3ZSVA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Transferase
source organism Human immunodeficiency virus
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsvA00
1YVUA 3NH0A 1HYSA 1EETA 4CK3A 5HRPA 4CIEA 2GUIA 2VWJA 1RT7A 1S6QA 2KQ2A 3CYMA 3D45A 3AO1A 3I0SA 5EU7A 4EP4A 1X9WA 2G8KA 2IS3A 4FK2A 1QTMA 1C0MA 4Z0UA 3QETA 5J2PA 1DTQA 4NCBA 5C24A 2OZMA 4K8ZA 2YNHA 1KVBA 4N41A 1WLJA 3KKRA 3KK3A 3TAPA 1SUQA 3NGYA 4LD0A 3KLEA 2Z1HA 3HPHA 1L3SA 1ZBFA 3ZSQA 1KLMA 3QINA 3RMDA 3S3OA 4N76A 4H8KA 3L3UA 2HHUA 2P1JA 1W0HA 4G1QA 3SJJA 4OVLA 2YV0X 1TAUA 4QAGA 4CF2A 1GOCA 3NCIA 1CLQA 1RDAA 2HHTA 3LPUA 3V6DA 1JLEA 4ELUA 1VSJA 2ZE2A 3M8RA 4ELVA 2PYJA 1VRUA 3BGRA 1U48A 3QO9A 4AH9A 4DS5A 1VSLA 4BDZA 1RCHA 4RW8A 1SL0A 4F2SA 3THVA 3MECA 3VQQA 2Z1GA 1NK9A 2LSNA 3DOLA 3SNNA 1LV5A 2IGIA 2RPIA 1RTJA 1WSFA 4Q5VA 3OVNA 4M3RA 3QESA 2ZQBA 3CM6A 3PV8A 3KD1E 4LSLA 4CGFA 4OPKA 3OS1A 1ZBUA 3OYDA 1J9AA 4JRQA 4HHTA 4FLYA 1JL2A 4L8RB 1UWBA 2P51A 1KVCA 1VSHA 3C94A 3KIOA 5KGWA 4FM0A 3OYMA 3QEIA 3RRGA 2WONA 2BANA 1TAQA 4I9LA 4OKEA 3QERA 3K5OA 4DTUA 3VQ8A 2G8FA 3OYHA 3ALYA 1U49A 4OLAA 3MEDA 4J2EA 2IAJA 2EHGA 3LP0A 1G15A 4NYNA 1EKEA 3OYAA 3V1QA 1JL1A 3I8DA 4FM1A 3DRPA 4CCHA 4FJ8A 3ZSYA 2HNYA 3S9HA 4B8CA 1ASUA 4JS5A 2E6LA 5JS2A 4ZTFA 3VQ7A 2G8WA 4B9NA 4CHNA 2D0BA 3L2UA 1WSGA 1B92A 1Q9XA 3AVHA 4DFPA 4CJEA 1NK0A 1HNIA 3CFPA 3EY1A 1VSMA 4DSKA 3B6PA 3KLGA 3IRXA 1RDCA 3L2RA 3V81A 2DFEA 3ZSXA 2Z1IA 4FJHA 2RN2A 4C8NA 3HVTA 2Y1JA 4E1MA 1S1VA 1Q9YA 4CK1A 3VQPA 2FBYA 3U6FA 1GOAA 4DQSA 5CZ2A 1R0AA 3C6TA 5KRSA 3OYCA 1RT1A 3V9ZA 5HLFA 3OYNA 3OYIA 3UIQA 3RWUA 1A5VA 3T3FA 3S3MA 1ASWA 3AVBA 3TAFA 4IG0A 3HP9A 3AVKA 3NH1A 3ZT0A 4DTMA 1BCMA 4CJUA 2HHSA 3NBPA 4DMNA 1WAFA 2W42A 1WSHA 5HRRA 3V1OA 4YFUA 3M8SA 2FC0A 4FK4A 1U45A 3MAQA 1NJZA 1NJXA 3AVMA 3SV3A 1JLQA 4CJ3A 3BDPA 1NJWA 4JS4A 5K14A 3TAQA 4CFBA 1TK5A 4FJKA 4E7KA 3O4QA 3LDSA 2NUBA 3RR8A 2HNZA 4Q0BA 4CEAA 1REVA 3OYJA 4EP5A 4QOZB 3RMAA 4DSLA 4J2AA 4M3TA 3KJVA 4FJGA 3AA4A 4CEFA 1BQNA 2VG7A 4DLEA 1JLCA 3P5JA 1SV5A 1IO2A 4E1NA 1J5OA 3OYEA 3KLIA 2PY5A 3LZIA 5J2NA 1S5JA 2HHQA 5T7BA 1IKVA 1HRHA 5HRSA 1KTQA 3OYKA 2JGUA 3RRHA 5DMRA 4DTXA 3DMJA 3MEGA 5KI6A 2XO7A 4GW6A 4RG8A 3KKSA 4FK0A 4GVMA 3QIPA 4CK2A 1NK7A 1LW2A 1EX4A 4E19A 1NOYA 4FZYA 4O44A 1C6VA 4B9UA 4M3UA 1BCOA 1TL1A 4TSXA 3O3GA 3HVRA 4DLGA 4HUFA 4QCLA 4GMJB 1D8YA 3KK2A 4I7FA 2HMIA 4M3YA 4OGCA 1JXBA 3PY8A 3QEXA 4HCBA 2KZMA 2AJQA 2XHBA 3DYAA 1C1AA 4HVJA 1ASVA 1XI1A 3NF6A 4AILC 2HHVA 1MU2A 3MXIA 2XRIA 1ZBIA 2OPRA 3VQ5A 3PX6A 3RMBA 5JS1A 3VQDA 3SUQA 3ZSOA 4KPYA 3FFIA 1BGXT 1KLNA 4O55A 4B9VA 4KHWA 3DLGA 5D3GA 4CHQA 4IBNA 1IH7A 3KD5E 1HPZA 1S9EA 1BI4A 4CECA 4FLTA 4O5BA 2YNGA 4FJ5A 3K58A 4KHQA 4EZ6A 1UOCA 1L3TA 4KV8A 2DY4A 3KLFA 3LALA 4CJPA 1D9DA 1QSSA 2PZSA 4W5TA 3L2QA 4F4KA 2HHWA 1LAVA 3DLEA 3RR7A 2WOMA 5SWMA 3SPYA 1EP4A 2YKMA 3O3HA 3QIOA 4FLVA 4ZTJA 3K5MA 1JLGA 1HQEA 1RNHA 2A1SA 4CEQA 4CGDA 3F73A 3TI0A 2A1RA 4C8LA 4MQ3A 1C0TA 3SV4A 4B9TA 4DFJA 1C1BA 3AVIA 3DOKA 4KTZA 4CHZA 4CEEA 4CIFA 3NAEA 2G8VA 3SQ0A 3E01A 2YKNA 4NCGA 4DTJA 1IG9A 1RT5A 1RBTA 5HRNA 3LWLA 2XY7A 1Q8IA 1NK8A 1UAXA 4PA1A 3ISNC 4FJMA 4PY5A 2DTUA 1FK9A 4AHTA 3LAMA 4DSJA 3S3NA 2E4LA 1CXUA 3O3FA 2FBXA 1BQMA 4XIUA 2YNFA 3K57A 4DQPA 1BL3A 4DWIA 3VQBA 4LH4A 5HROA 3HSTB 4CGJA 1FKPA 4FVMA 3OJUA 2HNDA 4DTOA 4FZZA 5KRTA 3V9XA 4FLXA 1UA0A 3DLHA 4LSNA 2OPQA 3SZ2A 4PQUA 4DFMA 2F8SA 3ASMA 3SQ4A 2E6MA 1NKEA 3QLHA 4W5OA 1S1WA 1B9DA 4AHSA 4CEBA 1RBVA 4E3SA 1A5WA 4C8MA 2PYLA 4C8KA 2F96A 4CFCA 4R5PA 3K5NA 4AHUA 2XY8A 1DTTA 1WSEA 3HYFA 4DS4A 1VSEA 4OJRA 4I2PA 5FROA 3V9UA 1KVAA 3KK1A 2BGGA 1QSLA 4AHVA 3G0ZA 3JSMA 4FXDA 3OS2A 4OKJA 4DTRA 3AVAA 1KSPA 4CGIA 4CJSA 2JLEA 1I39A 3AVCA 3DRSA 3LP1A 4E7HA 4E7LA 3VA0A 3I0RA 4IFYA 3ITHA 4DTNA 3MXJA 3PO4A 4CJRA 1S6PA 3B6OA 4ZHRA 4FZXC 4PUOA 4J2BA 1VSIA 3K2PA 3PUFA 3K5LA 1Y97A 1L5UA 4CJTA 3DLKA 4Z4CA 1RDDA 4KTQA 4KB1A 1X9MA 4M45A 2DFHA 2R7YA 4HUEA 1ZBLA 3H08A 3F9KA 1NKBA 4PWDA 3ZT4A 4M3WA 4FJLA 4AHCA 3V9WA 3IG1A 3VQ6A 3NHGA 1N5YA 1IKYA 4F3OA 4DQQA 1T03A 1BIUA 1RT4A 1LAWA 2EX3A 3CQ8A 3QEVA 1SL1A 3K59A 2HW3A 4ID5A 1NOZA 5I3UA 1F21A 2HVIA 1TL3A 1HYVA 4CERA 1TKTA 2HVHA 3VQ4A 2DFFA 1SKSA 1DLOA 1ZYQA 3ZT2A 5CZ1A 4H4OA 1GOBA 2ATQA 3ZT3A 4W5QA 1XC9A 4N47A 4BE1A 3L3VA 4W5RA 2OPSA 4CFAA 2KFNA 2F8TA 4CEDA 3U3YA 1T05A 3PX4A 3AO2A 4RW7A 3WNFA 1TVRA 3RMCA 1NKCA 4O0IA 4HCCA 3C6UA 4CESA 3OYLA 1BI4B 1WN7A 1LWEA 1RBSA 4OPJA 3DI6A 2KFZA 2OPPA 1X9SA 4FJJA 1JXEA 1VRTA 1QHTA 1X1PA 1JLFA 3NF8A 3HP6A 1NK6A 1KRPA 4BDPA 4DF8A 4FLZA 3T1AA 1TKXA 3CFRA 2IOCA 1L3UA 2KZZA 3TAMA 4FCYA 1NK5A 3SCXA 4B9LA 4DSFA 3AVFA 1B9FA 3ZT1A 1YTUA 1I3AA 3HPGA 1HYZA 4BACA 1KFDA 2BE2A 1LWFA 3KTQA 4KI4A 3C95A 3WNGA 3NF9A 4CJVA 4BE2A 1TGOA 3NH2A 5J1EA 1RILA 5C42A 4CFDA 3EZ5A 3OJSA 2B4JA 3TARA 3NDKA 2FBVA 1JLAA 1BHLA 1VSDA 4KKOA 5HBMA 4DQIA 4ELTA 4B3OA 3AO4A 4DSIA 2Q3SA 1TKZA 3SPZA 1WAJA 4FW1A 3QEWA 1CZ9A 4HUGA 5CYQA 1Z25A 4M42A 5CY4A 4FW2A 3ZSRA 2QKKA 1C1CA 1YT3A 3HPOA 4DFKA 3AO3A 3HT3A 1FKOA 3OS0A 4NCAA 3LAKA 1CXQA 1RTHA 3PO5A 3NF7A 3VQCA 3ZSVA 1LW0A 1TK8A 1N6QA 4RW4A 4W5NA 2QXFA 3LZJA 1NJYA 4KB0A 2P5OA 4F8RA 4FM2A 4FLUA 3ZCMA 1RDBA 4CF1A 4KFBA 4J2DA 4UQGA 1RTIA 1KFSA 3LP2A 1RBRA 4OKKA 4CGGA 1C0UA 4F2RA 4YNQA 4Z4GA 4CJFA 3V1RA 5DK5A 2QK9A 2RKIA 4O0JA 4CJ5A 5KGXA 3NGZA 4CHPA 4KHNA 3HJFA 4NYFA 3HO1A 2O4GA 3VQAA 1WSJA 4H4MA 4KAZA 2I5JA 3SUPA 1BISA 3TWHA 3OYBA 4IDKA 2KTQA 4IG3A 3RTVA 4RW9A 3EYZA 4MFBA 1J53A 3IAYA 1QQCA 3AVGA 2VG5A 2YHBA 3IS9A 1VSKA 2VG6A 3CG7A 4ICLA 4FJNA 4EZ9A 3AO5A 2ITGA 3TANA 4B8AB 4HTUA 3AA5X 5E41A 3SYZA 3HL8A 5I42A 2OZSA 5KTQA 4WE1A 4BE0A 1HQUA 3MXMA 3CM5A 1TKDA 1HJRA 4N5SA 1YTAA 2FBTA 4JRPA 3QNOA 1FXXA 4CJQA 3TR8A 4CGHA 3DRRA 3CFOA 3VQ9A 4M3ZA 1RT2A 2D5RA 3AVLA 1S1XA 3WNHA 3QNNA 4K8XA 4Y1DA 5FRNA 2O4IA 2XY6A 2GBZA 3AV9A 1VSFA 3VQEA 4I2QA 3U3GA 4CF0A 4Z4IA 3AA3A 3VA3A 3NFAA 4E7IA 1D9FA 3DLRA 2X6SA 2KW4A 3AVJA 4M41A 1RBUA 3SUNA 3P1GA 2G8IA 3AA2A 4FJIA 1ZBHA 4KRFA 4RW6A 3ULDA 3ZSWA 3A2FA 1U04A 1RTDA 4C8OA 4FJ9A 3M8QA 4FJXA 2HHXA 4DU1A 2ZD1A 2QKBA 3HK2A 4DU4A 3LANA 4DSEA 4N56A 3OYFA 3SQ2A 4M3XA 3HXMA 1O1WA 4IFVA 4CEOA 4JLHA 3D0PA 4CHYA 4DF4A 4Z4FA 1A5XA 1Z26A 1IKWA 1XWLA 4CJWA 1JKHA 4LH5A 2B6AA 4KO0A 4CHOA 5C25A 2G8HA 4B9MA 3MEEA 1NK4A 2RF2A 3G10A 3NE6A 1S9GA 1T7PA 5FDLA 2X6NA 4DU3A 5CYMA 1KCFA 2ETJA 3M8PA 1XHXA 1J54A 5J2MA 1ITGA 1WNSA 3L2WA 4CJLA 4ID1A 3L8BA 3V9SA 3SI6A 4KHYA 4O4GA 1CZBA 4OGEA 3VN5A 4BDYA 4FLWA 2P5GA 4E0DA 1TV6A 3LP3A 2OA8A 4DG1A 1RT6A 4CF9A 1JLBA 3P83D 2X74A 4DQRA 1SKRA 4BWJA 4DTSA 1U4BA 2BDPA 1SL2A 4IKFA 2YHAA 4FYDA 3OYGA 1SKWA 5J2QA 2HB5A 4KHUA 2VWKA 3KLHA 3TAEA 4CJ4A 1K6YA 1VK0A 5SZTA 1BIZA 1S1TA 3LPTA 3DLBA 3LWMA 5HP1A 4OLBA 3HM9A 5FRMA 4DTPA 1QE1A 3TABA 3AVNA 3T19A 2Y1IA 2YNIA 1TK0A 2D0CA 3L2VA 4KTWA 4CIGA 1W9HA 4B08A 3TAGA 2B5JA 2G8UA 4Y1CA 3SQ1A 3O4NA 3WNEA 4AHRA 4E7JA 3NGIA 1D5AA 1XHZA 4CJKA 4KI6A 1T8EA 1QS4A 1IKXA 4CE9A 2IC3A 1QSYA 4B9SA 3V4IA 4KHSA 1EXQA 3SUOA 1L3VA 2IDOA 4I9QA 2D0AA 4LY7A 3PX0A 3OY9A 2X78A 4Z4EA 1HNVA 1HMVA 1UA1A 1S1UA 4CEZA 3JYTA 2GV9A 3ZSZA 1LWCA 1WSIA 4CF8A 4Z4HA 1RT3A 2OYQA 4E89A 2XY5A 4F3TA 4BWMA 1U47A 3QEPA 3DM2A 4FJ7A 4KREA 2Z1JA
chains in the Genus database with same CATH superfamily
1YVUA 3AGRA 3DXKB 2E88A 3HSCA 2VWJA 2KQ2A 4IO9L 1HPMA 3CYMA 1XNRK 3HBTA 3O6WA 4EP4A 1X9WA 3P39A 1C0MA 2UYTA 4Z0UA 3RVCA 4N41A 1WLJA 2AP1A 1SUQA 3GE1A 3KLEA 3I56N 3O9TA 3SLCA 3ULEB 3C7NA 4QAGA 1GOCA 3D2FA 4B9QA 2YHXA 3V6DA 3NMUA 3M8RA 4ELVA 1U48A 4DS5A 1VSLA 2AA4A 1RCHA 3FLCO 4F2SA 1V4SA 3MECA 3THVA 2Z1GA 3TSPA 3SNNA 2RPIA 4BR7A 3ID8A 3CCUN 3OVNA 5C10A 2YCHA 4DR6K 3PV8A 3KD1E 4LSLA 4CGFA 1UA0A 3OS1A 4JRQA 1J9AA 4HHTA 1KVCA 3KIOA 5BN8A 5KGWA 3VTIA 1ZBSA 2WONA 2BANA 1TAQA 4GKJK 3MCPA 3QERA 3F9MA 3Q7BA 3ALYA 2E5LK 2IAJA 2EHGA 3LP0A 4NYNA 3V1QA 1JL1A 3DRPA 5IWAK 5TKYA 4AF1A 4B9NA 3BZCA 2D0BA 1B92A 5AQXA 4DFPA 1ESVA 1VQKN 1N32K 4WCEL 3CFPA 3EY1A 3HOSA 4DSKA 2RHKA 2FSJA 3L2RA 3CCMN 2DFEA 3FZKA 2FLOA 4C8NA 2Y1JA 4E1MA 2ZM6K 1R0AA 3OYCA 5HLFA 4FSVA 3QBWA 4CJ7A 3R3LA 3S3MA 1ASWA 2QWRA 3SMPA 3T1HK 2YX6A 3NH1A 3ZT0A 2ZGYA 3UKUA 4CJUA 4ISGA 4BRLA 1K73O 5H1SQ 1CZAN 4YFUA 4FK4A 1NJZA 3AVMA 4CJ3A 5K14A 1OKJA 2UU9K 4E7KA 3O4QA 3LDSA 2HNZA 4CEAA 3OYJA 3RMAA 1YF5L 3EKSA 2GUPA 3DJCA 1M1KO 4BC5A 4CEFA 1BQNA 2FF6A 1J5OA 3MX5A 4XEIA 3MWTA 3OYEA 3FE1A 2E1YA 2NRXA 1S72N 2P9PA 5AQHA 3T1YK 3HM8A 2PY5A 5HRSA 3OYKA 3TSQA 1GLFO 3MN6A 4JN4A 4JAXA 1C6VA 3TU5A 3O3GA 4BR2A 4DLGA 1XMOK 1D8YA 3PY8A 2KZMA 1C1AA 4HVJA 3HTVA 1ASVA 3QB0A 4WQ5A 1XI1A 3NF6A 4AILC 4BQZA 1MU2A 4WYBA 3PX6A 3I33A 2OTLN 1HNXK 3FFIA 5MLCQ 4CZIA 4YOUA 4JI5K 4NXNK 4CHQA 1IH7A 1BI4A 4FJ5A 3K58A 1W7AA 4EZ6A 1L3TA 4JI3K 2NRWA 1HNZK 4WF9L 1SAZA 3SAHA 3DLEA 1EP4A 5C2FA 1DGKN 3QIOA 4FLVA 4YOTA 3WEEB 1RNHA 4BREA 2A1RA 2UUBK 4O5FA 3FZFA 1C0TA 3DOKA 4KTZA 4BC2A 4CEEA 4CIFA 1KXPA 1RBTA 2XY7A 2HF3A 4PA1A 4QS9A 4M63C 4B1UB 4BRPA 4B1WB 3O3FA 1NBWA 3EEQA 3TTDA 4DWIA 1SS6A 3HOTA 5HROA 1FKPA 2NRHA 4DTOA 5KRTA 2ZF5O 4FLXA 3DLHA 3SQ4A 5AQSA 2E6MA 3AY9A 3EZWA 3QLHA 1S1WA 4W5OA 1A5WA 4C8MA 4CFCA 3K5NA 2XY8A 2HBLA 4DS4A 4FL9A 5FROA 5JVGL 3V9UA 1KVAA 3J7AP 2BGGA 3ZLJA 4AHVA 3OS2A 2ZJRL 4OKJA 3ZX0A 4CGIA 2JLEA 3FFKB 3PO4A 4JV5K 4PUOA 1VSIA 3PUFA 3K5LA 4U67L 1Y97A 4CJTA 3DLKA 1RDDA 5DM6L 4M45A 3DAWA 4EIAA 1NKBA 4PWDA 3ZT4A 1QZ5A 1IKYA 4F3OA 1RT4A 1LAWA 3CQ8A 3QEVA 2HW3A 1F21A 2HVIA 1HYVA 3BUZB 2HVHA 1ZYQA 1XC9A 5BRFA 4MLEA 3L3VA 4W5RA 4BE1A 4KBOA 2F8TA 1YVNA 4CEDA 2W6LA 2IVOA 4I6MB 3SMSA 3KWGA 3WQTA 2P9KA 4CBWA 3AAPA 4IO8A 4PL8A 4CBXA 2F4VK 4BRCA 4OPJA 1QHTA 3HP6A 3CPWM 1C0FA 3T1AA 1TKXA 2KZZA 5M1FA 2E2PA 4B9LA 4JKCA 1MWMA 3HPGA 1KFDA 4CBUA 3KTQA 3WNGA 4CJVA 1TGOA 2DPNA 1HKGA 3NH2A 1RILA 5C42A 4CFDA 3OJSA 3TARA 3LDOA 3SAGA 4FW1A 4YDUC 5CHIA 4HUGA 1FW6A 5CYQA 1Z25A 4M42A 5FLXO 2O8FB 3G4SN 4BVOA 3HPOA 1NWKA 5JLFA 4NCAA 4BROA 4DV2K 1CXQA 4WQ4C 4JI7K 2QXFA 4F8RA 3ZCMA 1RDBA 1J6ZA 1TYQA 3CC2N 1RTIA 2UUAK 4DV6K 2CH5A 5AR0A 4CJFA 4JHDA 2YJFA 2QK9A 2RKIA 5KGXA 1K8KB 2VQEK 4KHNA 3HJFA 4NYFA 4FPAA 2UXBK 1BISA 3TWHA 4IDKA 1BDGA 3FZLA 5AQRA 1HLUA 1QQCA 2YHBA 1VSKA 2VG6A 2HF4A 4EZ9A 2CH6A 3TANA 2IVPA 2OZSA 3HL8A 5KTQA 3MXMA 3CM5A 1TKDA 3R8EA 4IZ9A 3QNOA 1FXXA 3VENA 3CFOA 1K8AO 4M3ZA 2D5RA 4Y1DA 2O4IA 2XY6A 4Z4IA 3U3GA 3CCJN 1D9FA 3DLRA 3AVJA 4OX9K 4GV3A 4JI6K 3P1GA 2G8IA 3AA2A 1DKGD 3ZSWA 3BZKA 1U04A 4FJ9A 4DU1A 2ZD1A 4DU4A 4FWQA 4BRQA 4M3XA 3HXMA 1O1WA 4IFVA 4JLHA 3FGUA 3DXMA 1A5XA 3ZYYX 5A2QO 1NGFA 1JKHA 3VEXA 3GOIA 5C25A 2G8HA 4B9MA 4ILJA 1S9GA 4JKHA 2QI2A 5FDLA 5BPNA 5JVHL 4DU3A 3VTHA 1XHXA 4JKBA 3L2WA 4ID1A 3V9SA 2D0OA 4BDYA 4OGEA 4H5RA 1XQSC 1TV6A 4PKHA 3H1QA 1EO1A 4YOVA 1SL2A 2YHAA 4FWMA 4FYDA 3OYGA 1SKWA 2HB5A 3CQXA 2VWKA 1KAYA 4CJ4A 1VK0A 1S1TA 3LWMA 5HP1A 4PKIA 5FRMA 4DV5K 3TABA 3AVNA 1HX1A 3L2VA 1IBKK 2B5JA 3O4NA 3HZ6A 2WTUA 3NGIA 3G25A 4KI6A 3CQYA 4DR4K 4BRGA 4CE9A 1NGBA 2IC3A 3WUHA 1W97L 4EFHA 4MDAA 4KHSA 3EL2A 5AQLA 3MDQA 1L3VA 2GELA 4IFEA 3P38A 3OW2M 1S1UA 3JYTA 1KAZA 2GV9A 1LWCA 1Q81O 4Z4HA 1K8KA 3N4PA 4BWMA 1U47A 2O8EA 4FJ7A 5GINA 3N4QA 2ZWHA 2Z1JA 1HYSA 3FR0A 5HRPA 2IVNA 1S6QA 2OCEA 3I0SA 2UXDK 3BP8A 4BC3A 3F2KA 5J2PA 4NCBA 3CC7N 3KK3A 3TAPA 1YITN 3H3NO 1L3SA 1ZBFA 2F7TA 1KLMA 1Q82O 3L3UA 2HHUA 2P1JA 1WBDA 3WXKA 2YV0X 1TAUA 4CF2A 4ISFA 5EY4A 1RDAA 2HHTA 3LPUA 2E2NA 1VSJA 5LL6Z 4CZEA 2PYJA 3BGRA 4LF8K 4AH9A 1NJIO 3MN9A 4RW8A 5E84A 3L4IA 2LSNA 2P9NA 3DOLA 1GLLO 2IGIA 3DXKA 4Q5VA 3QESA 1OVYA 5GIPA 4H5NA 1RDWX 4FLYA 2OZMA 1VSHA 3C94A 5AJ3K 3EE8A 3CD6N 5AQGA 4DR2K 3F5TA 5BRDA 5AFUA 3K5OA 4NLBA 3VQ8A 2G8FA 3ENHA 3OYHA 4OLAA 3EE9A 3MEDA 3KWIA 1Q7YO 3OYAA 1S3XA 4CCHA 3OBYA 1JCGA 3ZSYA 2HNYA 4H0VB 4B8CA 4FWPA 2WFBA 4JS5A 2G8WA 4CHNA 3L2UA 1WSGA 4BRAA 3WEEA 1KD1O 1NK0A 1VSMA 2GTDA 3KLGA 3V81A 1N8RO 1NGEA 3ZSXA 2GWJA 1TUUA 4B1ZA 3VQPA 4FWKA 1GOAA 1HR0K 1IG8A 3C6TA 1NGIA 4JD2B 3RWUA 5AQMA 3T3FA 4LFAK 5JICA 3AVBA 4IG0A 3HP9A 1WUAA 3LDPA 2I7PA 4DTMA 1BCMA 1V4TA 1WAFA 2W42A 3I8BA 5HRRA 3V1OA 5AQZA 2FC0A 1U45A 3MAQA 3BDPA 3SV3A 2YJEA 4JS4A 5AQJA 1TK5A 4Q0BA 4ILGB 2P9SA 4J2AA 2VG7A 1JLCA 3WXMB 3ATUA 3P5JA 1IO2A 3J7ZO 2NRZA 2E2QA 2VGMA 4DR1K 5J2NA 1HRHA 3A0IX 3IKMA 5BPMA 2JGUA 1XMQK 3DMJA 3M1FA 4GW6A 2PFUA 4RG8A 4GVMA 1NK7A 3OHRA 1EX4A 4FZYA 4M3UA 5AQNA 1OVQA 3HVRA 2Q36A 4HUFA 5C0YA 4QCLA 2HMIA 3O1WA 5FPMA 4M3YA 4H5WA 1NGCA 3QEXA 4HCBA 3VEWA 2WBNA 4B3SK 3MK6A 3RMBA 3P4IA 2P9LA 2NNWA 1BGXT 2NRTA 4O55A 2CGLA 5D3GA 4B3MK 1BU6O 1S9EA 4CECA 4FLTA 4O5BA 3O4WA 1UOCA 4KV8A 3KLFA 4CJPA 2P9UA 1ILYA 2ZGZA 4F4KA 1LAVA 2WOMA 3K5MA 3VGKA 4CGDA 4CEQA 4C8LA 1Z6RA 5AQVA 4B9TA 3NAEA 2OTJN 4DQ8A 2O8EB 4H0YB 4FOIA 4DTJA 1IG9A 1RT5A 5HRNA 4FJMA 1CXUA 1E4GT 4XIUA 3VEYA 1BL3A 3VQBA 4LH4A 3HSTB 1T3VA 4FVMA 3OJUA 4FZZA 3CJ1A 3VERA 3V9XA 3CMEN 3LDNA 2OPQA 4WQ4A 4DFMA 1NKEA 4CEBA 1TYQB 4E1JA 4XH1A 3UKRB 1VSEA 4O8KA 3E9PA 4OJRA 4I2PA 3ENOA 4YOYA 3KK1A 1BUPA 1YI2N 1QSLA 1NGDA 3JSMA 1U2VA 4OO1J 3AVAA 3AVCA 3DRSA 3LP1A 4E7LA 3I0RA 3TTCA 4IFYA 3U9ZA 4DTNA 3MXJA 1HKCA 3H1VX 4CZJA 1NU0A 4FZXC 3ZEUA 4J2BA 2ZJPL 3G6EN 1VQ5N 2NZTA 4Z4CA 4KB1A 4KTQA 1U6ZA 1ZBLA 3F9KA 4FJLA 4IEEA 5BREA 3IG1A 3VQ6A 1VQNN 1T03A 2EX3A 5AQUA 5BPLA 1SL1A 3O9RA 5I3UA 3H45C 1YJWN 1TKTA 1SKSA 4CW7B 2ASPA 2ATQA 3DWLA 4DV0K 1T05A 5AQPA 3WNFA 4PKGA 3CCRN 4WFBL 1NKCA 4HCCA 1WN7A 1LWEA 1RBSA 2KFZA 2P9IB 1JXEA 1VRTA 1XC3A 4CZMA 1NK6A 4DF8A 3VOVA 5EXWA 1BG3A 4LFBK 3W0LA 3TAMA 2A3ZA 4DSFA 2O8CB 3ZT1A 1YTUA 3E9OA 1HYZA 1VQ9N 1LWFA 3CETA 4JI4K 1EWQA 4BE2A 3VF4A 4H0OA 4CI6A 5J1EA 4H0XB 3FZHA 3NDKA 2FBVA 4KKOA 4EHUA 3A5LC 4LF9K 4MO4A 3QEWA 4JKAA 2QKKA 1C1CA 1YT3A 3OS0A 3LAKA 3U9DA 1RTHA 3VQCA 1LW0A 4RW4A 1NJYA 3BEXA 1IBMK 4CF1A 1YAGA 4HWIA 4JNEA 4JEPA 4UQGA 1NMDA 1KFSA 4CGGA 3HO1A 4CHPA 2O4GA 3ATVA 3VF6A 3VQAA 3OYBA 4DB3A 4DV1K 3CF5L 3RTVA 3CPEA 4DR5K 3IS9A 4ICLA 4H5VA 3CCVN 3GDQA 2ITGA 3AA5X 4BE0A 1HQUA 4ILHA 2FBTA 4CJQA 4JK9A 3DRRA 3AVLA 3WNHA 4K8XA 5FRNA 5JMVA 3VQEA 1OH8A 4CF0A 3AARA 4I2QA 1H1VA 3VA3A 4X66K 3O08A 2KW4A 3J81O 1RBUA 3SUNA 4R79A 4C8OA 5AQTA 3OA9A 1NG9A 3LANA 4DSEA 4N56A 1GLEG 3OYFA 4KHYA 3P31A 1YJNN 4CHYA 4DF4A 4JKDA 1Z26A 4DHYA 3G10A 2A5XA 3TSUA 1DT9A 4CVNE 1KCFA 1VQ7N 2P9IA 4WFAL 4PHTX 1ITGA 3SI6A 4CJLA 4BRIA 1LCUA 1CZBA 5AQFA 2JWLA 4E0DA 4DG1A 1RT6A 2VQFK 1JLBA 2VYPA 4DQRA 4BWJA 1GLAG 5J2QA 4JK7A 5SZTA 3LPTA 4JKEA 2H3GX 3IMXA 4DTPA 1QQOA 1QE1A 4YHHK 2YNIA 3EKUA 2D0CA 3ID6A 4BG8A 3TAGA 1W9HA 1VAZA 3CERA 4YOWA 3SQ1A 4JK8A 4JI8K 5EOYA 3A8YA 1QS4A 2Q0RA 1IKXA 1HJOA 1EXQA 2IDOA 4I9QA 2D0AA 3O8MA 2GEMA 4BR9A 3PX0A 3D2FB 3OY9A 1OH6A 4WFNL 1UA1A 4YDUA 4CEZA 4A62A 1VQPN 1ATSA 2J4RA 2XY5A 2P9SB 3DM2A 4KREA 4LF4K 3QFUA 4I6MA 4CIEA 1SZ2A 1RT7A 4IDHA 4FVUA 5EU7A 3AO1A 2IS3A 3A5MC 3H6EA 1QVGM 2YI1A 1DTQA 4V19S 2YNHA 3SJHA 4LD0A 2Z1HA 3QINA 4ISEA 4H8KA 1MDUB 3LM2A 2NRVA 2NRRA 1CLQA 5LJWA 4ELUA 4JYAK 2YHYA 2ZE2A 4BR5A 1XNQK 1VRUA 3QO9A 4YY3K 4BDZA 3R6MA 4JKFA 4A2AA 2V7YA 5DM7L 3VQQA 3H46O 2HBKA 4FWRA 2HHHK 1RTJA 4M3RA 2ZQBA 4OPKA 1ZBUA 3CHWA 4L8RB 1JL2A 1UWBA 2P51A 3MCAB 3CCSN 3QEIA 3RRGA 4FM0A 2DTUA 3OYMA 3JS6A 1O13A 3PIOL 5B8HA 5ELZA 2P9UB 4DTUA 4DV3K 4RCHA 1YIJN 1U49A 5AQYA 2VCPA 1EKEA 4FM1A 4FJ8A 2Q1NA 2QXLA 4ZTFA 4K42A 3VQ7A 4BC4A 4C1NK 5F0XA 3EO3A 1Q9XA 3AVHA 1HNIA 2WC9A 3IRXA 3O9SA 5KPZA 3EN9A 2Z1IA 4FJHA 2RN2A 3THYB 3HVTA 4A2BA 1S1VA 4A57A 1Q9YA 4CK1A 2FBYA 3U6FA 1RFQA 3UB5A 5KRSA 3UIQA 3OYNA 5AQOA 3NVMA 1IBLK 3KVGA 1VQ8N 3LL3A 4J8FA 2HHSA 4NB4A 3NBPA 4DMNA 5ADXH 2HBJA 4X65K 5LY3A 3M8SA 1JLQA 3TAQA 4CFBA 4FJKA 2NUBA 4BRNA 1K9MO 1REVA 4QOZB 3KJVA 3AA4A 3U4LA 2UXCK 3G71N 4E1NA 5AQQA 3KLIA 3M6GA 3ULEA 1P8ZA 2HHQA 1IKVA 3RRHA 4IEIA 5KQDA 3ZEUB 4DTXA 3MEGA 5KI6A 2XO7A 5LJVA 3KKSA 1LW2A 2F9WA 4E19A 1TL1A 4TSXA 3I55N 2HSTA 4IOCL 3J80O 4BR4A 5C15A 2Q0UA 5GAGP 3UE5A 4WQ5C 4JI2K 2AJQA 2HHVA 1ZBIA 2OPRA 2QWPA 3VQ5A 5JS1A 4MO5A 3VQDA 4K0KK 2HBMA 4H5TA 2UUCK 1NGAA 3E1YA 3ZX3A 4B9VA 4AQYK 3SAFA 2P9KB 3MX2A 3DLLL 4IBNA 3U8XA 1HPZA 4IWVA 2YNGA 4C23A 2Q31A 2W6KA 2ASOA 1D9DA 1W2BM 2PZSA 4MLHA 4W5TA 5AZJA 2PAVA 3WQUA 5TKWA 2V51B 2O8BA 5SWMA 3O3HA 2VWBA 4K43A 4BRKA 1JLGA 4DV4K 3TI0A 4MQ3A 4DFJA 3OBWA 3AVIA 2QM1A 1IJJA 1M90O 3SQ0A 3E01A 2YKNA 3Q7CA 1NK8A 1Q8IA 1UAXA 1GLBG 1X3NA 4AHTA 3J8AA 3LAMA 3S3NA 5F1XA 5C12A 2FBXA 2YNFA 4NO7A 3CJ9A 4CGJA 2HNDA 4CD3A 3SZ2A 1WOQA 4H03B 3O9QA 4AHSA 1N36K 4C8KA 3MN7A 2F96A 3K9KA 1WSEA 5KPTA 3G0ZA 2BUPA 4DTRA 1KSPA 1I39A 1T6CA 3VA0A 3ITHA 1NMNA 2NLXA 4CJRA 3GBTA 4BVPA 5M1KA 3B6OA 3THXB 5BR8K 2ASMA 1L5UA 2QA4N 1X9MA 4BGBA 4AHCA 3V9WA 3CC4N 4DQQA 4DUZK 1JCEA 4ID5A 1NOZA 2W40A 4CERA 3UKRA 2DFFA 3C0BA 4B1VA 3ZT2A 4W5QA 4H4OA 3ZT3A 3J7YP 5F2RA 4CFAA 2KFNA 1MWKA 3PX4A 2IIRA 3RMCA 4CESA 1JJ2M 1E4FT 1BI4B 4IOXA 2CGKA 3THYA 3LDLA 4JKGB 1X9SA 4FJJA 3NF8A 1KRPA 4BDPA 2ITMA 3CFRA 2IOCA 1L3UA 1VQ6N 3RSEA 1NK5A 3SCXA 3AVFA 2V7ZA 3VEZA 5GAHP 1X9JA 1BWFO 4JHDB 2BE2A 3CJCA 3C95A 3ZETA 2CGJA 4KH6A 4JI1K 3BF3A 3CMAN 3EZ5A 1BHLA 1YUWA 2Q2RA 3AO4A 1IV0A 2Q3SA 4LC9B 1DEJA 1WAJA 3NVKA 5CY4A 4FW2A 4H0TB 1LOTB 3HT3A 2Q97A 4UY8O 3H3OB 3NF7A 3PO5A 1TK8A 4W5NA 1N6QA 4JI0K 3WXJA 2P5OA 4FM2A 3O5BA 1FJGK 4KFBA 4B3TK 1RBRA 4H0PA 4Z4GA 5CE3A 5DK5A 4O0JA 2FSNA 4CJ5A 1S22A 3GG4A 1VHXA 1QZ6A 2I5JA 2GWKA 5ADXA 3EYZA 4MFBA 1J53A 3IAYA 2VG5A 2D1KA 3MWPA 3VMFB 3CG7A 4A5AA 3AO5A 3CJ7A 3CI5A 3QDKA 4HTUA 3SYZA 5I42A 2FXUA 4JRPA 4C1NI 4IJAA 1VQON 3TR8A 4CGHA 4G9ZA 1RT2A 2E2OA 3QNNA 3WXIA 3TPQA 3NFAA 2X6SA 4M41A 3KHYA 4BRMA 1GLJO 5AQKA 3ULDA 1RTDA 2HHXA 2HOEA 3M8QA 4FJXA 2BH1A 3R1XA 3WT0A 5HOOA 3SQ2A 4Z4FA 2O8DB 4YORA 4U7BA 1IKWA 4CJWA 4BY9C 4LH5A 2B6AA 4KO0A 2D4WA 3SK3A 1NK4A 3NE6A 1T7PA 2PBDA 4IOAL 5GIOA 5CYMA 2ETJA 3M8PA 1J54A 1WNSA 3R9PA 4O4GA 4FWLA 3VN5A 1ZC6A 2HMPA 2P5GA 3LP3A 3P83D 4QS7A 1SKRA 4IKFA 2O8FA 4X64K 3SBGA 4KHUA 2FF3B 3KLHA 3TAEA 3O9UA 1BIZA 1NGHA 3HM9A 2RE2A 3SBTA 2Y1IA 4OPAA 4O8UA 1QVFM 5EVZA 4CIGA 4B08A 3VESA 4Y1CA 2W41A 4AHRA 4E7JA 3O1BA 1XHZA 4DKWA 3VEVA 4L3QA 1QSYA 3SUOA 4BG9A 4DUYK 4LY7A 3K0SA 1G99A 2X78A 4Z4EA 3LDQA 1HNVA 1HMVA 2QW9A 3ZSZA 1WSIA 2E1ZA 3C65A 5BN9A 2OYQA 4E89A 4F3TA 1JCFA 4GV6A 3NH0A 1EETA 3VGLA 4CK3A 2GUIA 3T69A 3M5RA 4BQLA 4CZKA 3D45A 4FK2A 2G8KA 1QTMA 3QETA 5C24A 1I94K 4K8ZA 4FOEA 1KVBA 3KKRA 3NGYA 3HPHA 1EWRA 3ZSQA 3RMDA 3S3OA 1RDUA 4N76A 5AQIA 2YHWA 1W0HA 4G1QA 3SJJA 4OVLA 3IUCA 3CCEN 2VGNA 3NCIA 1JLEA 3ZETB 3L0QA 1SL0A 1TUYA 3QFPA 4IXCA 3VGMA 1LV5A 1NK9A 4A5BA 1WSFA 3CM6A 5FPEA 1OH5A 3OYDA 4CD1A 4I9LA 4OKEA 1KC8O 3PLAA 2I7NA 4J2EA 3JAMO 1G15A 1E3MA 3I8DA 5AZIA 1BOTO 3S9HA 3VEOA 1VQLN 1ASUA 1YXQA 4A61A 2E8AA 2E6LA 5JS2A 5AZJB 3OTOK 5BRHA 4EAHD 4XH4A 1XUPO 4CJEA 3A5NC 3B6PA 1RDCA 1T6DA 3C6AA 4DR7K 3M3ZA 4DQSA 3E66A 5CZ2A 5C2DA 1RT1A 5JLHA 3V9ZA 3T7ZA 3OYIA 1A5VA 4RTFD 3TAFA 3PSIA 3AVKA 4GKKK 2EWSA 3CJAA 1J5EK 3D2EB 2QWMA 1OH7A 1WSHA 5BR9A 1Q18A 1NJXA 1NJWA 3RR8A 3PIPL 4Z94A 4EP5A 4IJNA 5CR4A 4DSLA 4M3TA 4FJGA 1QQNA 4LFCK 4DLEA 1SV5A 5M1PA 1N34K 1Z05A 3LZIA 1S5JA 5T7BA 3KZBA 3MN5A 1KTQA 4KHPK 5DMRA 3VETA 2QEXN 4FK0A 3CCLN 4CK2A 3QIPA 1NOYA 4O44A 4B9UA 1BCOA 1GLDG 4GMJB 3C7NB 5M1OA 3KK2A 4I7FA 4OGCA 4NXMK 1JXBA 2XHBA 3DYAA 4FO0A 4Y0WA 3JXUA 3MXIA 2XRIA 4JKGA 4GVEA 3C6HA 5AQWA 3SUQA 4BRDA 5LMNK 3ZSOA 4B1YB 4KPYA 1KLNA 1ATNA 4KHWA 1BA0A 3DLGA 3BF1A 3KD5E 4DR3K 4FWOA 1KAXA 4BGAA 1X3MA 4KHQA 3GL1A 2DY4A 3LALA 1QSSA 2QWQA 5HL7L 3L2QA 2HHWA 1QQMA 3RR7A 3SPYA 2YKMA 3RSEB 4ZTJA 1HQEA 2QWNA 2A1SA 3F73A 5AZIB 3SV4A 1C1BA 4CHZA 3K9JA 2G8VA 2D0PA 3KK7A 4NCGA 4PY5A 5M1QA 3VPZA 3LWLA 2P9LB 3ISNC 4JD2A 1FK9A 4DSJA 4OPHA 1NGGA 2E4LA 3K57A 4DQPA 1BQMA 5FPDA 4CZFA 1VQMN 5E26A 3CIPA 1NNEA 5IT9O 2A6AA 4PL7A 4LSNA 5I9EB 4PQUA 2F8SA 3ASMA 2O8BB 3E9LA 1B9DA 4E3SA 1RBVA 2PYLA 1SQKA 2A42A 4R5PA 2FSKA 4AHUA 1DTTA 3HYFA 1YJ9N 4MDBA 5GAEP 3UKUB 4M7XA 2KKZA 3THWB 3D2EA 4FXDA 4CJSA 4E7HA 4RWTA 3LM9A 2P9PB 1S6PA 4ZHRA 2GX9A 3K2PA 3A5OC 4NLCA 2DFHA 2R7YA 4HUEA 1BO5O 3H08A 1WB9A 4M3WA 5FPNA 3NHGA 1VQ4N 3ENBA 1N5YA 4KH5A 4KH4A 1BIUA 2WUSA 3CCQN 3HRGA 3K59A 1TL3A 3VQ4A 3FZMA 1DLOA 1Y64A 2JWKA 5CZ1A 1GOBA 2V52B 4N47A 3QMLA 2OPSA 1U2VB 2E20A 2ZJQL 3U3YA 3TTFA 3AO2A 4RW7A 1TVRA 4O0IA 3C6UA 3OYLA 4GNIA 4FWNA 3THXA 1WBBA 3DI6A 4XH5A 5LMUK 2BTFA 2OPPA 1X1PA 1JLFA 2O8DA 4FLZA 1ZXOA 3ZX2A 5M1NA 1RGIA 3CJBA 4FCYA 2A41A 1NGJA 1B9FA 2OANA 1KQSM 1I3AA 2F9TA 4GV9A 1Q86O 4BACA 4AM7A 4KI4A 3NF9A 2B4JA 5HBMA 1JLAA 1VSDA 4DQIA 1QHAA 4ELTA 4B3OA 4DSIA 1TKZA 2QWOA 3SPZA 1CZ9A 4BRHA 4B3RK 3ZSRA 4FWSA 4BR0A 4DFKA 3AO3A 1R59O 1FKOA 3MMVA 3ZSVA 3LZJA 4KB0A 4FLUA 1T44A 3W3DA 4J2DA 4YOXA 1ATRA 3LP2A 4OKKA 1C0UA 4F2RA 4YNQA 1BA1A 3V1RA 2KLAA 3NGZA 3CXCM 3WXLA 1WSJA 1HNWK 4H4MA 4KAZA 3SUPA 1N33K 3QBXA 4DV7K 4IG3A 2QWLA 4RW9A 1EQYA 3PSFA 3AVGA 1NM1A 3IFRA 4FJNA 4HTLA 1HUXA 3DXMB 4B8AB 4A59A 4LF7K 5E41A 3L4QA 4CZHA 3AGKA 4WE1A 4CZLA 3AAQA 4BRFA 1HJRA 2KHOA 1YTAA 4N5SA 3VQ9A 1S1XA 4AM6A 3QICA 2GBZA 3AV9A 1VSFA 4K41A 3AA3A 3D6RA 4X62K 4E7IA 4LF6K 4KRFA 4FJIA 1ZBHA 4RW6A 3A2FA 1GLCG 3HK2A 1D4XA 2QKBA 3D0PA 4CEOA 5KQ8A 1XWLA 2A40A 4CHOA 4DCHA 3MEEA 2RF2A 4M7YA 4FPBA 5AFUH 2O8CA 3B8AX 2X6NA 4LF5K 5J2MA 2KTQA 3L8BA 4GY2B 4FLWA 2OA8A 3BY5A 4CF9A 3IDHA 3VF2A 2X74A 2BDPA 4DTSA 1U4BA 1HKBA 3THWA 1YHQN 1K6YA 3HI0A 3DLBA 4OLBA 1NLVA 3D7EO 5KPRA 4QS8A 4F9OA 2QTDA 1MA9B 3T19A 4CZGA 4EHTA 1TK0A 5EX5A 4KTWA 3S41A 2G8UA 3WNEA 1D5AA 4CJKA 1C0GA 1T8EA 4B9SA 3V4IA 4K25A 5GADP 3O80A 4CF8A 1P90A 1RT3A 3QEPA 3L6QA 2P9NB 4B1XB
chains in the Genus database with same CATH topology
1YVUA 3NH0A 1HYSA 1EETA 4CK3A 5HRPA 4CIEA 2GUIA 2VWJA 1RT7A 1S6QA 2KQ2A 3CYMA 3D45A 3AO1A 3I0SA 5EU7A 4EP4A 1X9WA 2G8KA 2IS3A 4FK2A 1QTMA 1C0MA 4Z0UA 3QETA 5J2PA 1DTQA 4NCBA 5C24A 2OZMA 4K8ZA 2YNHA 1KVBA 4N41A 1WLJA 3KKRA 3KK3A 3TAPA 1SUQA 3NGYA 4LD0A 3KLEA 2Z1HA 3HPHA 1L3SA 1ZBFA 3ZSQA 1KLMA 3QINA 3RMDA 3S3OA 4N76A 4H8KA 3L3UA 2HHUA 2P1JA 1W0HA 4G1QA 3SJJA 4OVLA 2YV0X 1TAUA 4QAGA 4CF2A 1GOCA 3NCIA 1CLQA 1RDAA 2HHTA 3LPUA 3V6DA 1JLEA 4ELUA 1VSJA 2ZE2A 3M8RA 4ELVA 2PYJA 1VRUA 3BGRA 1U48A 3QO9A 4AH9A 4DS5A 1VSLA 4BDZA 1RCHA 4RW8A 1SL0A 4F2SA 3THVA 3MECA 3VQQA 2Z1GA 1NK9A 2LSNA 3DOLA 3SNNA 1LV5A 2IGIA 2RPIA 1RTJA 1WSFA 4Q5VA 3OVNA 4M3RA 3QESA 2ZQBA 3CM6A 3PV8A 3KD1E 4LSLA 4CGFA 4OPKA 3OS1A 1ZBUA 3OYDA 1J9AA 4JRQA 4HHTA 4FLYA 1JL2A 4L8RB 1UWBA 2P51A 1KVCA 1VSHA 3C94A 3KIOA 5KGWA 4FM0A 3OYMA 3QEIA 3RRGA 2WONA 2BANA 1TAQA 4I9LA 4OKEA 3QERA 3K5OA 4DTUA 3VQ8A 2G8FA 3OYHA 3ALYA 1U49A 4OLAA 3MEDA 4J2EA 2IAJA 2EHGA 3LP0A 1G15A 4NYNA 1EKEA 3OYAA 3V1QA 1JL1A 3I8DA 4FM1A 3DRPA 4CCHA 4FJ8A 3ZSYA 2HNYA 3S9HA 4B8CA 1ASUA 4JS5A 2E6LA 5JS2A 4ZTFA 3VQ7A 2G8WA 4B9NA 4CHNA 2D0BA 3L2UA 1WSGA 1B92A 1Q9XA 3AVHA 4DFPA 4CJEA 1NK0A 1HNIA 3CFPA 3EY1A 1VSMA 4DSKA 3B6PA 3KLGA 3IRXA 1RDCA 3L2RA 3V81A 2DFEA 3ZSXA 2Z1IA 4FJHA 2RN2A 4C8NA 3HVTA 2Y1JA 4E1MA 1S1VA 1Q9YA 4CK1A 3VQPA 2FBYA 3U6FA 1GOAA 4DQSA 5CZ2A 1R0AA 3C6TA 5KRSA 3OYCA 1RT1A 3V9ZA 5HLFA 3OYNA 3OYIA 3UIQA 3RWUA 1A5VA 3T3FA 3S3MA 1ASWA 3AVBA 3TAFA 4IG0A 3HP9A 3AVKA 3NH1A 3ZT0A 4DTMA 1BCMA 4CJUA 2HHSA 3NBPA 4DMNA 1WAFA 2W42A 1WSHA 5HRRA 3V1OA 4YFUA 3M8SA 2FC0A 4FK4A 1U45A 3MAQA 1NJZA 1NJXA 3AVMA 3SV3A 1JLQA 4CJ3A 3BDPA 1NJWA 4JS4A 5K14A 3TAQA 4CFBA 1TK5A 4FJKA 4E7KA 3O4QA 3LDSA 2NUBA 3RR8A 2HNZA 4Q0BA 4CEAA 1REVA 3OYJA 4EP5A 4QOZB 3RMAA 4DSLA 4J2AA 4M3TA 3KJVA 4FJGA 3AA4A 4CEFA 1BQNA 2VG7A 4DLEA 1JLCA 3P5JA 1SV5A 1IO2A 4E1NA 1J5OA 3OYEA 3KLIA 2PY5A 3LZIA 5J2NA 1S5JA 2HHQA 5T7BA 1IKVA 1HRHA 5HRSA 1KTQA 3OYKA 2JGUA 3RRHA 5DMRA 4DTXA 3DMJA 3MEGA 5KI6A 2XO7A 4GW6A 4RG8A 3KKSA 4FK0A 4GVMA 3QIPA 4CK2A 1NK7A 1LW2A 1EX4A 4E19A 1NOYA 4FZYA 4O44A 1C6VA 4B9UA 4M3UA 1BCOA 1TL1A 4TSXA 3O3GA 3HVRA 4DLGA 4HUFA 4QCLA 4GMJB 1D8YA 3KK2A 4I7FA 2HMIA 4M3YA 4OGCA 1JXBA 3PY8A 3QEXA 4HCBA 2KZMA 2AJQA 2XHBA 3DYAA 1C1AA 4HVJA 1ASVA 1XI1A 3NF6A 4AILC 2HHVA 1MU2A 3MXIA 2XRIA 1ZBIA 2OPRA 3VQ5A 3PX6A 3RMBA 5JS1A 3VQDA 3SUQA 3ZSOA 4KPYA 3FFIA 1BGXT 1KLNA 4O55A 4B9VA 4KHWA 3DLGA 5D3GA 4CHQA 4IBNA 1IH7A 3KD5E 1HPZA 1S9EA 1BI4A 4CECA 4FLTA 4O5BA 2YNGA 4FJ5A 3K58A 4KHQA 4EZ6A 1UOCA 1L3TA 4KV8A 2DY4A 3KLFA 3LALA 4CJPA 1D9DA 1QSSA 2PZSA 4W5TA 3L2QA 4F4KA 2HHWA 1LAVA 3DLEA 3RR7A 2WOMA 5SWMA 3SPYA 1EP4A 2YKMA 3O3HA 3QIOA 4FLVA 4ZTJA 3K5MA 1JLGA 1HQEA 1RNHA 2A1SA 4CEQA 4CGDA 3F73A 3TI0A 2A1RA 4C8LA 4MQ3A 1C0TA 3SV4A 4B9TA 4DFJA 1C1BA 3AVIA 3DOKA 4KTZA 4CHZA 4CEEA 4CIFA 3NAEA 2G8VA 3SQ0A 3E01A 2YKNA 4NCGA 4DTJA 1IG9A 1RT5A 1RBTA 5HRNA 3LWLA 2XY7A 1Q8IA 1NK8A 1UAXA 4PA1A 3ISNC 4FJMA 4PY5A 2DTUA 1FK9A 4AHTA 3LAMA 4DSJA 3S3NA 2E4LA 1CXUA 3O3FA 2FBXA 1BQMA 4XIUA 2YNFA 3K57A 4DQPA 1BL3A 4DWIA 3VQBA 4LH4A 5HROA 3HSTB 4CGJA 1FKPA 4FVMA 3OJUA 2HNDA 4DTOA 4FZZA 5KRTA 3V9XA 4FLXA 1UA0A 3DLHA 4LSNA 2OPQA 3SZ2A 4PQUA 4DFMA 2F8SA 3ASMA 3SQ4A 2E6MA 1NKEA 3QLHA 4W5OA 1S1WA 1B9DA 4AHSA 4CEBA 1RBVA 4E3SA 1A5WA 4C8MA 2PYLA 4C8KA 2F96A 4CFCA 4R5PA 3K5NA 4AHUA 2XY8A 1DTTA 1WSEA 3HYFA 4DS4A 1VSEA 4OJRA 4I2PA 5FROA 3V9UA 1KVAA 3KK1A 2BGGA 1QSLA 4AHVA 3G0ZA 3JSMA 4FXDA 3OS2A 4OKJA 4DTRA 3AVAA 1KSPA 4CGIA 4CJSA 2JLEA 1I39A 3AVCA 3DRSA 3LP1A 4E7HA 4E7LA 3VA0A 3I0RA 4IFYA 3ITHA 4DTNA 3MXJA 3PO4A 4CJRA 1S6PA 3B6OA 4ZHRA 4FZXC 4PUOA 4J2BA 1VSIA 3K2PA 3PUFA 3K5LA 1Y97A 1L5UA 4CJTA 3DLKA 4Z4CA 1RDDA 4KTQA 4KB1A 1X9MA 4M45A 2DFHA 2R7YA 4HUEA 1ZBLA 3H08A 3F9KA 1NKBA 4PWDA 3ZT4A 4M3WA 4FJLA 4AHCA 3V9WA 3IG1A 3VQ6A 3NHGA 1N5YA 1IKYA 4F3OA 4DQQA 1T03A 1BIUA 1RT4A 1LAWA 2EX3A 3CQ8A 3QEVA 1SL1A 3K59A 2HW3A 4ID5A 1NOZA 5I3UA 1F21A 2HVIA 1TL3A 1HYVA 4CERA 1TKTA 2HVHA 3VQ4A 2DFFA 1SKSA 1DLOA 1ZYQA 3ZT2A 5CZ1A 4H4OA 1GOBA 2ATQA 3ZT3A 4W5QA 1XC9A 4N47A 4BE1A 3L3VA 4W5RA 2OPSA 4CFAA 2KFNA 2F8TA 4CEDA 3U3YA 1T05A 3PX4A 3AO2A 4RW7A 3WNFA 1TVRA 3RMCA 1NKCA 4O0IA 4HCCA 3C6UA 4CESA 3OYLA 1BI4B 1WN7A 1LWEA 1RBSA 4OPJA 3DI6A 2KFZA 2OPPA 1X9SA 4FJJA 1JXEA 1VRTA 1QHTA 1X1PA 1JLFA 3NF8A 3HP6A 1NK6A 1KRPA 4BDPA 4DF8A 4FLZA 3T1AA 1TKXA 3CFRA 2IOCA 1L3UA 2KZZA 3TAMA 4FCYA 1NK5A 3SCXA 4B9LA 4DSFA 3AVFA 1B9FA 3ZT1A 1YTUA 1I3AA 3HPGA 1HYZA 4BACA 1KFDA 2BE2A 1LWFA 3KTQA 4KI4A 3C95A 3WNGA 3NF9A 4CJVA 4BE2A 1TGOA 3NH2A 5J1EA 1RILA 5C42A 4CFDA 3EZ5A 3OJSA 2B4JA 3TARA 3NDKA 2FBVA 1JLAA 1BHLA 1VSDA 4KKOA 5HBMA 4DQIA 4ELTA 4B3OA 3AO4A 4DSIA 2Q3SA 1TKZA 3SPZA 1WAJA 4FW1A 3QEWA 1CZ9A 4HUGA 5CYQA 1Z25A 4M42A 5CY4A 4FW2A 3ZSRA 2QKKA 1C1CA 1YT3A 3HPOA 4DFKA 3AO3A 3HT3A 1FKOA 3OS0A 4NCAA 3LAKA 1CXQA 1RTHA 3PO5A 3NF7A 3VQCA 3ZSVA 1LW0A 1TK8A 1N6QA 4RW4A 4W5NA 2QXFA 3LZJA 1NJYA 4KB0A 2P5OA 4F8RA 4FM2A 4FLUA 3ZCMA 1RDBA 4CF1A 4KFBA 4J2DA 4UQGA 1RTIA 1KFSA 3LP2A 1RBRA 4OKKA 4CGGA 1C0UA 4F2RA 4YNQA 4Z4GA 4CJFA 3V1RA 5DK5A 2QK9A 2RKIA 4O0JA 4CJ5A 5KGXA 3NGZA 4CHPA 4KHNA 3HJFA 4NYFA 3HO1A 2O4GA 3VQAA 1WSJA 4H4MA 4KAZA 2I5JA 3SUPA 1BISA 3TWHA 3OYBA 4IDKA 2KTQA 4IG3A 3RTVA 4RW9A 3EYZA 4MFBA 1J53A 3IAYA 1QQCA 3AVGA 2VG5A 2YHBA 3IS9A 1VSKA 2VG6A 3CG7A 4ICLA 4FJNA 4EZ9A 3AO5A 2ITGA 3TANA 4B8AB 4HTUA 3AA5X 5E41A 3SYZA 3HL8A 5I42A 2OZSA 5KTQA 4WE1A 4BE0A 1HQUA 3MXMA 3CM5A 1TKDA 1HJRA 4N5SA 1YTAA 2FBTA 4JRPA 3QNOA 1FXXA 4CJQA 3TR8A 4CGHA 3DRRA 3CFOA 3VQ9A 4M3ZA 1RT2A 2D5RA 3AVLA 1S1XA 3WNHA 3QNNA 4K8XA 4Y1DA 5FRNA 2O4IA 2XY6A 2GBZA 3AV9A 1VSFA 3VQEA 4I2QA 3U3GA 4CF0A 4Z4IA 3AA3A 3VA3A 3NFAA 4E7IA 1D9FA 3DLRA 2X6SA 2KW4A 3AVJA 4M41A 1RBUA 3SUNA 3P1GA 2G8IA 3AA2A 4FJIA 1ZBHA 4KRFA 4RW6A 3ULDA 3ZSWA 3A2FA 1U04A 1RTDA 4C8OA 4FJ9A 3M8QA 4FJXA 2HHXA 4DU1A 2ZD1A 2QKBA 3HK2A 4DU4A 3LANA 4DSEA 4N56A 3OYFA 3SQ2A 4M3XA 3HXMA 1O1WA 4IFVA 4CEOA 4JLHA 3D0PA 4CHYA 4DF4A 4Z4FA 1A5XA 1Z26A 1IKWA 1XWLA 4CJWA 1JKHA 4LH5A 2B6AA 4KO0A 4CHOA 5C25A 2G8HA 4B9MA 3MEEA 1NK4A 2RF2A 3G10A 3NE6A 1S9GA 1T7PA 5FDLA 2X6NA 4DU3A 5CYMA 1KCFA 2ETJA 3M8PA 1XHXA 1J54A 5J2MA 1ITGA 1WNSA 3L2WA 4CJLA 4ID1A 3L8BA 3V9SA 3SI6A 4KHYA 4O4GA 1CZBA 4OGEA 3VN5A 4BDYA 4FLWA 2P5GA 4E0DA 1TV6A 3LP3A 2OA8A 4DG1A 1RT6A 4CF9A 1JLBA 3P83D 2X74A 4DQRA 1SKRA 4BWJA 4DTSA 1U4BA 2BDPA 1SL2A 4IKFA 2YHAA 4FYDA 3OYGA 1SKWA 5J2QA 2HB5A 4KHUA 2VWKA 3KLHA 3TAEA 4CJ4A 1K6YA 1VK0A 5SZTA 1BIZA 1S1TA 3LPTA 3DLBA 3LWMA 5HP1A 4OLBA 3HM9A 5FRMA 4DTPA 1QE1A 3TABA 3AVNA 3T19A 2Y1IA 2YNIA 1TK0A 2D0CA 3L2VA 4KTWA 4CIGA 1W9HA 4B08A 3TAGA 2B5JA 2G8UA 4Y1CA 3SQ1A 3O4NA 3WNEA 4AHRA 4E7JA 3NGIA 1D5AA 1XHZA 4CJKA 4KI6A 1T8EA 1QS4A 1IKXA 4CE9A 2IC3A 1QSYA 4B9SA 3V4IA 4KHSA 1EXQA 3SUOA 1L3VA 2IDOA 4I9QA 2D0AA 4LY7A 3PX0A 3OY9A 2X78A 4Z4EA 1HNVA 1HMVA 1UA1A 1S1UA 4CEZA 3JYTA 2GV9A 3ZSZA 1LWCA 1WSIA 4CF8A 4Z4HA 1RT3A 2OYQA 4E89A 2XY5A 4F3TA 4BWMA 1U47A 3QEPA 3DM2A 4FJ7A 4KREA 2Z1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVU A;  3NH0 A;  1HYS A;  1EET A;  4CK3 A;  5HRP A;  4CIE A;  2GUI A;  2VWJ A;  1RT7 A;  1S6Q A;  2KQ2 A;  3CYM A;  3D45 A;  3AO1 A;  3I0S A;  5EU7 A;  4EP4 A;  1X9W A;  2G8K A;  2IS3 A;  4FK2 A;  1QTM A;  1C0M A;  4Z0U A;  3QET A;  5J2P A;  1DTQ A;  4NCB A;  5C24 A;  2OZM A;  4K8Z A;  2YNH A;  1KVB A;  4N41 A;  1WLJ A;  3KKR A;  3KK3 A;  3TAP A;  1SUQ A;  3NGY A;  4LD0 A;  3KLE A;  2Z1H A;  3HPH A;  1L3S A;  1ZBF A;  3ZSQ A;  1KLM A;  3QIN A;  3RMD A;  3S3O A;  4N76 A;  4H8K A;  3L3U A;  2HHU A;  2P1J A;  1W0H A;  4G1Q A;  3SJJ A;  4OVL A;  2YV0 X;  1TAU A;  4QAG A;  4CF2 A;  1GOC A;  3NCI A;  1CLQ A;  1RDA A;  2HHT A;  3LPU A;  3V6D A;  1JLE A;  4ELU A;  1VSJ A;  2ZE2 A;  3M8R A;  4ELV A;  2PYJ A;  1VRU A;  3BGR A;  1U48 A;  3QO9 A;  4AH9 A;  4DS5 A;  1VSL A;  4BDZ A;  1RCH A;  4RW8 A;  1SL0 A;  4F2S A;  3THV A;  3MEC A;  3VQQ A;  2Z1G A;  1NK9 A;  2LSN A;  3DOL A;  3SNN A;  1LV5 A;  2IGI A;  2RPI A;  1RTJ A;  1WSF A;  4Q5V A;  3OVN A;  4M3R A;  3QES A;  2ZQB A;  3CM6 A;  3PV8 A;  3KD1 E;  4LSL A;  4CGF A;  4OPK A;  3OS1 A;  1ZBU A;  3OYD A;  1J9A A;  4JRQ A;  4HHT A;  4FLY A;  1JL2 A;  4L8R B;  1UWB A;  2P51 A;  1KVC A;  1VSH A;  3C94 A;  3KIO A;  5KGW A;  4FM0 A;  3OYM A;  3QEI A;  3RRG A;  2WON A;  2BAN A;  1TAQ A;  4I9L A;  4OKE A;  3QER A;  3K5O A;  4DTU A;  3VQ8 A;  2G8F A;  3OYH A;  3ALY A;  1U49 A;  4OLA A;  3MED A;  4J2E A;  2IAJ A;  2EHG A;  3LP0 A;  1G15 A;  4NYN A;  1EKE A;  3OYA A;  3V1Q A;  1JL1 A;  3I8D A;  4FM1 A;  3DRP A;  4CCH A;  4FJ8 A;  3ZSY A;  2HNY A;  3S9H A;  4B8C A;  1ASU A;  4JS5 A;  2E6L A;  5JS2 A;  4ZTF A;  3VQ7 A;  2G8W A;  4B9N A;  4CHN A;  2D0B A;  3L2U A;  1WSG A;  1B92 A;  1Q9X A;  3AVH A;  4DFP A;  4CJE A;  1NK0 A;  1HNI A;  3CFP A;  3EY1 A;  1VSM A;  4DSK A;  3B6P A;  3KLG A;  3IRX A;  1RDC A;  3L2R A;  3V81 A;  2DFE A;  3ZSX A;  2Z1I A;  4FJH A;  2RN2 A;  4C8N A;  3HVT A;  2Y1J A;  4E1M A;  1S1V A;  1Q9Y A;  4CK1 A;  3VQP A;  2FBY A;  3U6F A;  1GOA A;  4DQS A;  5CZ2 A;  1R0A A;  3C6T A;  5KRS A;  3OYC A;  1RT1 A;  3V9Z A;  5HLF A;  3OYN A;  3OYI A;  3UIQ A;  3RWU A;  1A5V A;  3T3F A;  3S3M A;  1ASW A;  3AVB A;  3TAF A;  4IG0 A;  3HP9 A;  3AVK A;  3NH1 A;  3ZT0 A;  4DTM A;  1BCM A;  4CJU A;  2HHS A;  3NBP A;  4DMN A;  1WAF A;  2W42 A;  1WSH A;  5HRR A;  3V1O A;  4YFU A;  3M8S A;  2FC0 A;  4FK4 A;  1U45 A;  3MAQ A;  1NJZ A;  1NJX A;  3AVM A;  3SV3 A;  1JLQ A;  4CJ3 A;  3BDP A;  1NJW A;  4JS4 A;  5K14 A;  3TAQ A;  4CFB A;  1TK5 A;  4FJK A;  4E7K A;  3O4Q A;  3LDS A;  2NUB A;  3RR8 A;  2HNZ A;  4Q0B A;  4CEA A;  1REV A;  3OYJ A;  4EP5 A;  4QOZ B;  3RMA A;  4DSL A;  4J2A A;  4M3T A;  3KJV A;  4FJG A;  3AA4 A;  4CEF A;  1BQN A;  2VG7 A;  4DLE A;  1JLC A;  3P5J A;  1SV5 A;  1IO2 A;  4E1N A;  1J5O A;  3OYE A;  3KLI A;  2PY5 A;  3LZI A;  5J2N A;  1S5J A;  2HHQ A;  5T7B A;  1IKV A;  1HRH A;  5HRS A;  1KTQ A;  3OYK A;  2JGU A;  3RRH A;  5DMR A;  4DTX A;  3DMJ A;  3MEG A;  5KI6 A;  2XO7 A;  4GW6 A;  4RG8 A;  3KKS A;  4FK0 A;  4GVM A;  3QIP A;  4CK2 A;  1NK7 A;  1LW2 A;  1EX4 A;  4E19 A;  1NOY A;  4FZY A;  4O44 A;  1C6V A;  4B9U A;  4M3U A;  1BCO A;  1TL1 A;  4TSX A;  3O3G A;  3HVR A;  4DLG A;  4HUF A;  4QCL A;  4GMJ B;  1D8Y A;  3KK2 A;  4I7F A;  2HMI A;  4M3Y A;  4OGC A;  1JXB A;  3PY8 A;  3QEX A;  4HCB A;  2KZM A;  2AJQ A;  2XHB A;  3DYA A;  1C1A A;  4HVJ A;  1ASV A;  1XI1 A;  3NF6 A;  4AIL C;  2HHV A;  1MU2 A;  3MXI A;  2XRI A;  1ZBI A;  2OPR A;  3VQ5 A;  3PX6 A;  3RMB A;  5JS1 A;  3VQD A;  3SUQ A;  3ZSO A;  4KPY A;  3FFI A;  1BGX T;  1KLN A;  4O55 A;  4B9V A;  4KHW A;  3DLG A;  5D3G A;  4CHQ A;  4IBN A;  1IH7 A;  3KD5 E;  1HPZ A;  1S9E A;  1BI4 A;  4CEC A;  4FLT A;  4O5B A;  2YNG A;  4FJ5 A;  3K58 A;  4KHQ A;  4EZ6 A;  1UOC A;  1L3T A;  4KV8 A;  2DY4 A;  3KLF A;  3LAL A;  4CJP A;  1D9D A;  1QSS A;  2PZS A;  4W5T A;  3L2Q A;  4F4K A;  2HHW A;  1LAV A;  3DLE A;  3RR7 A;  2WOM A;  5SWM A;  3SPY A;  1EP4 A;  2YKM A;  3O3H A;  3QIO A;  4FLV A;  4ZTJ A;  3K5M A;  1JLG A;  1HQE A;  1RNH A;  2A1S A;  4CEQ A;  4CGD A;  3F73 A;  3TI0 A;  2A1R A;  4C8L A;  4MQ3 A;  1C0T A;  3SV4 A;  4B9T A;  4DFJ A;  1C1B A;  3AVI A;  3DOK A;  4KTZ A;  4CHZ A;  4CEE A;  4CIF A;  3NAE A;  2G8V A;  3SQ0 A;  3E01 A;  2YKN A;  4NCG A;  4DTJ A;  1IG9 A;  1RT5 A;  1RBT A;  5HRN A;  3LWL A;  2XY7 A;  1Q8I A;  1NK8 A;  1UAX A;  4PA1 A;  3ISN C;  4FJM A;  4PY5 A;  2DTU A;  1FK9 A;  4AHT A;  3LAM A;  4DSJ A;  3S3N A;  2E4L A;  1CXU A;  3O3F A;  2FBX A;  1BQM A;  4XIU A;  2YNF A;  3K57 A;  4DQP A;  1BL3 A;  4DWI A;  3VQB A;  4LH4 A;  5HRO A;  3HST B;  4CGJ A;  1FKP A;  4FVM A;  3OJU A;  2HND A;  4DTO A;  4FZZ A;  5KRT A;  3V9X A;  4FLX A;  1UA0 A;  3DLH A;  4LSN A;  2OPQ A;  3SZ2 A;  4PQU A;  4DFM A;  2F8S A;  3ASM A;  3SQ4 A;  2E6M A;  1NKE A;  3QLH A;  4W5O A;  1S1W A;  1B9D A;  4AHS A;  4CEB A;  1RBV A;  4E3S A;  1A5W A;  4C8M A;  2PYL A;  4C8K A;  2F96 A;  4CFC A;  4R5P A;  3K5N A;  4AHU A;  2XY8 A;  1DTT A;  1WSE A;  3HYF A;  4DS4 A;  1VSE A;  4OJR A;  4I2P A;  5FRO A;  3V9U A;  1KVA A;  3KK1 A;  2BGG A;  1QSL A;  4AHV A;  3G0Z A;  3JSM A;  4FXD A;  3OS2 A;  4OKJ A;  4DTR A;  3AVA A;  1KSP A;  4CGI A;  4CJS A;  2JLE A;  1I39 A;  3AVC A;  3DRS A;  3LP1 A;  4E7H A;  4E7L A;  3VA0 A;  3I0R A;  4IFY A;  3ITH A;  4DTN A;  3MXJ A;  3PO4 A;  4CJR A;  1S6P A;  3B6O A;  4ZHR A;  4FZX C;  4PUO A;  4J2B A;  1VSI A;  3K2P A;  3PUF A;  3K5L A;  1Y97 A;  1L5U A;  4CJT A;  3DLK A;  4Z4C A;  1RDD A;  4KTQ A;  4KB1 A;  1X9M A;  4M45 A;  2DFH A;  2R7Y A;  4HUE A;  1ZBL A;  3H08 A;  3F9K A;  1NKB A;  4PWD A;  3ZT4 A;  4M3W A;  4FJL A;  4AHC A;  3V9W A;  3IG1 A;  3VQ6 A;  3NHG A;  1N5Y A;  1IKY A;  4F3O A;  4DQQ A;  1T03 A;  1BIU A;  1RT4 A;  1LAW A;  2EX3 A;  3CQ8 A;  3QEV A;  1SL1 A;  3K59 A;  2HW3 A;  4ID5 A;  1NOZ A;  5I3U A;  1F21 A;  2HVI A;  1TL3 A;  1HYV A;  4CER A;  1TKT A;  2HVH A;  3VQ4 A;  2DFF A;  1SKS A;  1DLO A;  1ZYQ A;  3ZT2 A;  5CZ1 A;  4H4O A;  1GOB A;  2ATQ A;  3ZT3 A;  4W5Q A;  1XC9 A;  4N47 A;  4BE1 A;  3L3V A;  4W5R A;  2OPS A;  4CFA A;  2KFN A;  2F8T A;  4CED A;  3U3Y A;  1T05 A;  3PX4 A;  3AO2 A;  4RW7 A;  3WNF A;  1TVR A;  3RMC A;  1NKC A;  4O0I A;  4HCC A;  3C6U A;  4CES A;  3OYL A;  1BI4 B;  1WN7 A;  1LWE A;  1RBS A;  4OPJ A;  3DI6 A;  2KFZ A;  2OPP A;  1X9S A;  4FJJ A;  1JXE A;  1VRT A;  1QHT A;  1X1P A;  1JLF A;  3NF8 A;  3HP6 A;  1NK6 A;  1KRP A;  4BDP A;  4DF8 A;  4FLZ A;  3T1A A;  1TKX A;  3CFR A;  2IOC A;  1L3U A;  2KZZ A;  3TAM A;  4FCY A;  1NK5 A;  3SCX A;  4B9L A;  4DSF A;  3AVF A;  1B9F A;  3ZT1 A;  1YTU A;  1I3A A;  3HPG A;  1HYZ A;  4BAC A;  1KFD A;  2BE2 A;  1LWF A;  3KTQ A;  4KI4 A;  3C95 A;  3WNG A;  3NF9 A;  4CJV A;  4BE2 A;  1TGO A;  3NH2 A;  5J1E A;  1RIL A;  5C42 A;  4CFD A;  3EZ5 A;  3OJS A;  2B4J A;  3TAR A;  3NDK A;  2FBV A;  1JLA A;  1BHL A;  1VSD A;  4KKO A;  5HBM A;  4DQI A;  4ELT A;  4B3O A;  3AO4 A;  4DSI A;  2Q3S A;  1TKZ A;  3SPZ A;  1WAJ A;  4FW1 A;  3QEW A;  1CZ9 A;  4HUG A;  5CYQ A;  1Z25 A;  4M42 A;  5CY4 A;  4FW2 A;  3ZSR A;  2QKK A;  1C1C A;  1YT3 A;  3HPO A;  4DFK A;  3AO3 A;  3HT3 A;  1FKO A;  3OS0 A;  4NCA A;  3LAK A;  1CXQ A;  1RTH A;  3PO5 A;  3NF7 A;  3VQC A;  3ZSV A;  1LW0 A;  1TK8 A;  1N6Q A;  4RW4 A;  4W5N A;  2QXF A;  3LZJ A;  1NJY A;  4KB0 A;  2P5O A;  4F8R A;  4FM2 A;  4FLU A;  3ZCM A;  1RDB A;  4CF1 A;  4KFB A;  4J2D A;  4UQG A;  1RTI A;  1KFS A;  3LP2 A;  1RBR A;  4OKK A;  4CGG A;  1C0U A;  4F2R A;  4YNQ A;  4Z4G A;  4CJF A;  3V1R A;  5DK5 A;  2QK9 A;  2RKI A;  4O0J A;  4CJ5 A;  5KGX A;  3NGZ A;  4CHP A;  4KHN A;  3HJF A;  4NYF A;  3HO1 A;  2O4G A;  3VQA A;  1WSJ A;  4H4M A;  4KAZ A;  2I5J A;  3SUP A;  1BIS A;  3TWH A;  3OYB A;  4IDK A;  2KTQ A;  4IG3 A;  3RTV A;  4RW9 A;  3EYZ A;  4MFB A;  1J53 A;  3IAY A;  1QQC A;  3AVG A;  2VG5 A;  2YHB A;  3IS9 A;  1VSK A;  2VG6 A;  3CG7 A;  4ICL A;  4FJN A;  4EZ9 A;  3AO5 A;  2ITG A;  3TAN A;  4B8A B;  4HTU A;  3AA5 X;  5E41 A;  3SYZ A;  3HL8 A;  5I42 A;  2OZS A;  5KTQ A;  4WE1 A;  4BE0 A;  1HQU A;  3MXM A;  3CM5 A;  1TKD A;  1HJR A;  4N5S A;  1YTA A;  2FBT A;  4JRP A;  3QNO A;  1FXX A;  4CJQ A;  3TR8 A;  4CGH A;  3DRR A;  3CFO A;  3VQ9 A;  4M3Z A;  1RT2 A;  2D5R A;  3AVL A;  1S1X A;  3WNH A;  3QNN A;  4K8X A;  4Y1D A;  5FRN A;  2O4I A;  2XY6 A;  2GBZ A;  3AV9 A;  1VSF A;  3VQE A;  4I2Q A;  3U3G A;  4CF0 A;  4Z4I A;  3AA3 A;  3VA3 A;  3NFA A;  4E7I A;  1D9F A;  3DLR A;  2X6S A;  2KW4 A;  3AVJ A;  4M41 A;  1RBU A;  3SUN A;  3P1G A;  2G8I A;  3AA2 A;  4FJI A;  1ZBH A;  4KRF A;  4RW6 A;  3ULD A;  3ZSW A;  3A2F A;  1U04 A;  1RTD A;  4C8O A;  4FJ9 A;  3M8Q A;  4FJX A;  2HHX A;  4DU1 A;  2ZD1 A;  2QKB A;  3HK2 A;  4DU4 A;  3LAN A;  4DSE A;  4N56 A;  3OYF A;  3SQ2 A;  4M3X A;  3HXM A;  1O1W A;  4IFV A;  4CEO A;  4JLH A;  3D0P A;  4CHY A;  4DF4 A;  4Z4F A;  1A5X A;  1Z26 A;  1IKW A;  1XWL A;  4CJW A;  1JKH A;  4LH5 A;  2B6A A;  4KO0 A;  4CHO A;  5C25 A;  2G8H A;  4B9M A;  3MEE A;  1NK4 A;  2RF2 A;  3G10 A;  3NE6 A;  1S9G A;  1T7P A;  5FDL A;  2X6N A;  4DU3 A;  5CYM A;  1KCF A;  2ETJ A;  3M8P A;  1XHX A;  1J54 A;  5J2M A;  1ITG A;  1WNS A;  3L2W A;  4CJL A;  4ID1 A;  3L8B A;  3V9S A;  3SI6 A;  4KHY A;  4O4G A;  1CZB A;  4OGE A;  3VN5 A;  4BDY A;  4FLW A;  2P5G A;  4E0D A;  1TV6 A;  3LP3 A;  2OA8 A;  4DG1 A;  1RT6 A;  4CF9 A;  1JLB A;  3P83 D;  2X74 A;  4DQR A;  1SKR A;  4BWJ A;  4DTS A;  1U4B A;  2BDP A;  1SL2 A;  4IKF A;  2YHA A;  4FYD A;  3OYG A;  1SKW A;  5J2Q A;  2HB5 A;  4KHU A;  2VWK A;  3KLH A;  3TAE A;  4CJ4 A;  1K6Y A;  1VK0 A;  5SZT A;  1BIZ A;  1S1T A;  3LPT A;  3DLB A;  3LWM A;  5HP1 A;  4OLB A;  3HM9 A;  5FRM A;  4DTP A;  1QE1 A;  3TAB A;  3AVN A;  3T19 A;  2Y1I A;  2YNI A;  1TK0 A;  2D0C A;  3L2V A;  4KTW A;  4CIG A;  1W9H A;  4B08 A;  3TAG A;  2B5J A;  2G8U A;  4Y1C A;  3SQ1 A;  3O4N A;  3WNE A;  4AHR A;  4E7J A;  3NGI A;  1D5A A;  1XHZ A;  4CJK A;  4KI6 A;  1T8E A;  1QS4 A;  1IKX A;  4CE9 A;  2IC3 A;  1QSY A;  4B9S A;  3V4I A;  4KHS A;  1EXQ A;  3SUO A;  1L3V A;  2IDO A;  4I9Q A;  2D0A A;  4LY7 A;  3PX0 A;  3OY9 A;  2X78 A;  4Z4E A;  1HNV A;  1HMV A;  1UA1 A;  1S1U A;  4CEZ A;  3JYT A;  2GV9 A;  3ZSZ A;  1LWC A;  1WSI A;  4CF8 A;  4Z4H A;  1RT3 A;  2OYQ A;  4E89 A;  2XY5 A;  4F3T A;  4BWM A;  1U47 A;  3QEP A;  3DM2 A;  4FJ7 A;  4KRE A;  2Z1J A; 
#chains in the Genus database with same CATH topology
 1YVU A;  3AGR A;  3DXK B;  2E88 A;  3HSC A;  2VWJ A;  2KQ2 A;  4IO9 L;  1HPM A;  3CYM A;  1XNR K;  3HBT A;  3O6W A;  4EP4 A;  1X9W A;  3P39 A;  1C0M A;  2UYT A;  4Z0U A;  3RVC A;  4N41 A;  1WLJ A;  2AP1 A;  1SUQ A;  3GE1 A;  3KLE A;  3I56 N;  3O9T A;  3SLC A;  3ULE B;  3C7N A;  4QAG A;  1GOC A;  3D2F A;  4B9Q A;  2YHX A;  3V6D A;  3NMU A;  3M8R A;  4ELV A;  1U48 A;  4DS5 A;  1VSL A;  2AA4 A;  1RCH A;  3FLC O;  4F2S A;  1V4S A;  3MEC A;  3THV A;  2Z1G A;  3TSP A;  3SNN A;  2RPI A;  4BR7 A;  3ID8 A;  3CCU N;  3OVN A;  5C10 A;  2YCH A;  4DR6 K;  3PV8 A;  3KD1 E;  4LSL A;  4CGF A;  1UA0 A;  3OS1 A;  4JRQ A;  1J9A A;  4HHT A;  1KVC A;  3KIO A;  5BN8 A;  5KGW A;  3VTI A;  1ZBS A;  2WON A;  2BAN A;  1TAQ A;  4GKJ K;  3MCP A;  3QER A;  3F9M A;  3Q7B A;  3ALY A;  2E5L K;  2IAJ A;  2EHG A;  3LP0 A;  4NYN A;  3V1Q A;  1JL1 A;  3DRP A;  5IWA K;  5TKY A;  4AF1 A;  4B9N A;  3BZC A;  2D0B A;  1B92 A;  5AQX A;  4DFP A;  1ESV A;  1VQK N;  1N32 K;  4WCE L;  3CFP A;  3EY1 A;  3HOS A;  4DSK A;  2RHK A;  2FSJ A;  3L2R A;  3CCM N;  2DFE A;  3FZK A;  2FLO A;  4C8N A;  2Y1J A;  4E1M A;  2ZM6 K;  1R0A A;  3OYC A;  5HLF A;  4FSV A;  3QBW A;  4CJ7 A;  3R3L A;  3S3M A;  1ASW A;  2QWR A;  3SMP A;  3T1H K;  2YX6 A;  3NH1 A;  3ZT0 A;  2ZGY A;  3UKU A;  4CJU A;  4ISG A;  4BRL A;  1K73 O;  5H1S Q;  1CZA N;  4YFU A;  4FK4 A;  1NJZ A;  3AVM A;  4CJ3 A;  5K14 A;  1OKJ A;  2UU9 K;  4E7K A;  3O4Q A;  3LDS A;  2HNZ A;  4CEA A;  3OYJ A;  3RMA A;  1YF5 L;  3EKS A;  2GUP A;  3DJC A;  1M1K O;  4BC5 A;  4CEF A;  1BQN A;  2FF6 A;  1J5O A;  3MX5 A;  4XEI A;  3MWT A;  3OYE A;  3FE1 A;  2E1Y A;  2NRX A;  1S72 N;  2P9P A;  5AQH A;  3T1Y K;  3HM8 A;  2PY5 A;  5HRS A;  3OYK A;  3TSQ A;  1GLF O;  3MN6 A;  4JN4 A;  4JAX A;  1C6V A;  3TU5 A;  3O3G A;  4BR2 A;  4DLG A;  1XMO K;  1D8Y A;  3PY8 A;  2KZM A;  1C1A A;  4HVJ A;  3HTV A;  1ASV A;  3QB0 A;  4WQ5 A;  1XI1 A;  3NF6 A;  4AIL C;  4BQZ A;  1MU2 A;  4WYB A;  3PX6 A;  3I33 A;  2OTL N;  1HNX K;  3FFI A;  5MLC Q;  4CZI A;  4YOU A;  4JI5 K;  4NXN K;  4CHQ A;  1IH7 A;  1BI4 A;  4FJ5 A;  3K58 A;  1W7A A;  4EZ6 A;  1L3T A;  4JI3 K;  2NRW A;  1HNZ K;  4WF9 L;  1SAZ A;  3SAH A;  3DLE A;  1EP4 A;  5C2F A;  1DGK N;  3QIO A;  4FLV A;  4YOT A;  3WEE B;  1RNH A;  4BRE A;  2A1R A;  2UUB K;  4O5F A;  3FZF A;  1C0T A;  3DOK A;  4KTZ A;  4BC2 A;  4CEE A;  4CIF A;  1KXP A;  1RBT A;  2XY7 A;  2HF3 A;  4PA1 A;  4QS9 A;  4M63 C;  4B1U B;  4BRP A;  4B1W B;  3O3F A;  1NBW A;  3EEQ A;  3TTD A;  4DWI A;  1SS6 A;  3HOT A;  5HRO A;  1FKP A;  2NRH A;  4DTO A;  5KRT A;  2ZF5 O;  4FLX A;  3DLH A;  3SQ4 A;  5AQS A;  2E6M A;  3AY9 A;  3EZW A;  3QLH A;  1S1W A;  4W5O A;  1A5W A;  4C8M A;  4CFC A;  3K5N A;  2XY8 A;  2HBL A;  4DS4 A;  4FL9 A;  5FRO A;  5JVG L;  3V9U A;  1KVA A;  3J7A P;  2BGG A;  3ZLJ A;  4AHV A;  3OS2 A;  2ZJR L;  4OKJ A;  3ZX0 A;  4CGI A;  2JLE A;  3FFK B;  3PO4 A;  4JV5 K;  4PUO A;  1VSI A;  3PUF A;  3K5L A;  4U67 L;  1Y97 A;  4CJT A;  3DLK A;  1RDD A;  5DM6 L;  4M45 A;  3DAW A;  4EIA A;  1NKB A;  4PWD A;  3ZT4 A;  1QZ5 A;  1IKY A;  4F3O A;  1RT4 A;  1LAW A;  3CQ8 A;  3QEV A;  2HW3 A;  1F21 A;  2HVI A;  1HYV A;  3BUZ B;  2HVH A;  1ZYQ A;  1XC9 A;  5BRF A;  4MLE A;  3L3V A;  4W5R A;  4BE1 A;  4KBO A;  2F8T A;  1YVN A;  4CED A;  2W6L A;  2IVO A;  4I6M B;  3SMS A;  3KWG A;  3WQT A;  2P9K A;  4CBW A;  3AAP A;  4IO8 A;  4PL8 A;  4CBX A;  2F4V K;  4BRC A;  4OPJ A;  1QHT A;  3HP6 A;  3CPW M;  1C0F A;  3T1A A;  1TKX A;  2KZZ A;  5M1F A;  2E2P A;  4B9L A;  4JKC A;  1MWM A;  3HPG A;  1KFD A;  4CBU A;  3KTQ A;  3WNG A;  4CJV A;  1TGO A;  2DPN A;  1HKG A;  3NH2 A;  1RIL A;  5C42 A;  4CFD A;  3OJS A;  3TAR A;  3LDO A;  3SAG A;  4FW1 A;  4YDU C;  5CHI A;  4HUG A;  1FW6 A;  5CYQ A;  1Z25 A;  4M42 A;  5FLX O;  2O8F B;  3G4S N;  4BVO A;  3HPO A;  1NWK A;  5JLF A;  4NCA A;  4BRO A;  4DV2 K;  1CXQ A;  4WQ4 C;  4JI7 K;  2QXF A;  4F8R A;  3ZCM A;  1RDB A;  1J6Z A;  1TYQ A;  3CC2 N;  1RTI A;  2UUA K;  4DV6 K;  2CH5 A;  5AR0 A;  4CJF A;  4JHD A;  2YJF A;  2QK9 A;  2RKI A;  5KGX A;  1K8K B;  2VQE K;  4KHN A;  3HJF A;  4NYF A;  4FPA A;  2UXB K;  1BIS A;  3TWH A;  4IDK A;  1BDG A;  3FZL A;  5AQR A;  1HLU A;  1QQC A;  2YHB A;  1VSK A;  2VG6 A;  2HF4 A;  4EZ9 A;  2CH6 A;  3TAN A;  2IVP A;  2OZS A;  3HL8 A;  5KTQ A;  3MXM A;  3CM5 A;  1TKD A;  3R8E A;  4IZ9 A;  3QNO A;  1FXX A;  3VEN A;  3CFO A;  1K8A O;  4M3Z A;  2D5R A;  4Y1D A;  2O4I A;  2XY6 A;  4Z4I A;  3U3G A;  3CCJ N;  1D9F A;  3DLR A;  3AVJ A;  4OX9 K;  4GV3 A;  4JI6 K;  3P1G A;  2G8I A;  3AA2 A;  1DKG D;  3ZSW A;  3BZK A;  1U04 A;  4FJ9 A;  4DU1 A;  2ZD1 A;  4DU4 A;  4FWQ A;  4BRQ A;  4M3X A;  3HXM A;  1O1W A;  4IFV A;  4JLH A;  3FGU A;  3DXM A;  1A5X A;  3ZYY X;  5A2Q O;  1NGF A;  1JKH A;  3VEX A;  3GOI A;  5C25 A;  2G8H A;  4B9M A;  4ILJ A;  1S9G A;  4JKH A;  2QI2 A;  5FDL A;  5BPN A;  5JVH L;  4DU3 A;  3VTH A;  1XHX A;  4JKB A;  3L2W A;  4ID1 A;  3V9S A;  2D0O A;  4BDY A;  4OGE A;  4H5R A;  1XQS C;  1TV6 A;  4PKH A;  3H1Q A;  1EO1 A;  4YOV A;  1SL2 A;  2YHA A;  4FWM A;  4FYD A;  3OYG A;  1SKW A;  2HB5 A;  3CQX A;  2VWK A;  1KAY A;  4CJ4 A;  1VK0 A;  1S1T A;  3LWM A;  5HP1 A;  4PKI A;  5FRM A;  4DV5 K;  3TAB A;  3AVN A;  1HX1 A;  3L2V A;  1IBK K;  2B5J A;  3O4N A;  3HZ6 A;  2WTU A;  3NGI A;  3G25 A;  4KI6 A;  3CQY A;  4DR4 K;  4BRG A;  4CE9 A;  1NGB A;  2IC3 A;  3WUH A;  1W97 L;  4EFH A;  4MDA A;  4KHS A;  3EL2 A;  5AQL A;  3MDQ A;  1L3V A;  2GEL A;  4IFE A;  3P38 A;  3OW2 M;  1S1U A;  3JYT A;  1KAZ A;  2GV9 A;  1LWC A;  1Q81 O;  4Z4H A;  1K8K A;  3N4P A;  4BWM A;  1U47 A;  2O8E A;  4FJ7 A;  5GIN A;  3N4Q A;  2ZWH A;  2Z1J A;  1HYS A;  3FR0 A;  5HRP A;  2IVN A;  1S6Q A;  2OCE A;  3I0S A;  2UXD K;  3BP8 A;  4BC3 A;  3F2K A;  5J2P A;  4NCB A;  3CC7 N;  3KK3 A;  3TAP A;  1YIT N;  3H3N O;  1L3S A;  1ZBF A;  2F7T A;  1KLM A;  1Q82 O;  3L3U A;  2HHU A;  2P1J A;  1WBD A;  3WXK A;  2YV0 X;  1TAU A;  4CF2 A;  4ISF A;  5EY4 A;  1RDA A;  2HHT A;  3LPU A;  2E2N A;  1VSJ A;  5LL6 Z;  4CZE A;  2PYJ A;  3BGR A;  4LF8 K;  4AH9 A;  1NJI O;  3MN9 A;  4RW8 A;  5E84 A;  3L4I A;  2LSN A;  2P9N A;  3DOL A;  1GLL O;  2IGI A;  3DXK A;  4Q5V A;  3QES A;  1OVY A;  5GIP A;  4H5N A;  1RDW X;  4FLY A;  2OZM A;  1VSH A;  3C94 A;  5AJ3 K;  3EE8 A;  3CD6 N;  5AQG A;  4DR2 K;  3F5T A;  5BRD A;  5AFU A;  3K5O A;  4NLB A;  3VQ8 A;  2G8F A;  3ENH A;  3OYH A;  4OLA A;  3EE9 A;  3MED A;  3KWI A;  1Q7Y O;  3OYA A;  1S3X A;  4CCH A;  3OBY A;  1JCG A;  3ZSY A;  2HNY A;  4H0V B;  4B8C A;  4FWP A;  2WFB A;  4JS5 A;  2G8W A;  4CHN A;  3L2U A;  1WSG A;  4BRA A;  3WEE A;  1KD1 O;  1NK0 A;  1VSM A;  2GTD A;  3KLG A;  3V81 A;  1N8R O;  1NGE A;  3ZSX A;  2GWJ A;  1TUU A;  4B1Z A;  3VQP A;  4FWK A;  1GOA A;  1HR0 K;  1IG8 A;  3C6T A;  1NGI A;  4JD2 B;  3RWU A;  5AQM A;  3T3F A;  4LFA K;  5JIC A;  3AVB A;  4IG0 A;  3HP9 A;  1WUA A;  3LDP A;  2I7P A;  4DTM A;  1BCM A;  1V4T A;  1WAF A;  2W42 A;  3I8B A;  5HRR A;  3V1O A;  5AQZ A;  2FC0 A;  1U45 A;  3MAQ A;  3BDP A;  3SV3 A;  2YJE A;  4JS4 A;  5AQJ A;  1TK5 A;  4Q0B A;  4ILG B;  2P9S A;  4J2A A;  2VG7 A;  1JLC A;  3WXM B;  3ATU A;  3P5J A;  1IO2 A;  3J7Z O;  2NRZ A;  2E2Q A;  2VGM A;  4DR1 K;  5J2N A;  1HRH A;  3A0I X;  3IKM A;  5BPM A;  2JGU A;  1XMQ K;  3DMJ A;  3M1F A;  4GW6 A;  2PFU A;  4RG8 A;  4GVM A;  1NK7 A;  3OHR A;  1EX4 A;  4FZY A;  4M3U A;  5AQN A;  1OVQ A;  3HVR A;  2Q36 A;  4HUF A;  5C0Y A;  4QCL A;  2HMI A;  3O1W A;  5FPM A;  4M3Y A;  4H5W A;  1NGC A;  3QEX A;  4HCB A;  3VEW A;  2WBN A;  4B3S K;  3MK6 A;  3RMB A;  3P4I A;  2P9L A;  2NNW A;  1BGX T;  2NRT A;  4O55 A;  2CGL A;  5D3G A;  4B3M K;  1BU6 O;  1S9E A;  4CEC A;  4FLT A;  4O5B A;  3O4W A;  1UOC A;  4KV8 A;  3KLF A;  4CJP A;  2P9U A;  1ILY A;  2ZGZ A;  4F4K A;  1LAV A;  2WOM A;  3K5M A;  3VGK A;  4CGD A;  4CEQ A;  4C8L A;  1Z6R A;  5AQV A;  4B9T A;  3NAE A;  2OTJ N;  4DQ8 A;  2O8E B;  4H0Y B;  4FOI A;  4DTJ A;  1IG9 A;  1RT5 A;  5HRN A;  4FJM A;  1CXU A;  1E4G T;  4XIU A;  3VEY A;  1BL3 A;  3VQB A;  4LH4 A;  3HST B;  1T3V A;  4FVM A;  3OJU A;  4FZZ A;  3CJ1 A;  3VER A;  3V9X A;  3CME N;  3LDN A;  2OPQ A;  4WQ4 A;  4DFM A;  1NKE A;  4CEB A;  1TYQ B;  4E1J A;  4XH1 A;  3UKR B;  1VSE A;  4O8K A;  3E9P A;  4OJR A;  4I2P A;  3ENO A;  4YOY A;  3KK1 A;  1BUP A;  1YI2 N;  1QSL A;  1NGD A;  3JSM A;  1U2V A;  4OO1 J;  3AVA A;  3AVC A;  3DRS A;  3LP1 A;  4E7L A;  3I0R A;  3TTC A;  4IFY A;  3U9Z A;  4DTN A;  3MXJ A;  1HKC A;  3H1V X;  4CZJ A;  1NU0 A;  4FZX C;  3ZEU A;  4J2B A;  2ZJP L;  3G6E N;  1VQ5 N;  2NZT A;  4Z4C A;  4KB1 A;  4KTQ A;  1U6Z A;  1ZBL A;  3F9K A;  4FJL A;  4IEE A;  5BRE A;  3IG1 A;  3VQ6 A;  1VQN N;  1T03 A;  2EX3 A;  5AQU A;  5BPL A;  1SL1 A;  3O9R A;  5I3U A;  3H45 C;  1YJW N;  1TKT A;  1SKS A;  4CW7 B;  2ASP A;  2ATQ A;  3DWL A;  4DV0 K;  1T05 A;  5AQP A;  3WNF A;  4PKG A;  3CCR N;  4WFB L;  1NKC A;  4HCC A;  1WN7 A;  1LWE A;  1RBS A;  2KFZ A;  2P9I B;  1JXE A;  1VRT A;  1XC3 A;  4CZM A;  1NK6 A;  4DF8 A;  3VOV A;  5EXW A;  1BG3 A;  4LFB K;  3W0L A;  3TAM A;  2A3Z A;  4DSF A;  2O8C B;  3ZT1 A;  1YTU A;  3E9O A;  1HYZ A;  1VQ9 N;  1LWF A;  3CET A;  4JI4 K;  1EWQ A;  4BE2 A;  3VF4 A;  4H0O A;  4CI6 A;  5J1E A;  4H0X B;  3FZH A;  3NDK A;  2FBV A;  4KKO A;  4EHU A;  3A5L C;  4LF9 K;  4MO4 A;  3QEW A;  4JKA A;  2QKK A;  1C1C A;  1YT3 A;  3OS0 A;  3LAK A;  3U9D A;  1RTH A;  3VQC A;  1LW0 A;  4RW4 A;  1NJY A;  3BEX A;  1IBM K;  4CF1 A;  1YAG A;  4HWI A;  4JNE A;  4JEP A;  4UQG A;  1NMD A;  1KFS A;  4CGG A;  3HO1 A;  4CHP A;  2O4G A;  3ATV A;  3VF6 A;  3VQA A;  3OYB A;  4DB3 A;  4DV1 K;  3CF5 L;  3RTV A;  3CPE A;  4DR5 K;  3IS9 A;  4ICL A;  4H5V A;  3CCV N;  3GDQ A;  2ITG A;  3AA5 X;  4BE0 A;  1HQU A;  4ILH A;  2FBT A;  4CJQ A;  4JK9 A;  3DRR A;  3AVL A;  3WNH A;  4K8X A;  5FRN A;  5JMV A;  3VQE A;  1OH8 A;  4CF0 A;  3AAR A;  4I2Q A;  1H1V A;  3VA3 A;  4X66 K;  3O08 A;  2KW4 A;  3J81 O;  1RBU A;  3SUN A;  4R79 A;  4C8O A;  5AQT A;  3OA9 A;  1NG9 A;  3LAN A;  4DSE A;  4N56 A;  1GLE G;  3OYF A;  4KHY A;  3P31 A;  1YJN N;  4CHY A;  4DF4 A;  4JKD A;  1Z26 A;  4DHY A;  3G10 A;  2A5X A;  3TSU A;  1DT9 A;  4CVN E;  1KCF A;  1VQ7 N;  2P9I A;  4WFA L;  4PHT X;  1ITG A;  3SI6 A;  4CJL A;  4BRI A;  1LCU A;  1CZB A;  5AQF A;  2JWL A;  4E0D A;  4DG1 A;  1RT6 A;  2VQF K;  1JLB A;  2VYP A;  4DQR A;  4BWJ A;  1GLA G;  5J2Q A;  4JK7 A;  5SZT A;  3LPT A;  4JKE A;  2H3G X;  3IMX A;  4DTP A;  1QQO A;  1QE1 A;  4YHH K;  2YNI A;  3EKU A;  2D0C A;  3ID6 A;  4BG8 A;  3TAG A;  1W9H A;  1VAZ A;  3CER A;  4YOW A;  3SQ1 A;  4JK8 A;  4JI8 K;  5EOY A;  3A8Y A;  1QS4 A;  2Q0R A;  1IKX A;  1HJO A;  1EXQ A;  2IDO A;  4I9Q A;  2D0A A;  3O8M A;  2GEM A;  4BR9 A;  3PX0 A;  3D2F B;  3OY9 A;  1OH6 A;  4WFN L;  1UA1 A;  4YDU A;  4CEZ A;  4A62 A;  1VQP N;  1ATS A;  2J4R A;  2XY5 A;  2P9S B;  3DM2 A;  4KRE A;  4LF4 K;  3QFU A;  4I6M A;  4CIE A;  1SZ2 A;  1RT7 A;  4IDH A;  4FVU A;  5EU7 A;  3AO1 A;  2IS3 A;  3A5M C;  3H6E A;  1QVG M;  2YI1 A;  1DTQ A;  4V19 S;  2YNH A;  3SJH A;  4LD0 A;  2Z1H A;  3QIN A;  4ISE A;  4H8K A;  1MDU B;  3LM2 A;  2NRV A;  2NRR A;  1CLQ A;  5LJW A;  4ELU A;  4JYA K;  2YHY A;  2ZE2 A;  4BR5 A;  1XNQ K;  1VRU A;  3QO9 A;  4YY3 K;  4BDZ A;  3R6M A;  4JKF A;  4A2A A;  2V7Y A;  5DM7 L;  3VQQ A;  3H46 O;  2HBK A;  4FWR A;  2HHH K;  1RTJ A;  4M3R A;  2ZQB A;  4OPK A;  1ZBU A;  3CHW A;  4L8R B;  1JL2 A;  1UWB A;  2P51 A;  3MCA B;  3CCS N;  3QEI A;  3RRG A;  4FM0 A;  2DTU A;  3OYM A;  3JS6 A;  1O13 A;  3PIO L;  5B8H A;  5ELZ A;  2P9U B;  4DTU A;  4DV3 K;  4RCH A;  1YIJ N;  1U49 A;  5AQY A;  2VCP A;  1EKE A;  4FM1 A;  4FJ8 A;  2Q1N A;  2QXL A;  4ZTF A;  4K42 A;  3VQ7 A;  4BC4 A;  4C1N K;  5F0X A;  3EO3 A;  1Q9X A;  3AVH A;  1HNI A;  2WC9 A;  3IRX A;  3O9S A;  5KPZ A;  3EN9 A;  2Z1I A;  4FJH A;  2RN2 A;  3THY B;  3HVT A;  4A2B A;  1S1V A;  4A57 A;  1Q9Y A;  4CK1 A;  2FBY A;  3U6F A;  1RFQ A;  3UB5 A;  5KRS A;  3UIQ A;  3OYN A;  5AQO A;  3NVM A;  1IBL K;  3KVG A;  1VQ8 N;  3LL3 A;  4J8F A;  2HHS A;  4NB4 A;  3NBP A;  4DMN A;  5ADX H;  2HBJ A;  4X65 K;  5LY3 A;  3M8S A;  1JLQ A;  3TAQ A;  4CFB A;  4FJK A;  2NUB A;  4BRN A;  1K9M O;  1REV A;  4QOZ B;  3KJV A;  3AA4 A;  3U4L A;  2UXC K;  3G71 N;  4E1N A;  5AQQ A;  3KLI A;  3M6G A;  3ULE A;  1P8Z A;  2HHQ A;  1IKV A;  3RRH A;  4IEI A;  5KQD A;  3ZEU B;  4DTX A;  3MEG A;  5KI6 A;  2XO7 A;  5LJV A;  3KKS A;  1LW2 A;  2F9W A;  4E19 A;  1TL1 A;  4TSX A;  3I55 N;  2HST A;  4IOC L;  3J80 O;  4BR4 A;  5C15 A;  2Q0U A;  5GAG P;  3UE5 A;  4WQ5 C;  4JI2 K;  2AJQ A;  2HHV A;  1ZBI A;  2OPR A;  2QWP A;  3VQ5 A;  5JS1 A;  4MO5 A;  3VQD A;  4K0K K;  2HBM A;  4H5T A;  2UUC K;  1NGA A;  3E1Y A;  3ZX3 A;  4B9V A;  4AQY K;  3SAF A;  2P9K B;  3MX2 A;  3DLL L;  4IBN A;  3U8X A;  1HPZ A;  4IWV A;  2YNG A;  4C23 A;  2Q31 A;  2W6K A;  2ASO A;  1D9D A;  1W2B M;  2PZS A;  4MLH A;  4W5T A;  5AZJ A;  2PAV A;  3WQU A;  5TKW A;  2V51 B;  2O8B A;  5SWM A;  3O3H A;  2VWB A;  4K43 A;  4BRK A;  1JLG A;  4DV4 K;  3TI0 A;  4MQ3 A;  4DFJ A;  3OBW A;  3AVI A;  2QM1 A;  1IJJ A;  1M90 O;  3SQ0 A;  3E01 A;  2YKN A;  3Q7C A;  1NK8 A;  1Q8I A;  1UAX A;  1GLB G;  1X3N A;  4AHT A;  3J8A A;  3LAM A;  3S3N A;  5F1X A;  5C12 A;  2FBX A;  2YNF A;  4NO7 A;  3CJ9 A;  4CGJ A;  2HND A;  4CD3 A;  3SZ2 A;  1WOQ A;  4H03 B;  3O9Q A;  4AHS A;  1N36 K;  4C8K A;  3MN7 A;  2F96 A;  3K9K A;  1WSE A;  5KPT A;  3G0Z A;  2BUP A;  4DTR A;  1KSP A;  1I39 A;  1T6C A;  3VA0 A;  3ITH A;  1NMN A;  2NLX A;  4CJR A;  3GBT A;  4BVP A;  5M1K A;  3B6O A;  3THX B;  5BR8 K;  2ASM A;  1L5U A;  2QA4 N;  1X9M A;  4BGB A;  4AHC A;  3V9W A;  3CC4 N;  4DQQ A;  4DUZ K;  1JCE A;  4ID5 A;  1NOZ A;  2W40 A;  4CER A;  3UKR A;  2DFF A;  3C0B A;  4B1V A;  3ZT2 A;  4W5Q A;  4H4O A;  3ZT3 A;  3J7Y P;  5F2R A;  4CFA A;  2KFN A;  1MWK A;  3PX4 A;  2IIR A;  3RMC A;  4CES A;  1JJ2 M;  1E4F T;  1BI4 B;  4IOX A;  2CGK A;  3THY A;  3LDL A;  4JKG B;  1X9S A;  4FJJ A;  3NF8 A;  1KRP A;  4BDP A;  2ITM A;  3CFR A;  2IOC A;  1L3U A;  1VQ6 N;  3RSE A;  1NK5 A;  3SCX A;  3AVF A;  2V7Z A;  3VEZ A;  5GAH P;  1X9J A;  1BWF O;  4JHD B;  2BE2 A;  3CJC A;  3C95 A;  3ZET A;  2CGJ A;  4KH6 A;  4JI1 K;  3BF3 A;  3CMA N;  3EZ5 A;  1BHL A;  1YUW A;  2Q2R A;  3AO4 A;  1IV0 A;  2Q3S A;  4LC9 B;  1DEJ A;  1WAJ A;  3NVK A;  5CY4 A;  4FW2 A;  4H0T B;  1LOT B;  3HT3 A;  2Q97 A;  4UY8 O;  3H3O B;  3NF7 A;  3PO5 A;  1TK8 A;  4W5N A;  1N6Q A;  4JI0 K;  3WXJ A;  2P5O A;  4FM2 A;  3O5B A;  1FJG K;  4KFB A;  4B3T K;  1RBR A;  4H0P A;  4Z4G A;  5CE3 A;  5DK5 A;  4O0J A;  2FSN A;  4CJ5 A;  1S22 A;  3GG4 A;  1VHX A;  1QZ6 A;  2I5J A;  2GWK A;  5ADX A;  3EYZ A;  4MFB A;  1J53 A;  3IAY A;  2VG5 A;  2D1K A;  3MWP A;  3VMF B;  3CG7 A;  4A5A A;  3AO5 A;  3CJ7 A;  3CI5 A;  3QDK A;  4HTU A;  3SYZ A;  5I42 A;  2FXU A;  4JRP A;  4C1N I;  4IJA A;  1VQO N;  3TR8 A;  4CGH A;  4G9Z A;  1RT2 A;  2E2O A;  3QNN A;  3WXI A;  3TPQ A;  3NFA A;  2X6S A;  4M41 A;  3KHY A;  4BRM A;  1GLJ O;  5AQK A;  3ULD A;  1RTD A;  2HHX A;  2HOE A;  3M8Q A;  4FJX A;  2BH1 A;  3R1X A;  3WT0 A;  5HOO A;  3SQ2 A;  4Z4F A;  2O8D B;  4YOR A;  4U7B A;  1IKW A;  4CJW A;  4BY9 C;  4LH5 A;  2B6A A;  4KO0 A;  2D4W A;  3SK3 A;  1NK4 A;  3NE6 A;  1T7P A;  2PBD A;  4IOA L;  5GIO A;  5CYM A;  2ETJ A;  3M8P A;  1J54 A;  1WNS A;  3R9P A;  4O4G A;  4FWL A;  3VN5 A;  1ZC6 A;  2HMP A;  2P5G A;  3LP3 A;  3P83 D;  4QS7 A;  1SKR A;  4IKF A;  2O8F A;  4X64 K;  3SBG A;  4KHU A;  2FF3 B;  3KLH A;  3TAE A;  3O9U A;  1BIZ A;  1NGH A;  3HM9 A;  2RE2 A;  3SBT A;  2Y1I A;  4OPA A;  4O8U A;  1QVF M;  5EVZ A;  4CIG A;  4B08 A;  3VES A;  4Y1C A;  2W41 A;  4AHR A;  4E7J A;  3O1B A;  1XHZ A;  4DKW A;  3VEV A;  4L3Q A;  1QSY A;  3SUO A;  4BG9 A;  4DUY K;  4LY7 A;  3K0S A;  1G99 A;  2X78 A;  4Z4E A;  3LDQ A;  1HNV A;  1HMV A;  2QW9 A;  3ZSZ A;  1WSI A;  2E1Z A;  3C65 A;  5BN9 A;  2OYQ A;  4E89 A;  4F3T A;  1JCF A;  4GV6 A;  3NH0 A;  1EET A;  3VGL A;  4CK3 A;  2GUI A;  3T69 A;  3M5R A;  4BQL A;  4CZK A;  3D45 A;  4FK2 A;  2G8K A;  1QTM A;  3QET A;  5C24 A;  1I94 K;  4K8Z A;  4FOE A;  1KVB A;  3KKR A;  3NGY A;  3HPH A;  1EWR A;  3ZSQ A;  3RMD A;  3S3O A;  1RDU A;  4N76 A;  5AQI A;  2YHW A;  1W0H A;  4G1Q A;  3SJJ A;  4OVL A;  3IUC A;  3CCE N;  2VGN A;  3NCI A;  1JLE A;  3ZET B;  3L0Q A;  1SL0 A;  1TUY A;  3QFP A;  4IXC A;  3VGM A;  1LV5 A;  1NK9 A;  4A5B A;  1WSF A;  3CM6 A;  5FPE A;  1OH5 A;  3OYD A;  4CD1 A;  4I9L A;  4OKE A;  1KC8 O;  3PLA A;  2I7N A;  4J2E A;  3JAM O;  1G15 A;  1E3M A;  3I8D A;  5AZI A;  1BOT O;  3S9H A;  3VEO A;  1VQL N;  1ASU A;  1YXQ A;  4A61 A;  2E8A A;  2E6L A;  5JS2 A;  5AZJ B;  3OTO K;  5BRH A;  4EAH D;  4XH4 A;  1XUP O;  4CJE A;  3A5N C;  3B6P A;  1RDC A;  1T6D A;  3C6A A;  4DR7 K;  3M3Z A;  4DQS A;  3E66 A;  5CZ2 A;  5C2D A;  1RT1 A;  5JLH A;  3V9Z A;  3T7Z A;  3OYI A;  1A5V A;  4RTF D;  3TAF A;  3PSI A;  3AVK A;  4GKK K;  2EWS A;  3CJA A;  1J5E K;  3D2E B;  2QWM A;  1OH7 A;  1WSH A;  5BR9 A;  1Q18 A;  1NJX A;  1NJW A;  3RR8 A;  3PIP L;  4Z94 A;  4EP5 A;  4IJN A;  5CR4 A;  4DSL A;  4M3T A;  4FJG A;  1QQN A;  4LFC K;  4DLE A;  1SV5 A;  5M1P A;  1N34 K;  1Z05 A;  3LZI A;  1S5J A;  5T7B A;  3KZB A;  3MN5 A;  1KTQ A;  4KHP K;  5DMR A;  3VET A;  2QEX N;  4FK0 A;  3CCL N;  4CK2 A;  3QIP A;  1NOY A;  4O44 A;  4B9U A;  1BCO A;  1GLD G;  4GMJ B;  3C7N B;  5M1O A;  3KK2 A;  4I7F A;  4OGC A;  4NXM K;  1JXB A;  2XHB A;  3DYA A;  4FO0 A;  4Y0W A;  3JXU A;  3MXI A;  2XRI A;  4JKG A;  4GVE A;  3C6H A;  5AQW A;  3SUQ A;  4BRD A;  5LMN K;  3ZSO A;  4B1Y B;  4KPY A;  1KLN A;  1ATN A;  4KHW A;  1BA0 A;  3DLG A;  3BF1 A;  3KD5 E;  4DR3 K;  4FWO A;  1KAX A;  4BGA A;  1X3M A;  4KHQ A;  3GL1 A;  2DY4 A;  3LAL A;  1QSS A;  2QWQ A;  5HL7 L;  3L2Q A;  2HHW A;  1QQM A;  3RR7 A;  3SPY A;  2YKM A;  3RSE B;  4ZTJ A;  1HQE A;  2QWN A;  2A1S A;  3F73 A;  5AZI B;  3SV4 A;  1C1B A;  4CHZ A;  3K9J A;  2G8V A;  2D0P A;  3KK7 A;  4NCG A;  4PY5 A;  5M1Q A;  3VPZ A;  3LWL A;  2P9L B;  3ISN C;  4JD2 A;  1FK9 A;  4DSJ A;  4OPH A;  1NGG A;  2E4L A;  3K57 A;  4DQP A;  1BQM A;  5FPD A;  4CZF A;  1VQM N;  5E26 A;  3CIP A;  1NNE A;  5IT9 O;  2A6A A;  4PL7 A;  4LSN A;  5I9E B;  4PQU A;  2F8S A;  3ASM A;  2O8B B;  3E9L A;  1B9D A;  4E3S A;  1RBV A;  2PYL A;  1SQK A;  2A42 A;  4R5P A;  2FSK A;  4AHU A;  1DTT A;  3HYF A;  1YJ9 N;  4MDB A;  5GAE P;  3UKU B;  4M7X A;  2KKZ A;  3THW B;  3D2E A;  4FXD A;  4CJS A;  4E7H A;  4RWT A;  3LM9 A;  2P9P B;  1S6P A;  4ZHR A;  2GX9 A;  3K2P A;  3A5O C;  4NLC A;  2DFH A;  2R7Y A;  4HUE A;  1BO5 O;  3H08 A;  1WB9 A;  4M3W A;  5FPN A;  3NHG A;  1VQ4 N;  3ENB A;  1N5Y A;  4KH5 A;  4KH4 A;  1BIU A;  2WUS A;  3CCQ N;  3HRG A;  3K59 A;  1TL3 A;  3VQ4 A;  3FZM A;  1DLO A;  1Y64 A;  2JWK A;  5CZ1 A;  1GOB A;  2V52 B;  4N47 A;  3QML A;  2OPS A;  1U2V B;  2E20 A;  2ZJQ L;  3U3Y A;  3TTF A;  3AO2 A;  4RW7 A;  1TVR A;  4O0I A;  3C6U A;  3OYL A;  4GNI A;  4FWN A;  3THX A;  1WBB A;  3DI6 A;  4XH5 A;  5LMU K;  2BTF A;  2OPP A;  1X1P A;  1JLF A;  2O8D A;  4FLZ A;  1ZXO A;  3ZX2 A;  5M1N A;  1RGI A;  3CJB A;  4FCY A;  2A41 A;  1NGJ A;  1B9F A;  2OAN A;  1KQS M;  1I3A A;  2F9T A;  4GV9 A;  1Q86 O;  4BAC A;  4AM7 A;  4KI4 A;  3NF9 A;  2B4J A;  5HBM A;  1JLA A;  1VSD A;  4DQI A;  1QHA A;  4ELT A;  4B3O A;  4DSI A;  1TKZ A;  2QWO A;  3SPZ A;  1CZ9 A;  4BRH A;  4B3R K;  3ZSR A;  4FWS A;  4BR0 A;  4DFK A;  3AO3 A;  1R59 O;  1FKO A;  3MMV A;  3ZSV A;  3LZJ A;  4KB0 A;  4FLU A;  1T44 A;  3W3D A;  4J2D A;  4YOX A;  1ATR A;  3LP2 A;  4OKK A;  1C0U A;  4F2R A;  4YNQ A;  1BA1 A;  3V1R A;  2KLA A;  3NGZ A;  3CXC M;  3WXL A;  1WSJ A;  1HNW K;  4H4M A;  4KAZ A;  3SUP A;  1N33 K;  3QBX A;  4DV7 K;  4IG3 A;  2QWL A;  4RW9 A;  1EQY A;  3PSF A;  3AVG A;  1NM1 A;  3IFR A;  4FJN A;  4HTL A;  1HUX A;  3DXM B;  4B8A B;  4A59 A;  4LF7 K;  5E41 A;  3L4Q A;  4CZH A;  3AGK A;  4WE1 A;  4CZL A;  3AAQ A;  4BRF A;  1HJR A;  2KHO A;  1YTA A;  4N5S A;  3VQ9 A;  1S1X A;  4AM6 A;  3QIC A;  2GBZ A;  3AV9 A;  1VSF A;  4K41 A;  3AA3 A;  3D6R A;  4X62 K;  4E7I A;  4LF6 K;  4KRF A;  4FJI A;  1ZBH A;  4RW6 A;  3A2F A;  1GLC G;  3HK2 A;  1D4X A;  2QKB A;  3D0P A;  4CEO A;  5KQ8 A;  1XWL A;  2A40 A;  4CHO A;  4DCH A;  3MEE A;  2RF2 A;  4M7Y A;  4FPB A;  5AFU H;  2O8C A;  3B8A X;  2X6N A;  4LF5 K;  5J2M A;  2KTQ A;  3L8B A;  4GY2 B;  4FLW A;  2OA8 A;  3BY5 A;  4CF9 A;  3IDH A;  3VF2 A;  2X74 A;  2BDP A;  4DTS A;  1U4B A;  1HKB A;  3THW A;  1YHQ N;  1K6Y A;  3HI0 A;  3DLB A;  4OLB A;  1NLV A;  3D7E O;  5KPR A;  4QS8 A;  4F9O A;  2QTD A;  1MA9 B;  3T19 A;  4CZG A;  4EHT A;  1TK0 A;  5EX5 A;  4KTW A;  3S41 A;  2G8U A;  3WNE A;  1D5A A;  4CJK A;  1C0G A;  1T8E A;  4B9S A;  3V4I A;  4K25 A;  5GAD P;  3O80 A;  4CF8 A;  1P90 A;  1RT3 A;  3QEP A;  3L6Q A;  2P9N B;  4B1X B; 
#chains in the Genus database with same CATH homology
 1YVU A;  3NH0 A;  1HYS A;  1EET A;  4CK3 A;  5HRP A;  4CIE A;  2GUI A;  2VWJ A;  1RT7 A;  1S6Q A;  2KQ2 A;  3CYM A;  3D45 A;  3AO1 A;  3I0S A;  5EU7 A;  4EP4 A;  1X9W A;  2G8K A;  2IS3 A;  4FK2 A;  1QTM A;  1C0M A;  4Z0U A;  3QET A;  5J2P A;  1DTQ A;  4NCB A;  5C24 A;  2OZM A;  4K8Z A;  2YNH A;  1KVB A;  4N41 A;  1WLJ A;  3KKR A;  3KK3 A;  3TAP A;  1SUQ A;  3NGY A;  4LD0 A;  3KLE A;  2Z1H A;  3HPH A;  1L3S A;  1ZBF A;  3ZSQ A;  1KLM A;  3QIN A;  3RMD A;  3S3O A;  4N76 A;  4H8K A;  3L3U A;  2HHU A;  2P1J A;  1W0H A;  4G1Q A;  3SJJ A;  4OVL A;  2YV0 X;  1TAU A;  4QAG A;  4CF2 A;  1GOC A;  3NCI A;  1CLQ A;  1RDA A;  2HHT A;  3LPU A;  3V6D A;  1JLE A;  4ELU A;  1VSJ A;  2ZE2 A;  3M8R A;  4ELV A;  2PYJ A;  1VRU A;  3BGR A;  1U48 A;  3QO9 A;  4AH9 A;  4DS5 A;  1VSL A;  4BDZ A;  1RCH A;  4RW8 A;  1SL0 A;  4F2S A;  3THV A;  3MEC A;  3VQQ A;  2Z1G A;  1NK9 A;  2LSN A;  3DOL A;  3SNN A;  1LV5 A;  2IGI A;  2RPI A;  1RTJ A;  1WSF A;  4Q5V A;  3OVN A;  4M3R A;  3QES A;  2ZQB A;  3CM6 A;  3PV8 A;  3KD1 E;  4LSL A;  4CGF A;  4OPK A;  3OS1 A;  1ZBU A;  3OYD A;  1J9A A;  4JRQ A;  4HHT A;  4FLY A;  1JL2 A;  4L8R B;  1UWB A;  2P51 A;  1KVC A;  1VSH A;  3C94 A;  3KIO A;  5KGW A;  4FM0 A;  3OYM A;  3QEI A;  3RRG A;  2WON A;  2BAN A;  1TAQ A;  4I9L A;  4OKE A;  3QER A;  3K5O A;  4DTU A;  3VQ8 A;  2G8F A;  3OYH A;  3ALY A;  1U49 A;  4OLA A;  3MED A;  4J2E A;  2IAJ A;  2EHG A;  3LP0 A;  1G15 A;  4NYN A;  1EKE A;  3OYA A;  3V1Q A;  1JL1 A;  3I8D A;  4FM1 A;  3DRP A;  4CCH A;  4FJ8 A;  3ZSY A;  2HNY A;  3S9H A;  4B8C A;  1ASU A;  4JS5 A;  2E6L A;  5JS2 A;  4ZTF A;  3VQ7 A;  2G8W A;  4B9N A;  4CHN A;  2D0B A;  3L2U A;  1WSG A;  1B92 A;  1Q9X A;  3AVH A;  4DFP A;  4CJE A;  1NK0 A;  1HNI A;  3CFP A;  3EY1 A;  1VSM A;  4DSK A;  3B6P A;  3KLG A;  3IRX A;  1RDC A;  3L2R A;  3V81 A;  2DFE A;  3ZSX A;  2Z1I A;  4FJH A;  2RN2 A;  4C8N A;  3HVT A;  2Y1J A;  4E1M A;  1S1V A;  1Q9Y A;  4CK1 A;  3VQP A;  2FBY A;  3U6F A;  1GOA A;  4DQS A;  5CZ2 A;  1R0A A;  3C6T A;  5KRS A;  3OYC A;  1RT1 A;  3V9Z A;  5HLF A;  3OYN A;  3OYI A;  3UIQ A;  3RWU A;  1A5V A;  3T3F A;  3S3M A;  1ASW A;  3AVB A;  3TAF A;  4IG0 A;  3HP9 A;  3AVK A;  3NH1 A;  3ZT0 A;  4DTM A;  1BCM A;  4CJU A;  2HHS A;  3NBP A;  4DMN A;  1WAF A;  2W42 A;  1WSH A;  5HRR A;  3V1O A;  4YFU A;  3M8S A;  2FC0 A;  4FK4 A;  1U45 A;  3MAQ A;  1NJZ A;  1NJX A;  3AVM A;  3SV3 A;  1JLQ A;  4CJ3 A;  3BDP A;  1NJW A;  4JS4 A;  5K14 A;  3TAQ A;  4CFB A;  1TK5 A;  4FJK A;  4E7K A;  3O4Q A;  3LDS A;  2NUB A;  3RR8 A;  2HNZ A;  4Q0B A;  4CEA A;  1REV A;  3OYJ A;  4EP5 A;  4QOZ B;  3RMA A;  4DSL A;  4J2A A;  4M3T A;  3KJV A;  4FJG A;  3AA4 A;  4CEF A;  1BQN A;  2VG7 A;  4DLE A;  1JLC A;  3P5J A;  1SV5 A;  1IO2 A;  4E1N A;  1J5O A;  3OYE A;  3KLI A;  2PY5 A;  3LZI A;  5J2N A;  1S5J A;  2HHQ A;  5T7B A;  1IKV A;  1HRH A;  5HRS A;  1KTQ A;  3OYK A;  2JGU A;  3RRH A;  5DMR A;  4DTX A;  3DMJ A;  3MEG A;  5KI6 A;  2XO7 A;  4GW6 A;  4RG8 A;  3KKS A;  4FK0 A;  4GVM A;  3QIP A;  4CK2 A;  1NK7 A;  1LW2 A;  1EX4 A;  4E19 A;  1NOY A;  4FZY A;  4O44 A;  1C6V A;  4B9U A;  4M3U A;  1BCO A;  1TL1 A;  4TSX A;  3O3G A;  3HVR A;  4DLG A;  4HUF A;  4QCL A;  4GMJ B;  1D8Y A;  3KK2 A;  4I7F A;  2HMI A;  4M3Y A;  4OGC A;  1JXB A;  3PY8 A;  3QEX A;  4HCB A;  2KZM A;  2AJQ A;  2XHB A;  3DYA A;  1C1A A;  4HVJ A;  1ASV A;  1XI1 A;  3NF6 A;  4AIL C;  2HHV A;  1MU2 A;  3MXI A;  2XRI A;  1ZBI A;  2OPR A;  3VQ5 A;  3PX6 A;  3RMB A;  5JS1 A;  3VQD A;  3SUQ A;  3ZSO A;  4KPY A;  3FFI A;  1BGX T;  1KLN A;  4O55 A;  4B9V A;  4KHW A;  3DLG A;  5D3G A;  4CHQ A;  4IBN A;  1IH7 A;  3KD5 E;  1HPZ A;  1S9E A;  1BI4 A;  4CEC A;  4FLT A;  4O5B A;  2YNG A;  4FJ5 A;  3K58 A;  4KHQ A;  4EZ6 A;  1UOC A;  1L3T A;  4KV8 A;  2DY4 A;  3KLF A;  3LAL A;  4CJP A;  1D9D A;  1QSS A;  2PZS A;  4W5T A;  3L2Q A;  4F4K A;  2HHW A;  1LAV A;  3DLE A;  3RR7 A;  2WOM A;  5SWM A;  3SPY A;  1EP4 A;  2YKM A;  3O3H A;  3QIO A;  4FLV A;  4ZTJ A;  3K5M A;  1JLG A;  1HQE A;  1RNH A;  2A1S A;  4CEQ A;  4CGD A;  3F73 A;  3TI0 A;  2A1R A;  4C8L A;  4MQ3 A;  1C0T A;  3SV4 A;  4B9T A;  4DFJ A;  1C1B A;  3AVI A;  3DOK A;  4KTZ A;  4CHZ A;  4CEE A;  4CIF A;  3NAE A;  2G8V A;  3SQ0 A;  3E01 A;  2YKN A;  4NCG A;  4DTJ A;  1IG9 A;  1RT5 A;  1RBT A;  5HRN A;  3LWL A;  2XY7 A;  1Q8I A;  1NK8 A;  1UAX A;  4PA1 A;  3ISN C;  4FJM A;  4PY5 A;  2DTU A;  1FK9 A;  4AHT A;  3LAM A;  4DSJ A;  3S3N A;  2E4L A;  1CXU A;  3O3F A;  2FBX A;  1BQM A;  4XIU A;  2YNF A;  3K57 A;  4DQP A;  1BL3 A;  4DWI A;  3VQB A;  4LH4 A;  5HRO A;  3HST B;  4CGJ A;  1FKP A;  4FVM A;  3OJU A;  2HND A;  4DTO A;  4FZZ A;  5KRT A;  3V9X A;  4FLX A;  1UA0 A;  3DLH A;  4LSN A;  2OPQ A;  3SZ2 A;  4PQU A;  4DFM A;  2F8S A;  3ASM A;  3SQ4 A;  2E6M A;  1NKE A;  3QLH A;  4W5O A;  1S1W A;  1B9D A;  4AHS A;  4CEB A;  1RBV A;  4E3S A;  1A5W A;  4C8M A;  2PYL A;  4C8K A;  2F96 A;  4CFC A;  4R5P A;  3K5N A;  4AHU A;  2XY8 A;  1DTT A;  1WSE A;  3HYF A;  4DS4 A;  1VSE A;  4OJR A;  4I2P A;  5FRO A;  3V9U A;  1KVA A;  3KK1 A;  2BGG A;  1QSL A;  4AHV A;  3G0Z A;  3JSM A;  4FXD A;  3OS2 A;  4OKJ A;  4DTR A;  3AVA A;  1KSP A;  4CGI A;  4CJS A;  2JLE A;  1I39 A;  3AVC A;  3DRS A;  3LP1 A;  4E7H A;  4E7L A;  3VA0 A;  3I0R A;  4IFY A;  3ITH A;  4DTN A;  3MXJ A;  3PO4 A;  4CJR A;  1S6P A;  3B6O A;  4ZHR A;  4FZX C;  4PUO A;  4J2B A;  1VSI A;  3K2P A;  3PUF A;  3K5L A;  1Y97 A;  1L5U A;  4CJT A;  3DLK A;  4Z4C A;  1RDD A;  4KTQ A;  4KB1 A;  1X9M A;  4M45 A;  2DFH A;  2R7Y A;  4HUE A;  1ZBL A;  3H08 A;  3F9K A;  1NKB A;  4PWD A;  3ZT4 A;  4M3W A;  4FJL A;  4AHC A;  3V9W A;  3IG1 A;  3VQ6 A;  3NHG A;  1N5Y A;  1IKY A;  4F3O A;  4DQQ A;  1T03 A;  1BIU A;  1RT4 A;  1LAW A;  2EX3 A;  3CQ8 A;  3QEV A;  1SL1 A;  3K59 A;  2HW3 A;  4ID5 A;  1NOZ A;  5I3U A;  1F21 A;  2HVI A;  1TL3 A;  1HYV A;  4CER A;  1TKT A;  2HVH A;  3VQ4 A;  2DFF A;  1SKS A;  1DLO A;  1ZYQ A;  3ZT2 A;  5CZ1 A;  4H4O A;  1GOB A;  2ATQ A;  3ZT3 A;  4W5Q A;  1XC9 A;  4N47 A;  4BE1 A;  3L3V A;  4W5R A;  2OPS A;  4CFA A;  2KFN A;  2F8T A;  4CED A;  3U3Y A;  1T05 A;  3PX4 A;  3AO2 A;  4RW7 A;  3WNF A;  1TVR A;  3RMC A;  1NKC A;  4O0I A;  4HCC A;  3C6U A;  4CES A;  3OYL A;  1BI4 B;  1WN7 A;  1LWE A;  1RBS A;  4OPJ A;  3DI6 A;  2KFZ A;  2OPP A;  1X9S A;  4FJJ A;  1JXE A;  1VRT A;  1QHT A;  1X1P A;  1JLF A;  3NF8 A;  3HP6 A;  1NK6 A;  1KRP A;  4BDP A;  4DF8 A;  4FLZ A;  3T1A A;  1TKX A;  3CFR A;  2IOC A;  1L3U A;  2KZZ A;  3TAM A;  4FCY A;  1NK5 A;  3SCX A;  4B9L A;  4DSF A;  3AVF A;  1B9F A;  3ZT1 A;  1YTU A;  1I3A A;  3HPG A;  1HYZ A;  4BAC A;  1KFD A;  2BE2 A;  1LWF A;  3KTQ A;  4KI4 A;  3C95 A;  3WNG A;  3NF9 A;  4CJV A;  4BE2 A;  1TGO A;  3NH2 A;  5J1E A;  1RIL A;  5C42 A;  4CFD A;  3EZ5 A;  3OJS A;  2B4J A;  3TAR A;  3NDK A;  2FBV A;  1JLA A;  1BHL A;  1VSD A;  4KKO A;  5HBM A;  4DQI A;  4ELT A;  4B3O A;  3AO4 A;  4DSI A;  2Q3S A;  1TKZ A;  3SPZ A;  1WAJ A;  4FW1 A;  3QEW A;  1CZ9 A;  4HUG A;  5CYQ A;  1Z25 A;  4M42 A;  5CY4 A;  4FW2 A;  3ZSR A;  2QKK A;  1C1C A;  1YT3 A;  3HPO A;  4DFK A;  3AO3 A;  3HT3 A;  1FKO A;  3OS0 A;  4NCA A;  3LAK A;  1CXQ A;  1RTH A;  3PO5 A;  3NF7 A;  3VQC A;  3ZSV A;  1LW0 A;  1TK8 A;  1N6Q A;  4RW4 A;  4W5N A;  2QXF A;  3LZJ A;  1NJY A;  4KB0 A;  2P5O A;  4F8R A;  4FM2 A;  4FLU A;  3ZCM A;  1RDB A;  4CF1 A;  4KFB A;  4J2D A;  4UQG A;  1RTI A;  1KFS A;  3LP2 A;  1RBR A;  4OKK A;  4CGG A;  1C0U A;  4F2R A;  4YNQ A;  4Z4G A;  4CJF A;  3V1R A;  5DK5 A;  2QK9 A;  2RKI A;  4O0J A;  4CJ5 A;  5KGX A;  3NGZ A;  4CHP A;  4KHN A;  3HJF A;  4NYF A;  3HO1 A;  2O4G A;  3VQA A;  1WSJ A;  4H4M A;  4KAZ A;  2I5J A;  3SUP A;  1BIS A;  3TWH A;  3OYB A;  4IDK A;  2KTQ A;  4IG3 A;  3RTV A;  4RW9 A;  3EYZ A;  4MFB A;  1J53 A;  3IAY A;  1QQC A;  3AVG A;  2VG5 A;  2YHB A;  3IS9 A;  1VSK A;  2VG6 A;  3CG7 A;  4ICL A;  4FJN A;  4EZ9 A;  3AO5 A;  2ITG A;  3TAN A;  4B8A B;  4HTU A;  3AA5 X;  5E41 A;  3SYZ A;  3HL8 A;  5I42 A;  2OZS A;  5KTQ A;  4WE1 A;  4BE0 A;  1HQU A;  3MXM A;  3CM5 A;  1TKD A;  1HJR A;  4N5S A;  1YTA A;  2FBT A;  4JRP A;  3QNO A;  1FXX A;  4CJQ A;  3TR8 A;  4CGH A;  3DRR A;  3CFO A;  3VQ9 A;  4M3Z A;  1RT2 A;  2D5R A;  3AVL A;  1S1X A;  3WNH A;  3QNN A;  4K8X A;  4Y1D A;  5FRN A;  2O4I A;  2XY6 A;  2GBZ A;  3AV9 A;  1VSF A;  3VQE A;  4I2Q A;  3U3G A;  4CF0 A;  4Z4I A;  3AA3 A;  3VA3 A;  3NFA A;  4E7I A;  1D9F A;  3DLR A;  2X6S A;  2KW4 A;  3AVJ A;  4M41 A;  1RBU A;  3SUN A;  3P1G A;  2G8I A;  3AA2 A;  4FJI A;  1ZBH A;  4KRF A;  4RW6 A;  3ULD A;  3ZSW A;  3A2F A;  1U04 A;  1RTD A;  4C8O A;  4FJ9 A;  3M8Q A;  4FJX A;  2HHX A;  4DU1 A;  2ZD1 A;  2QKB A;  3HK2 A;  4DU4 A;  3LAN A;  4DSE A;  4N56 A;  3OYF A;  3SQ2 A;  4M3X A;  3HXM A;  1O1W A;  4IFV A;  4CEO A;  4JLH A;  3D0P A;  4CHY A;  4DF4 A;  4Z4F A;  1A5X A;  1Z26 A;  1IKW A;  1XWL A;  4CJW A;  1JKH A;  4LH5 A;  2B6A A;  4KO0 A;  4CHO A;  5C25 A;  2G8H A;  4B9M A;  3MEE A;  1NK4 A;  2RF2 A;  3G10 A;  3NE6 A;  1S9G A;  1T7P A;  5FDL A;  2X6N A;  4DU3 A;  5CYM A;  1KCF A;  2ETJ A;  3M8P A;  1XHX A;  1J54 A;  5J2M A;  1ITG A;  1WNS A;  3L2W A;  4CJL A;  4ID1 A;  3L8B A;  3V9S A;  3SI6 A;  4KHY A;  4O4G A;  1CZB A;  4OGE A;  3VN5 A;  4BDY A;  4FLW A;  2P5G A;  4E0D A;  1TV6 A;  3LP3 A;  2OA8 A;  4DG1 A;  1RT6 A;  4CF9 A;  1JLB A;  3P83 D;  2X74 A;  4DQR A;  1SKR A;  4BWJ A;  4DTS A;  1U4B A;  2BDP A;  1SL2 A;  4IKF A;  2YHA A;  4FYD A;  3OYG A;  1SKW A;  5J2Q A;  2HB5 A;  4KHU A;  2VWK A;  3KLH A;  3TAE A;  4CJ4 A;  1K6Y A;  1VK0 A;  5SZT A;  1BIZ A;  1S1T A;  3LPT A;  3DLB A;  3LWM A;  5HP1 A;  4OLB A;  3HM9 A;  5FRM A;  4DTP A;  1QE1 A;  3TAB A;  3AVN A;  3T19 A;  2Y1I A;  2YNI A;  1TK0 A;  2D0C A;  3L2V A;  4KTW A;  4CIG A;  1W9H A;  4B08 A;  3TAG A;  2B5J A;  2G8U A;  4Y1C A;  3SQ1 A;  3O4N A;  3WNE A;  4AHR A;  4E7J A;  3NGI A;  1D5A A;  1XHZ A;  4CJK A;  4KI6 A;  1T8E A;  1QS4 A;  1IKX A;  4CE9 A;  2IC3 A;  1QSY A;  4B9S A;  3V4I A;  4KHS A;  1EXQ A;  3SUO A;  1L3V A;  2IDO A;  4I9Q A;  2D0A A;  4LY7 A;  3PX0 A;  3OY9 A;  2X78 A;  4Z4E A;  1HNV A;  1HMV A;  1UA1 A;  1S1U A;  4CEZ A;  3JYT A;  2GV9 A;  3ZSZ A;  1LWC A;  1WSI A;  4CF8 A;  4Z4H A;  1RT3 A;  2OYQ A;  4E89 A;  2XY5 A;  4F3T A;  4BWM A;  1U47 A;  3QEP A;  3DM2 A;  4FJ7 A;  4KRE A;  2Z1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...