  4DU4 A;  4AIL C;  4DMN A;  3ZSW A;  4DQS A;  5C42 A;  5I42 A;  4KHS A;  4IFV A;  5KGW A;  3I0S A;  3OYG A;  2YHA A;  3M8S A;  1S5J A;  4FJK A;  3P83 D;  3KLH A;  1SUQ A;  3ZSO A;  5SWM A;  1BQM A;  2IGI A;  4CJF A;  1RTH A;  4DTO A;  1RDB A;  1ZYQ A;  3KLG A;  4HCB A;  2DY4 A;  1CXU A;  1J5O A;  4DTM A;  3NF6 A;  4LSL A;  4B9T A;  1SKR A;  4QOZ B;  1XWL A;  1CLQ A;  4CJQ A;  4ZTJ A;  3NFA A;  4FLX A;  1IG9 A;  2OPR A;  3JYT A;  3VQ7 A;  1NKC A;  1LWE A;  4HVJ A;  5KTQ A;  3B6P A;  4JRQ A;  1C1C A;  3SZ2 A;  4BDP A;  3V9S A;  3TAG A;  3DRS A;  3NF9 A;  1EXQ A;  4HUF A;  4LSN A;  5HP1 A;  4CF9 A;  2A1R A;  4KB0 A;  2XY7 A;  3OS1 A;  1NKB A;  3KLI A;  1HNI A;  1BGX T;  2GV9 A;  3ASM A;  3HST B;  3IG1 A;  4CIE A;  1JL2 A;  1QSL A;  3U3G A;  1NK8 A;  4Z4I A;  3MAQ A;  3SQ1 A;  4LD0 A;  3ZSR A;  1HRH A;  3AO3 A;  1NKE A;  4DFP A;  4IDK A;  4CJ5 A;  2Z1J A;  3EYZ A;  2NUB A;  3AO4 A;  3NGZ A;  3S3M A;  4OLA A;  4K8Z A;  2HHX A;  3RTV A;  3OYE A;  2G8H A;  1VSF A;  3ZSV A;  2B4J A;  3RMC A;  4PWD A;  3AVI A;  2P1J A;  4RW7 A;  3MXI A;  4M3Y A;  1ZBL A;  4PQU A;  3C6T A;  3K2P A;  5FRO A;  2Y1J A;  4DU1 A;  2PY5 A;  1RT4 A;  1L3U A;  4FLZ A;  1BHL A;  5HRR A;  1D9D A;  3VQB A;  3QNO A;  3VN5 A;  2JLE A;  4PA1 A;  1C1A A;  1TAU A;  3AA2 A;  4CFA A;  1IKY A;  1WSI A;  3OYA A;  4TSX A;  4CK2 A;  4DTU A;  1SL2 A;  1I3A A;  4DF4 A;  4H4O A;  4FLV A;  1QSY A;  2Y1I A;  5HRP A;  4G1Q A;  3ZT0 A;  3OYI A;  1X1P A;  4DS4 A;  1RT7 A;  1ZBI A;  2E6M A;  3O3G A;  3JSM A;  5KRS A;  1TVR A;  3TAR A;  2KW4 A;  1X9W A;  1L3S A;  1U48 A;  3OYH A;  3OYN A;  1RBT A;  1C0M A;  1KCF A;  1KVC A;  3LDS A;  1S9E A;  3U6F A;  3RRG A;  3EZ5 A;  3V9U A;  2D0C A;  2X6N A;  3CM6 A;  1C6V A;  2HVH A;  3QEW A;  1RTI A;  3V9X A;  4FZZ A;  2OYQ A;  4M3T A;  2QKB A;  4GW6 A;  1JLF A;  4CEF A;  4CJR A;  1ASV A;  3TR8 A;  4JS5 A;  5J2P A;  3ZCM A;  4RG8 A;  1XI1 A;  3RR7 A;  2XHB A;  1LAW A;  3HYF A;  3QEI A;  2F8S A;  4E1N A;  3RRH A;  4F3O A;  1J54 A;  3LWL A;  4KO0 A;  2VWJ A;  1KLN A;  1HMV A;  3DLK A;  2RKI A;  2KZZ A;  4EP5 A;  1IKX A;  2R7Y A;  2HHU A;  4EZ9 A;  3MXJ A;  2YNG A;  5FRN A;  3V1Q A;  2Q3S A;  1WN7 A;  2O4G A;  4ICL A;  3D0P A;  1VSM A;  4RW9 A;  3DOL A;  4AHT A;  1O1W A;  4CIG A;  3OYF A;  3I0R A;  3KJV A;  3RMA A;  2YNF A;  4DLG A;  2D0B A;  2KQ2 A;  4DTS A;  1WSE A;  4DQR A;  2ETJ A;  3T19 A;  2ZE2 A;  3L3V A;  3QNN A;  4CJ3 A;  4O44 A;  3AVB A;  2FC0 A;  2G8V A;  4N56 A;  5KI6 A;  3O3H A;  1KSP A;  1JLB A;  4MFB A;  2HHV A;  2G8W A;  2HMI A;  3OYD A;  1XHX A;  3M8R A;  4FK2 A;  3DLG A;  2G8K A;  3V1R A;  5JS1 A;  4CGG A;  3VA0 A;  3VQD A;  4CEQ A;  3AVM A;  1VSH A;  4FM0 A;  1B9F A;  5D3G A;  4ID5 A;  2X74 A;  1BL3 A;  3V4I A;  1VK0 A;  4FCY A;  3WNE A;  2DFF A;  3KK1 A;  4KHW A;  1KVB A;  1U49 A;  4H4M A;  4KTW A;  5C24 A;  4CEZ A;  4ZHR A;  4CJL A;  4DFK A;  3HP6 A;  2HHQ A;  2ITG A;  2F8T A;  4FYD A;  1JL1 A;  3KLF A;  3SYZ A;  1IH7 A;  3K57 A;  1DLO A;  4Z4C A;  1S1U A;  4DSI A;  3AO5 A;  3K58 A;  4DSE A;  2IS3 A;  1ITG A;  3IS9 A;  3VQ8 A;  3V9W A;  1X9S A;  3CM5 A;  3DM2 A;  2FBT A;  1HJR A;  2RPI A;  3L2Q A;  1UA0 A;  4PUO A;  3AV9 A;  4L8R B;  5HRN A;  4DLE A;  4AH9 A;  4FLY A;  4FJ9 A;  3AO2 A;  4RW4 A;  4E7I A;  1XHZ A;  3SUO A;  1GOA A;  1TK8 A;  1CZ9 A;  2Z1I A;  3T1A A;  1L3T A;  1WAJ A;  3DLH A;  3LAN A;  1HNV A;  4H8K A;  3E01 A;  4CJT A;  3DMJ A;  4FK4 A;  5FRM A;  3HJF A;  4FLT A;  3VQE A;  3AVG A;  4CJ4 A;  2BDP A;  5CYM A;  1U4B A;  2P5O A;  2EX3 A;  4CGF A;  3OJS A;  3NBP A;  1CXQ A;  2YHB A;  4CJS A;  2XO7 A;  5I3U A;  1WSH A;  3K5N A;  2F96 A;  3THV A;  3SNN A;  4BWM A;  4FJ8 A;  3NH1 A;  3SPZ A;  3P5J A;  3TAB A;  3IRX A;  2QXF A;  4W5R A;  3S3O A;  4C8N A;  4J2A A;  5KRT A;  3ZSY A;  2KFN A;  5J1E A;  3HPG A;  2ZQB A;  3OJU A;  4DTJ A;  1D9F A;  1DTT A;  3F9K A;  3ISN C;  4I2Q A;  3TAM A;  1TKT A;  5HRS A;  3TAE A;  3PX6 A;  1ZBU A;  4M41 A;  1N6Q A;  3SQ2 A;  1BIS A;  1RIL A;  1NK0 A;  1EET A;  3G0Z A;  4DWI A;  5CY4 A;  4M3R A;  4CK1 A;  4I7F A;  3TAN A;  1HYZ A;  4EZ6 A;  3VQA A;  3C6U A;  3MED A;  4AHV A;  5HRO A;  4M3U A;  1SL0 A;  2BAN A;  3KKR A;  1NK9 A;  1RDC A;  4KKO A;  1KFD A;  4OKK A;  1Q9X A;  4W5Q A;  1FKP A;  5CZ2 A;  4DQQ A;  2RN2 A;  4FJH A;  3PX4 A;  3OVN A;  4CHZ A;  1Q8I A;  1SKW A;  3AVK A;  4B9V A;  4KB1 A;  4K8X A;  2HW3 A;  2DFE A;  3NHG A;  4CGI A;  4FJG A;  3QIO A;  3VQ6 A;  4Z4H A;  4RW6 A;  1VSL A;  3CQ8 A;  3KLE A;  2BGG A;  4CFB A;  1C0U A;  2ZD1 A;  4DQP A;  1RBU A;  1J53 A;  3S3N A;  1LW0 A;  4AHR A;  2OZS A;  4F4K A;  3A2F A;  4IBN A;  3NF7 A;  4GVM A;  1KFS A;  1EKE A;  3V6D A;  1S6P A;  1RT2 A;  3AA5 X;  3CFO A;  4CCH A;  2DTU A;  3AVJ A;  4NYF A;  4BWJ A;  3SV3 A;  3LAK A;  2XY5 A;  4F8R A;  3DYA A;  1VRT A;  2XY8 A;  1S9G A;  3RMD A;  2I5J A;  3WNH A;  4Z4F A;  5JS2 A;  4F2S A;  3OS0 A;  4FJ7 A;  4I2P A;  1FK9 A;  5DMR A;  4HCC A;  4GMJ B;  1W0H A;  3C95 A;  4DSK A;  1QS4 A;  3WNF A;  3QET A;  1WSF A;  4FW1 A;  4J2D A;  1I39 A;  2HNY A;  3CFP A;  4OKJ A;  3ZSZ A;  1Q9Y A;  3LZI A;  4OPK A;  2Z1H A;  3NF8 A;  4NCA A;  4FZX C;  4J2B A;  3MXM A;  3VQQ A;  1D8Y A;  4C8L A;  4RW8 A;  2PZS A;  1YT3 A;  1BIU A;  3C94 A;  3FFI A;  3HVT A;  4R5P A;  4N47 A;  4DSL A;  4ELV A;  3MEG A;  4FXD A;  2GUI A;  5E41 A;  3OYL A;  4E3S A;  3OYM A;  2JGU A;  2IC3 A;  4DTP A;  1RNH A;  4HUG A;  4DS5 A;  3SUP A;  1YTU A;  2G8I A;  1RCH A;  3SPY A;  4QCL A;  1TKZ A;  1HYS A;  2OPQ A;  1KVA A;  4W5N A;  4I9L A;  4KI4 A;  2YKN A;  2VG5 A;  4HTU A;  5KGX A;  4NCB A;  4KI6 A;  2VG7 A;  3NCI A;  1BCM A;  1NJX A;  4KHN A;  3M8P A;  4BDY A;  3LP3 A;  3LPU A;  3VQ5 A;  4FM2 A;  3U3Y A;  3LP0 A;  3HP9 A;  3QES A;  1B92 A;  1A5W A;  1F21 A;  2WON A;  1XC9 A;  3VQ9 A;  1NK6 A;  1Z26 A;  2VG6 A;  1IO2 A;  4AHS A;  3LAL A;  2G8F A;  5HBM A;  3TAP A;  3QEV A;  2IDO A;  1R0A A;  3AVH A;  4KV8 A;  2D5R A;  4CJV A;  1RDD A;  4YFU A;  4XIU A;  1TK0 A;  1RBS A;  3NH2 A;  4IKF A;  3HM9 A;  4BE1 A;  1G15 A;  3VA3 A;  1X9M A;  3HK2 A;  1QTM A;  3KTQ A;  4B8C A;  4DFJ A;  4CEB A;  1T8E A;  4CJU A;  3T3F A;  3NH0 A;  2O4I A;  4UQG A;  2GBZ A;  3PO5 A;  3L3U A;  4KRE A;  2D0A A;  3ITH A;  1K6Y A;  1MU2 A;  4CHP A;  2IOC A;  2WOM A;  1NJZ A;  3TAQ A;  2A1S A;  1SKS A;  1KTQ A;  3AA4 A;  3ULD A;  3ZSX A;  1HPZ A;  1JLE A;  4QAG A;  4JS4 A;  3QEP A;  1LWC A;  2DFH A;  5SZT A;  4E7K A;  1WAF A;  4FJI A;  3KD5 E;  2OA8 A;  1S1T A;  1QE1 A;  3LWM A;  4CHQ A;  3MEE A;  3DOK A;  1BCO A;  3ZT4 A;  1NK7 A;  3VQC A;  2HVI A;  3KKS A;  1IKV A;  1CZB A;  1VSD A;  4E7L A;  4F3T A;  1UWB A;  4OKE A;  4CEO A;  4CJP A;  3HL8 A;  4KHY A;  4LY7 A;  4Z4E A;  1FKO A;  4CGJ A;  2YNI A;  3KK2 A;  4FLW A;  4KRF A;  1TAQ A;  2RF2 A;  5C25 A;  4BAC A;  4FM1 A;  1NK5 A;  1T05 A;  4CF8 A;  4B9S A;  3QEX A;  3DLB A;  1VSE A;  2ATQ A;  2QKK A;  4B9U A;  4FK0 A;  1RDA A;  4CER A;  3NE6 A;  2XY6 A;  4KHU A;  4OGE A;  3NDK A;  4FJ5 A;  5T7B A;  4DFM A;  4CES A;  3SUQ A;  4M3W A;  1WNS A;  3O4N A;  4CF0 A;  4KHQ A;  1TGO A;  3HPH A;  1RBR A;  3ALY A;  2FBV A;  4C8M A;  1TL3 A;  4BE2 A;  3RR8 A;  1YTA A;  1TKX A;  1WLJ A;  4CHY A;  2KZM A;  3OYJ A;  2HHS A;  3G10 A;  4CHN A;  4CK3 A;  3UIQ A;  4FVM A;  3L2U A;  3V9Z A;  4PY5 A;  4O5B A;  2HND A;  3HVR A;  3H08 A;  3M8Q A;  5HLF A;  3DI6 A;  1J9A A;  1JLA A;  3LP2 A;  1W9H A;  3SQ4 A;  1T03 A;  4Q0B A;  3IAY A;  5CYQ A;  1A5V A;  4ID1 A;  2B6A A;  1JXE A;  3VQP A;  1BI4 B;  2OPP A;  4HHT A;  3O3F A;  4B08 A;  4O55 A;  4M45 A;  1KRP A;  2YNH A;  2B5J A;  1NOY A;  1NK4 A;  1SV5 A;  1S1W A;  4NYN A;  1YVU A;  2X6S A;  4DSJ A;  4CGD A;  1LWF A;  1ZBF A;  2FBX A;  1HYV A;  2P51 A;  3CYM A;  3AO1 A;  2PYL A;  3DRR A;  3NGI A;  4B9N A;  3SI6 A;  2E4L A;  4C8K A;  3HXM A;  4OJR A;  4DQI A;  2YKM A;  4FJM A;  4HUE A;  4LH5 A;  4CE9 A;  3OS2 A;  4KPY A;  2KFZ A;  3K59 A;  3QIN A;  4N5S A;  4M3X A;  2OPS A;  5FDL A;  3QLH A;  4CF1 A;  4Q5V A;  3HO1 A;  3OYK A;  4E7J A;  3AA3 A;  1TL1 A;  1Y97 A;  4CEA A;  3KK3 A;  3WNG A;  4DTN A;  1VSK A;  3RWU A;  3KIO A;  1ASU A;  2G8U A;  3S9H A;  4FJJ A;  4CHO A;  3K5O A;  3L8B A;  4FJN A;  2LSN A;  3CG7 A;  4O4G A;  1FXX A;  1NJY A;  1EX4 A;  3TWH A;  4O0I A;  4ELT A;  1KLM A;  3QIP A;  3O4Q A;  3L2R A;  1U04 A;  1HQU A;  1LAV A;  4AHU A;  3OY9 A;  1D5A A;  4DSF A;  1TK5 A;  5J2M A;  3ZT1 A;  4FW2 A;  1C1B A;  1LW2 A;  1UAX A;  4DU3 A;  3SQ0 A;  3DLR A;  4FJL A;  1BI4 A;  3HT3 A;  4ELU A;  3ZT3 A;  1REV A;  4MQ3 A;  1RT1 A;  2Z1G A;  4AHC A;  2HHW A;  4CJK A;  1U45 A;  2QK9 A;  1TV6 A;  3NGY A;  2VWK A;  1L5U A;  1VSI A;  1JLG A;  4CED A;  3KD1 E;  4IG0 A;  1JLC A;  4IFY A;  4ZTF A;  4C8O A;  1UA1 A;  4I9Q A;  3TI0 A;  1JXB A;  1WSJ A;  3F73 A;  4F2R A;  1RT3 A;  1WSG A;  1VRU A;  2FBY A;  2HNZ A;  3QO9 A;  4OGC A;  3I8D A;  4JLH A;  4DTR A;  3PV8 A;  4Y1D A;  4CEE A;  4WE1 A;  4E0D A;  3AVN A;  5J2Q A;  2E6L A;  1U47 A;  2W42 A;  1QHT A;  4CEC A;  1JKH A;  4FJX A;  2HHT A;  3DLE A;  3EY1 A;  3B6O A;  5DK5 A;  1NOZ A;  4OLB A;  3LAM A;  4IG3 A;  1UOC A;  3SV4 A;  3LPT A;  3P1G A;  1GOC A;  3OYC A;  3SUN A;  4O0J A;  5CZ1 A;  1HQE A;  1BIZ A;  3VQ4 A;  1B9D A;  4B9M A;  4M42 A;  1SL1 A;  1N5Y A;  1S6Q A;  1QSS A;  2AJQ A;  1L3V A;  3K5L A;  3V1O A;  4EP4 A;  1RBV A;  4KFB A;  3HPO A;  3CFR A;  4B8A B;  1TKD A;  3L2V A;  1NJW A;  4BDZ A;  4DF8 A;  4N41 A;  2YV0 X;  1T7P A;  4B9L A;  3ZSQ A;  5K14 A;  3K5M A;  3PO4 A;  4LH4 A;  5EU7 A;  3ZT2 A;  4CFC A;  3QER A;  4N76 A;  1S1V A;  3PX0 A;  4KTQ A;  2KTQ A;  1LV5 A;  2IAJ A;  4CFD A;  4M3Z A;  2HB5 A;  1RTD A;  4CGH A;  1RTJ A;  4NCG A;  4OVL A;  4CF2 A;  3OYB A;  3DRP A;  4FLU A;  4J2E A;  1ZBH A;  1RT5 A;  4E19 A;  4E1M A;  4OPJ A;  4W5T A;  1QQC A;  4CIF A;  4FZY A;  3D45 A;  3L2W A;  4Z4G A;  4BE0 A;  1DTQ A;  1RT6 A;  1S1X A;  2EHG A;  4Z0U A;  4CJE A;  3NAE A;  3AVA A;  3SCX A;  1IKW A;  4DG1 A;  3V81 A;  1EP4 A;  2XRI A;  4YNQ A;  2P5G A;  4B3O A;  3TAF A;  3LP1 A;  1Z25 A;  4DTX A;  3AVL A;  3SJJ A;  1VSJ A;  4Y1C A;  1JLQ A;  2X78 A;  3LZJ A;  2OZM A;  4JRP A;  2BE2 A;  3PY8 A;  4KAZ A;  1C0T A;  3AVC A;  3RMB A;  4KTZ A;  2PYJ A;  5J2N A;  3BGR A;  4E7H A;  3MEC A;  3BDP A; 
#chains in the Genus database with same CATH topology
 4CJW A;  1A5X A;  4CD1 A;  4W5O A;  3M6G A;  1GLE G;  4NXM K;  3B8A X;  5M1N A;  2QW9 A;  4DMN A;  3VGK A;  5I42 A;  4KHS A;  2ASO A;  3CIP A;  3OYG A;  3P83 D;  2YCH A;  3KLH A;  1SUQ A;  3R9P A;  1ZYQ A;  3KLG A;  1CXU A;  4B3S K;  3IMX A;  4B9T A;  1JCF A;  3HM8 A;  3CHW A;  4QOZ B;  1XWL A;  2BUP A;  4KH4 A;  4CJQ A;  3TSU A;  4ZTJ A;  1K8K B;  2QA4 N;  1EQY A;  3T1H K;  3B6P A;  4JRQ A;  3NF9 A;  4CF9 A;  3OS1 A;  1NKB A;  1HNI A;  1BGX T;  3SBG A;  1JL2 A;  3U3G A;  4H5T A;  3SQ1 A;  3H1V X;  2D4W A;  1VQ9 N;  3AO3 A;  1NKE A;  4DFP A;  2NUB A;  3NGZ A;  2HHH K;  4K8Z A;  3RTV A;  3OYE A;  2B4J A;  1M1K O;  4M63 C;  4EHU A;  4FO0 A;  3C6T A;  2Y1J A;  4DU1 A;  4A5A A;  4BRM A;  4FLZ A;  3VN5 A;  2JLE A;  5CE3 A;  3AA2 A;  1IKY A;  1WSI A;  3OYA A;  3J81 O;  2V52 B;  5E26 A;  3SJH A;  5HRP A;  3KWI A;  4X65 K;  2P9L A;  3FZK A;  3TAR A;  1X9W A;  1U48 A;  5AQT A;  5AQY A;  1C0M A;  3T7Z A;  1VQ8 N;  4RCH A;  3TTD A;  2Q1N A;  2X6N A;  4GVE A;  1GLL O;  1C6V A;  2HVH A;  4BC4 A;  3QEW A;  4FZZ A;  4BRQ A;  3HOT A;  1JLF A;  4CEF A;  3TR8 A;  1IBK K;  1E4F T;  1RDU A;  3ZCM A;  4A2A A;  5M1K A;  2V7Y A;  4E1N A;  1QQM A;  3QML A;  4JKG B;  3RRH A;  4F3O A;  3AGK A;  3DLK A;  4EP5 A;  1IKX A;  5LL6 Z;  2R7Y A;  3MXJ A;  1IG8 A;  1MA9 B;  1VSM A;  3DOL A;  2HBM A;  1O1W A;  3CCQ N;  2D0B A;  2KQ2 A;  4B1U B;  1WSE A;  5LY3 A;  2ETJ A;  1GLJ O;  2ZE2 A;  3L3V A;  3PIO L;  1VQO N;  3ZX3 A;  3MX5 A;  3CCV N;  2D0P A;  4I6M A;  4NXN K;  5C10 A;  2G8W A;  3H6E A;  1MWM A;  3ZEU B;  3CCL N;  3DLG A;  2G8K A;  4CGG A;  3VQD A;  4CEQ A;  1VSH A;  4O5F A;  2X74 A;  3V4I A;  2VGM A;  5AQS A;  3WNE A;  4FCY A;  1KVB A;  2F9T A;  4H4M A;  4CEZ A;  3O80 A;  5EOY A;  4CJL A;  2IVP A;  2HHQ A;  1JL1 A;  3KLF A;  1N36 K;  5AQX A;  3LM2 A;  5BR9 A;  1IH7 A;  4HTL A;  3TSQ A;  3A5L C;  1VAZ A;  3IS9 A;  3VQ8 A;  1X9S A;  1TYQ B;  3DM2 A;  1EO1 A;  3E66 A;  3QFP A;  3BUZ B;  2FLO A;  4DLE A;  2QTD A;  4LFA K;  4JKF A;  4H0P A;  1GOA A;  1WBD A;  2Z1I A;  3T1A A;  3WXK A;  4BRO A;  4G9Z A;  4ISF A;  2VQF K;  3A0I X;  3LAN A;  3VEO A;  4CJT A;  3E01 A;  3DLH A;  4FLT A;  3VQE A;  4CJ4 A;  3ID6 A;  3T69 A;  3UKU B;  1HX1 A;  2VQE K;  4CGF A;  3D2F A;  1CXQ A;  2E2P A;  5I3U A;  3SNN A;  3NH1 A;  3SPZ A;  3TAB A;  1RGI A;  4FWO A;  3S3O A;  1G99 A;  5KRT A;  5J1E A;  3HPG A;  2D1K A;  3OJU A;  1D9F A;  1BWF O;  4EFH A;  3TAE A;  4M41 A;  3BY5 A;  3SQ2 A;  2O8B B;  4DWI A;  5CY4 A;  2P9P A;  3ATU A;  1ZC6 A;  3C6U A;  4KKO A;  4W5Q A;  4DQQ A;  2RN2 A;  4BRA A;  3OVN A;  3SBT A;  4KB1 A;  4B9V A;  2DFE A;  3QIO A;  4Z4H A;  4RW6 A;  1VSL A;  2BGG A;  3F9M A;  4DQP A;  2CH6 A;  4L3Q A;  2HMP A;  2QWO A;  1EKE A;  3H46 O;  5AFU H;  3V6D A;  2P9S A;  3AA5 X;  4CCH A;  2FSK A;  2DTU A;  3AVJ A;  4NYF A;  2NRX A;  1BDG A;  3DJC A;  4DR4 K;  3F5T A;  4F2S A;  3OS0 A;  1FK9 A;  4QS7 A;  4JI4 K;  2Q31 A;  4J2D A;  1I39 A;  3G71 N;  3LZI A;  1NU0 A;  2W41 A;  4CZI A;  3HVT A;  5EY4 A;  4BRI A;  5TKW A;  4DSL A;  2GUI A;  3CPW M;  3OYM A;  3K0S A;  1HUX A;  4A62 A;  2P9N A;  2VG5 A;  1TUY A;  2W40 A;  3PSF A;  5JIC A;  5KGX A;  4KI6 A;  2GX9 A;  4IJA A;  1BCM A;  3NCI A;  4BDY A;  2GEL A;  3ENH A;  3FE1 A;  3LAL A;  2G8F A;  2IDO A;  4BRL A;  5AQO A;  1RDD A;  4YFU A;  2UXD K;  4IKF A;  4BE1 A;  1G15 A;  1QTM A;  4B8C A;  4BRP A;  4IXC A;  5MLC Q;  3L3U A;  2D0A A;  4CHP A;  2E2Q A;  2IOC A;  1GLD G;  3MCA B;  1NJZ A;  1JLE A;  3CI5 A;  3QDK A;  1LWC A;  5SZT A;  5JVH L;  3KD5 E;  2OA8 A;  2VGN A;  4CHQ A;  3VER A;  3DOK A;  1BCO A;  1NBW A;  3VQC A;  3BZC A;  4E7L A;  1UWB A;  1MWK A;  3LL3 A;  3VEX A;  2P9U A;  4CF8 A;  4M3U A;  3QEX A;  1VSE A;  2QKK A;  2XY6 A;  1YIT N;  1M90 O;  4FJ5 A;  4M3W A;  4CES A;  3SUQ A;  3CJ1 A;  4KHQ A;  1TGO A;  3EEQ A;  4C8M A;  1TL3 A;  4NO7 A;  1TKX A;  1KD1 O;  1K8A O;  2HHS A;  3M1F A;  4FVM A;  3V9Z A;  1Q18 A;  3HVR A;  3H08 A;  5LMU K;  2P9K B;  5HLF A;  3DI6 A;  3SQ4 A;  4FSV A;  4HHT A;  1BI4 B;  3LDL A;  3RSE B;  1KXP A;  3GBT A;  2QWM A;  4CGD A;  1LWF A;  2O8D B;  2F9W A;  3AO1 A;  3NGI A;  1SZ2 A;  3OS2 A;  1Y64 A;  4H0T B;  4N5S A;  4M3X A;  2OPS A;  3HO1 A;  4CEA A;  4DTN A;  3KIO A;  1ASU A;  5BPM A;  3S9H A;  3O9U A;  2NRW A;  3K5O A;  2AP1 A;  3CG7 A;  4ISE A;  3CCE N;  4BRC A;  4O4G A;  1NJY A;  5KPT A;  4O0I A;  1LAV A;  4DSF A;  1D5A A;  1ZBS A;  4CBW A;  5A2Q O;  1NM1 A;  3SAH A;  3BF3 A;  4JKC A;  3ZT3 A;  3CCJ N;  1RT1 A;  1NGB A;  2FF6 A;  2Z1G A;  4CJK A;  1U45 A;  5GAG P;  1Q86 O;  2QK9 A;  1TV6 A;  2NNW A;  1JLG A;  3KD1 E;  1K73 O;  1JCE A;  4C8O A;  4I9Q A;  1WSJ A;  2A6A A;  1RT3 A;  1VRU A;  2FBY A;  3QO9 A;  2KZM A;  5EXW A;  4BR9 A;  5J2Q A;  4CEC A;  1JKH A;  3W3D A;  4WCE L;  1HPM A;  1NOZ A;  1OH5 A;  3LAM A;  3SV4 A;  3OYC A;  5CZ1 A;  3K9J A;  4XH1 A;  3VQ4 A;  4B9M A;  3MN9 A;  1SL1 A;  5F1X A;  5GIN A;  3O9T A;  1YF5 L;  4JI2 K;  3L4I A;  3E9P A;  4DB3 A;  3CFR A;  4CI6 A;  4N41 A;  1H1V A;  3ZSQ A;  5EU7 A;  3QER A;  1J5E K;  1VQM N;  4N76 A;  4KTQ A;  2IAJ A;  2HB5 A;  1RTJ A;  5GAE P;  1ZBH A;  4W5T A;  3MN6 A;  3LDO A;  4E19 A;  1QQC A;  4CIF A;  3LDQ A;  1RT6 A;  4Z0U A;  4CJE A;  3NAE A;  3AVA A;  4CZG A;  3V81 A;  3F2K A;  3IKM A;  4PKG A;  1Z25 A;  3SJJ A;  4MLH A;  2VYP A;  3PY8 A;  4KAZ A;  1HKB A;  3AVC A;  3H3O B;  3RMB A;  2PYJ A;  3BGR A;  3VF2 A;  3L4Q A;  5F2R A;  3J7Z O;  2ASM A;  2JWK A;  1BQN A;  4E89 A;  1ASW A;  3PUF A;  2V51 B;  1E4G T;  3I0S A;  2YHA A;  4CJ7 A;  4FJK A;  3U9D A;  3ZSO A;  2E2N A;  5SWM A;  2IGI A;  1RDB A;  4BC3 A;  4WFB L;  1J5O A;  4DTM A;  3NF6 A;  4LSL A;  1YJN N;  2OTL N;  2QEX N;  3VQ7 A;  4BDP A;  1U6Z A;  2GUP A;  4KB0 A;  4LSN A;  1RDW X;  4A5B A;  5HP1 A;  5M1P A;  3IG1 A;  4JK8 A;  1QSL A;  3PSI A;  4FWR A;  4Z4I A;  3EKU A;  2IVO A;  4LD0 A;  1ATR A;  1NGG A;  3UKR B;  4AF1 A;  4CJ5 A;  3EYZ A;  3CET A;  1W2B M;  1GLC G;  3AO4 A;  3S3M A;  4OLA A;  4BR0 A;  4DHY A;  1VSF A;  3ZSV A;  3RMC A;  4PWD A;  4LFB K;  4RW7 A;  1ZBL A;  4KBO A;  1ZXO A;  5AZI B;  1P8Z A;  4FWN A;  3VQB A;  2GWK A;  4PA1 A;  1TAU A;  3KK7 A;  4CFA A;  1KSP A;  1QSY A;  4H4O A;  4FLV A;  1K8K A;  2QWN A;  4G1Q A;  4XH4 A;  3OYI A;  2A40 A;  1X1P A;  4DR5 K;  1RT7 A;  1ZBI A;  3JSM A;  2KW4 A;  4JYA K;  3CJB A;  3ZX2 A;  1KVC A;  3U6F A;  1OH6 A;  4UY8 O;  3CM6 A;  1QQN A;  5KPR A;  1RTI A;  2OYQ A;  4M3T A;  4JS5 A;  2XHB A;  2ZGZ A;  3CQY A;  2F8S A;  1SAZ A;  4F9O A;  4KO0 A;  2VWJ A;  1KLN A;  3DXK B;  1HMV A;  2RKI A;  2KZZ A;  5C2D A;  4EZ9 A;  4BRE A;  2YNG A;  3V1Q A;  1WN7 A;  2O4G A;  4ICL A;  4AHT A;  3RMA A;  3I0R A;  1Q7Y O;  1DEJ A;  4DQR A;  3WEE B;  3QNN A;  4CJ3 A;  2FC0 A;  2HHV A;  5CR4 A;  1XHX A;  5ELZ A;  2UU9 K;  3VF6 A;  5JS1 A;  4FK2 A;  4DQ8 A;  4FM0 A;  1YAG A;  5BPL A;  4DUZ K;  4KTW A;  5C24 A;  1NNE A;  1DKG D;  3VTI A;  1HNW K;  1HNX K;  2PFU A;  2F8T A;  4WQ5 A;  1IBL K;  3SYZ A;  4LF7 K;  4DSI A;  3K58 A;  4BC2 A;  4EAH D;  3V9W A;  4GKJ K;  3ZX0 A;  2CGL A;  2RPI A;  1HJR A;  1NGA A;  4AH9 A;  3TTC A;  4DKW A;  1XHZ A;  2E1Y A;  4DV6 K;  1L3T A;  3AAR A;  1WAJ A;  4WQ4 C;  4E1J A;  3HJF A;  4FK4 A;  3THY A;  2I7N A;  5CYM A;  1U4B A;  2P5O A;  4IEE A;  3NBP A;  2XO7 A;  3K5N A;  2ZGY A;  3P5J A;  2WC9 A;  2F7T A;  2QXF A;  4B1Z A;  3ZSY A;  5BPN A;  3ISN C;  3O6W A;  1ZBU A;  1N6Q A;  1RIL A;  1NK0 A;  3OA9 A;  1TYQ A;  4M3R A;  4I7F A;  1P90 A;  4AQY K;  3TAN A;  5AQN A;  4EZ6 A;  3MED A;  1SL0 A;  1NK9 A;  1Q9X A;  1FKP A;  2CGJ A;  4FJH A;  3U8X A;  4CHZ A;  1Q8I A;  1SKW A;  3CJ7 A;  4FJG A;  3VQ6 A;  3KLE A;  2ZM6 K;  3UKU A;  4GV9 A;  1RBU A;  3S3N A;  2OZS A;  4B1V A;  4F4K A;  3SAF A;  3A2F A;  4IBN A;  1KAY A;  4GVM A;  4H03 B;  1RT2 A;  4JD2 A;  4F8R A;  3O9R A;  1S9G A;  1BOT O;  2I5J A;  4H5W A;  3WNH A;  3MWT A;  4HCC A;  4IJN A;  3A5N C;  1W0H A;  2O8B A;  4CBU A;  5FPM A;  3QET A;  1WSF A;  4PL8 A;  1OVY A;  2QM1 A;  4OKJ A;  3ZSZ A;  3HZ6 A;  4H5R A;  4NCA A;  5FPN A;  3MXM A;  3VQQ A;  1D8Y A;  3CD6 N;  4FJ7 A;  4R5P A;  2JWL A;  4FXD A;  5E41 A;  4QS9 A;  1HYS A;  1KVA A;  5LJV A;  3J7Y P;  4I9L A;  2YKN A;  3KHY A;  1LOT B;  4HTU A;  3DXM B;  1NJX A;  3LP3 A;  3VQ5 A;  4FM2 A;  1B92 A;  1A5W A;  1J6Z A;  1NK6 A;  1IO2 A;  4AHS A;  4BR2 A;  5HBM A;  3TAP A;  3QEV A;  4H0V B;  1R0A A;  4KV8 A;  5AZJ B;  4FL9 A;  4CJV A;  1GLA G;  1TK0 A;  3HM9 A;  4GY2 B;  4DFJ A;  4OPA A;  4CJU A;  3T3F A;  3ZET A;  2P9I B;  3WXI A;  1K6Y A;  1YVN A;  2A1S A;  2O8C B;  3AA4 A;  1KC8 O;  3QEP A;  2YJE A;  4E7K A;  3TSP A;  3LWM A;  3MEE A;  4H5N A;  2FF3 B;  3WXJ A;  1VSD A;  1K9M O;  4CEO A;  3HL8 A;  3FZF A;  4LY7 A;  3KK2 A;  4KRF A;  1TAQ A;  2RE2 A;  5C25 A;  1T05 A;  4B9U A;  1Q81 O;  4KHU A;  4OGE A;  3NDK A;  3U4L A;  1C0F A;  4DFM A;  3O4N A;  5C15 A;  4CF0 A;  3ALY A;  4BRH A;  4CZJ A;  4JI8 K;  4K42 A;  2NRR A;  4CHY A;  3OYJ A;  3L2U A;  2O8F B;  3GOI A;  4FPA A;  1JLA A;  4B1W B;  1JJ2 M;  1A5V A;  4ID1 A;  3O3F A;  2ITM A;  1NOY A;  1S1W A;  4NYN A;  1YVU A;  1ZBF A;  1HYV A;  2PYL A;  4B9N A;  3DRR A;  4FJM A;  3EKS A;  4DQI A;  4OJR A;  2YKM A;  2VWB A;  5AQR A;  3OW2 M;  1V4T A;  4YOW A;  5FDL A;  3QLH A;  4A59 A;  1Z6R A;  3WT0 A;  3AA3 A;  3C6A A;  1TL1 A;  3KK3 A;  4FOE A;  1VSK A;  3M3Z A;  2G8U A;  4JI0 K;  1NGH A;  4GNI A;  4FJN A;  3D6R A;  3N4Q A;  3G6E N;  3O4Q A;  2CGK A;  1U04 A;  2OTJ N;  2P9K A;  5J2M A;  3ZT1 A;  4FW2 A;  3NVK A;  1LW2 A;  1UAX A;  4YOR A;  4DU3 A;  4FJL A;  1BI4 A;  2HF3 A;  4ELU A;  4R79 A;  3RSE A;  4AHC A;  4HWI A;  1Z05 A;  2VWK A;  1L5U A;  1VSI A;  1W7A A;  2O8D A;  3TI0 A;  3F73 A;  4F2R A;  1WSG A;  3I8D A;  3PV8 A;  3C7N B;  4WFN L;  2I7P A;  3AVN A;  1U47 A;  5BRH A;  2W42 A;  3OTO K;  3EN9 A;  4B1Y B;  2HHT A;  5AQW A;  2D0O A;  2QWL A;  3ZYY X;  1S72 N;  1LCU A;  2NRV A;  2BTF A;  5DK5 A;  1T44 A;  1W97 L;  4OLB A;  4IFE A;  3UB5 A;  4O8U A;  3LPT A;  1XUP O;  3P1G A;  4O0J A;  2HST A;  4XH5 A;  2IIR A;  1S6Q A;  3O5B A;  2WUS A;  2AJQ A;  3HPO A;  2ZWH A;  1TKD A;  1NJW A;  4U7B A;  4DF8 A;  1O13 A;  4XEI A;  4B9L A;  3PO4 A;  2A5X A;  3CPE A;  2QWR A;  1S1V A;  3JAM O;  4DUY K;  3PX0 A;  4CFD A;  4M3Z A;  3MWP A;  3I33 A;  1RT5 A;  4E1M A;  4Z4G A;  3H1Q A;  2EHG A;  3VMF B;  2HBL A;  2P5G A;  4DG1 A;  3L6Q A;  2XRI A;  1N32 K;  5BRD A;  4Y1C A;  3Q7C A;  4JRP A;  3MN7 A;  5J2N A;  2GEM A;  3AVF A;  3AY9 A;  3VEW A;  4LF6 K;  4DQS A;  5C42 A;  2QWQ A;  5BRE A;  1S5J A;  1ATN A;  4JKH A;  2WBN A;  2DY4 A;  4ISG A;  3C65 A;  1SKR A;  3R3L A;  1CLQ A;  3NFA A;  1NKC A;  1LWE A;  4HVJ A;  1C1C A;  3TAG A;  3GL1 A;  3DRS A;  4HUF A;  2A1R A;  4BR5 A;  4IOC L;  4CIE A;  1NK8 A;  1NMN A;  3MAQ A;  3I55 N;  1GLF O;  2UXB K;  1VQN N;  4MDA A;  3VES A;  3RVC A;  5AQJ A;  3E9O A;  4DR7 K;  3K2P A;  5FRO A;  4EIA A;  4OPH A;  3ULE B;  1YUW A;  1BHL A;  1D9D A;  1C1A A;  3GE1 A;  4DTU A;  5HL7 L;  4CK2 A;  1SL2 A;  1I3A A;  2YX6 A;  2Y1I A;  4DV2 K;  3PIP L;  4IO9 L;  2RHK A;  4JHD B;  2E6M A;  3O3G A;  5KRS A;  1TVR A;  5AQV A;  1YJW N;  1L3S A;  1MDU B;  3OYH A;  3LDS A;  3E1Y A;  3CCU N;  3RRG A;  2E1Z A;  1T3V A;  3UKR A;  4X64 K;  3N4P A;  3D2E B;  4GW6 A;  4CJR A;  1ASV A;  3O9Q A;  3VEZ A;  4BGA A;  5AQG A;  5J2P A;  4IZ9 A;  3RR7 A;  1U2V B;  1LAW A;  4M7X A;  4IEI A;  1J54 A;  1BO5 O;  3LWL A;  3CCS N;  3GDQ A;  2HHU A;  1QZ6 A;  1NGD A;  4CZL A;  2QI2 A;  1DT9 A;  3D0P A;  2ZF5 O;  5CHI A;  3KJV A;  3J8A A;  4DR3 K;  2FSJ A;  3CCM N;  1S22 A;  3T19 A;  4DR1 K;  3H45 C;  4O44 A;  1NGI A;  4N56 A;  5KI6 A;  1JLB A;  4MFB A;  2HMI A;  3OYD A;  1CZA N;  4GV3 A;  3M8R A;  3AVM A;  1BL3 A;  4OO1 J;  1U49 A;  3BP8 A;  4JK9 A;  4ZHR A;  4QS8 A;  2ZJP L;  3WXL A;  2YHX A;  5C0Y A;  3ENB A;  3HP6 A;  2ITG A;  4FYD A;  3OHR A;  4PL7 A;  3K57 A;  4Z4C A;  4DSE A;  4LF9 K;  2IS3 A;  1ITG A;  3FGU A;  3CM5 A;  2FBT A;  4NB4 A;  3L2Q A;  1UA0 A;  3PLA A;  1E3M A;  3AV9 A;  5IT9 O;  4L8R B;  4LF5 K;  3WEE A;  3SAG A;  4YOV A;  4BRK A;  4RW4 A;  4YDU C;  3WUH A;  3IDH A;  1TK8 A;  1CZ9 A;  5FRM A;  3DMJ A;  1VQ6 N;  4BQL A;  2BDP A;  3AVG A;  4WYB A;  5JVG L;  2EX3 A;  3CCR N;  3OJS A;  5AR0 A;  1WBB A;  2YHB A;  3MX2 A;  2FSN A;  4CJS A;  1WSH A;  2F96 A;  4FJ8 A;  3CC4 N;  4BWM A;  3O08 A;  3IRX A;  3QB0 A;  1NGF A;  4C8N A;  3VEY A;  4AM6 A;  4DTJ A;  2ZQB A;  4C1N I;  3F9K A;  4I2Q A;  1TKT A;  5HRS A;  4YOT A;  3PX6 A;  3OBW A;  1RFQ A;  1BIS A;  1IJJ A;  3G0Z A;  4FWP A;  5AQF A;  4BQZ A;  4CK1 A;  4OX9 K;  1HYZ A;  4IDH A;  3VQA A;  4AHV A;  2BAN A;  3KKR A;  1KFD A;  3ENO A;  1QHA A;  3MN5 A;  5CZ2 A;  4NLC A;  4BR7 A;  1C0U A;  2ZD1 A;  1J53 A;  1HKG A;  1LW0 A;  4AHR A;  4A61 A;  3NF7 A;  1KFS A;  1KAX A;  1S6P A;  3TU5 A;  3CFO A;  4BWJ A;  3SV3 A;  2XY5 A;  3RMD A;  3HSC A;  5JS2 A;  4CZH A;  5DMR A;  4GMJ B;  3R8E A;  3C95 A;  2J4R A;  2Q97 A;  4O8K A;  3WNF A;  4FW1 A;  4BRF A;  3CFP A;  1Q9Y A;  4OPK A;  2Z1H A;  4JI3 K;  2GWJ A;  4FZX C;  3O1W A;  4J2B A;  4C8L A;  4RW8 A;  1KAZ A;  1BIU A;  1QVG M;  4JI7 K;  3OYL A;  4E3S A;  2JGU A;  4HUG A;  4QCL A;  4ILJ A;  3CMA N;  1RCH A;  1TKZ A;  5FPD A;  2OPQ A;  4RTF D;  5AQH A;  4W5N A;  4NLB A;  1QZ5 A;  3IFR A;  3G25 A;  4CW7 B;  4DR2 K;  2VG7 A;  2PBD A;  3DLL L;  3M8P A;  1DGK N;  3LP0 A;  1NG9 A;  3QES A;  2O8E B;  1F21 A;  3VQ9 A;  3Q7B A;  1Z26 A;  2VG6 A;  5AQZ A;  1XNR K;  2GTD A;  4XIU A;  3NH2 A;  3C0B A;  3VA3 A;  3HK2 A;  3LM9 A;  4CZE A;  3KTQ A;  2ZJQ L;  4CEB A;  4JI1 K;  2Q0U A;  4JKG A;  3NH0 A;  3EL2 A;  4UQG A;  2O4I A;  3PO5 A;  3MCP A;  1X3M A;  2OCE A;  1Q82 O;  5M1O A;  4BR4 A;  3TAQ A;  1SKS A;  1KTQ A;  5F0X A;  4FWL A;  4BRD A;  1HPZ A;  4JS4 A;  2DFH A;  4FJI A;  2OAN A;  3AGR A;  3ZT4 A;  1C0G A;  1VQL N;  4F3T A;  3P39 A;  3DXM A;  3HI0 A;  4CJP A;  4DV7 K;  3DAW A;  4Z4E A;  4CGJ A;  2YNI A;  3DWL A;  4FLW A;  3ZEU A;  4BAC A;  4B9S A;  4FK0 A;  3NE6 A;  3SMS A;  5T7B A;  3O8M A;  4YDU A;  1WNS A;  5AZJ A;  3HPH A;  4BE2 A;  4M7Y A;  3A5O C;  1NMD A;  1QQO A;  2H3G X;  3UIQ A;  4PY5 A;  2KHO A;  4O5B A;  5JLF A;  2F4V K;  1S3X A;  1J9A A;  3LP2 A;  2P9I A;  5CYQ A;  4EHT A;  2O8C A;  4KH6 A;  4M45 A;  1BA0 A;  4GV6 A;  1SV5 A;  3R1X A;  2X6S A;  4DSJ A;  2FBX A;  3BZK A;  4PQU A;  5M1Q A;  3SI6 A;  3HXM A;  4JKA A;  4JNE A;  3THW B;  4HUE A;  4KPY A;  2KFZ A;  2NRT A;  3MDQ A;  4PKI A;  4E7J A;  3WNG A;  3THX B;  4LFC K;  3RWU A;  4MO5 A;  4FJJ A;  3VGL A;  4JI5 K;  1FXX A;  2QXL A;  1EX4 A;  2Q0R A;  4ELT A;  4C23 A;  1D4X A;  3HBT A;  4ILH A;  2O8F A;  4AHU A;  4J8F A;  3OY9 A;  1XMQ K;  1BUP A;  1TK5 A;  1C1B A;  1VQP N;  3DLR A;  2FXU A;  3HT3 A;  4MQ3 A;  1OH8 A;  2HHW A;  1NGE A;  2E8A A;  4DV1 K;  4C1N K;  4IG0 A;  1JLC A;  4IFY A;  3EE8 A;  3QBX A;  4DTR A;  4OGC A;  4Y1D A;  4CEE A;  4WE1 A;  4LF4 K;  5AQL A;  1QHT A;  4FJX A;  3CC2 N;  3VGM A;  3B6O A;  1ESV A;  1UOC A;  4JEP A;  1HR0 K;  1GOC A;  1TUU A;  1I94 K;  5JMV A;  2A3Z A;  4M42 A;  1NGJ A;  4K43 A;  1N5Y A;  1NGC A;  1WUA A;  2HBJ A;  1QSS A;  3I56 N;  1L3V A;  3K5L A;  4KFB A;  4B8A B;  5LJW A;  3L2V A;  3A5M C;  2YV0 X;  1R59 O;  2W6K A;  4LH4 A;  4Z94 A;  4CFC A;  3BF1 A;  2ASP A;  2KTQ A;  1OKJ A;  1LV5 A;  5EVZ A;  1HNZ K;  3C7N A;  4NCG A;  4OVL A;  3SK3 A;  3OYB A;  3THY B;  3DRP A;  4FLU A;  4J2E A;  4OPJ A;  5AQP A;  4FZY A;  3D45 A;  3L2W A;  3EE9 A;  3HRG A;  5KPZ A;  1DTQ A;  2YI1 A;  3SCX A;  4B3O A;  1VQK N;  1EP4 A;  4YNQ A;  3TTF A;  3TAF A;  4DTX A;  3LZJ A;  3TPQ A;  1C0T A;  3CC7 N;  1IV0 A;  1GOB A;  4A2B A;  1N34 K;  4DU4 A;  4AIL C;  4PKH A;  5M1F A;  3ZSW A;  5I9E B;  4IFV A;  5KGW A;  4WQ4 A;  3CER A;  3M8S A;  1HKC A;  3EO3 A;  2HF4 A;  4GKK K;  5ADX A;  2A41 A;  5BN9 A;  5DM6 L;  1BQM A;  3W0L A;  4CJF A;  1RTH A;  4CZK A;  5FPE A;  4DTO A;  4HCB A;  1XNQ K;  2CH5 A;  3VTH A;  4WF9 L;  3KVG A;  1YJ9 N;  3VOV A;  2WFB A;  3P4I A;  3OBY A;  3O4W A;  4FLX A;  1YIJ N;  2OPR A;  3JYT A;  1IG9 A;  2YHW A;  5KTQ A;  3SZ2 A;  1NJI O;  3V9S A;  2P9L B;  3CME N;  1SQK A;  4CBX A;  1EXQ A;  3HOS A;  2XY7 A;  1OVQ A;  2V7Z A;  4BG8 A;  4JD2 B;  3KLI A;  2GV9 A;  3ASM A;  2UXC K;  3HST B;  4DV5 K;  3ZSR A;  1HRH A;  2HBK A;  3FZL A;  4IDK A;  2Z1J A;  4YHH K;  2HHX A;  2G8H A;  3QBW A;  3AAP A;  4K0K K;  4BGB A;  3AVI A;  2P1J A;  3MXI A;  4M3Y A;  4BC5 A;  2PY5 A;  1RT4 A;  2E2O A;  1L3U A;  5HRR A;  3QNO A;  5GAH P;  1YXQ A;  3K9K A;  4TSX A;  4DF4 A;  3ZT0 A;  4DS4 A;  4K41 A;  4RWT A;  4IOX A;  5C2F A;  4I6M B;  4MO4 A;  4B1X B;  3OYN A;  1RBT A;  3O1B A;  1KCF A;  1S9E A;  3EZ5 A;  3V9U A;  3UE5 A;  2D0C A;  4KHP K;  3V9X A;  4JI6 K;  2QKB A;  2QWP A;  4RG8 A;  1XI1 A;  3HYF A;  4BRN A;  3D7E O;  5TKY A;  3QEI A;  4H0Y B;  4B9Q A;  5EX5 A;  3VEN A;  4B3T K;  1FJG K;  1BA1 A;  4JV5 K;  3KZB A;  3ZET B;  3FZH A;  3R6M A;  3ULE A;  5FRN A;  2Q3S A;  2W6L A;  4RW9 A;  4CIG A;  3OYF A;  2YNF A;  5AQQ A;  4DLG A;  2DPN A;  4DTS A;  2YJF A;  1YHQ N;  3HTV A;  4KH5 A;  4CZM A;  3GG4 A;  3KWG A;  3AVB A;  4JHD A;  2G8V A;  2NRH A;  3O3H A;  4JK7 A;  4CZF A;  3V1R A;  3VA0 A;  5B8H A;  1B9F A;  5D3G A;  1FW6 A;  4ID5 A;  3D2F B;  1VK0 A;  1VQ4 N;  5AQK A;  2DFF A;  3D2E A;  4H5V A;  3KK1 A;  4KHW A;  1U2V A;  3J7A P;  2E88 A;  3EZW A;  2NRZ A;  3ATV A;  4DFK A;  1X9J A;  4Y0W A;  1DLO A;  1S1U A;  4H0O A;  3AO5 A;  4FWQ A;  3CJC A;  2Q2R A;  2P9P B;  5H1S Q;  4PUO A;  4YOX A;  5HRN A;  2KLA A;  4FLY A;  4FJ9 A;  3AO2 A;  4E7I A;  3SUO A;  3T1Y K;  1HNV A;  4H8K A;  1VQ7 N;  5BRF A;  1BU6 O;  1HLU A;  1EWQ A;  3CJA A;  3FLC O;  2P9S B;  3THV A;  3U9Z A;  1WB9 A;  5KQD A;  4W5R A;  1JCG A;  3WXM B;  4J2A A;  2KFN A;  1DTT A;  3BEX A;  3TAM A;  3J80 O;  3VEV A;  3A8Y A;  1EET A;  4IWV A;  2KKZ A;  5HRO A;  3NVM A;  5DM7 L;  1RDC A;  4OKK A;  3P38 A;  4FVU A;  2YHY A;  1N33 K;  3PX4 A;  3AVK A;  4K8X A;  1NLV A;  2HW3 A;  4FOI A;  3NHG A;  4JKB A;  4CGI A;  5GIO A;  3CQ8 A;  4CFB A;  1SS6 A;  3ZLJ A;  2P9N B;  1X3N A;  4H0X B;  4DR6 K;  2E20 A;  2Q36 A;  1GLB G;  5E84 A;  3LAK A;  3DYA A;  1VRT A;  2XY8 A;  4FWK A;  4Z4F A;  4I2P A;  3O9S A;  4B3R K;  4DSK A;  4DV0 K;  1QS4 A;  2IVN A;  2UYT A;  1KQS M;  4AM7 A;  2HNY A;  1QVF M;  3NF8 A;  4IOA L;  4B3M K;  5AZI A;  3QFU A;  4BVO A;  2PZS A;  1YT3 A;  3FFI A;  3C94 A;  4ELV A;  4N47 A;  5GAD P;  3MEG A;  1BG3 A;  3SMP A;  2IC3 A;  4DTP A;  1RNH A;  3I8B A;  4DS5 A;  3SUP A;  1YTU A;  2G8I A;  3SPY A;  2PAV A;  5C12 A;  4BVP A;  4KI4 A;  4NCB A;  3E9L A;  4MLE A;  4KHN A;  4JKE A;  3LPU A;  3U3Y A;  5GIP A;  3HP9 A;  2P9U B;  1VHX A;  2VCP A;  2WON A;  1XC9 A;  1XC3 A;  2NLX A;  2AA4 A;  3AVH A;  4ILG B;  4IO8 A;  2D5R A;  3VET A;  1RBS A;  1X9M A;  1V4S A;  1T8E A;  1XQS C;  4A57 A;  3H3N O;  3M5R A;  2GBZ A;  3DXK A;  4KRE A;  3ITH A;  1MU2 A;  3WQU A;  2WOM A;  3ULD A;  3ZSX A;  4K25 A;  4QAG A;  1IBM K;  1WAF A;  4WQ5 C;  2E5L K;  1S1T A;  1QE1 A;  5ADX H;  2WTU A;  1NK7 A;  2HVI A;  3KKS A;  1IKV A;  1CZB A;  2A42 A;  1T6C A;  2UUA K;  4OKE A;  4BRG A;  5JLH A;  4KHY A;  1FKO A;  1ATS A;  2RF2 A;  2O8E A;  4FM1 A;  3LDN A;  1NK5 A;  3DLB A;  2ATQ A;  3CJ9 A;  4V19 S;  1RDA A;  4CER A;  5BR8 K;  4LF8 K;  3QIC A;  4JN4 A;  1RBR A;  3CF5 L;  2FBV A;  1HJO A;  3RR8 A;  3FZM A;  1YTA A;  1WLJ A;  3C6H A;  4MDB A;  4BY9 C;  3G10 A;  4CHN A;  4CK3 A;  4FWS A;  5BN8 A;  2HND A;  3M8Q A;  1T03 A;  4Q0B A;  1W9H A;  2ZJR L;  1YI2 N;  3IAY A;  2B6A A;  1JXE A;  3VQP A;  2OPP A;  1KRP A;  4B08 A;  4O55 A;  1XMO K;  3SLC A;  1N8R O;  2YNH A;  2B5J A;  5IWA K;  3FFK B;  3CXC M;  1NK4 A;  2UUC K;  2BH1 A;  3JS6 A;  3JXU A;  1T6D A;  3CYM A;  2P51 A;  4C8K A;  2E4L A;  4LH5 A;  4CE9 A;  3K59 A;  3QIN A;  1WOQ A;  4CF1 A;  3L0Q A;  4Q5V A;  3OYK A;  2NZT A;  1NWK A;  1Y97 A;  1VQ5 N;  4YOY A;  3MK6 A;  4CHO A;  3L8B A;  2UUB K;  2LSN A;  3MMV A;  3TWH A;  1KLM A;  3QIP A;  4CD3 A;  3ID8 A;  3L2R A;  5AQM A;  1HQU A;  3S41 A;  4DV4 K;  3SQ0 A;  1REV A;  4FPB A;  3NMU A;  3CQX A;  3NGY A;  4DV3 K;  4X62 K;  3AAQ A;  4CED A;  4FWM A;  4YY3 K;  4X66 K;  4ZTF A;  1ILY A;  1UA1 A;  1JXB A;  5AFU A;  3THW A;  2HNZ A;  4JLH A;  4E0D A;  2E6L A;  4DCH A;  3DLE A;  3THX A;  1OH7 A;  3EY1 A;  4LC9 B;  5HOO A;  4IG3 A;  3VF4 A;  4JAX A;  2EWS A;  3SUN A;  1HQE A;  1BIZ A;  1B9D A;  4U67 L;  2HOE A;  3LDP A;  1EWR A;  4CVN E;  4PHT X;  4JKD A;  3P31 A;  3V1O A;  4BG9 A;  4EP4 A;  1RBV A;  4BDZ A;  1T7P A;  5K14 A;  3K5M A;  5FLX O;  3ZT2 A;  5KQ8 A;  3IUC A;  4YOU A;  3WQT A;  1RTD A;  4CGH A;  4CF2 A;  4WFA L;  5AJ3 K;  5AQI A;  4BE0 A;  1S1X A;  1IKW A;  3VPZ A;  3LP1 A;  3AVL A;  5LMN K;  1VSJ A;  1JLQ A;  2X78 A;  2OZM A;  2BE2 A;  3FR0 A;  5AQU A;  4KTZ A;  4E7H A;  3MEC A;  3G4S N;  3BDP A; 
#chains in the Genus database with same CATH homology
 4CJW A;  1A5X A;  1GOB A;  4W5O A;  3AVF A;  1BQN A;  4E89 A;  1ASW A;  3PUF A;  4DU4 A;  4AIL C;  4DMN A;  3ZSW A;  4DQS A;  5C42 A;  5I42 A;  4KHS A;  4IFV A;  5KGW A;  3I0S A;  3OYG A;  2YHA A;  3M8S A;  1S5J A;  4FJK A;  3P83 D;  3KLH A;  1SUQ A;  3ZSO A;  5SWM A;  1BQM A;  2IGI A;  4CJF A;  1RTH A;  4DTO A;  1RDB A;  1ZYQ A;  3KLG A;  4HCB A;  2DY4 A;  1CXU A;  1J5O A;  4DTM A;  3NF6 A;  4LSL A;  4B9T A;  1SKR A;  4QOZ B;  1XWL A;  1CLQ A;  4CJQ A;  4ZTJ A;  3NFA A;  4FLX A;  1IG9 A;  2OPR A;  3JYT A;  3VQ7 A;  1NKC A;  1LWE A;  4HVJ A;  5KTQ A;  3B6P A;  4JRQ A;  1C1C A;  3SZ2 A;  4BDP A;  3V9S A;  3TAG A;  3DRS A;  3NF9 A;  1EXQ A;  4HUF A;  4LSN A;  5HP1 A;  4CF9 A;  2A1R A;  4KB0 A;  2XY7 A;  3OS1 A;  1NKB A;  3KLI A;  1HNI A;  1BGX T;  2GV9 A;  3ASM A;  3HST B;  3IG1 A;  4CIE A;  1JL2 A;  1QSL A;  3U3G A;  1NK8 A;  4Z4I A;  3MAQ A;  3SQ1 A;  4LD0 A;  3ZSR A;  1HRH A;  3AO3 A;  1NKE A;  4DFP A;  4IDK A;  4CJ5 A;  2Z1J A;  3EYZ A;  2NUB A;  3AO4 A;  3NGZ A;  3S3M A;  4OLA A;  4K8Z A;  2HHX A;  3RTV A;  3OYE A;  2G8H A;  1VSF A;  3ZSV A;  2B4J A;  3RMC A;  4PWD A;  3AVI A;  2P1J A;  4RW7 A;  3MXI A;  4M3Y A;  1ZBL A;  4PQU A;  3C6T A;  3K2P A;  5FRO A;  2Y1J A;  4DU1 A;  2PY5 A;  1RT4 A;  1L3U A;  4FLZ A;  1BHL A;  5HRR A;  1D9D A;  3VQB A;  3QNO A;  3VN5 A;  2JLE A;  4PA1 A;  1C1A A;  1TAU A;  3AA2 A;  4CFA A;  1IKY A;  1WSI A;  3OYA A;  4TSX A;  4CK2 A;  4DTU A;  1SL2 A;  1I3A A;  4DF4 A;  4H4O A;  4FLV A;  1QSY A;  2Y1I A;  5HRP A;  4G1Q A;  3ZT0 A;  3OYI A;  1X1P A;  4DS4 A;  1RT7 A;  1ZBI A;  2E6M A;  3O3G A;  3JSM A;  5KRS A;  1TVR A;  3TAR A;  2KW4 A;  1X9W A;  1L3S A;  1U48 A;  3OYH A;  3OYN A;  1RBT A;  1C0M A;  1KCF A;  1KVC A;  3LDS A;  1S9E A;  3U6F A;  3RRG A;  3EZ5 A;  3V9U A;  2D0C A;  2X6N A;  3CM6 A;  1C6V A;  2HVH A;  3QEW A;  1RTI A;  3V9X A;  4FZZ A;  2OYQ A;  4M3T A;  2QKB A;  4GW6 A;  1JLF A;  4CEF A;  4CJR A;  1ASV A;  3TR8 A;  4JS5 A;  5J2P A;  3ZCM A;  4RG8 A;  1XI1 A;  3RR7 A;  2XHB A;  1LAW A;  3HYF A;  3QEI A;  2F8S A;  4E1N A;  3RRH A;  4F3O A;  1J54 A;  3LWL A;  4KO0 A;  2VWJ A;  1KLN A;  1HMV A;  3DLK A;  2RKI A;  2KZZ A;  4EP5 A;  1IKX A;  2R7Y A;  2HHU A;  4EZ9 A;  3MXJ A;  2YNG A;  5FRN A;  3V1Q A;  2Q3S A;  1WN7 A;  2O4G A;  4ICL A;  3D0P A;  1VSM A;  4RW9 A;  3DOL A;  4AHT A;  1O1W A;  4CIG A;  3OYF A;  3I0R A;  3KJV A;  3RMA A;  2YNF A;  4DLG A;  2D0B A;  2KQ2 A;  4DTS A;  1WSE A;  4DQR A;  2ETJ A;  3T19 A;  2ZE2 A;  3L3V A;  3QNN A;  4CJ3 A;  4O44 A;  3AVB A;  2FC0 A;  2G8V A;  4N56 A;  5KI6 A;  3O3H A;  1KSP A;  1JLB A;  4MFB A;  2HHV A;  2G8W A;  2HMI A;  3OYD A;  1XHX A;  3M8R A;  4FK2 A;  3DLG A;  2G8K A;  3V1R A;  5JS1 A;  4CGG A;  3VA0 A;  3VQD A;  4CEQ A;  3AVM A;  1VSH A;  4FM0 A;  1B9F A;  5D3G A;  4ID5 A;  2X74 A;  1BL3 A;  3V4I A;  1VK0 A;  4FCY A;  3WNE A;  2DFF A;  3KK1 A;  4KHW A;  1KVB A;  1U49 A;  4H4M A;  4KTW A;  5C24 A;  4CEZ A;  4ZHR A;  4CJL A;  4DFK A;  3HP6 A;  2HHQ A;  2ITG A;  2F8T A;  4FYD A;  1JL1 A;  3KLF A;  3SYZ A;  1IH7 A;  3K57 A;  1DLO A;  4Z4C A;  1S1U A;  4DSI A;  3AO5 A;  3K58 A;  4DSE A;  2IS3 A;  1ITG A;  3IS9 A;  3VQ8 A;  3V9W A;  1X9S A;  3CM5 A;  3DM2 A;  2FBT A;  1HJR A;  2RPI A;  3L2Q A;  1UA0 A;  4PUO A;  3AV9 A;  4L8R B;  5HRN A;  4DLE A;  4AH9 A;  4FLY A;  4FJ9 A;  3AO2 A;  4RW4 A;  4E7I A;  1XHZ A;  3SUO A;  1GOA A;  1TK8 A;  1CZ9 A;  2Z1I A;  3T1A A;  1L3T A;  1WAJ A;  3DLH A;  3LAN A;  1HNV A;  4H8K A;  3E01 A;  4CJT A;  3DMJ A;  4FK4 A;  5FRM A;  3HJF A;  4FLT A;  3VQE A;  3AVG A;  4CJ4 A;  2BDP A;  5CYM A;  1U4B A;  2P5O A;  2EX3 A;  4CGF A;  3OJS A;  3NBP A;  1CXQ A;  2YHB A;  4CJS A;  2XO7 A;  5I3U A;  1WSH A;  3K5N A;  2F96 A;  3THV A;  3SNN A;  4BWM A;  4FJ8 A;  3NH1 A;  3SPZ A;  3P5J A;  3TAB A;  3IRX A;  2QXF A;  4W5R A;  3S3O A;  4C8N A;  4J2A A;  5KRT A;  3ZSY A;  2KFN A;  5J1E A;  3HPG A;  2ZQB A;  3OJU A;  4DTJ A;  1D9F A;  1DTT A;  3F9K A;  3ISN C;  4I2Q A;  3TAM A;  1TKT A;  5HRS A;  3TAE A;  3PX6 A;  1ZBU A;  4M41 A;  1N6Q A;  3SQ2 A;  1BIS A;  1RIL A;  1NK0 A;  1EET A;  3G0Z A;  4DWI A;  5CY4 A;  4M3R A;  4CK1 A;  4I7F A;  3TAN A;  1HYZ A;  4EZ6 A;  3VQA A;  3C6U A;  3MED A;  4AHV A;  5HRO A;  4M3U A;  1SL0 A;  2BAN A;  3KKR A;  1NK9 A;  1RDC A;  4KKO A;  1KFD A;  4OKK A;  1Q9X A;  4W5Q A;  1FKP A;  5CZ2 A;  4DQQ A;  2RN2 A;  4FJH A;  3PX4 A;  3OVN A;  4CHZ A;  1Q8I A;  1SKW A;  3AVK A;  4B9V A;  4KB1 A;  4K8X A;  2HW3 A;  2DFE A;  3NHG A;  4CGI A;  4FJG A;  3QIO A;  3VQ6 A;  4Z4H A;  4RW6 A;  1VSL A;  3CQ8 A;  3KLE A;  2BGG A;  4CFB A;  1C0U A;  2ZD1 A;  4DQP A;  1RBU A;  1J53 A;  3S3N A;  1LW0 A;  4AHR A;  2OZS A;  4F4K A;  3A2F A;  4IBN A;  3NF7 A;  4GVM A;  1KFS A;  1EKE A;  3V6D A;  1S6P A;  1RT2 A;  3AA5 X;  3CFO A;  4CCH A;  2DTU A;  3AVJ A;  4NYF A;  4BWJ A;  3SV3 A;  3LAK A;  2XY5 A;  4F8R A;  3DYA A;  1VRT A;  2XY8 A;  1S9G A;  3RMD A;  2I5J A;  3WNH A;  4Z4F A;  5JS2 A;  4F2S A;  3OS0 A;  4FJ7 A;  4I2P A;  1FK9 A;  5DMR A;  4HCC A;  4GMJ B;  1W0H A;  3C95 A;  4DSK A;  1QS4 A;  3WNF A;  3QET A;  1WSF A;  4FW1 A;  4J2D A;  1I39 A;  2HNY A;  3CFP A;  4OKJ A;  3ZSZ A;  1Q9Y A;  3LZI A;  4OPK A;  2Z1H A;  3NF8 A;  4NCA A;  4FZX C;  4J2B A;  3MXM A;  3VQQ A;  1D8Y A;  4C8L A;  4RW8 A;  2PZS A;  1YT3 A;  1BIU A;  3C94 A;  3FFI A;  3HVT A;  4R5P A;  4N47 A;  4DSL A;  4ELV A;  3MEG A;  4FXD A;  2GUI A;  5E41 A;  3OYL A;  4E3S A;  3OYM A;  2JGU A;  2IC3 A;  4DTP A;  1RNH A;  4HUG A;  4DS5 A;  3SUP A;  1YTU A;  2G8I A;  1RCH A;  3SPY A;  4QCL A;  1TKZ A;  1HYS A;  2OPQ A;  1KVA A;  4W5N A;  4I9L A;  4KI4 A;  2YKN A;  2VG5 A;  4HTU A;  5KGX A;  4NCB A;  4KI6 A;  2VG7 A;  3NCI A;  1BCM A;  1NJX A;  4KHN A;  3M8P A;  4BDY A;  3LP3 A;  3LPU A;  3VQ5 A;  4FM2 A;  3U3Y A;  3LP0 A;  3HP9 A;  3QES A;  1B92 A;  1A5W A;  1F21 A;  2WON A;  1XC9 A;  3VQ9 A;  1NK6 A;  1Z26 A;  2VG6 A;  1IO2 A;  4AHS A;  3LAL A;  2G8F A;  5HBM A;  3TAP A;  3QEV A;  2IDO A;  1R0A A;  3AVH A;  4KV8 A;  2D5R A;  4CJV A;  1RDD A;  4YFU A;  4XIU A;  1TK0 A;  1RBS A;  3NH2 A;  4IKF A;  3HM9 A;  4BE1 A;  1G15 A;  3VA3 A;  1X9M A;  3HK2 A;  1QTM A;  3KTQ A;  4B8C A;  4DFJ A;  4CEB A;  1T8E A;  4CJU A;  3T3F A;  3NH0 A;  2O4I A;  4UQG A;  2GBZ A;  3PO5 A;  3L3U A;  4KRE A;  2D0A A;  3ITH A;  1K6Y A;  1MU2 A;  4CHP A;  2IOC A;  2WOM A;  1NJZ A;  3TAQ A;  2A1S A;  1SKS A;  1KTQ A;  3AA4 A;  3ULD A;  3ZSX A;  1HPZ A;  1JLE A;  4QAG A;  4JS4 A;  3QEP A;  1LWC A;  2DFH A;  5SZT A;  4E7K A;  1WAF A;  4FJI A;  3KD5 E;  2OA8 A;  1S1T A;  1QE1 A;  3LWM A;  4CHQ A;  3MEE A;  3DOK A;  1BCO A;  3ZT4 A;  1NK7 A;  3VQC A;  2HVI A;  3KKS A;  1IKV A;  1CZB A;  1VSD A;  4E7L A;  4F3T A;  1UWB A;  4OKE A;  4CEO A;  4CJP A;  3HL8 A;  4KHY A;  4LY7 A;  4Z4E A;  1FKO A;  4CGJ A;  2YNI A;  3KK2 A;  4FLW A;  4KRF A;  1TAQ A;  2RF2 A;  5C25 A;  4BAC A;  4FM1 A;  1NK5 A;  1T05 A;  4CF8 A;  4B9S A;  3QEX A;  3DLB A;  1VSE A;  2ATQ A;  2QKK A;  4B9U A;  4FK0 A;  1RDA A;  4CER A;  3NE6 A;  2XY6 A;  4KHU A;  4OGE A;  3NDK A;  4FJ5 A;  5T7B A;  4DFM A;  4CES A;  3SUQ A;  4M3W A;  1WNS A;  3O4N A;  4CF0 A;  4KHQ A;  1TGO A;  3HPH A;  1RBR A;  3ALY A;  2FBV A;  4C8M A;  1TL3 A;  4BE2 A;  3RR8 A;  1YTA A;  1TKX A;  1WLJ A;  4CHY A;  2KZM A;  3OYJ A;  2HHS A;  3G10 A;  4CHN A;  4CK3 A;  3UIQ A;  4FVM A;  3L2U A;  3V9Z A;  4PY5 A;  4O5B A;  2HND A;  3HVR A;  3H08 A;  3M8Q A;  5HLF A;  3DI6 A;  1J9A A;  1JLA A;  3LP2 A;  1W9H A;  3SQ4 A;  1T03 A;  4Q0B A;  3IAY A;  5CYQ A;  1A5V A;  4ID1 A;  2B6A A;  1JXE A;  3VQP A;  1BI4 B;  2OPP A;  4HHT A;  3O3F A;  4B08 A;  4O55 A;  4M45 A;  1KRP A;  2YNH A;  2B5J A;  1NOY A;  1NK4 A;  1SV5 A;  1S1W A;  4NYN A;  1YVU A;  2X6S A;  4DSJ A;  4CGD A;  1LWF A;  1ZBF A;  2FBX A;  1HYV A;  2P51 A;  3CYM A;  3AO1 A;  2PYL A;  3DRR A;  3NGI A;  4B9N A;  3SI6 A;  2E4L A;  4C8K A;  3HXM A;  4OJR A;  4DQI A;  2YKM A;  4FJM A;  4HUE A;  4LH5 A;  4CE9 A;  3OS2 A;  4KPY A;  2KFZ A;  3K59 A;  3QIN A;  4N5S A;  4M3X A;  2OPS A;  5FDL A;  3QLH A;  4CF1 A;  4Q5V A;  3HO1 A;  3OYK A;  4E7J A;  3AA3 A;  1TL1 A;  1Y97 A;  4CEA A;  3KK3 A;  3WNG A;  4DTN A;  1VSK A;  3RWU A;  3KIO A;  1ASU A;  2G8U A;  3S9H A;  4FJJ A;  4CHO A;  3K5O A;  3L8B A;  4FJN A;  2LSN A;  3CG7 A;  4O4G A;  1FXX A;  1NJY A;  1EX4 A;  3TWH A;  4O0I A;  4ELT A;  1KLM A;  3QIP A;  3O4Q A;  3L2R A;  1U04 A;  1HQU A;  1LAV A;  4AHU A;  3OY9 A;  1D5A A;  4DSF A;  1TK5 A;  5J2M A;  3ZT1 A;  4FW2 A;  1C1B A;  1LW2 A;  1UAX A;  4DU3 A;  3SQ0 A;  3DLR A;  4FJL A;  1BI4 A;  3HT3 A;  4ELU A;  3ZT3 A;  1REV A;  4MQ3 A;  1RT1 A;  2Z1G A;  4AHC A;  2HHW A;  4CJK A;  1U45 A;  2QK9 A;  1TV6 A;  3NGY A;  2VWK A;  1L5U A;  1VSI A;  1JLG A;  4CED A;  3KD1 E;  4IG0 A;  1JLC A;  4IFY A;  4ZTF A;  4C8O A;  1UA1 A;  4I9Q A;  3TI0 A;  1JXB A;  1WSJ A;  3F73 A;  4F2R A;  1RT3 A;  1WSG A;  1VRU A;  2FBY A;  2HNZ A;  3QO9 A;  4OGC A;  3I8D A;  4JLH A;  4DTR A;  3PV8 A;  4Y1D A;  4CEE A;  4WE1 A;  4E0D A;  3AVN A;  5J2Q A;  2E6L A;  1U47 A;  2W42 A;  1QHT A;  4CEC A;  1JKH A;  4FJX A;  2HHT A;  3DLE A;  3EY1 A;  3B6O A;  5DK5 A;  1NOZ A;  4OLB A;  3LAM A;  4IG3 A;  1UOC A;  3SV4 A;  3LPT A;  3P1G A;  1GOC A;  3OYC A;  3SUN A;  4O0J A;  5CZ1 A;  1HQE A;  1BIZ A;  3VQ4 A;  1B9D A;  4B9M A;  4M42 A;  1SL1 A;  1N5Y A;  1S6Q A;  1QSS A;  2AJQ A;  1L3V A;  3K5L A;  3V1O A;  4EP4 A;  1RBV A;  4KFB A;  3HPO A;  3CFR A;  4B8A B;  1TKD A;  3L2V A;  1NJW A;  4BDZ A;  4DF8 A;  4N41 A;  2YV0 X;  1T7P A;  4B9L A;  3ZSQ A;  5K14 A;  3K5M A;  3PO4 A;  4LH4 A;  5EU7 A;  3ZT2 A;  4CFC A;  3QER A;  4N76 A;  1S1V A;  3PX0 A;  4KTQ A;  2KTQ A;  1LV5 A;  2IAJ A;  4CFD A;  4M3Z A;  2HB5 A;  1RTD A;  4CGH A;  1RTJ A;  4NCG A;  4OVL A;  4CF2 A;  3OYB A;  3DRP A;  4FLU A;  4J2E A;  1ZBH A;  1RT5 A;  4E19 A;  4E1M A;  4OPJ A;  4W5T A;  1QQC A;  4CIF A;  4FZY A;  3D45 A;  3L2W A;  4Z4G A;  4BE0 A;  1DTQ A;  1RT6 A;  1S1X A;  2EHG A;  4Z0U A;  4CJE A;  3NAE A;  3AVA A;  3SCX A;  1IKW A;  4DG1 A;  3V81 A;  1EP4 A;  2XRI A;  4YNQ A;  2P5G A;  4B3O A;  3TAF A;  3LP1 A;  1Z25 A;  4DTX A;  3AVL A;  3SJJ A;  1VSJ A;  4Y1C A;  1JLQ A;  2X78 A;  3LZJ A;  2OZM A;  4JRP A;  2BE2 A;  3PY8 A;  4KAZ A;  1C0T A;  3AVC A;  3RMB A;  4KTZ A;  2PYJ A;  5J2N A;  3BGR A;  4E7H A;  3MEC A;  3BDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...