3ZSWA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zswA00
3LZIA 4M3WA 4C8MA 1I3AA 1WSHA 1JLFA 4HTUA 1SL0A 4KO0A 1BGXT 5KRSA 2KQ2A 3SV3A 4CJEA 2VWKA 1IO2A 4CF9A 3OYEA 4AHVA 3AA3A 3O3FA 1RCHA 2IC3A 1SKWA 4M3XA 3AO3A 4KHWA 3S9HA 2Z1JA 3K5OA 4F4KA 4RW6A 3VQ5A 4W5TA 5FRNA 1BQMA 3ZSRA 3QO9A 4CHOA 1D5AA 3QETA 4N76A 4M3ZA 3QIPA 4OPJA 1G15A 2RF2A 1WSEA 3HP6A 2RPIA 1LWCA 2XHBA 2XY5A 4DQPA 5I42A 3TWHA 4EP4A 4M3YA 3C95A 3WNHA 1RTHA 1O1WA 4DTUA 4F2SA 3T3FA 3EYZA 1D8YA 4F8RA 3B6OA 3OJSA 4O5BA 2HHSA 3THVA 4CHZA 3CQ8A 4B9TA 4FJKA 2HHTA 2F96A 2ETJA 1RBVA 5SWMA 3AVJA 4FZYA 1WSGA 3ZT3A 1JL1A 2FBXA 5CZ2A 4CHYA 4JS5A 4O0IA 3L2VA 4FJ9A 3AV9A 4OKEA 3DOLA 2BGGA 2D0BA 5FDLA 3CFOA 4DTJA 2FBYA 4CFCA 4FW1A 3TANA 1D9FA 2X74A 2P5OA 3DOKA 1JLAA 1W9HA 1JKHA 3M8RA 3HK2A 4DTMA 3OYJA 3MXMA 4ELUA 4FXDA 2G8HA 4C8LA 4LSLA 4QCLA 3ULDA 1LW2A 4Y1CA 1S9EA 4CECA 1J9AA 4IG3A 2KTQA 5FRMA 1UOCA 3DRRA 4CJPA 4DSFA 3HSTB 4CJSA 1WSFA 1DTQA 1RBRA 1F21A 3QNNA 1RTIA 3KD1E 2XY6A 2PYLA 5KRTA 1JLEA 1FXXA 4LH5A 4BWJA 2X6NA 3IS9A 2ZQBA 3P1GA 4H4MA 3KK1A 3HO1A 4CJKA 4QOZB 2HHUA 2QKBA 1IKYA 4I2QA 4CGGA 2HHQA 3OVNA 3PV8A 2DFFA 3FFIA 1TKDA 2RKIA 1XC9A 3K2PA 3CFRA 1B9DA 5KI6A 1NOZA 4OLBA 4CGFA 1QSYA 4RW7A 1IKVA 3ZCMA 5J2NA 4DFJA 3QLHA 4BDZA 1C0MA 2XY8A 4FZXC 1J53A 3WNGA 3OYIA 1HNIA 3ZT0A 5CY4A 1NKBA 3AVKA 4E7IA 1SUQA 4E1MA 3KLIA 3DLRA 3OYHA 3SPZA 4AHUA 1TL1A 5CYQA 3NF8A 3ZT1A 1L3SA 1LWEA 3VN5A 4CEEA 2OZMA 1VSMA 4CJLA 2Z1IA 4GW6A 4OPKA 3JSMA 4E7LA 2KZMA 1TAUA 1WSIA 2O4GA 3VQ4A 4OLAA 1ZBIA 4KRFA 1TGOA 4E89A 3PX0A 5JS1A 5HLFA 3NH1A 2HHXA 3AVMA 3TI0A 4KAZA 4CEFA 3ITHA 4FCYA 3SYZA 3NGIA 1BI4B 2W42A 4C8OA 1RTDA 4CK3A 1ZBLA 1KLNA 4B8AB 4H4OA 1JXEA 3QEWA 4W5OA 3QNOA 1HYZA 4OGCA 3O4QA 4DU4A 1I39A 3SQ0A 5HRRA 5C42A 1LAVA 3SUPA 1Q8IA 3G0ZA 4CF2A 4B9MA 1RT5A 2G8UA 1ZBHA 1Q9YA 1BIZA 3ZSXA 1KVBA 1NOYA 3S3NA 1XWLA 1TV6A 3O4NA 3OY9A 2PYJA 3HM9A 3SUQA 3K5NA 4BACA 1RT4A 2E6LA 3NGZA 1C1CA 1TK8A 3ZSVA 4I9QA 4W5RA 3AVIA 1ASUA 1EX4A 1C0UA 4CJ5A 4L8RB 3SQ4A 2GUIA 4CJQA 4KHQA 2G8IA 3ZT2A 4OJRA 4KREA 4IBNA 5J2QA 3AA4A 1BIUA 4JLHA 4FVMA 5T7BA 1SL1A 1NK6A 4HUFA 4MFBA 4DQQA 3OYGA 3V6DA 4CEAA 4DU1A 4ELTA 1KCFA 1EETA 5HRPA 1KSPA 3U6FA 4CJUA 3QIOA 2PY5A 4B9LA 4DWIA 4M3TA 3NF6A 3KLHA 1BHLA 1HYVA 5J1EA 2HVHA 4ICLA 1SKSA 1RBSA 4W5QA 3MEDA 3AA5X 3TARA 1NJXA 4GVMA 3OYNA 3OYDA 2Z1GA 1S1XA 3KLGA 1NK0A 1N5YA 3PO4A 3NCIA 1U49A 4PWDA 1TAQA 4N56A 4HUGA 1D9DA 4CGJA 1FKOA 2XY7A 1CXUA 3K5MA 3K59A 3RTVA 3ZSZA 3VQ8A 2G8KA 2G8FA 3DLBA 3K58A 1RBTA 4KTZA 4CE9A 2BE2A 4BE2A 4KPYA 1KTQA 3V1RA 4E0DA 1JXBA 3F73A 4FJ7A 2HMIA 1S6PA 1S6QA 4FLUA 2B4JA 3DLGA 3RR8A 3CYMA 3VQPA 4DTSA 2KZZA 1J5OA 1A5WA 2HHVA 3TAQA 3ASMA 4IFYA 3OYCA 4G1QA 3DLHA 3MAQA 4B9NA 3MEGA 4CEDA 4Q5VA 3KK3A 4FW2A 1ZBFA 2VWJA 1QSSA 1JLBA 3DRPA 3A2FA 3HPHA 1YTAA 3HYFA 1BCMA 4DTNA 1SL2A 4XIUA 3AVGA 2BDPA 4K8ZA 1FKPA 1JLGA 1X9SA 1VSDA 1BISA 5JS2A 1NKEA 4C8KA 2DTUA 3T1AA 3V81A 4E1NA 5HBMA 1KVAA 1VSEA 2P1JA 3QEIA 1REVA 3HVTA 4KTWA 3NDKA 3OJUA 1W0HA 3NF7A 1TK5A 4M3UA 4E19A 4CEOA 4NCBA 4E7JA 1WLJA 3VQ9A 3VQBA 3V4IA 4CERA 5CYMA 4I9LA 4JRPA 3NF9A 4CIEA 3KLEA 3U3YA 2QK9A 1LAWA 2B5JA 2IS3A 4DMNA 3L2RA 4J2EA 1S9GA 5HP1A 5KGWA 4DQSA 1EXQA 3P83D 1HNVA 4DSIA 4Z4GA 1VSHA 4ID1A 1XI1A 1NJWA 2QKKA 3TAMA 4CIGA 5C24A 2P51A 3LALA 2Q3SA 4CK2A 3KK2A 3ZSOA 4FJHA 1VSLA 4O55A 1X1PA 2HNZA 4CEBA 4KB0A 3VQAA 2O4IA 4W5NA 4BDPA 2DFHA 3P5JA 2OPRA 4ZHRA 3HP9A 5K14A 5FROA 1U47A 4KHYA 3TR8A 4F3TA 1KFDA 2YNFA 1IH7A 1KLMA 3VQ6A 3V9ZA 1B92A 4CFAA 2YNHA 2DFEA 3E01A 3LP3A 3VA3A 3EZ5A 3LDSA 1HMVA 3MXJA 5EU7A 3PX4A 3SUOA 1HJRA 3SI6A 1T8EA 4QAGA 1NK4A 4LD0A 3RMAA 3TABA 1RDAA 2DY4A 4DTOA 2I5JA 1QQCA 3SJJA 4O0JA 3CM5A 4Z4CA 4Z4HA 3JYTA 4PY5A 4OKKA 4FLTA 4CJRA 4J2DA 1ASVA 5J2PA 4FLYA 2A1RA 3SQ1A 4HCBA 1C6VA 1YVUA 4IG0A 1UA1A 1VSKA 1YT3A 1BI4A 3L2UA 3PY8A 2IDOA 4BE0A 4DS4A 1ASWA 3LANA 3RMDA 3CFPA 4CF8A 4FLVA 3OYMA 3V9UA 4FJJA 4AHSA 4KI4A 4CGIA 1YTUA 2AJQA 2FBTA 3QERA 3V1QA 1BCOA 2VG6A 4NYNA 3WNEA 3VQEA 4DTRA 3DM2A 1NJYA 3DLKA 2JLEA 3AVFA 1MU2A 4Z4EA 3K57A 3SPYA 4J2AA 3G10A 4KFBA 3C94A 3DRSA 1GOCA 1A5VA 4FLWA 1S1UA 1JL2A 4B3OA 3L3UA 2ZD1A 2KFZA 1S1TA 3KIOA 3LWMA 2E4LA 4NYFA 4CJVA 3L8BA 3MXIA 4HUEA 1HPZA 1Z26A 1X9MA 4OKJA 4ZTFA 4RW9A 3RR7A 1TKTA 1HRHA 1WAJA 4B9SA 1RDDA 3NFAA 4E7HA 2D0AA 3NGYA 4OVLA 3L2QA 3S3OA 1NK8A 4Q0BA 3M8QA 3OYFA 1IKXA 2Y1JA 4FJ5A 1TKXA 3KTQA 2LSNA 1TL3A 1L3TA 1QS4A 1VRTA 5KTQA 4FJIA 2YHAA 1RILA 4J2BA 2GV9A 4BE1A 2ZE2A 4KKOA 3ISNC 2OPQA 4CJWA 3ZSWA 3CG7A 3V9SA 5E41A 4CHQA 4DS5A 1CZBA 1K6YA 1U45A 4CF0A 5I3UA 3RMBA 1A5XA 2BANA 4FJXA 1VRUA 1HQUA 2B6AA 2KFNA 4AHCA 2IGIA 4CJFA 1RT6A 3HPOA 1IG9A 1RT7A 4B9VA 2HNYA 3NBPA 3DI6A 4WE1A 4C8NA 3VQ7A 4BWMA 3V9WA 4FK4A 3SQ2A 4ELVA 3AVAA 4FK0A 1VK0A 3AA2A 1WSJA 1Y97A 1SKRA 4F2RA 3OYLA 3QINA 4CEQA 4FYDA 1TVRA 1RTJA 1S1VA 2P5GA 3HPGA 3D45A 3V9XA 4AHTA 3SUNA 4KI6A 3TAPA 1Z25A 3BGRA 4NCGA 3BDPA 2KW4A 4AHRA 4E3SA 1ZYQA 3RMCA 1NK9A 3KKRA 4LY7A 3D0PA 1NJZA 4PA1A 4DFPA 3KD5E 3NAEA 3L2WA 4RW8A 3AO4A 3LWLA 4PUOA 3ALYA 3NE6A 5C25A 3TAGA 3IAYA 3ZSQA 4CESA 4JS4A 4B08A 2XRIA 5DK5A 4DF4A 4KV8A 3TAEA 3HVRA 3I8DA 4AILC 3SCXA 3F9KA 3AO2A 2X78A 2GBZA 3SNNA 4DQRA 1U4BA 3KJVA 2D5RA 3NH2A 2Z1HA 4UQGA 3NH0A 3LZJA 4H8KA 1XHXA 2YKNA 3LP2A 3WNFA 4CHPA 2R7YA 1BL3A 5DMRA 4HHTA 4FLXA 1L5UA 1RBUA 1KRPA 4CEZA 3K5LA 1RNHA 1U48A 2HNDA 4YNQA 1QHTA 3QEXA 4B9UA 4O44A 4CHNA 4DSLA 3AVNA 4M45A 3QESA 1L3UA 3PO5A 1NK7A 4HCCA 4CGDA 4FM0A 3LPTA 4N5SA 2EHGA 3AO1A 4FK2A 1UAXA 2F8TA 1CLQA 4DTXA 2OYQA 4N47A 3O3GA 3PX6A 3RRGA 3DYAA 2YNGA 4DFKA 4E7KA 2PZSA 1VSFA 4CK1A 4Z0UA 4M3RA 4KB1A 3OYBA 5KGXA 4N41A 4FJMA 1VSIA 4I7FA 4CJ4A 4DSEA 1N6QA 4CFBA 4DSKA 5J2MA 1JLQA 1SV5A 2IOCA 1L3VA 4KHNA 2EX3A 2X6SA 3T19A 3L3VA 2OA8A 3LP1A 4LH4A 4OGEA 1T03A 1FK9A 1CXQA 1RT3A 1S1WA 2OPPA 3SV4A 2OZSA 1RDCA 2IAJA 4CF1A 2WONA 4K8XA 1UA0A 2YNIA 3QEVA 4FJGA 5HRSA 3PUFA 3VQCA 4CIFA 1S5JA 2F8SA 2JGUA 4DU3A 3IRXA 2G8WA 4DSJA 4F3OA 4FJLA 1VSJA 4Z4IA 2QXFA 3KLFA 1NK5A 4I2PA 1TKZA 1ZBUA 1WNSA 1HYSA 3AVBA 4DQIA 1LWFA 4MQ3A 1QE1A 1KVCA 4M42A 1RT2A 2HVIA 4PQUA 4Y1DA 4AH9A 5CZ1A 3AVLA 2ITGA 1Q9XA 2YV0X 1LV5A 3AVCA 4IKFA 4DG1A 4FZZA 3DLEA 1GOBA 1WAFA 3U3GA 2A1SA 2XO7A 3OS1A 1DTTA 4HVJA 1C1BA 1WN7A 4DF8A 5D3GA 2G8VA 1U04A 2ATQA 4FLZA 4YFUA 1IKWA 3EY1A 1EP4A 4DTPA 1C0TA 2VG7A 4EP5A 3HXMA 3RWUA 4RG8A 2WOMA 3I0RA 4CCHA 1J54A 3V1OA 1DLOA 1LW0A 3MEEA 3C6TA 3OYAA 2E6MA 3OS2A 4BDYA 4DFMA 4KHUA 3LAMA 3VQDA 1NKCA 4DLEA 4DLGA 1C1AA 1CZ9A 3LPUA 3O3HA 4EZ9A 1T7PA 3M8SA 3HT3A 2YKMA 3B6PA 3VA0A 2FBVA 3IG1A 1RT1A 4IFVA 4M41A 3NHGA 1RDBA 3KKSA 3HJFA 3SZ2A 2FC0A 1JLCA 4LSNA 1QSLA 1R0AA 4JRQA 1EKEA 4FJNA 4Z4FA 3DMJA 2D0CA 3H08A 3I0SA 4ID5A 4O4GA 5SZTA 4FM2A 3M8PA 3OS0A 4CGHA 3LP0A 2RN2A 4GMJB 1KFSA 3ZT4A 3QEPA 3UIQA 1B9FA 5HROA 3ZSYA 1XHZA 3VQQA 4FJ8A 2HW3A 2Y1IA 2HB5A 4RW4A 4IDKA 1X9WA 1HQEA 3HL8A 4CJTA 4FM1A 3LAKA 2NUBA 4B8CA 2OPSA 3CM6A 2HHWA 4CFDA 3C6UA 1ITGA 1BQNA 4ZTJA 1GOAA 4TSXA 1TK0A 1QTMA 4KTQA 1UWBA 3MECA 4CJ3A 3S3MA 4KHSA 4R5PA 4EZ6A 2VG5A 3AVHA 5HRNA 3RRHA 4NCAA 3AO5A 1T05A 3TAFA 3OYKA 2YHBA
chains in the Genus database with same CATH superfamily
3CCJN 4M3WA 4C8MA 3HI0A 1WSHA 5JVGL 1BGXT 5KRSA 3DWLA 4BRFA 2IVPA 3WXJA 4CJEA 3HTVA 1RCHA 2IC3A 1SKWA 4M3XA 5JLHA 2Z1JA 4YY3K 5KPRA 4MLEA 3ZSRA 4R79A 4M3ZA 2Q36A 4OPJA 1G15A 1WSEA 3HP6A 3TWHA 4EP4A 4CBXA 1D8YA 3O4WA 1XMQK 2HHSA 3THVA 2GEMA 4CHZA 4KBOA 2KKZA 3VERA 4B9TA 1RBVA 3ZT3A 2WFBA 3L2VA 4CZJA 3DOLA 2D0BA 3CFOA 4FW1A 3TANA 2QWMA 1D9FA 3TU5A 3H3OB 1K8KB 4BC5A 4EAHD 3OYJA 4ELUA 2G8HA 2VGNA 3ULDA 4CZIA 1S9EA 3DAWA 2KTQA 1UOCA 3C7NA 4X64K 4CJSA 1P90A 1WSFA 3ZEUA 5AQPA 5KRTA 3ZEUB 2X6NA 5IWAK 3IS9A 2HHUA 3KK1A 4I2QA 2CH5A 5AQSA 3W3DA 3UE5A 1XC9A 3K2PA 4CGFA 3ZCMA 4IDHA 1J53A 5CY4A 1NKBA 2D0OA 4E1MA 3TTCA 5CYQA 1L3SA 3VN5A 4H0XB 3ENOA 2Z1IA 3KHYA 3ID8A 1NMDA 4RCHA 5JS1A 2E1ZA 3AVMA 2O8BA 3TI0A 1NU0A 4CEFA 4FCYA 3SYZA 1BI4B 1TUYA 4CK3A 3KWIA 1XC3A 3EO3A 5M1KA 1QQMA 4H0YB 1C0FA 3O4NA 1YAGA 2Q2RA 3HM9A 3K5NA 2QWLA 4BACA 2E6LA 1TK8A 4I9QA 4W5RA 2F7TA 4K25A 4HUFA 1NGGA 4CEAA 5HRPA 3O08A 2FF6A 2O8CA 2PY5A 4DWIA 4M3TA 1HYVA 3F5TA 4BQLA 5J1EA 4K41A 3CJCA 4GVMA 1NK0A 4C1NK 4A57A 1FKOA 2XY7A 1CXUA 3GL1A 3K5MA 4WYBA 3VQ8A 2P9NA 3DLBA 4KPYA 4CE9A 4BE2A 4E0DA 4B1YB 4A61A 4FJ7A 3O1BA 3LDOA 1GLBG 1S6QA 3VQPA 1A5WA 3TAQA 1VQ9N 3ASMA 4IFYA 3K9KA 4M63C 4FW2A 1ZBFA 4DSJA 4HWIA 1SL2A 3HYFA 3HK2A 1BCMA 4JI2K 1T44A 5JS2A 1NKEA 1Z6RA 2DTUA 3FZHA 3T1AA 3O9UA 1FJGK 2HHHK 4JEPA 3F2KA 4KTWA 3NF7A 1ZC6A 3A5OC 1EQYA 4JD2A 4X62K 3NF9A 2HBLA 4CIEA 2ASOA 2QK9A 4A5BA 1I94K 1S9GA 4KHPK 4GKKK 1HNVA 2GWJA 1W97L 1NJWA 3KK2A 4CEBA 1GLDG 3VQAA 2W6KA 1NJIO 4ZHRA 3CJ9A 3GE1A 1GLCG 3HZ6A 1TYQB 5FROA 3SLCA 1KFDA 2UXBK 2BH1A 3VQ6A 2DFEA 3PX4A 2QI2A 1X9JA 1HJRA 3H6EA 4QAGA 4O8UA 2I5JA 1QQCA 4O0JA 3E66A 3CCMN 4PY5A 4FLTA 2QA4N 1QZ6A 5BRHA 5J2PA 2ITMA 5B8HA 4JI8K 1G99A 2HMPA 3EKSA 3FFKB 3IMXA 2IDOA 4BE0A 1ASWA 1ZBIA 3OYMA 3THXA 4CGIA 4DV5K 2AJQA 4GVEA 4DTRA 5KPTA 4Z4EA 4FWKA 1YJNN 4FLWA 1JL2A 4DHYA 3KIOA 3TSPA 2E4LA 3P39A 3UKUB 3VF4A 4CJVA 3LWMA 3L8BA 1X9MA 3TPQA 1XNRK 5JMVA 3RR7A 4E7HA 3OYFA 1IKXA 5AQYA 2P9LA 4DV7K 1TKXA 3KTQA 1TL3A 1L3TA 4YOUA 4B1WB 3SAFA 2P9LB 4J2BA 5AZIA 1GLFO 4BE1A 4LF8K 4KKOA 4BC3A 3I8BA 2UXCK 4IJNA 3ZSWA 3CG7A 3V9SA 4CHQA 2FSNA 1CZBA 5AZIB 4CF0A 3RMBA 1A5XA 1BU6O 2BANA 2B6AA 4X65K 4AHCA 4IO9L 4CJFA 3A5MC 1IG9A 3NBPA 4FK4A 3M5RA 2P9SB 3LDLA 1JCGA 3ULEA 3I33A 3T7ZA 2P5GA 3HPGA 2YHWA 3GDQA 4DKWA 3TAPA 1Z25A 3SMSA 3BDPA 4E3SA 3KKRA 4LY7A 4NLBA 4IEEA 3D0PA 1NJZA 3KD5E 3L2WA 4JK8A 4HTLA 4JKBA 3LWLA 4PUOA 2WUSA 1NNEA 1NGIA 3RVCA 1T3VA 3IAYA 4BR0A 4CESA 5DK5A 4DF4A 3HVRA 4AILC 3SCXA 3AO2A 3KJVA 3CI5A 2Z1HA 5E26A 3C6HA 3LZJA 3OBYA 5FPMA 3T1HK 1K73O 3WNFA 4FLXA 5DMRA 3H46O 1VHXA 1RBUA 4CEZA 3K5LA 1RNHA 4YOWA 1QHTA 3HOSA 5LJWA 3QEXA 1BA0A 3DXMA 4B1VA 4M45A 4WQ4A 1U6ZA 4CGDA 3THYA 3C65A 1Q18A 1WBBA 4N5SA 2F8TA 4FK2A 3LDNA 3N4QA 5LMUK 3VGLA 1CLQA 3O3GA 3O9QA 4EHTA 1OH6A 4E7KA 2CGLA 4IJAA 4CK1A 1HNXK 2UU9K 4N41A 4GNIA 5M1PA 1JLQA 1L3VA 2EX3A 3BUZB 3QBXA 4BRQA 3L3VA 5DM7L 3LP1A 4LH4A 2HF3A 4OGEA 1FK9A 1S1WA 5AQLA 2OZSA 3C6AA 3LL3A 5GIPA 4A62A 3J80O 4K8XA 4PKGA 5LJVA 3CMAN 4FJGA 5HRSA 2NRZA 2G8WA 1VSJA 2QXFA 1TKZA 2CGJA 1YVNA 1HNWK 1BOTO 4KH5A 4MQ3A 1BUPA 1KVCA 3KK7A 4Y1DA 1Q9XA 1LV5A 3AVCA 2ZGZA 3AAPA 3U3GA 1VQ7N 1WN7A 4YFUA 4DTPA 4B3SK 3OBWA 1NGFA 2VG7A 5AQXA 4RG8A 2WOMA 4BGAA 3L4QA 3V1OA 3EL2A 1DLOA 4IWVA 1NKCA 2QTDA 2Q97A 4DLGA 2ZJQL 1CZ9A 3HT3A 2YKMA 3CJ1A 3NHGA 5LL6Z 3HJFA 4LSNA 2ZM6K 1EKEA 2KHOA 3I0SA 3MK6A 4FM2A 3M8PA 4CGHA 5EOYA 1KFSA 5GAHP 3ZT4A 3QEPA 1B9FA 1XHZA 3DXKA 3VOVA 2QWOA 2HB5A 4RW4A 5M1OA 3FR0A 3HL8A 4FM1A 2NUBA 4B8CA 2OPSA 3DXKB 2ZF5O 3CM6A 2HHWA 4J2AA 1QTMA 4KTQA 4IOAL 4CJ3A 3S3MA 4KHSA 4R5PA 4GV3A 3ZETB 1FW6A 1BWFO 3AO5A 1X9SA 1N36K 4HCBA 3LZIA 4FOIA 1OH8A 2KQ2A 4JN4A 4AHVA 2QW9A 4LF6K 4M7YA 4JI6K 5AQGA 3I55N 3VQ5A 4W5TA 3QO9A 3QETA 4N76A 4JI4K 2RPIA 1LWCA 5I42A 1IV0A 3C95A 4YOYA 1RTHA 1O1WA 1YHQN 3T3FA 5BPLA 3EYZA 2RE2A 3OJSA 5I9EB 2F4VK 3CQ8A 3H1QA 2F96A 2ETJA 4FZYA 1Q81O 3CCEN 4OKEA 4PL8A 3UKRB 4FWSA 4DV6K 1HKCA 2P5OA 1JLAA 4CZHA 3M8RA 3SJHA 4C8LA 3MCPA 1LW2A 1BG3A 4CECA 2QWQA 4CJPA 2FXUA 4JHDB 5AQMA 1F21A 4BRGA 3O9RA 3H45C 3R3LA 2PYLA 1FXXA 4LH5A 4WFBL 4H4MA 1BA1A 1IKYA 4CGGA 3OVNA 1TKDA 1ZBSA 1NOZA 3WQUA 1IKVA 4I6MA 4BDZA 3J7AP 2JWKA 2XY8A 3WNGA 4I6MB 3ZT0A 3WQTA 3KLIA 5AQKA 1TL1A 4C23A 5DM6L 3BZKA 3JSMA 5AQZA 4E7LA 2KZMA 5C15A 4IOCL 2V52B 1DEJA 3NH1A 2HHXA 4AM7A 1HKGA 4JKHA 3VENA 3NGIA 5C10A 2O8DA 2BUPA 2V51B 4MDAA 2P9UA 4H0PA 4H4OA 5BN9A 4BRIA 5AQOA 2P9UB 3WT0A 3QEWA 4W5OA 3HM8A 2QXLA 1HYZA 3VPZA 3D2FA 3SUPA 1Q8IA 4B9MA 1RT5A 3EE8A 4CD3A 1ZBHA 1BIZA 1KVBA 3OY9A 3VF6A 3SUQA 3ZSVA 4KH4A 3AVIA 1ASUA 2NRXA 4CJ5A 3ATUA 3SQ4A 4CJQA 4DR1K 3IUCA 3AA4A 5T7BA 4JLHA 4FVMA 1SL1A 3V6DA 4AF1A 4DU1A 3LDQA 3U6FA 3MN9A 4QS9A 4Y0WA 1D4XA 4ICLA 2OTLN 1RBSA 1N5YA 2NRVA 4CBUA 3PO4A 4PWDA 3NVKA 2HBMA 1VQLN 4F9OA 1IBMK 3K59A 1RBTA 4KTZA 3PSIA 3WEEB 3V1RA 3F73A 2IIRA 4FLUA 3RR8A 3CYMA 4BR7A 2KZZA 1J5OA 2HHVA 4JKFA 3DLHA 2UXDK 3MEGA 4Q5VA 3KK3A 1QSSA 5H1SQ 3A2FA 4DTNA 2BDPA 3AVGA 4MLHA 1MWMA 5M1FA 1K8KA 1KVAA 3P31A 1REVA 3HSCA 3NDKA 2VCPA 4M7XA 4CEOA 1WBDA 1WLJA 3CPWM 4I9LA 4JRPA 3CC2N 3KLEA 5FLXO 1LAWA 5KGWA 1ATRA 3DLLL 2AP1A 5C24A 3O1WA 4CK2A 3Q7BA 3ZSOA 4O55A 2HNZA 2O4IA 4KB0A 3FZFA 3P5JA 4OX9K 2ASPA 4PHTX 3HP9A 3IKMA 4KHYA 1C0GA 2YNFA 4DV0K 2ZJPL 4CFAA 3HOTA 3E01A 3SUOA 2G8UA 3EZ5A 3LDSA 1HMVA 3MXJA 3SI6A 4MDBA 1NK4A 3EE9A 3G25A 4Z4CA 3VESA 1Y64A 3SQ1A 2HSTA 1NMNA 4GV6A 4IG0A 1UA1A 1K9MO 5BREA 1YT3A 1BI4A 3L2UA 3PY8A 5AQFA 1YTUA 3V9UA 1VQ8N 4AHSA 3FLCO 4KI4A 4BRNA 3V1QA 2EWSA 2JLEA 3AVFA 1XMOK 3K57A 3SPYA 3G10A 3W0LA 1A5VA 4CZGA 2O8EA 1S1UA 3L3UA 2KFZA 5GIOA 3MDQA 3L0QA 2A40A 3ATVA 2O8EB 4A5AA 4B3RK 3MXIA 5KPZA 4HUEA 1HPZA 1Z26A 3BY5A 5BR8K 4H5VA 1HRHA 1WAJA 3R6MA 4JKEA 1RDDA 2D0AA 3NGYA 3S3OA 1NGEA 3FZMA 1NK8A 2Y1JA 4FJ5A 3AAQA 5KTQA 5EX5A 2ZE2A 3CCRN 4YDUC 4DS5A 1K6YA 1U45A 1YJWN 1LOTB 2KFNA 5EXWA 2UUCK 5AQNA 1RT7A 1KAYA 4B9VA 4C8NA 3DI6A 3LDPA 4WE1A 3VQ7A 4BWMA 3V9WA 3THWB 3BZCA 4FK0A 1VK0A 3AA2A 1Y97A 3CIPA 3QINA 2Q1NA 3WUHA 5AFUA 4FYDA 3V9XA 3D7EO 3JAMO 2KW4A 1ZYQA 3QICA 5AQTA 3RMCA 3JXUA 3FGUA 1NGHA 4PA1A 4BROA 3NAEA 4RW8A 4DR4K 3P38A 4JS4A 2XRIA 3TAEA 3QFUA 3AGRA 2ZJRL 2GBZA 5GAGP 2NRTA 2FF3B 4H8KA 3OA9A 3MN6A 5AQQA 1NG9A 1EO1A 1L5UA 3F9MA 1KRPA 1U48A 2HNDA 4B1ZA 4B9UA 3A0IX 2CH6A 4NB4A 4LFAK 2HBJA 4B1UB 4CHNA 3PO5A 3EN9A 4HCCA 4FM0A 1J6ZA 5KQ8A 2IVNA 3LPTA 1UAXA 3J8AA 2OYQA 3PX6A 1OVQA 2NRRA 4DV4K 3RRGA 3DYAA 1TYQA 4YDUA 1JJ2M 4IO8A 4Z0UA 3TTFA 5KGXA 3GG4A 4FJMA 4CJ7A 4CJ4A 4IOXA 1N6QA 1SV5A 2IOCA 2QM1A 4KHNA 2OANA 1T03A 2W40A 5EY4A 1CXQA 3SV4A 4PKHA 2WONA 4BC2A 4JV5K 4K43A 5BR9A 1E3MA 3VQCA 2P9IB 2JGUA 4FJLA 4Z4IA 4I2PA 4XH4A 1QVGM 1T6DA 4IFEA 4PKIA 2ITGA 2ZWHA 2YV0X 4IKFA 4DG1A 4FZZA 4IZ9A 1WAFA 2XO7A 3CCSN 3UKUA 1C1BA 4BR5A 1U04A 4ISGA 1C0TA 4EP5A 3HXMA 5JVHL 1J54A 3CCUN 5F2RA 3OYAA 2E6MA 3VQDA 3NVMA 2YCHA 1C1AA 1KQSM 3O3HA 1T7PA 2FBVA 3IG1A 4IFVA 1WB9A 3KZBA 1HX1A 1RDBA 3SZ2A 4WF9L 2FC0A 4EFHA 3G4SN 4JK9A 4YOXA 3DMJA 3ZYYX 2E5LK 2YJEA 2RN2A 4ISEA 2P9SA 3R8EA 3ZSYA 1HQEA 1DKGD 3LAKA 3R9PA 3SBTA 2PAVA 1ITGA 1BQNA 1GOAA 2VG5A 5HRNA 3R1XA 1T05A 2YHBA 1I3AA 1JLFA 4HTUA 1SL0A 3SV3A 4ISFA 3CD6N 4JKCA 2VWKA 4CF9A 3JS6A 2UUBK 3AA3A 4KHWA 5BRFA 3S9HA 4RW6A 5FRNA 1BQMA 4CHOA 1D5AA 3QIPA 2GTDA 4DQPA 2XHBA 2XY5A 4M3YA 3WNHA 4H5NA 2YJFA 3ZX2A 3B6OA 5AQUA 4FJKA 2HHTA 5SWMA 1WSGA 3EEQA 1JL1A 4JS5A 4CHYA 4FJ9A 4O0IA 3O9SA 3AV9A 2BGGA 4DTJA 4CFCA 4Z94A 4BR9A 3MCAB 3DOKA 1W9HA 1JKHA 2FLOA 3MXMA 5TKYA 4QCLA 2E2NA 4Y1CA 4G9ZA 4DSFA 1DTQA 4CZMA 1RBRA 1RTIA 1SS6A 1JLEA 5ADXH 2ZQBA 3P1GA 1IBKK 4CJKA 3K9JA 2HHQA 3FFIA 1WOQA 2RKIA 3CFRA 2A3ZA 4BRKA 4DV2K 1B9DA 5KI6A 3VEXA 3KWGA 4RW7A 3QLHA 1C0MA 3D2EB 1HNIA 3A8YA 5IT9O 3O5BA 4E7IA 4FWPA 5C2FA 3OYHA 3DLRA 4NLCA 3VEYA 4AHUA 4BC4A 2DPNA 4BRDA 4GW6A 1TAUA 3T1YK 1WSIA 3VQ4A 3PX0A 5HLFA 3ENHA 3ITHA 5AQWA 2W42A 2D0PA 1RTDA 1KLNA 2VGMA 5GAEP 3U4LA 2QWNA 5BN8A 4KH6A 3MN5A 1DT9A 1JXEA 2D1KA 4XEIA 4OGCA 1JCEA 3O4QA 4DU4A 3CJ7A 4FOEA 3AY9A 3G0ZA 3MWPA 1S3XA 2A41A 1XWLA 1RT4A 5GADP 2HF4A 3NGZA 1C1CA 1EX4A 1C0UA 2GUIA 1VQNN 4UY8O 4YORA 3ZT2A 4OJRA 2G8IA 4IBNA 4KREA 5J2QA 1OVYA 3ZETA 1BIUA 2KLAA 1IBLK 4DQQA 3OYGA 1KCFA 3E9LA 1KSPA 4ILHA 4DQ8A 2YI1A 3KLHA 4XH5A 1K8AO 4W5QA 3MEDA 1NJXA 3OYNA 3OYDA 1S1XA 1TAQA 1D9DA 4CGJA 3ZSZA 3MWTA 3CHWA 2G8FA 3K58A 2BE2A 4JI1K 1QQOA 3ZX3A 4JK7A 3LM2A 1S6PA 2BTFA 3DLGA 3M6GA 3CJAA 3ZX0A 5M1NA 3OYCA 4G1QA 4B9NA 4CEDA 3DRPA 5AQIA 1YTAA 3UKRA 2NNWA 5AQRA 1VSDA 1VQPN 5LY3A 3V81A 2QWPA 5HBMA 4E1NA 1VAZA 1YXQA 1NGBA 2P1JA 2UUAK 3OJUA 1W0HA 4U67L 4BG8A 4E19A 4NCBA 4E7JA 3VQ9A 3RSEA 3VQBA 4CERA 5CYMA 5JICA 1VQMN 3U3YA 3RSEB 3J81O 2IS3A 4JHDA 4B1XB 4DQSA 3P83D 4Z4GA 4A2AA 2QKKA 1N34K 2P51A 4E1JA 2PFUA 4MO4A 4DV1K 4DR2K 4W5NA 1QQNA 4JKDA 4FL9A 1RDUA 4WFNL 1U47A 2CGKA 3TR8A 3D6RA 4AM6A 1E4GT 1KLMA 2YHYA 1VQ4N 1B92A 2YNHA 3VA3A 5EU7A 1T8EA 3MMVA 4QS7A 4CZLA 3RMAA 1RDAA 3PSFA 3SJJA 3CM5A 4GY2B 3U9ZA 4Z4HA 3CCVN 1YUWA 1VQ6N 4CJRA 4H0OA 1ASVA 2E2OA 4DR7K 3EZWA 4FLYA 1ZXOA 5AZJA 4DS4A 5AZJB 3CFPA 4CF8A 4FJJA 3TSUA 2FBTA 1BCOA 2VG6A 4FPAA 3VQEA 3DLKA 2VQEK 5BPNA 2Q0RA 3DRSA 4LF9K 4B3OA 2ZD1A 2OTJN 1S1TA 4NYFA 4CBWA 1M90O 1P8ZA 4OKJA 2VQFK 4B9SA 1KXPA 3NFAA 4OVLA 3L2QA 3M8QA 5C12A 2OCEA 4FWRA 2LSNA 3GBTA 5BRDA 2YHAA 1HJOA 4CJWA 1N33K 3CQXA 5EVZA 1RGIA 2I7NA 1HQUA 3L4IA 5AJ3K 3CPEA 2IGIA 2GELA 3HPOA 3CETA 5KQDA 3SQ2A 4MO5A 3CCQN 3MX5A 4F2RA 2I7PA 3OYLA 4CEQA 1TVRA 4LF4K 3WEEA 1NBWA 1RTJA 1S1VA 3D45A 4AHTA 1Q86O 3SUNA 3BGRA 4AHRA 1NK9A 1HPMA 3GOIA 1YIJN 4BR2A 2F9WA 3VEWA 3TAGA 5GINA 3M1FA 5ELZA 2IVOA 1NWKA 4FWLA 1JCFA 1QHAA 4CZKA 4DV3K 3L6QA 2X78A 4CVNE 3SNNA 4DQRA 3NH2A 2YKNA 4CHPA 1BL3A 1MDUB 1X3NA 1EWQA 1XUPO 3AVNA 3QESA 1L3UA 1NK7A 1S22A 2EHGA 4JKGA 4DTXA 4N47A 4DFKA 2NRHA 2PZSA 4JKGB 1WUAA 4M3RA 4KB1A 3OYBA 5AQJA 5LMNK 4DSEA 2V7YA 4EHUA 1T6CA 5HL7L 3J7ZO 4WFAL 2X6SA 3T19A 3AGKA 5BPMA 4NXNK 2A5XA 4BRCA 4A59A 2OPPA 1RT3A 3C7NB 4CF1A 3SAGA 2YNIA 2GUPA 4H5RA 1S5JA 2F8SA 4YOTA 3IRXA 4F3OA 4DB3A 3KLFA 4L3QA 1ZBUA 4H5TA 1WNSA 1HYSA 3SAHA 3AVBA 4DQIA 2ZGYA 1LWFA 1QE1A 4CD1A 1RT2A 4PQUA 4AH9A 5CZ1A 3AVLA 3QDKA 4H0VB 2E1YA 4BREA 4BRMA 1DTTA 4HVJA 4JYAK 3SK3A 4O8KA 1IKWA 1W7AA 1EP4A 3QFPA 3CJBA 1LW0A 3OS2A 3FZLA 3LAMA 2O8BB 1GLJO 1VQ5N 4BR4A 4U7BA 1YITN 3M8SA 3B6PA 1ESVA 3VA0A 4OPAA 1RT1A 3KKSA 3CXCM 4DUYK 1JLCA 2GX9A 1R0AA 3VGKA 4CI6A 3H08A 4FO0A 3PLAA 5SZTA 4X66K 3OS0A 3LP0A 4GMJB 3THWA 2QEXN 1XNQK 2HW3A 4FJ8A 1ILYA 3E9PA 2Y1IA 4IDKA 4J8FA 2HBKA 5AR0A 4TSXA 1UWBA 3RRHA 4NCAA 1Z05A 3SMPA 1OH7A 3TAFA 3OYKA 3G71N 3VTHA 4KO0A 2O8CB 4A2BA 3OYEA 1IO2A 3M3ZA 3O3FA 3AO3A 2V7ZA 1N32K 3K5OA 2ASMA 1HNZK 3T69A 1NGDA 5AFUH 2WTUA 1NGJA 1IJJA 2RF2A 4FWOA 2P9NB 4DTUA 4F2SA 4F8RA 4O5BA 4XH1A 1V4SA 2YHXA 3AVJA 4JNEA 2FBXA 5CZ2A 3TTDA 5FDLA 3BEXA 2FBYA 1RFQA 2PBDA 2X74A 2FSKA 5FPDA 4FVUA 1S72N 1V4TA 1QVFM 4DTMA 4FXDA 4BQZA 4LSLA 5M1QA 2HOEA 4JD2B 3NMUA 1J9AA 4IG3A 1RDWX 5FRMA 3O6WA 3DRRA 3HSTB 3QNNA 3SBGA 4JI0K 3KD1E 2XY6A 3HBTA 4BWJA 3P4IA 2P9IA 3HO1A 4QOZB 2QKBA 3PV8A 2DFFA 1DGKN 3HRGA 2Q0UA 3Q7CA 4BVPA 4OLBA 1QSYA 1BO5O 1O13A 1ATNA 5J2NA 4DFJA 4FZXC 5FPNA 1NLVA 3OYIA 4DCHA 4WQ5C 3AVKA 1SUQA 3SPZA 3ZT1A 3NF8A 3MX2A 1LWEA 1R59O 3ID6A 4CEEA 1VSMA 4CJLA 4OPKA 4B3TK 3OHRA 2O4GA 4OLAA 4KRFA 1TGOA 4E89A 4KAZA 4BRAA 2J4RA 1YJ9N 4C8OA 1ZBLA 3BF3A 4B8AB 3THXB 1YI2N 3VTIA 1Q7YO 3QNOA 1I39A 3SQ0A 3CCLN 5HRRA 5C42A 1LAVA 4CF2A 4CZEA 1Q9YA 4FWNA 3ZSXA 1NOYA 2GWKA 3S3NA 1TV6A 2PYJA 3U9DA 2JWLA 2A6AA 1KC8O 3MN7A 3QBWA 3DJCA 5HOOA 1LCUA 2W6LA 5F0XA 4L8RB 1MWKA 4WQ4C 4KHQA 4OO1J 1NK6A 3O80A 4MFBA 1MA9B 4ELTA 1EETA 4V19S 3PIOL 4K42A 4CJUA 3QIOA 4B9LA 4YHHK 3H1VX 3NF6A 1BHLA 2HVHA 4FWQA 1SKSA 3N4PA 3AA5X 3TARA 4F4KA 3KLGA 2Z1GA 4WQ5A 3NCIA 1U49A 1J5EK 3WXKA 3VMFB 4N56A 4HUGA 3KVGA 3CERA 3RTVA 2G8KA 1KTQA 3ULEB 1JXBA 2HMIA 3ZLJA 2B4JA 1HLUA 1QZ5A 4DTSA 4H5WA 1N8RO 4B9QA 5MLCQ 3VETA 3MAQA 4DR3K 2VWJA 2WBNA 1JLBA 3HPHA 3TSQA 4K8ZA 4LC9B 4LF7K 4XIUA 3VEZA 1FKPA 1JLGA 1BISA 4C8KA 1VSEA 3QEIA 3PIPL 2Q31A 1TK5A 3HVTA 4M3UA 1H1VA 3V4IA 4BVOA 2F9TA 3H3NO 4DMNA 2B5JA 4B3MK 3L2RA 4J2EA 3WXIA 5HP1A 1ATSA 3A5LC 1EXQA 2E8AA 4DSIA 1VSHA 4ID1A 4RTFD 1XI1A 3TAMA 3DXMB 4CIGA 3LALA 4JKAA 2Q3SA 4FJHA 4IXCA 1VSLA 1X1PA 5ADXA 3THYB 4NO7A 3VGMA 4BDPA 2DFHA 4JI7K 2OPRA 4IEIA 4LF5K 2QWRA 4PL7A 5K14A 3VF2A 2UYTA 4F3TA 1IH7A 3D2EA 3V9ZA 1SAZA 3LP3A 2OZMA 2VWBA 4CZFA 3ENBA 3QB0A 4LD0A 1HKBA 1NM1A 3TABA 2DY4A 4DTOA 3JYTA 4OKKA 4J2DA 2WC9A 2A1RA 4BY9C 1C6VA 1YVUA 2NLXA 3FE1A 1VSKA 1YF5L 4LFCK 4DR6K 3RMDA 2VYPA 3LANA 4FLVA 4DUZK 1U2VA 3QERA 4NYNA 3WNEA 3DM2A 1NJYA 1U2VB 1MU2A 2D4WA 4C1NI 4KFBA 3C94A 2E20A 1GOCA 5FPEA 3O9TA 3FZKA 4BRPA 1GLAG 1SQKA 5CR4A 3G6EN 4ZTFA 4RW9A 1TKTA 4Q0BA 3UB5A 1W2BM 3BF1A 1QS4A 1VRTA 4FJIA 1RILA 4JI5K 2GV9A 3B8AX 3ISNC 2OPQA 4OPHA 5E41A 1XQSC 1VQKN 5AQHA 5I3UA 5A2QO 4FJXA 2E2PA 1VRUA 2W41A 4O5FA 4QS8A 1HR0K 2E88A 1RT6A 1CZAN 3BP8A 2HNYA 1IG8A 4BRLA 3OW2M 3AVAA 4ELVA 1WSJA 2P9KA 1SKRA 1OKJA 2E2QA 5CHIA 2NRWA 5F1XA 2P9KB 5E84A 3I56N 4KI6A 5TKWA 4BG9A 4NCGA 4DFPA 3AARA 3AO4A 3IFRA 1X3MA 3IDHA 3ALYA 3NE6A 5C25A 3CF5L 3ZSQA 4BGBA 4ILGB 4B08A 4KV8A 3I8DA 1KAZA 3J7YP 3F9KA 1SZ2A 1U4BA 2D5RA 4UQGA 3NH0A 1XHXA 3LP2A 2R7YA 4HHTA 1GLEG 1GLLO 3OTOK 3WXMB 2H3GX 4YNQA 1M1KO 4K0KK 2P9PA 4O44A 5C2DA 4DSLA 2P9PB 2NZTA 1Q82O 1KAXA 3AO1A 1VQON 2RHKA 1OH5A 2YNGA 4H03B 1VSFA 3WXLA 4JAXA 1VSIA 3E1YA 4I7FA 4DSKA 4CFBA 5J2MA 3O8MA 3S41A 4JI3K 4GKJK 4EIAA 3CC4N 2OA8A 4GV9A 2YX6A 4RWTA 1BDGA 1RDCA 3CMEN 2IAJA 5AQVA 5JLFA 1UA0A 3QEVA 3VEOA 3PUFA 4CIFA 3EKUA 4CW7B 4DU3A 5CE3A 1NK5A 3K0SA 3VEVA 4M42A 2HVIA 4AQYK 4NXMK 1EWRA 3DLEA 1GOBA 4WCEL 1NGAA 2A1SA 3OS1A 5D3GA 1HUXA 4DF8A 2G8VA 2ATQA 4FLZA 3EY1A 3RWUA 3CQYA 3C0BA 4CCHA 3I0RA 4LFBK 2O8FA 4KHUA 3MEEA 3C6TA 4BDYA 3QMLA 4DFMA 4ILJA 4DLEA 3U8XA 2O8FB 4FSVA 3LPUA 4YOVA 4EZ9A 2O8DB 5C0YA 1TUUA 4DR5K 1KD1O 4M41A 4FWMA 2FSJA 2AA4A 1QSLA 4JRQA 4FJNA 4Z4FA 1E4FT 2D0CA 3LM9A 1NGCA 3D2FB 4ID5A 4O4GA 4BRHA 3UIQA 4FPBA 3A5NC 5HROA 3VQQA 1X9WA 4H0TB 4CJTA 4CFDA 3C6UA 4ZTJA 3E9OA 1TK0A 2A42A 3MECA 4EZ6A 3AVHA 3CC7N
chains in the Genus database with same CATH topology
3LZIA 4M3WA 4C8MA 1I3AA 1WSHA 1JLFA 4HTUA 1SL0A 4KO0A 1BGXT 5KRSA 2KQ2A 3SV3A 4CJEA 2VWKA 1IO2A 4CF9A 3OYEA 4AHVA 3AA3A 3O3FA 1RCHA 2IC3A 1SKWA 4M3XA 3AO3A 4KHWA 3S9HA 2Z1JA 3K5OA 4F4KA 4RW6A 3VQ5A 4W5TA 5FRNA 1BQMA 3ZSRA 3QO9A 4CHOA 1D5AA 3QETA 4N76A 4M3ZA 3QIPA 4OPJA 1G15A 2RF2A 1WSEA 3HP6A 2RPIA 1LWCA 2XHBA 2XY5A 4DQPA 5I42A 3TWHA 4EP4A 4M3YA 3C95A 3WNHA 1RTHA 1O1WA 4DTUA 4F2SA 3T3FA 3EYZA 1D8YA 4F8RA 3B6OA 3OJSA 4O5BA 2HHSA 3THVA 4CHZA 3CQ8A 4B9TA 4FJKA 2HHTA 2F96A 2ETJA 1RBVA 5SWMA 3AVJA 4FZYA 1WSGA 3ZT3A 1JL1A 2FBXA 5CZ2A 4CHYA 4JS5A 4O0IA 3L2VA 4FJ9A 3AV9A 4OKEA 3DOLA 2BGGA 2D0BA 5FDLA 3CFOA 4DTJA 2FBYA 4CFCA 4FW1A 3TANA 1D9FA 2X74A 2P5OA 3DOKA 1JLAA 1W9HA 1JKHA 3M8RA 3HK2A 4DTMA 3OYJA 3MXMA 4ELUA 4FXDA 2G8HA 4C8LA 4LSLA 4QCLA 3ULDA 1LW2A 4Y1CA 1S9EA 4CECA 1J9AA 4IG3A 2KTQA 5FRMA 1UOCA 3DRRA 4CJPA 4DSFA 3HSTB 4CJSA 1WSFA 1DTQA 1RBRA 1F21A 3QNNA 1RTIA 3KD1E 2XY6A 2PYLA 5KRTA 1JLEA 1FXXA 4LH5A 4BWJA 2X6NA 3IS9A 2ZQBA 3P1GA 4H4MA 3KK1A 3HO1A 4CJKA 4QOZB 2HHUA 2QKBA 1IKYA 4I2QA 4CGGA 2HHQA 3OVNA 3PV8A 2DFFA 3FFIA 1TKDA 2RKIA 1XC9A 3K2PA 3CFRA 1B9DA 5KI6A 1NOZA 4OLBA 4CGFA 1QSYA 4RW7A 1IKVA 3ZCMA 5J2NA 4DFJA 3QLHA 4BDZA 1C0MA 2XY8A 4FZXC 1J53A 3WNGA 3OYIA 1HNIA 3ZT0A 5CY4A 1NKBA 3AVKA 4E7IA 1SUQA 4E1MA 3KLIA 3DLRA 3OYHA 3SPZA 4AHUA 1TL1A 5CYQA 3NF8A 3ZT1A 1L3SA 1LWEA 3VN5A 4CEEA 2OZMA 1VSMA 4CJLA 2Z1IA 4GW6A 4OPKA 3JSMA 4E7LA 2KZMA 1TAUA 1WSIA 2O4GA 3VQ4A 4OLAA 1ZBIA 4KRFA 1TGOA 4E89A 3PX0A 5JS1A 5HLFA 3NH1A 2HHXA 3AVMA 3TI0A 4KAZA 4CEFA 3ITHA 4FCYA 3SYZA 3NGIA 1BI4B 2W42A 4C8OA 1RTDA 4CK3A 1ZBLA 1KLNA 4B8AB 4H4OA 1JXEA 3QEWA 4W5OA 3QNOA 1HYZA 4OGCA 3O4QA 4DU4A 1I39A 3SQ0A 5HRRA 5C42A 1LAVA 3SUPA 1Q8IA 3G0ZA 4CF2A 4B9MA 1RT5A 2G8UA 1ZBHA 1Q9YA 1BIZA 3ZSXA 1KVBA 1NOYA 3S3NA 1XWLA 1TV6A 3O4NA 3OY9A 2PYJA 3HM9A 3SUQA 3K5NA 4BACA 1RT4A 2E6LA 3NGZA 1C1CA 1TK8A 3ZSVA 4I9QA 4W5RA 3AVIA 1ASUA 1EX4A 1C0UA 4CJ5A 4L8RB 3SQ4A 2GUIA 4CJQA 4KHQA 2G8IA 3ZT2A 4OJRA 4KREA 4IBNA 5J2QA 3AA4A 1BIUA 4JLHA 4FVMA 5T7BA 1SL1A 1NK6A 4HUFA 4MFBA 4DQQA 3OYGA 3V6DA 4CEAA 4DU1A 4ELTA 1KCFA 1EETA 5HRPA 1KSPA 3U6FA 4CJUA 3QIOA 2PY5A 4B9LA 4DWIA 4M3TA 3NF6A 3KLHA 1BHLA 1HYVA 5J1EA 2HVHA 4ICLA 1SKSA 1RBSA 4W5QA 3MEDA 3AA5X 3TARA 1NJXA 4GVMA 3OYNA 3OYDA 2Z1GA 1S1XA 3KLGA 1NK0A 1N5YA 3PO4A 3NCIA 1U49A 4PWDA 1TAQA 4N56A 4HUGA 1D9DA 4CGJA 1FKOA 2XY7A 1CXUA 3K5MA 3K59A 3RTVA 3ZSZA 3VQ8A 2G8KA 2G8FA 3DLBA 3K58A 1RBTA 4KTZA 4CE9A 2BE2A 4BE2A 4KPYA 1KTQA 3V1RA 4E0DA 1JXBA 3F73A 4FJ7A 2HMIA 1S6PA 1S6QA 4FLUA 2B4JA 3DLGA 3RR8A 3CYMA 3VQPA 4DTSA 2KZZA 1J5OA 1A5WA 2HHVA 3TAQA 3ASMA 4IFYA 3OYCA 4G1QA 3DLHA 3MAQA 4B9NA 3MEGA 4CEDA 4Q5VA 3KK3A 4FW2A 1ZBFA 2VWJA 1QSSA 1JLBA 3DRPA 3A2FA 3HPHA 1YTAA 3HYFA 1BCMA 4DTNA 1SL2A 4XIUA 3AVGA 2BDPA 4K8ZA 1FKPA 1JLGA 1X9SA 1VSDA 1BISA 5JS2A 1NKEA 4C8KA 2DTUA 3T1AA 3V81A 4E1NA 5HBMA 1KVAA 1VSEA 2P1JA 3QEIA 1REVA 3HVTA 4KTWA 3NDKA 3OJUA 1W0HA 3NF7A 1TK5A 4M3UA 4E19A 4CEOA 4NCBA 4E7JA 1WLJA 3VQ9A 3VQBA 3V4IA 4CERA 5CYMA 4I9LA 4JRPA 3NF9A 4CIEA 3KLEA 3U3YA 2QK9A 1LAWA 2B5JA 2IS3A 4DMNA 3L2RA 4J2EA 1S9GA 5HP1A 5KGWA 4DQSA 1EXQA 3P83D 1HNVA 4DSIA 4Z4GA 1VSHA 4ID1A 1XI1A 1NJWA 2QKKA 3TAMA 4CIGA 5C24A 2P51A 3LALA 2Q3SA 4CK2A 3KK2A 3ZSOA 4FJHA 1VSLA 4O55A 1X1PA 2HNZA 4CEBA 4KB0A 3VQAA 2O4IA 4W5NA 4BDPA 2DFHA 3P5JA 2OPRA 4ZHRA 3HP9A 5K14A 5FROA 1U47A 4KHYA 3TR8A 4F3TA 1KFDA 2YNFA 1IH7A 1KLMA 3VQ6A 3V9ZA 1B92A 4CFAA 2YNHA 2DFEA 3E01A 3LP3A 3VA3A 3EZ5A 3LDSA 1HMVA 3MXJA 5EU7A 3PX4A 3SUOA 1HJRA 3SI6A 1T8EA 4QAGA 1NK4A 4LD0A 3RMAA 3TABA 1RDAA 2DY4A 4DTOA 2I5JA 1QQCA 3SJJA 4O0JA 3CM5A 4Z4CA 4Z4HA 3JYTA 4PY5A 4OKKA 4FLTA 4CJRA 4J2DA 1ASVA 5J2PA 4FLYA 2A1RA 3SQ1A 4HCBA 1C6VA 1YVUA 4IG0A 1UA1A 1VSKA 1YT3A 1BI4A 3L2UA 3PY8A 2IDOA 4BE0A 4DS4A 1ASWA 3LANA 3RMDA 3CFPA 4CF8A 4FLVA 3OYMA 3V9UA 4FJJA 4AHSA 4KI4A 4CGIA 1YTUA 2AJQA 2FBTA 3QERA 3V1QA 1BCOA 2VG6A 4NYNA 3WNEA 3VQEA 4DTRA 3DM2A 1NJYA 3DLKA 2JLEA 3AVFA 1MU2A 4Z4EA 3K57A 3SPYA 4J2AA 3G10A 4KFBA 3C94A 3DRSA 1GOCA 1A5VA 4FLWA 1S1UA 1JL2A 4B3OA 3L3UA 2ZD1A 2KFZA 1S1TA 3KIOA 3LWMA 2E4LA 4NYFA 4CJVA 3L8BA 3MXIA 4HUEA 1HPZA 1Z26A 1X9MA 4OKJA 4ZTFA 4RW9A 3RR7A 1TKTA 1HRHA 1WAJA 4B9SA 1RDDA 3NFAA 4E7HA 2D0AA 3NGYA 4OVLA 3L2QA 3S3OA 1NK8A 4Q0BA 3M8QA 3OYFA 1IKXA 2Y1JA 4FJ5A 1TKXA 3KTQA 2LSNA 1TL3A 1L3TA 1QS4A 1VRTA 5KTQA 4FJIA 2YHAA 1RILA 4J2BA 2GV9A 4BE1A 2ZE2A 4KKOA 3ISNC 2OPQA 4CJWA 3ZSWA 3CG7A 3V9SA 5E41A 4CHQA 4DS5A 1CZBA 1K6YA 1U45A 4CF0A 5I3UA 3RMBA 1A5XA 2BANA 4FJXA 1VRUA 1HQUA 2B6AA 2KFNA 4AHCA 2IGIA 4CJFA 1RT6A 3HPOA 1IG9A 1RT7A 4B9VA 2HNYA 3NBPA 3DI6A 4WE1A 4C8NA 3VQ7A 4BWMA 3V9WA 4FK4A 3SQ2A 4ELVA 3AVAA 4FK0A 1VK0A 3AA2A 1WSJA 1Y97A 1SKRA 4F2RA 3OYLA 3QINA 4CEQA 4FYDA 1TVRA 1RTJA 1S1VA 2P5GA 3HPGA 3D45A 3V9XA 4AHTA 3SUNA 4KI6A 3TAPA 1Z25A 3BGRA 4NCGA 3BDPA 2KW4A 4AHRA 4E3SA 1ZYQA 3RMCA 1NK9A 3KKRA 4LY7A 3D0PA 1NJZA 4PA1A 4DFPA 3KD5E 3NAEA 3L2WA 4RW8A 3AO4A 3LWLA 4PUOA 3ALYA 3NE6A 5C25A 3TAGA 3IAYA 3ZSQA 4CESA 4JS4A 4B08A 2XRIA 5DK5A 4DF4A 4KV8A 3TAEA 3HVRA 3I8DA 4AILC 3SCXA 3F9KA 3AO2A 2X78A 2GBZA 3SNNA 4DQRA 1U4BA 3KJVA 2D5RA 3NH2A 2Z1HA 4UQGA 3NH0A 3LZJA 4H8KA 1XHXA 2YKNA 3LP2A 3WNFA 4CHPA 2R7YA 1BL3A 5DMRA 4HHTA 4FLXA 1L5UA 1RBUA 1KRPA 4CEZA 3K5LA 1RNHA 1U48A 2HNDA 4YNQA 1QHTA 3QEXA 4B9UA 4O44A 4CHNA 4DSLA 3AVNA 4M45A 3QESA 1L3UA 3PO5A 1NK7A 4HCCA 4CGDA 4FM0A 3LPTA 4N5SA 2EHGA 3AO1A 4FK2A 1UAXA 2F8TA 1CLQA 4DTXA 2OYQA 4N47A 3O3GA 3PX6A 3RRGA 3DYAA 2YNGA 4DFKA 4E7KA 2PZSA 1VSFA 4CK1A 4Z0UA 4M3RA 4KB1A 3OYBA 5KGXA 4N41A 4FJMA 1VSIA 4I7FA 4CJ4A 4DSEA 1N6QA 4CFBA 4DSKA 5J2MA 1JLQA 1SV5A 2IOCA 1L3VA 4KHNA 2EX3A 2X6SA 3T19A 3L3VA 2OA8A 3LP1A 4LH4A 4OGEA 1T03A 1FK9A 1CXQA 1RT3A 1S1WA 2OPPA 3SV4A 2OZSA 1RDCA 2IAJA 4CF1A 2WONA 4K8XA 1UA0A 2YNIA 3QEVA 4FJGA 5HRSA 3PUFA 3VQCA 4CIFA 1S5JA 2F8SA 2JGUA 4DU3A 3IRXA 2G8WA 4DSJA 4F3OA 4FJLA 1VSJA 4Z4IA 2QXFA 3KLFA 1NK5A 4I2PA 1TKZA 1ZBUA 1WNSA 1HYSA 3AVBA 4DQIA 1LWFA 4MQ3A 1QE1A 1KVCA 4M42A 1RT2A 2HVIA 4PQUA 4Y1DA 4AH9A 5CZ1A 3AVLA 2ITGA 1Q9XA 2YV0X 1LV5A 3AVCA 4IKFA 4DG1A 4FZZA 3DLEA 1GOBA 1WAFA 3U3GA 2A1SA 2XO7A 3OS1A 1DTTA 4HVJA 1C1BA 1WN7A 4DF8A 5D3GA 2G8VA 1U04A 2ATQA 4FLZA 4YFUA 1IKWA 3EY1A 1EP4A 4DTPA 1C0TA 2VG7A 4EP5A 3HXMA 3RWUA 4RG8A 2WOMA 3I0RA 4CCHA 1J54A 3V1OA 1DLOA 1LW0A 3MEEA 3C6TA 3OYAA 2E6MA 3OS2A 4BDYA 4DFMA 4KHUA 3LAMA 3VQDA 1NKCA 4DLEA 4DLGA 1C1AA 1CZ9A 3LPUA 3O3HA 4EZ9A 1T7PA 3M8SA 3HT3A 2YKMA 3B6PA 3VA0A 2FBVA 3IG1A 1RT1A 4IFVA 4M41A 3NHGA 1RDBA 3KKSA 3HJFA 3SZ2A 2FC0A 1JLCA 4LSNA 1QSLA 1R0AA 4JRQA 1EKEA 4FJNA 4Z4FA 3DMJA 2D0CA 3H08A 3I0SA 4ID5A 4O4GA 5SZTA 4FM2A 3M8PA 3OS0A 4CGHA 3LP0A 2RN2A 4GMJB 1KFSA 3ZT4A 3QEPA 3UIQA 1B9FA 5HROA 3ZSYA 1XHZA 3VQQA 4FJ8A 2HW3A 2Y1IA 2HB5A 4RW4A 4IDKA 1X9WA 1HQEA 3HL8A 4CJTA 4FM1A 3LAKA 2NUBA 4B8CA 2OPSA 3CM6A 2HHWA 4CFDA 3C6UA 1ITGA 1BQNA 4ZTJA 1GOAA 4TSXA 1TK0A 1QTMA 4KTQA 1UWBA 3MECA 4CJ3A 3S3MA 4KHSA 4R5PA 4EZ6A 2VG5A 3AVHA 5HRNA 3RRHA 4NCAA 3AO5A 1T05A 3TAFA 3OYKA 2YHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZI A;  4M3W A;  4C8M A;  1I3A A;  1WSH A;  1JLF A;  4HTU A;  1SL0 A;  4KO0 A;  1BGX T;  5KRS A;  2KQ2 A;  3SV3 A;  4CJE A;  2VWK A;  1IO2 A;  4CF9 A;  3OYE A;  4AHV A;  3AA3 A;  3O3F A;  1RCH A;  2IC3 A;  1SKW A;  4M3X A;  3AO3 A;  4KHW A;  3S9H A;  2Z1J A;  3K5O A;  4F4K A;  4RW6 A;  3VQ5 A;  4W5T A;  5FRN A;  1BQM A;  3ZSR A;  3QO9 A;  4CHO A;  1D5A A;  3QET A;  4N76 A;  4M3Z A;  3QIP A;  4OPJ A;  1G15 A;  2RF2 A;  1WSE A;  3HP6 A;  2RPI A;  1LWC A;  2XHB A;  2XY5 A;  4DQP A;  5I42 A;  3TWH A;  4EP4 A;  4M3Y A;  3C95 A;  3WNH A;  1RTH A;  1O1W A;  4DTU A;  4F2S A;  3T3F A;  3EYZ A;  1D8Y A;  4F8R A;  3B6O A;  3OJS A;  4O5B A;  2HHS A;  3THV A;  4CHZ A;  3CQ8 A;  4B9T A;  4FJK A;  2HHT A;  2F96 A;  2ETJ A;  1RBV A;  5SWM A;  3AVJ A;  4FZY A;  1WSG A;  3ZT3 A;  1JL1 A;  2FBX A;  5CZ2 A;  4CHY A;  4JS5 A;  4O0I A;  3L2V A;  4FJ9 A;  3AV9 A;  4OKE A;  3DOL A;  2BGG A;  2D0B A;  5FDL A;  3CFO A;  4DTJ A;  2FBY A;  4CFC A;  4FW1 A;  3TAN A;  1D9F A;  2X74 A;  2P5O A;  3DOK A;  1JLA A;  1W9H A;  1JKH A;  3M8R A;  3HK2 A;  4DTM A;  3OYJ A;  3MXM A;  4ELU A;  4FXD A;  2G8H A;  4C8L A;  4LSL A;  4QCL A;  3ULD A;  1LW2 A;  4Y1C A;  1S9E A;  4CEC A;  1J9A A;  4IG3 A;  2KTQ A;  5FRM A;  1UOC A;  3DRR A;  4CJP A;  4DSF A;  3HST B;  4CJS A;  1WSF A;  1DTQ A;  1RBR A;  1F21 A;  3QNN A;  1RTI A;  3KD1 E;  2XY6 A;  2PYL A;  5KRT A;  1JLE A;  1FXX A;  4LH5 A;  4BWJ A;  2X6N A;  3IS9 A;  2ZQB A;  3P1G A;  4H4M A;  3KK1 A;  3HO1 A;  4CJK A;  4QOZ B;  2HHU A;  2QKB A;  1IKY A;  4I2Q A;  4CGG A;  2HHQ A;  3OVN A;  3PV8 A;  2DFF A;  3FFI A;  1TKD A;  2RKI A;  1XC9 A;  3K2P A;  3CFR A;  1B9D A;  5KI6 A;  1NOZ A;  4OLB A;  4CGF A;  1QSY A;  4RW7 A;  1IKV A;  3ZCM A;  5J2N A;  4DFJ A;  3QLH A;  4BDZ A;  1C0M A;  2XY8 A;  4FZX C;  1J53 A;  3WNG A;  3OYI A;  1HNI A;  3ZT0 A;  5CY4 A;  1NKB A;  3AVK A;  4E7I A;  1SUQ A;  4E1M A;  3KLI A;  3DLR A;  3OYH A;  3SPZ A;  4AHU A;  1TL1 A;  5CYQ A;  3NF8 A;  3ZT1 A;  1L3S A;  1LWE A;  3VN5 A;  4CEE A;  2OZM A;  1VSM A;  4CJL A;  2Z1I A;  4GW6 A;  4OPK A;  3JSM A;  4E7L A;  2KZM A;  1TAU A;  1WSI A;  2O4G A;  3VQ4 A;  4OLA A;  1ZBI A;  4KRF A;  1TGO A;  4E89 A;  3PX0 A;  5JS1 A;  5HLF A;  3NH1 A;  2HHX A;  3AVM A;  3TI0 A;  4KAZ A;  4CEF A;  3ITH A;  4FCY A;  3SYZ A;  3NGI A;  1BI4 B;  2W42 A;  4C8O A;  1RTD A;  4CK3 A;  1ZBL A;  1KLN A;  4B8A B;  4H4O A;  1JXE A;  3QEW A;  4W5O A;  3QNO A;  1HYZ A;  4OGC A;  3O4Q A;  4DU4 A;  1I39 A;  3SQ0 A;  5HRR A;  5C42 A;  1LAV A;  3SUP A;  1Q8I A;  3G0Z A;  4CF2 A;  4B9M A;  1RT5 A;  2G8U A;  1ZBH A;  1Q9Y A;  1BIZ A;  3ZSX A;  1KVB A;  1NOY A;  3S3N A;  1XWL A;  1TV6 A;  3O4N A;  3OY9 A;  2PYJ A;  3HM9 A;  3SUQ A;  3K5N A;  4BAC A;  1RT4 A;  2E6L A;  3NGZ A;  1C1C A;  1TK8 A;  3ZSV A;  4I9Q A;  4W5R A;  3AVI A;  1ASU A;  1EX4 A;  1C0U A;  4CJ5 A;  4L8R B;  3SQ4 A;  2GUI A;  4CJQ A;  4KHQ A;  2G8I A;  3ZT2 A;  4OJR A;  4KRE A;  4IBN A;  5J2Q A;  3AA4 A;  1BIU A;  4JLH A;  4FVM A;  5T7B A;  1SL1 A;  1NK6 A;  4HUF A;  4MFB A;  4DQQ A;  3OYG A;  3V6D A;  4CEA A;  4DU1 A;  4ELT A;  1KCF A;  1EET A;  5HRP A;  1KSP A;  3U6F A;  4CJU A;  3QIO A;  2PY5 A;  4B9L A;  4DWI A;  4M3T A;  3NF6 A;  3KLH A;  1BHL A;  1HYV A;  5J1E A;  2HVH A;  4ICL A;  1SKS A;  1RBS A;  4W5Q A;  3MED A;  3AA5 X;  3TAR A;  1NJX A;  4GVM A;  3OYN A;  3OYD A;  2Z1G A;  1S1X A;  3KLG A;  1NK0 A;  1N5Y A;  3PO4 A;  3NCI A;  1U49 A;  4PWD A;  1TAQ A;  4N56 A;  4HUG A;  1D9D A;  4CGJ A;  1FKO A;  2XY7 A;  1CXU A;  3K5M A;  3K59 A;  3RTV A;  3ZSZ A;  3VQ8 A;  2G8K A;  2G8F A;  3DLB A;  3K58 A;  1RBT A;  4KTZ A;  4CE9 A;  2BE2 A;  4BE2 A;  4KPY A;  1KTQ A;  3V1R A;  4E0D A;  1JXB A;  3F73 A;  4FJ7 A;  2HMI A;  1S6P A;  1S6Q A;  4FLU A;  2B4J A;  3DLG A;  3RR8 A;  3CYM A;  3VQP A;  4DTS A;  2KZZ A;  1J5O A;  1A5W A;  2HHV A;  3TAQ A;  3ASM A;  4IFY A;  3OYC A;  4G1Q A;  3DLH A;  3MAQ A;  4B9N A;  3MEG A;  4CED A;  4Q5V A;  3KK3 A;  4FW2 A;  1ZBF A;  2VWJ A;  1QSS A;  1JLB A;  3DRP A;  3A2F A;  3HPH A;  1YTA A;  3HYF A;  1BCM A;  4DTN A;  1SL2 A;  4XIU A;  3AVG A;  2BDP A;  4K8Z A;  1FKP A;  1JLG A;  1X9S A;  1VSD A;  1BIS A;  5JS2 A;  1NKE A;  4C8K A;  2DTU A;  3T1A A;  3V81 A;  4E1N A;  5HBM A;  1KVA A;  1VSE A;  2P1J A;  3QEI A;  1REV A;  3HVT A;  4KTW A;  3NDK A;  3OJU A;  1W0H A;  3NF7 A;  1TK5 A;  4M3U A;  4E19 A;  4CEO A;  4NCB A;  4E7J A;  1WLJ A;  3VQ9 A;  3VQB A;  3V4I A;  4CER A;  5CYM A;  4I9L A;  4JRP A;  3NF9 A;  4CIE A;  3KLE A;  3U3Y A;  2QK9 A;  1LAW A;  2B5J A;  2IS3 A;  4DMN A;  3L2R A;  4J2E A;  1S9G A;  5HP1 A;  5KGW A;  4DQS A;  1EXQ A;  3P83 D;  1HNV A;  4DSI A;  4Z4G A;  1VSH A;  4ID1 A;  1XI1 A;  1NJW A;  2QKK A;  3TAM A;  4CIG A;  5C24 A;  2P51 A;  3LAL A;  2Q3S A;  4CK2 A;  3KK2 A;  3ZSO A;  4FJH A;  1VSL A;  4O55 A;  1X1P A;  2HNZ A;  4CEB A;  4KB0 A;  3VQA A;  2O4I A;  4W5N A;  4BDP A;  2DFH A;  3P5J A;  2OPR A;  4ZHR A;  3HP9 A;  5K14 A;  5FRO A;  1U47 A;  4KHY A;  3TR8 A;  4F3T A;  1KFD A;  2YNF A;  1IH7 A;  1KLM A;  3VQ6 A;  3V9Z A;  1B92 A;  4CFA A;  2YNH A;  2DFE A;  3E01 A;  3LP3 A;  3VA3 A;  3EZ5 A;  3LDS A;  1HMV A;  3MXJ A;  5EU7 A;  3PX4 A;  3SUO A;  1HJR A;  3SI6 A;  1T8E A;  4QAG A;  1NK4 A;  4LD0 A;  3RMA A;  3TAB A;  1RDA A;  2DY4 A;  4DTO A;  2I5J A;  1QQC A;  3SJJ A;  4O0J A;  3CM5 A;  4Z4C A;  4Z4H A;  3JYT A;  4PY5 A;  4OKK A;  4FLT A;  4CJR A;  4J2D A;  1ASV A;  5J2P A;  4FLY A;  2A1R A;  3SQ1 A;  4HCB A;  1C6V A;  1YVU A;  4IG0 A;  1UA1 A;  1VSK A;  1YT3 A;  1BI4 A;  3L2U A;  3PY8 A;  2IDO A;  4BE0 A;  4DS4 A;  1ASW A;  3LAN A;  3RMD A;  3CFP A;  4CF8 A;  4FLV A;  3OYM A;  3V9U A;  4FJJ A;  4AHS A;  4KI4 A;  4CGI A;  1YTU A;  2AJQ A;  2FBT A;  3QER A;  3V1Q A;  1BCO A;  2VG6 A;  4NYN A;  3WNE A;  3VQE A;  4DTR A;  3DM2 A;  1NJY A;  3DLK A;  2JLE A;  3AVF A;  1MU2 A;  4Z4E A;  3K57 A;  3SPY A;  4J2A A;  3G10 A;  4KFB A;  3C94 A;  3DRS A;  1GOC A;  1A5V A;  4FLW A;  1S1U A;  1JL2 A;  4B3O A;  3L3U A;  2ZD1 A;  2KFZ A;  1S1T A;  3KIO A;  3LWM A;  2E4L A;  4NYF A;  4CJV A;  3L8B A;  3MXI A;  4HUE A;  1HPZ A;  1Z26 A;  1X9M A;  4OKJ A;  4ZTF A;  4RW9 A;  3RR7 A;  1TKT A;  1HRH A;  1WAJ A;  4B9S A;  1RDD A;  3NFA A;  4E7H A;  2D0A A;  3NGY A;  4OVL A;  3L2Q A;  3S3O A;  1NK8 A;  4Q0B A;  3M8Q A;  3OYF A;  1IKX A;  2Y1J A;  4FJ5 A;  1TKX A;  3KTQ A;  2LSN A;  1TL3 A;  1L3T A;  1QS4 A;  1VRT A;  5KTQ A;  4FJI A;  2YHA A;  1RIL A;  4J2B A;  2GV9 A;  4BE1 A;  2ZE2 A;  4KKO A;  3ISN C;  2OPQ A;  4CJW A;  3ZSW A;  3CG7 A;  3V9S A;  5E41 A;  4CHQ A;  4DS5 A;  1CZB A;  1K6Y A;  1U45 A;  4CF0 A;  5I3U A;  3RMB A;  1A5X A;  2BAN A;  4FJX A;  1VRU A;  1HQU A;  2B6A A;  2KFN A;  4AHC A;  2IGI A;  4CJF A;  1RT6 A;  3HPO A;  1IG9 A;  1RT7 A;  4B9V A;  2HNY A;  3NBP A;  3DI6 A;  4WE1 A;  4C8N A;  3VQ7 A;  4BWM A;  3V9W A;  4FK4 A;  3SQ2 A;  4ELV A;  3AVA A;  4FK0 A;  1VK0 A;  3AA2 A;  1WSJ A;  1Y97 A;  1SKR A;  4F2R A;  3OYL A;  3QIN A;  4CEQ A;  4FYD A;  1TVR A;  1RTJ A;  1S1V A;  2P5G A;  3HPG A;  3D45 A;  3V9X A;  4AHT A;  3SUN A;  4KI6 A;  3TAP A;  1Z25 A;  3BGR A;  4NCG A;  3BDP A;  2KW4 A;  4AHR A;  4E3S A;  1ZYQ A;  3RMC A;  1NK9 A;  3KKR A;  4LY7 A;  3D0P A;  1NJZ A;  4PA1 A;  4DFP A;  3KD5 E;  3NAE A;  3L2W A;  4RW8 A;  3AO4 A;  3LWL A;  4PUO A;  3ALY A;  3NE6 A;  5C25 A;  3TAG A;  3IAY A;  3ZSQ A;  4CES A;  4JS4 A;  4B08 A;  2XRI A;  5DK5 A;  4DF4 A;  4KV8 A;  3TAE A;  3HVR A;  3I8D A;  4AIL C;  3SCX A;  3F9K A;  3AO2 A;  2X78 A;  2GBZ A;  3SNN A;  4DQR A;  1U4B A;  3KJV A;  2D5R A;  3NH2 A;  2Z1H A;  4UQG A;  3NH0 A;  3LZJ A;  4H8K A;  1XHX A;  2YKN A;  3LP2 A;  3WNF A;  4CHP A;  2R7Y A;  1BL3 A;  5DMR A;  4HHT A;  4FLX A;  1L5U A;  1RBU A;  1KRP A;  4CEZ A;  3K5L A;  1RNH A;  1U48 A;  2HND A;  4YNQ A;  1QHT A;  3QEX A;  4B9U A;  4O44 A;  4CHN A;  4DSL A;  3AVN A;  4M45 A;  3QES A;  1L3U A;  3PO5 A;  1NK7 A;  4HCC A;  4CGD A;  4FM0 A;  3LPT A;  4N5S A;  2EHG A;  3AO1 A;  4FK2 A;  1UAX A;  2F8T A;  1CLQ A;  4DTX A;  2OYQ A;  4N47 A;  3O3G A;  3PX6 A;  3RRG A;  3DYA A;  2YNG A;  4DFK A;  4E7K A;  2PZS A;  1VSF A;  4CK1 A;  4Z0U A;  4M3R A;  4KB1 A;  3OYB A;  5KGX A;  4N41 A;  4FJM A;  1VSI A;  4I7F A;  4CJ4 A;  4DSE A;  1N6Q A;  4CFB A;  4DSK A;  5J2M A;  1JLQ A;  1SV5 A;  2IOC A;  1L3V A;  4KHN A;  2EX3 A;  2X6S A;  3T19 A;  3L3V A;  2OA8 A;  3LP1 A;  4LH4 A;  4OGE A;  1T03 A;  1FK9 A;  1CXQ A;  1RT3 A;  1S1W A;  2OPP A;  3SV4 A;  2OZS A;  1RDC A;  2IAJ A;  4CF1 A;  2WON A;  4K8X A;  1UA0 A;  2YNI A;  3QEV A;  4FJG A;  5HRS A;  3PUF A;  3VQC A;  4CIF A;  1S5J A;  2F8S A;  2JGU A;  4DU3 A;  3IRX A;  2G8W A;  4DSJ A;  4F3O A;  4FJL A;  1VSJ A;  4Z4I A;  2QXF A;  3KLF A;  1NK5 A;  4I2P A;  1TKZ A;  1ZBU A;  1WNS A;  1HYS A;  3AVB A;  4DQI A;  1LWF A;  4MQ3 A;  1QE1 A;  1KVC A;  4M42 A;  1RT2 A;  2HVI A;  4PQU A;  4Y1D A;  4AH9 A;  5CZ1 A;  3AVL A;  2ITG A;  1Q9X A;  2YV0 X;  1LV5 A;  3AVC A;  4IKF A;  4DG1 A;  4FZZ A;  3DLE A;  1GOB A;  1WAF A;  3U3G A;  2A1S A;  2XO7 A;  3OS1 A;  1DTT A;  4HVJ A;  1C1B A;  1WN7 A;  4DF8 A;  5D3G A;  2G8V A;  1U04 A;  2ATQ A;  4FLZ A;  4YFU A;  1IKW A;  3EY1 A;  1EP4 A;  4DTP A;  1C0T A;  2VG7 A;  4EP5 A;  3HXM A;  3RWU A;  4RG8 A;  2WOM A;  3I0R A;  4CCH A;  1J54 A;  3V1O A;  1DLO A;  1LW0 A;  3MEE A;  3C6T A;  3OYA A;  2E6M A;  3OS2 A;  4BDY A;  4DFM A;  4KHU A;  3LAM A;  3VQD A;  1NKC A;  4DLE A;  4DLG A;  1C1A A;  1CZ9 A;  3LPU A;  3O3H A;  4EZ9 A;  1T7P A;  3M8S A;  3HT3 A;  2YKM A;  3B6P A;  3VA0 A;  2FBV A;  3IG1 A;  1RT1 A;  4IFV A;  4M41 A;  3NHG A;  1RDB A;  3KKS A;  3HJF A;  3SZ2 A;  2FC0 A;  1JLC A;  4LSN A;  1QSL A;  1R0A A;  4JRQ A;  1EKE A;  4FJN A;  4Z4F A;  3DMJ A;  2D0C A;  3H08 A;  3I0S A;  4ID5 A;  4O4G A;  5SZT A;  4FM2 A;  3M8P A;  3OS0 A;  4CGH A;  3LP0 A;  2RN2 A;  4GMJ B;  1KFS A;  3ZT4 A;  3QEP A;  3UIQ A;  1B9F A;  5HRO A;  3ZSY A;  1XHZ A;  3VQQ A;  4FJ8 A;  2HW3 A;  2Y1I A;  2HB5 A;  4RW4 A;  4IDK A;  1X9W A;  1HQE A;  3HL8 A;  4CJT A;  4FM1 A;  3LAK A;  2NUB A;  4B8C A;  2OPS A;  3CM6 A;  2HHW A;  4CFD A;  3C6U A;  1ITG A;  1BQN A;  4ZTJ A;  1GOA A;  4TSX A;  1TK0 A;  1QTM A;  4KTQ A;  1UWB A;  3MEC A;  4CJ3 A;  3S3M A;  4KHS A;  4R5P A;  4EZ6 A;  2VG5 A;  3AVH A;  5HRN A;  3RRH A;  4NCA A;  3AO5 A;  1T05 A;  3TAF A;  3OYK A;  2YHB A; 
#chains in the Genus database with same CATH topology
 3CCJ N;  4M3W A;  4C8M A;  3HI0 A;  1WSH A;  5JVG L;  1BGX T;  5KRS A;  3DWL A;  4BRF A;  2IVP A;  3WXJ A;  4CJE A;  3HTV A;  1RCH A;  2IC3 A;  1SKW A;  4M3X A;  5JLH A;  2Z1J A;  4YY3 K;  5KPR A;  4MLE A;  3ZSR A;  4R79 A;  4M3Z A;  2Q36 A;  4OPJ A;  1G15 A;  1WSE A;  3HP6 A;  3TWH A;  4EP4 A;  4CBX A;  1D8Y A;  3O4W A;  1XMQ K;  2HHS A;  3THV A;  2GEM A;  4CHZ A;  4KBO A;  2KKZ A;  3VER A;  4B9T A;  1RBV A;  3ZT3 A;  2WFB A;  3L2V A;  4CZJ A;  3DOL A;  2D0B A;  3CFO A;  4FW1 A;  3TAN A;  2QWM A;  1D9F A;  3TU5 A;  3H3O B;  1K8K B;  4BC5 A;  4EAH D;  3OYJ A;  4ELU A;  2G8H A;  2VGN A;  3ULD A;  4CZI A;  1S9E A;  3DAW A;  2KTQ A;  1UOC A;  3C7N A;  4X64 K;  4CJS A;  1P90 A;  1WSF A;  3ZEU A;  5AQP A;  5KRT A;  3ZEU B;  2X6N A;  5IWA K;  3IS9 A;  2HHU A;  3KK1 A;  4I2Q A;  2CH5 A;  5AQS A;  3W3D A;  3UE5 A;  1XC9 A;  3K2P A;  4CGF A;  3ZCM A;  4IDH A;  1J53 A;  5CY4 A;  1NKB A;  2D0O A;  4E1M A;  3TTC A;  5CYQ A;  1L3S A;  3VN5 A;  4H0X B;  3ENO A;  2Z1I A;  3KHY A;  3ID8 A;  1NMD A;  4RCH A;  5JS1 A;  2E1Z A;  3AVM A;  2O8B A;  3TI0 A;  1NU0 A;  4CEF A;  4FCY A;  3SYZ A;  1BI4 B;  1TUY A;  4CK3 A;  3KWI A;  1XC3 A;  3EO3 A;  5M1K A;  1QQM A;  4H0Y B;  1C0F A;  3O4N A;  1YAG A;  2Q2R A;  3HM9 A;  3K5N A;  2QWL A;  4BAC A;  2E6L A;  1TK8 A;  4I9Q A;  4W5R A;  2F7T A;  4K25 A;  4HUF A;  1NGG A;  4CEA A;  5HRP A;  3O08 A;  2FF6 A;  2O8C A;  2PY5 A;  4DWI A;  4M3T A;  1HYV A;  3F5T A;  4BQL A;  5J1E A;  4K41 A;  3CJC A;  4GVM A;  1NK0 A;  4C1N K;  4A57 A;  1FKO A;  2XY7 A;  1CXU A;  3GL1 A;  3K5M A;  4WYB A;  3VQ8 A;  2P9N A;  3DLB A;  4KPY A;  4CE9 A;  4BE2 A;  4E0D A;  4B1Y B;  4A61 A;  4FJ7 A;  3O1B A;  3LDO A;  1GLB G;  1S6Q A;  3VQP A;  1A5W A;  3TAQ A;  1VQ9 N;  3ASM A;  4IFY A;  3K9K A;  4M63 C;  4FW2 A;  1ZBF A;  4DSJ A;  4HWI A;  1SL2 A;  3HYF A;  3HK2 A;  1BCM A;  4JI2 K;  1T44 A;  5JS2 A;  1NKE A;  1Z6R A;  2DTU A;  3FZH A;  3T1A A;  3O9U A;  1FJG K;  2HHH K;  4JEP A;  3F2K A;  4KTW A;  3NF7 A;  1ZC6 A;  3A5O C;  1EQY A;  4JD2 A;  4X62 K;  3NF9 A;  2HBL A;  4CIE A;  2ASO A;  2QK9 A;  4A5B A;  1I94 K;  1S9G A;  4KHP K;  4GKK K;  1HNV A;  2GWJ A;  1W97 L;  1NJW A;  3KK2 A;  4CEB A;  1GLD G;  3VQA A;  2W6K A;  1NJI O;  4ZHR A;  3CJ9 A;  3GE1 A;  1GLC G;  3HZ6 A;  1TYQ B;  5FRO A;  3SLC A;  1KFD A;  2UXB K;  2BH1 A;  3VQ6 A;  2DFE A;  3PX4 A;  2QI2 A;  1X9J A;  1HJR A;  3H6E A;  4QAG A;  4O8U A;  2I5J A;  1QQC A;  4O0J A;  3E66 A;  3CCM N;  4PY5 A;  4FLT A;  2QA4 N;  1QZ6 A;  5BRH A;  5J2P A;  2ITM A;  5B8H A;  4JI8 K;  1G99 A;  2HMP A;  3EKS A;  3FFK B;  3IMX A;  2IDO A;  4BE0 A;  1ASW A;  1ZBI A;  3OYM A;  3THX A;  4CGI A;  4DV5 K;  2AJQ A;  4GVE A;  4DTR A;  5KPT A;  4Z4E A;  4FWK A;  1YJN N;  4FLW A;  1JL2 A;  4DHY A;  3KIO A;  3TSP A;  2E4L A;  3P39 A;  3UKU B;  3VF4 A;  4CJV A;  3LWM A;  3L8B A;  1X9M A;  3TPQ A;  1XNR K;  5JMV A;  3RR7 A;  4E7H A;  3OYF A;  1IKX A;  5AQY A;  2P9L A;  4DV7 K;  1TKX A;  3KTQ A;  1TL3 A;  1L3T A;  4YOU A;  4B1W B;  3SAF A;  2P9L B;  4J2B A;  5AZI A;  1GLF O;  4BE1 A;  4LF8 K;  4KKO A;  4BC3 A;  3I8B A;  2UXC K;  4IJN A;  3ZSW A;  3CG7 A;  3V9S A;  4CHQ A;  2FSN A;  1CZB A;  5AZI B;  4CF0 A;  3RMB A;  1A5X A;  1BU6 O;  2BAN A;  2B6A A;  4X65 K;  4AHC A;  4IO9 L;  4CJF A;  3A5M C;  1IG9 A;  3NBP A;  4FK4 A;  3M5R A;  2P9S B;  3LDL A;  1JCG A;  3ULE A;  3I33 A;  3T7Z A;  2P5G A;  3HPG A;  2YHW A;  3GDQ A;  4DKW A;  3TAP A;  1Z25 A;  3SMS A;  3BDP A;  4E3S A;  3KKR A;  4LY7 A;  4NLB A;  4IEE A;  3D0P A;  1NJZ A;  3KD5 E;  3L2W A;  4JK8 A;  4HTL A;  4JKB A;  3LWL A;  4PUO A;  2WUS A;  1NNE A;  1NGI A;  3RVC A;  1T3V A;  3IAY A;  4BR0 A;  4CES A;  5DK5 A;  4DF4 A;  3HVR A;  4AIL C;  3SCX A;  3AO2 A;  3KJV A;  3CI5 A;  2Z1H A;  5E26 A;  3C6H A;  3LZJ A;  3OBY A;  5FPM A;  3T1H K;  1K73 O;  3WNF A;  4FLX A;  5DMR A;  3H46 O;  1VHX A;  1RBU A;  4CEZ A;  3K5L A;  1RNH A;  4YOW A;  1QHT A;  3HOS A;  5LJW A;  3QEX A;  1BA0 A;  3DXM A;  4B1V A;  4M45 A;  4WQ4 A;  1U6Z A;  4CGD A;  3THY A;  3C65 A;  1Q18 A;  1WBB A;  4N5S A;  2F8T A;  4FK2 A;  3LDN A;  3N4Q A;  5LMU K;  3VGL A;  1CLQ A;  3O3G A;  3O9Q A;  4EHT A;  1OH6 A;  4E7K A;  2CGL A;  4IJA A;  4CK1 A;  1HNX K;  2UU9 K;  4N41 A;  4GNI A;  5M1P A;  1JLQ A;  1L3V A;  2EX3 A;  3BUZ B;  3QBX A;  4BRQ A;  3L3V A;  5DM7 L;  3LP1 A;  4LH4 A;  2HF3 A;  4OGE A;  1FK9 A;  1S1W A;  5AQL A;  2OZS A;  3C6A A;  3LL3 A;  5GIP A;  4A62 A;  3J80 O;  4K8X A;  4PKG A;  5LJV A;  3CMA N;  4FJG A;  5HRS A;  2NRZ A;  2G8W A;  1VSJ A;  2QXF A;  1TKZ A;  2CGJ A;  1YVN A;  1HNW K;  1BOT O;  4KH5 A;  4MQ3 A;  1BUP A;  1KVC A;  3KK7 A;  4Y1D A;  1Q9X A;  1LV5 A;  3AVC A;  2ZGZ A;  3AAP A;  3U3G A;  1VQ7 N;  1WN7 A;  4YFU A;  4DTP A;  4B3S K;  3OBW A;  1NGF A;  2VG7 A;  5AQX A;  4RG8 A;  2WOM A;  4BGA A;  3L4Q A;  3V1O A;  3EL2 A;  1DLO A;  4IWV A;  1NKC A;  2QTD A;  2Q97 A;  4DLG A;  2ZJQ L;  1CZ9 A;  3HT3 A;  2YKM A;  3CJ1 A;  3NHG A;  5LL6 Z;  3HJF A;  4LSN A;  2ZM6 K;  1EKE A;  2KHO A;  3I0S A;  3MK6 A;  4FM2 A;  3M8P A;  4CGH A;  5EOY A;  1KFS A;  5GAH P;  3ZT4 A;  3QEP A;  1B9F A;  1XHZ A;  3DXK A;  3VOV A;  2QWO A;  2HB5 A;  4RW4 A;  5M1O A;  3FR0 A;  3HL8 A;  4FM1 A;  2NUB A;  4B8C A;  2OPS A;  3DXK B;  2ZF5 O;  3CM6 A;  2HHW A;  4J2A A;  1QTM A;  4KTQ A;  4IOA L;  4CJ3 A;  3S3M A;  4KHS A;  4R5P A;  4GV3 A;  3ZET B;  1FW6 A;  1BWF O;  3AO5 A;  1X9S A;  1N36 K;  4HCB A;  3LZI A;  4FOI A;  1OH8 A;  2KQ2 A;  4JN4 A;  4AHV A;  2QW9 A;  4LF6 K;  4M7Y A;  4JI6 K;  5AQG A;  3I55 N;  3VQ5 A;  4W5T A;  3QO9 A;  3QET A;  4N76 A;  4JI4 K;  2RPI A;  1LWC A;  5I42 A;  1IV0 A;  3C95 A;  4YOY A;  1RTH A;  1O1W A;  1YHQ N;  3T3F A;  5BPL A;  3EYZ A;  2RE2 A;  3OJS A;  5I9E B;  2F4V K;  3CQ8 A;  3H1Q A;  2F96 A;  2ETJ A;  4FZY A;  1Q81 O;  3CCE N;  4OKE A;  4PL8 A;  3UKR B;  4FWS A;  4DV6 K;  1HKC A;  2P5O A;  1JLA A;  4CZH A;  3M8R A;  3SJH A;  4C8L A;  3MCP A;  1LW2 A;  1BG3 A;  4CEC A;  2QWQ A;  4CJP A;  2FXU A;  4JHD B;  5AQM A;  1F21 A;  4BRG A;  3O9R A;  3H45 C;  3R3L A;  2PYL A;  1FXX A;  4LH5 A;  4WFB L;  4H4M A;  1BA1 A;  1IKY A;  4CGG A;  3OVN A;  1TKD A;  1ZBS A;  1NOZ A;  3WQU A;  1IKV A;  4I6M A;  4BDZ A;  3J7A P;  2JWK A;  2XY8 A;  3WNG A;  4I6M B;  3ZT0 A;  3WQT A;  3KLI A;  5AQK A;  1TL1 A;  4C23 A;  5DM6 L;  3BZK A;  3JSM A;  5AQZ A;  4E7L A;  2KZM A;  5C15 A;  4IOC L;  2V52 B;  1DEJ A;  3NH1 A;  2HHX A;  4AM7 A;  1HKG A;  4JKH A;  3VEN A;  3NGI A;  5C10 A;  2O8D A;  2BUP A;  2V51 B;  4MDA A;  2P9U A;  4H0P A;  4H4O A;  5BN9 A;  4BRI A;  5AQO A;  2P9U B;  3WT0 A;  3QEW A;  4W5O A;  3HM8 A;  2QXL A;  1HYZ A;  3VPZ A;  3D2F A;  3SUP A;  1Q8I A;  4B9M A;  1RT5 A;  3EE8 A;  4CD3 A;  1ZBH A;  1BIZ A;  1KVB A;  3OY9 A;  3VF6 A;  3SUQ A;  3ZSV A;  4KH4 A;  3AVI A;  1ASU A;  2NRX A;  4CJ5 A;  3ATU A;  3SQ4 A;  4CJQ A;  4DR1 K;  3IUC A;  3AA4 A;  5T7B A;  4JLH A;  4FVM A;  1SL1 A;  3V6D A;  4AF1 A;  4DU1 A;  3LDQ A;  3U6F A;  3MN9 A;  4QS9 A;  4Y0W A;  1D4X A;  4ICL A;  2OTL N;  1RBS A;  1N5Y A;  2NRV A;  4CBU A;  3PO4 A;  4PWD A;  3NVK A;  2HBM A;  1VQL N;  4F9O A;  1IBM K;  3K59 A;  1RBT A;  4KTZ A;  3PSI A;  3WEE B;  3V1R A;  3F73 A;  2IIR A;  4FLU A;  3RR8 A;  3CYM A;  4BR7 A;  2KZZ A;  1J5O A;  2HHV A;  4JKF A;  3DLH A;  2UXD K;  3MEG A;  4Q5V A;  3KK3 A;  1QSS A;  5H1S Q;  3A2F A;  4DTN A;  2BDP A;  3AVG A;  4MLH A;  1MWM A;  5M1F A;  1K8K A;  1KVA A;  3P31 A;  1REV A;  3HSC A;  3NDK A;  2VCP A;  4M7X A;  4CEO A;  1WBD A;  1WLJ A;  3CPW M;  4I9L A;  4JRP A;  3CC2 N;  3KLE A;  5FLX O;  1LAW A;  5KGW A;  1ATR A;  3DLL L;  2AP1 A;  5C24 A;  3O1W A;  4CK2 A;  3Q7B A;  3ZSO A;  4O55 A;  2HNZ A;  2O4I A;  4KB0 A;  3FZF A;  3P5J A;  4OX9 K;  2ASP A;  4PHT X;  3HP9 A;  3IKM A;  4KHY A;  1C0G A;  2YNF A;  4DV0 K;  2ZJP L;  4CFA A;  3HOT A;  3E01 A;  3SUO A;  2G8U A;  3EZ5 A;  3LDS A;  1HMV A;  3MXJ A;  3SI6 A;  4MDB A;  1NK4 A;  3EE9 A;  3G25 A;  4Z4C A;  3VES A;  1Y64 A;  3SQ1 A;  2HST A;  1NMN A;  4GV6 A;  4IG0 A;  1UA1 A;  1K9M O;  5BRE A;  1YT3 A;  1BI4 A;  3L2U A;  3PY8 A;  5AQF A;  1YTU A;  3V9U A;  1VQ8 N;  4AHS A;  3FLC O;  4KI4 A;  4BRN A;  3V1Q A;  2EWS A;  2JLE A;  3AVF A;  1XMO K;  3K57 A;  3SPY A;  3G10 A;  3W0L A;  1A5V A;  4CZG A;  2O8E A;  1S1U A;  3L3U A;  2KFZ A;  5GIO A;  3MDQ A;  3L0Q A;  2A40 A;  3ATV A;  2O8E B;  4A5A A;  4B3R K;  3MXI A;  5KPZ A;  4HUE A;  1HPZ A;  1Z26 A;  3BY5 A;  5BR8 K;  4H5V A;  1HRH A;  1WAJ A;  3R6M A;  4JKE A;  1RDD A;  2D0A A;  3NGY A;  3S3O A;  1NGE A;  3FZM A;  1NK8 A;  2Y1J A;  4FJ5 A;  3AAQ A;  5KTQ A;  5EX5 A;  2ZE2 A;  3CCR N;  4YDU C;  4DS5 A;  1K6Y A;  1U45 A;  1YJW N;  1LOT B;  2KFN A;  5EXW A;  2UUC K;  5AQN A;  1RT7 A;  1KAY A;  4B9V A;  4C8N A;  3DI6 A;  3LDP A;  4WE1 A;  3VQ7 A;  4BWM A;  3V9W A;  3THW B;  3BZC A;  4FK0 A;  1VK0 A;  3AA2 A;  1Y97 A;  3CIP A;  3QIN A;  2Q1N A;  3WUH A;  5AFU A;  4FYD A;  3V9X A;  3D7E O;  3JAM O;  2KW4 A;  1ZYQ A;  3QIC A;  5AQT A;  3RMC A;  3JXU A;  3FGU A;  1NGH A;  4PA1 A;  4BRO A;  3NAE A;  4RW8 A;  4DR4 K;  3P38 A;  4JS4 A;  2XRI A;  3TAE A;  3QFU A;  3AGR A;  2ZJR L;  2GBZ A;  5GAG P;  2NRT A;  2FF3 B;  4H8K A;  3OA9 A;  3MN6 A;  5AQQ A;  1NG9 A;  1EO1 A;  1L5U A;  3F9M A;  1KRP A;  1U48 A;  2HND A;  4B1Z A;  4B9U A;  3A0I X;  2CH6 A;  4NB4 A;  4LFA K;  2HBJ A;  4B1U B;  4CHN A;  3PO5 A;  3EN9 A;  4HCC A;  4FM0 A;  1J6Z A;  5KQ8 A;  2IVN A;  3LPT A;  1UAX A;  3J8A A;  2OYQ A;  3PX6 A;  1OVQ A;  2NRR A;  4DV4 K;  3RRG A;  3DYA A;  1TYQ A;  4YDU A;  1JJ2 M;  4IO8 A;  4Z0U A;  3TTF A;  5KGX A;  3GG4 A;  4FJM A;  4CJ7 A;  4CJ4 A;  4IOX A;  1N6Q A;  1SV5 A;  2IOC A;  2QM1 A;  4KHN A;  2OAN A;  1T03 A;  2W40 A;  5EY4 A;  1CXQ A;  3SV4 A;  4PKH A;  2WON A;  4BC2 A;  4JV5 K;  4K43 A;  5BR9 A;  1E3M A;  3VQC A;  2P9I B;  2JGU A;  4FJL A;  4Z4I A;  4I2P A;  4XH4 A;  1QVG M;  1T6D A;  4IFE A;  4PKI A;  2ITG A;  2ZWH A;  2YV0 X;  4IKF A;  4DG1 A;  4FZZ A;  4IZ9 A;  1WAF A;  2XO7 A;  3CCS N;  3UKU A;  1C1B A;  4BR5 A;  1U04 A;  4ISG A;  1C0T A;  4EP5 A;  3HXM A;  5JVH L;  1J54 A;  3CCU N;  5F2R A;  3OYA A;  2E6M A;  3VQD A;  3NVM A;  2YCH A;  1C1A A;  1KQS M;  3O3H A;  1T7P A;  2FBV A;  3IG1 A;  4IFV A;  1WB9 A;  3KZB A;  1HX1 A;  1RDB A;  3SZ2 A;  4WF9 L;  2FC0 A;  4EFH A;  3G4S N;  4JK9 A;  4YOX A;  3DMJ A;  3ZYY X;  2E5L K;  2YJE A;  2RN2 A;  4ISE A;  2P9S A;  3R8E A;  3ZSY A;  1HQE A;  1DKG D;  3LAK A;  3R9P A;  3SBT A;  2PAV A;  1ITG A;  1BQN A;  1GOA A;  2VG5 A;  5HRN A;  3R1X A;  1T05 A;  2YHB A;  1I3A A;  1JLF A;  4HTU A;  1SL0 A;  3SV3 A;  4ISF A;  3CD6 N;  4JKC A;  2VWK A;  4CF9 A;  3JS6 A;  2UUB K;  3AA3 A;  4KHW A;  5BRF A;  3S9H A;  4RW6 A;  5FRN A;  1BQM A;  4CHO A;  1D5A A;  3QIP A;  2GTD A;  4DQP A;  2XHB A;  2XY5 A;  4M3Y A;  3WNH A;  4H5N A;  2YJF A;  3ZX2 A;  3B6O A;  5AQU A;  4FJK A;  2HHT A;  5SWM A;  1WSG A;  3EEQ A;  1JL1 A;  4JS5 A;  4CHY A;  4FJ9 A;  4O0I A;  3O9S A;  3AV9 A;  2BGG A;  4DTJ A;  4CFC A;  4Z94 A;  4BR9 A;  3MCA B;  3DOK A;  1W9H A;  1JKH A;  2FLO A;  3MXM A;  5TKY A;  4QCL A;  2E2N A;  4Y1C A;  4G9Z A;  4DSF A;  1DTQ A;  4CZM A;  1RBR A;  1RTI A;  1SS6 A;  1JLE A;  5ADX H;  2ZQB A;  3P1G A;  1IBK K;  4CJK A;  3K9J A;  2HHQ A;  3FFI A;  1WOQ A;  2RKI A;  3CFR A;  2A3Z A;  4BRK A;  4DV2 K;  1B9D A;  5KI6 A;  3VEX A;  3KWG A;  4RW7 A;  3QLH A;  1C0M A;  3D2E B;  1HNI A;  3A8Y A;  5IT9 O;  3O5B A;  4E7I A;  4FWP A;  5C2F A;  3OYH A;  3DLR A;  4NLC A;  3VEY A;  4AHU A;  4BC4 A;  2DPN A;  4BRD A;  4GW6 A;  1TAU A;  3T1Y K;  1WSI A;  3VQ4 A;  3PX0 A;  5HLF A;  3ENH A;  3ITH A;  5AQW A;  2W42 A;  2D0P A;  1RTD A;  1KLN A;  2VGM A;  5GAE P;  3U4L A;  2QWN A;  5BN8 A;  4KH6 A;  3MN5 A;  1DT9 A;  1JXE A;  2D1K A;  4XEI A;  4OGC A;  1JCE A;  3O4Q A;  4DU4 A;  3CJ7 A;  4FOE A;  3AY9 A;  3G0Z A;  3MWP A;  1S3X A;  2A41 A;  1XWL A;  1RT4 A;  5GAD P;  2HF4 A;  3NGZ A;  1C1C A;  1EX4 A;  1C0U A;  2GUI A;  1VQN N;  4UY8 O;  4YOR A;  3ZT2 A;  4OJR A;  2G8I A;  4IBN A;  4KRE A;  5J2Q A;  1OVY A;  3ZET A;  1BIU A;  2KLA A;  1IBL K;  4DQQ A;  3OYG A;  1KCF A;  3E9L A;  1KSP A;  4ILH A;  4DQ8 A;  2YI1 A;  3KLH A;  4XH5 A;  1K8A O;  4W5Q A;  3MED A;  1NJX A;  3OYN A;  3OYD A;  1S1X A;  1TAQ A;  1D9D A;  4CGJ A;  3ZSZ A;  3MWT A;  3CHW A;  2G8F A;  3K58 A;  2BE2 A;  4JI1 K;  1QQO A;  3ZX3 A;  4JK7 A;  3LM2 A;  1S6P A;  2BTF A;  3DLG A;  3M6G A;  3CJA A;  3ZX0 A;  5M1N A;  3OYC A;  4G1Q A;  4B9N A;  4CED A;  3DRP A;  5AQI A;  1YTA A;  3UKR A;  2NNW A;  5AQR A;  1VSD A;  1VQP N;  5LY3 A;  3V81 A;  2QWP A;  5HBM A;  4E1N A;  1VAZ A;  1YXQ A;  1NGB A;  2P1J A;  2UUA K;  3OJU A;  1W0H A;  4U67 L;  4BG8 A;  4E19 A;  4NCB A;  4E7J A;  3VQ9 A;  3RSE A;  3VQB A;  4CER A;  5CYM A;  5JIC A;  1VQM N;  3U3Y A;  3RSE B;  3J81 O;  2IS3 A;  4JHD A;  4B1X B;  4DQS A;  3P83 D;  4Z4G A;  4A2A A;  2QKK A;  1N34 K;  2P51 A;  4E1J A;  2PFU A;  4MO4 A;  4DV1 K;  4DR2 K;  4W5N A;  1QQN A;  4JKD A;  4FL9 A;  1RDU A;  4WFN L;  1U47 A;  2CGK A;  3TR8 A;  3D6R A;  4AM6 A;  1E4G T;  1KLM A;  2YHY A;  1VQ4 N;  1B92 A;  2YNH A;  3VA3 A;  5EU7 A;  1T8E A;  3MMV A;  4QS7 A;  4CZL A;  3RMA A;  1RDA A;  3PSF A;  3SJJ A;  3CM5 A;  4GY2 B;  3U9Z A;  4Z4H A;  3CCV N;  1YUW A;  1VQ6 N;  4CJR A;  4H0O A;  1ASV A;  2E2O A;  4DR7 K;  3EZW A;  4FLY A;  1ZXO A;  5AZJ A;  4DS4 A;  5AZJ B;  3CFP A;  4CF8 A;  4FJJ A;  3TSU A;  2FBT A;  1BCO A;  2VG6 A;  4FPA A;  3VQE A;  3DLK A;  2VQE K;  5BPN A;  2Q0R A;  3DRS A;  4LF9 K;  4B3O A;  2ZD1 A;  2OTJ N;  1S1T A;  4NYF A;  4CBW A;  1M90 O;  1P8Z A;  4OKJ A;  2VQF K;  4B9S A;  1KXP A;  3NFA A;  4OVL A;  3L2Q A;  3M8Q A;  5C12 A;  2OCE A;  4FWR A;  2LSN A;  3GBT A;  5BRD A;  2YHA A;  1HJO A;  4CJW A;  1N33 K;  3CQX A;  5EVZ A;  1RGI A;  2I7N A;  1HQU A;  3L4I A;  5AJ3 K;  3CPE A;  2IGI A;  2GEL A;  3HPO A;  3CET A;  5KQD A;  3SQ2 A;  4MO5 A;  3CCQ N;  3MX5 A;  4F2R A;  2I7P A;  3OYL A;  4CEQ A;  1TVR A;  4LF4 K;  3WEE A;  1NBW A;  1RTJ A;  1S1V A;  3D45 A;  4AHT A;  1Q86 O;  3SUN A;  3BGR A;  4AHR A;  1NK9 A;  1HPM A;  3GOI A;  1YIJ N;  4BR2 A;  2F9W A;  3VEW A;  3TAG A;  5GIN A;  3M1F A;  5ELZ A;  2IVO A;  1NWK A;  4FWL A;  1JCF A;  1QHA A;  4CZK A;  4DV3 K;  3L6Q A;  2X78 A;  4CVN E;  3SNN A;  4DQR A;  3NH2 A;  2YKN A;  4CHP A;  1BL3 A;  1MDU B;  1X3N A;  1EWQ A;  1XUP O;  3AVN A;  3QES A;  1L3U A;  1NK7 A;  1S22 A;  2EHG A;  4JKG A;  4DTX A;  4N47 A;  4DFK A;  2NRH A;  2PZS A;  4JKG B;  1WUA A;  4M3R A;  4KB1 A;  3OYB A;  5AQJ A;  5LMN K;  4DSE A;  2V7Y A;  4EHU A;  1T6C A;  5HL7 L;  3J7Z O;  4WFA L;  2X6S A;  3T19 A;  3AGK A;  5BPM A;  4NXN K;  2A5X A;  4BRC A;  4A59 A;  2OPP A;  1RT3 A;  3C7N B;  4CF1 A;  3SAG A;  2YNI A;  2GUP A;  4H5R A;  1S5J A;  2F8S A;  4YOT A;  3IRX A;  4F3O A;  4DB3 A;  3KLF A;  4L3Q A;  1ZBU A;  4H5T A;  1WNS A;  1HYS A;  3SAH A;  3AVB A;  4DQI A;  2ZGY A;  1LWF A;  1QE1 A;  4CD1 A;  1RT2 A;  4PQU A;  4AH9 A;  5CZ1 A;  3AVL A;  3QDK A;  4H0V B;  2E1Y A;  4BRE A;  4BRM A;  1DTT A;  4HVJ A;  4JYA K;  3SK3 A;  4O8K A;  1IKW A;  1W7A A;  1EP4 A;  3QFP A;  3CJB A;  1LW0 A;  3OS2 A;  3FZL A;  3LAM A;  2O8B B;  1GLJ O;  1VQ5 N;  4BR4 A;  4U7B A;  1YIT N;  3M8S A;  3B6P A;  1ESV A;  3VA0 A;  4OPA A;  1RT1 A;  3KKS A;  3CXC M;  4DUY K;  1JLC A;  2GX9 A;  1R0A A;  3VGK A;  4CI6 A;  3H08 A;  4FO0 A;  3PLA A;  5SZT A;  4X66 K;  3OS0 A;  3LP0 A;  4GMJ B;  3THW A;  2QEX N;  1XNQ K;  2HW3 A;  4FJ8 A;  1ILY A;  3E9P A;  2Y1I A;  4IDK A;  4J8F A;  2HBK A;  5AR0 A;  4TSX A;  1UWB A;  3RRH A;  4NCA A;  1Z05 A;  3SMP A;  1OH7 A;  3TAF A;  3OYK A;  3G71 N;  3VTH A;  4KO0 A;  2O8C B;  4A2B A;  3OYE A;  1IO2 A;  3M3Z A;  3O3F A;  3AO3 A;  2V7Z A;  1N32 K;  3K5O A;  2ASM A;  1HNZ K;  3T69 A;  1NGD A;  5AFU H;  2WTU A;  1NGJ A;  1IJJ A;  2RF2 A;  4FWO A;  2P9N B;  4DTU A;  4F2S A;  4F8R A;  4O5B A;  4XH1 A;  1V4S A;  2YHX A;  3AVJ A;  4JNE A;  2FBX A;  5CZ2 A;  3TTD A;  5FDL A;  3BEX A;  2FBY A;  1RFQ A;  2PBD A;  2X74 A;  2FSK A;  5FPD A;  4FVU A;  1S72 N;  1V4T A;  1QVF M;  4DTM A;  4FXD A;  4BQZ A;  4LSL A;  5M1Q A;  2HOE A;  4JD2 B;  3NMU A;  1J9A A;  4IG3 A;  1RDW X;  5FRM A;  3O6W A;  3DRR A;  3HST B;  3QNN A;  3SBG A;  4JI0 K;  3KD1 E;  2XY6 A;  3HBT A;  4BWJ A;  3P4I A;  2P9I A;  3HO1 A;  4QOZ B;  2QKB A;  3PV8 A;  2DFF A;  1DGK N;  3HRG A;  2Q0U A;  3Q7C A;  4BVP A;  4OLB A;  1QSY A;  1BO5 O;  1O13 A;  1ATN A;  5J2N A;  4DFJ A;  4FZX C;  5FPN A;  1NLV A;  3OYI A;  4DCH A;  4WQ5 C;  3AVK A;  1SUQ A;  3SPZ A;  3ZT1 A;  3NF8 A;  3MX2 A;  1LWE A;  1R59 O;  3ID6 A;  4CEE A;  1VSM A;  4CJL A;  4OPK A;  4B3T K;  3OHR A;  2O4G A;  4OLA A;  4KRF A;  1TGO A;  4E89 A;  4KAZ A;  4BRA A;  2J4R A;  1YJ9 N;  4C8O A;  1ZBL A;  3BF3 A;  4B8A B;  3THX B;  1YI2 N;  3VTI A;  1Q7Y O;  3QNO A;  1I39 A;  3SQ0 A;  3CCL N;  5HRR A;  5C42 A;  1LAV A;  4CF2 A;  4CZE A;  1Q9Y A;  4FWN A;  3ZSX A;  1NOY A;  2GWK A;  3S3N A;  1TV6 A;  2PYJ A;  3U9D A;  2JWL A;  2A6A A;  1KC8 O;  3MN7 A;  3QBW A;  3DJC A;  5HOO A;  1LCU A;  2W6L A;  5F0X A;  4L8R B;  1MWK A;  4WQ4 C;  4KHQ A;  4OO1 J;  1NK6 A;  3O80 A;  4MFB A;  1MA9 B;  4ELT A;  1EET A;  4V19 S;  3PIO L;  4K42 A;  4CJU A;  3QIO A;  4B9L A;  4YHH K;  3H1V X;  3NF6 A;  1BHL A;  2HVH A;  4FWQ A;  1SKS A;  3N4P A;  3AA5 X;  3TAR A;  4F4K A;  3KLG A;  2Z1G A;  4WQ5 A;  3NCI A;  1U49 A;  1J5E K;  3WXK A;  3VMF B;  4N56 A;  4HUG A;  3KVG A;  3CER A;  3RTV A;  2G8K A;  1KTQ A;  3ULE B;  1JXB A;  2HMI A;  3ZLJ A;  2B4J A;  1HLU A;  1QZ5 A;  4DTS A;  4H5W A;  1N8R O;  4B9Q A;  5MLC Q;  3VET A;  3MAQ A;  4DR3 K;  2VWJ A;  2WBN A;  1JLB A;  3HPH A;  3TSQ A;  4K8Z A;  4LC9 B;  4LF7 K;  4XIU A;  3VEZ A;  1FKP A;  1JLG A;  1BIS A;  4C8K A;  1VSE A;  3QEI A;  3PIP L;  2Q31 A;  1TK5 A;  3HVT A;  4M3U A;  1H1V A;  3V4I A;  4BVO A;  2F9T A;  3H3N O;  4DMN A;  2B5J A;  4B3M K;  3L2R A;  4J2E A;  3WXI A;  5HP1 A;  1ATS A;  3A5L C;  1EXQ A;  2E8A A;  4DSI A;  1VSH A;  4ID1 A;  4RTF D;  1XI1 A;  3TAM A;  3DXM B;  4CIG A;  3LAL A;  4JKA A;  2Q3S A;  4FJH A;  4IXC A;  1VSL A;  1X1P A;  5ADX A;  3THY B;  4NO7 A;  3VGM A;  4BDP A;  2DFH A;  4JI7 K;  2OPR A;  4IEI A;  4LF5 K;  2QWR A;  4PL7 A;  5K14 A;  3VF2 A;  2UYT A;  4F3T A;  1IH7 A;  3D2E A;  3V9Z A;  1SAZ A;  3LP3 A;  2OZM A;  2VWB A;  4CZF A;  3ENB A;  3QB0 A;  4LD0 A;  1HKB A;  1NM1 A;  3TAB A;  2DY4 A;  4DTO A;  3JYT A;  4OKK A;  4J2D A;  2WC9 A;  2A1R A;  4BY9 C;  1C6V A;  1YVU A;  2NLX A;  3FE1 A;  1VSK A;  1YF5 L;  4LFC K;  4DR6 K;  3RMD A;  2VYP A;  3LAN A;  4FLV A;  4DUZ K;  1U2V A;  3QER A;  4NYN A;  3WNE A;  3DM2 A;  1NJY A;  1U2V B;  1MU2 A;  2D4W A;  4C1N I;  4KFB A;  3C94 A;  2E20 A;  1GOC A;  5FPE A;  3O9T A;  3FZK A;  4BRP A;  1GLA G;  1SQK A;  5CR4 A;  3G6E N;  4ZTF A;  4RW9 A;  1TKT A;  4Q0B A;  3UB5 A;  1W2B M;  3BF1 A;  1QS4 A;  1VRT A;  4FJI A;  1RIL A;  4JI5 K;  2GV9 A;  3B8A X;  3ISN C;  2OPQ A;  4OPH A;  5E41 A;  1XQS C;  1VQK N;  5AQH A;  5I3U A;  5A2Q O;  4FJX A;  2E2P A;  1VRU A;  2W41 A;  4O5F A;  4QS8 A;  1HR0 K;  2E88 A;  1RT6 A;  1CZA N;  3BP8 A;  2HNY A;  1IG8 A;  4BRL A;  3OW2 M;  3AVA A;  4ELV A;  1WSJ A;  2P9K A;  1SKR A;  1OKJ A;  2E2Q A;  5CHI A;  2NRW A;  5F1X A;  2P9K B;  5E84 A;  3I56 N;  4KI6 A;  5TKW A;  4BG9 A;  4NCG A;  4DFP A;  3AAR A;  3AO4 A;  3IFR A;  1X3M A;  3IDH A;  3ALY A;  3NE6 A;  5C25 A;  3CF5 L;  3ZSQ A;  4BGB A;  4ILG B;  4B08 A;  4KV8 A;  3I8D A;  1KAZ A;  3J7Y P;  3F9K A;  1SZ2 A;  1U4B A;  2D5R A;  4UQG A;  3NH0 A;  1XHX A;  3LP2 A;  2R7Y A;  4HHT A;  1GLE G;  1GLL O;  3OTO K;  3WXM B;  2H3G X;  4YNQ A;  1M1K O;  4K0K K;  2P9P A;  4O44 A;  5C2D A;  4DSL A;  2P9P B;  2NZT A;  1Q82 O;  1KAX A;  3AO1 A;  1VQO N;  2RHK A;  1OH5 A;  2YNG A;  4H03 B;  1VSF A;  3WXL A;  4JAX A;  1VSI A;  3E1Y A;  4I7F A;  4DSK A;  4CFB A;  5J2M A;  3O8M A;  3S41 A;  4JI3 K;  4GKJ K;  4EIA A;  3CC4 N;  2OA8 A;  4GV9 A;  2YX6 A;  4RWT A;  1BDG A;  1RDC A;  3CME N;  2IAJ A;  5AQV A;  5JLF A;  1UA0 A;  3QEV A;  3VEO A;  3PUF A;  4CIF A;  3EKU A;  4CW7 B;  4DU3 A;  5CE3 A;  1NK5 A;  3K0S A;  3VEV A;  4M42 A;  2HVI A;  4AQY K;  4NXM K;  1EWR A;  3DLE A;  1GOB A;  4WCE L;  1NGA A;  2A1S A;  3OS1 A;  5D3G A;  1HUX A;  4DF8 A;  2G8V A;  2ATQ A;  4FLZ A;  3EY1 A;  3RWU A;  3CQY A;  3C0B A;  4CCH A;  3I0R A;  4LFB K;  2O8F A;  4KHU A;  3MEE A;  3C6T A;  4BDY A;  3QML A;  4DFM A;  4ILJ A;  4DLE A;  3U8X A;  2O8F B;  4FSV A;  3LPU A;  4YOV A;  4EZ9 A;  2O8D B;  5C0Y A;  1TUU A;  4DR5 K;  1KD1 O;  4M41 A;  4FWM A;  2FSJ A;  2AA4 A;  1QSL A;  4JRQ A;  4FJN A;  4Z4F A;  1E4F T;  2D0C A;  3LM9 A;  1NGC A;  3D2F B;  4ID5 A;  4O4G A;  4BRH A;  3UIQ A;  4FPB A;  3A5N C;  5HRO A;  3VQQ A;  1X9W A;  4H0T B;  4CJT A;  4CFD A;  3C6U A;  4ZTJ A;  3E9O A;  1TK0 A;  2A42 A;  3MEC A;  4EZ6 A;  3AVH A;  3CC7 N; 
#chains in the Genus database with same CATH homology
 3LZI A;  4M3W A;  4C8M A;  1I3A A;  1WSH A;  1JLF A;  4HTU A;  1SL0 A;  4KO0 A;  1BGX T;  5KRS A;  2KQ2 A;  3SV3 A;  4CJE A;  2VWK A;  1IO2 A;  4CF9 A;  3OYE A;  4AHV A;  3AA3 A;  3O3F A;  1RCH A;  2IC3 A;  1SKW A;  4M3X A;  3AO3 A;  4KHW A;  3S9H A;  2Z1J A;  3K5O A;  4F4K A;  4RW6 A;  3VQ5 A;  4W5T A;  5FRN A;  1BQM A;  3ZSR A;  3QO9 A;  4CHO A;  1D5A A;  3QET A;  4N76 A;  4M3Z A;  3QIP A;  4OPJ A;  1G15 A;  2RF2 A;  1WSE A;  3HP6 A;  2RPI A;  1LWC A;  2XHB A;  2XY5 A;  4DQP A;  5I42 A;  3TWH A;  4EP4 A;  4M3Y A;  3C95 A;  3WNH A;  1RTH A;  1O1W A;  4DTU A;  4F2S A;  3T3F A;  3EYZ A;  1D8Y A;  4F8R A;  3B6O A;  3OJS A;  4O5B A;  2HHS A;  3THV A;  4CHZ A;  3CQ8 A;  4B9T A;  4FJK A;  2HHT A;  2F96 A;  2ETJ A;  1RBV A;  5SWM A;  3AVJ A;  4FZY A;  1WSG A;  3ZT3 A;  1JL1 A;  2FBX A;  5CZ2 A;  4CHY A;  4JS5 A;  4O0I A;  3L2V A;  4FJ9 A;  3AV9 A;  4OKE A;  3DOL A;  2BGG A;  2D0B A;  5FDL A;  3CFO A;  4DTJ A;  2FBY A;  4CFC A;  4FW1 A;  3TAN A;  1D9F A;  2X74 A;  2P5O A;  3DOK A;  1JLA A;  1W9H A;  1JKH A;  3M8R A;  3HK2 A;  4DTM A;  3OYJ A;  3MXM A;  4ELU A;  4FXD A;  2G8H A;  4C8L A;  4LSL A;  4QCL A;  3ULD A;  1LW2 A;  4Y1C A;  1S9E A;  4CEC A;  1J9A A;  4IG3 A;  2KTQ A;  5FRM A;  1UOC A;  3DRR A;  4CJP A;  4DSF A;  3HST B;  4CJS A;  1WSF A;  1DTQ A;  1RBR A;  1F21 A;  3QNN A;  1RTI A;  3KD1 E;  2XY6 A;  2PYL A;  5KRT A;  1JLE A;  1FXX A;  4LH5 A;  4BWJ A;  2X6N A;  3IS9 A;  2ZQB A;  3P1G A;  4H4M A;  3KK1 A;  3HO1 A;  4CJK A;  4QOZ B;  2HHU A;  2QKB A;  1IKY A;  4I2Q A;  4CGG A;  2HHQ A;  3OVN A;  3PV8 A;  2DFF A;  3FFI A;  1TKD A;  2RKI A;  1XC9 A;  3K2P A;  3CFR A;  1B9D A;  5KI6 A;  1NOZ A;  4OLB A;  4CGF A;  1QSY A;  4RW7 A;  1IKV A;  3ZCM A;  5J2N A;  4DFJ A;  3QLH A;  4BDZ A;  1C0M A;  2XY8 A;  4FZX C;  1J53 A;  3WNG A;  3OYI A;  1HNI A;  3ZT0 A;  5CY4 A;  1NKB A;  3AVK A;  4E7I A;  1SUQ A;  4E1M A;  3KLI A;  3DLR A;  3OYH A;  3SPZ A;  4AHU A;  1TL1 A;  5CYQ A;  3NF8 A;  3ZT1 A;  1L3S A;  1LWE A;  3VN5 A;  4CEE A;  2OZM A;  1VSM A;  4CJL A;  2Z1I A;  4GW6 A;  4OPK A;  3JSM A;  4E7L A;  2KZM A;  1TAU A;  1WSI A;  2O4G A;  3VQ4 A;  4OLA A;  1ZBI A;  4KRF A;  1TGO A;  4E89 A;  3PX0 A;  5JS1 A;  5HLF A;  3NH1 A;  2HHX A;  3AVM A;  3TI0 A;  4KAZ A;  4CEF A;  3ITH A;  4FCY A;  3SYZ A;  3NGI A;  1BI4 B;  2W42 A;  4C8O A;  1RTD A;  4CK3 A;  1ZBL A;  1KLN A;  4B8A B;  4H4O A;  1JXE A;  3QEW A;  4W5O A;  3QNO A;  1HYZ A;  4OGC A;  3O4Q A;  4DU4 A;  1I39 A;  3SQ0 A;  5HRR A;  5C42 A;  1LAV A;  3SUP A;  1Q8I A;  3G0Z A;  4CF2 A;  4B9M A;  1RT5 A;  2G8U A;  1ZBH A;  1Q9Y A;  1BIZ A;  3ZSX A;  1KVB A;  1NOY A;  3S3N A;  1XWL A;  1TV6 A;  3O4N A;  3OY9 A;  2PYJ A;  3HM9 A;  3SUQ A;  3K5N A;  4BAC A;  1RT4 A;  2E6L A;  3NGZ A;  1C1C A;  1TK8 A;  3ZSV A;  4I9Q A;  4W5R A;  3AVI A;  1ASU A;  1EX4 A;  1C0U A;  4CJ5 A;  4L8R B;  3SQ4 A;  2GUI A;  4CJQ A;  4KHQ A;  2G8I A;  3ZT2 A;  4OJR A;  4KRE A;  4IBN A;  5J2Q A;  3AA4 A;  1BIU A;  4JLH A;  4FVM A;  5T7B A;  1SL1 A;  1NK6 A;  4HUF A;  4MFB A;  4DQQ A;  3OYG A;  3V6D A;  4CEA A;  4DU1 A;  4ELT A;  1KCF A;  1EET A;  5HRP A;  1KSP A;  3U6F A;  4CJU A;  3QIO A;  2PY5 A;  4B9L A;  4DWI A;  4M3T A;  3NF6 A;  3KLH A;  1BHL A;  1HYV A;  5J1E A;  2HVH A;  4ICL A;  1SKS A;  1RBS A;  4W5Q A;  3MED A;  3AA5 X;  3TAR A;  1NJX A;  4GVM A;  3OYN A;  3OYD A;  2Z1G A;  1S1X A;  3KLG A;  1NK0 A;  1N5Y A;  3PO4 A;  3NCI A;  1U49 A;  4PWD A;  1TAQ A;  4N56 A;  4HUG A;  1D9D A;  4CGJ A;  1FKO A;  2XY7 A;  1CXU A;  3K5M A;  3K59 A;  3RTV A;  3ZSZ A;  3VQ8 A;  2G8K A;  2G8F A;  3DLB A;  3K58 A;  1RBT A;  4KTZ A;  4CE9 A;  2BE2 A;  4BE2 A;  4KPY A;  1KTQ A;  3V1R A;  4E0D A;  1JXB A;  3F73 A;  4FJ7 A;  2HMI A;  1S6P A;  1S6Q A;  4FLU A;  2B4J A;  3DLG A;  3RR8 A;  3CYM A;  3VQP A;  4DTS A;  2KZZ A;  1J5O A;  1A5W A;  2HHV A;  3TAQ A;  3ASM A;  4IFY A;  3OYC A;  4G1Q A;  3DLH A;  3MAQ A;  4B9N A;  3MEG A;  4CED A;  4Q5V A;  3KK3 A;  4FW2 A;  1ZBF A;  2VWJ A;  1QSS A;  1JLB A;  3DRP A;  3A2F A;  3HPH A;  1YTA A;  3HYF A;  1BCM A;  4DTN A;  1SL2 A;  4XIU A;  3AVG A;  2BDP A;  4K8Z A;  1FKP A;  1JLG A;  1X9S A;  1VSD A;  1BIS A;  5JS2 A;  1NKE A;  4C8K A;  2DTU A;  3T1A A;  3V81 A;  4E1N A;  5HBM A;  1KVA A;  1VSE A;  2P1J A;  3QEI A;  1REV A;  3HVT A;  4KTW A;  3NDK A;  3OJU A;  1W0H A;  3NF7 A;  1TK5 A;  4M3U A;  4E19 A;  4CEO A;  4NCB A;  4E7J A;  1WLJ A;  3VQ9 A;  3VQB A;  3V4I A;  4CER A;  5CYM A;  4I9L A;  4JRP A;  3NF9 A;  4CIE A;  3KLE A;  3U3Y A;  2QK9 A;  1LAW A;  2B5J A;  2IS3 A;  4DMN A;  3L2R A;  4J2E A;  1S9G A;  5HP1 A;  5KGW A;  4DQS A;  1EXQ A;  3P83 D;  1HNV A;  4DSI A;  4Z4G A;  1VSH A;  4ID1 A;  1XI1 A;  1NJW A;  2QKK A;  3TAM A;  4CIG A;  5C24 A;  2P51 A;  3LAL A;  2Q3S A;  4CK2 A;  3KK2 A;  3ZSO A;  4FJH A;  1VSL A;  4O55 A;  1X1P A;  2HNZ A;  4CEB A;  4KB0 A;  3VQA A;  2O4I A;  4W5N A;  4BDP A;  2DFH A;  3P5J A;  2OPR A;  4ZHR A;  3HP9 A;  5K14 A;  5FRO A;  1U47 A;  4KHY A;  3TR8 A;  4F3T A;  1KFD A;  2YNF A;  1IH7 A;  1KLM A;  3VQ6 A;  3V9Z A;  1B92 A;  4CFA A;  2YNH A;  2DFE A;  3E01 A;  3LP3 A;  3VA3 A;  3EZ5 A;  3LDS A;  1HMV A;  3MXJ A;  5EU7 A;  3PX4 A;  3SUO A;  1HJR A;  3SI6 A;  1T8E A;  4QAG A;  1NK4 A;  4LD0 A;  3RMA A;  3TAB A;  1RDA A;  2DY4 A;  4DTO A;  2I5J A;  1QQC A;  3SJJ A;  4O0J A;  3CM5 A;  4Z4C A;  4Z4H A;  3JYT A;  4PY5 A;  4OKK A;  4FLT A;  4CJR A;  4J2D A;  1ASV A;  5J2P A;  4FLY A;  2A1R A;  3SQ1 A;  4HCB A;  1C6V A;  1YVU A;  4IG0 A;  1UA1 A;  1VSK A;  1YT3 A;  1BI4 A;  3L2U A;  3PY8 A;  2IDO A;  4BE0 A;  4DS4 A;  1ASW A;  3LAN A;  3RMD A;  3CFP A;  4CF8 A;  4FLV A;  3OYM A;  3V9U A;  4FJJ A;  4AHS A;  4KI4 A;  4CGI A;  1YTU A;  2AJQ A;  2FBT A;  3QER A;  3V1Q A;  1BCO A;  2VG6 A;  4NYN A;  3WNE A;  3VQE A;  4DTR A;  3DM2 A;  1NJY A;  3DLK A;  2JLE A;  3AVF A;  1MU2 A;  4Z4E A;  3K57 A;  3SPY A;  4J2A A;  3G10 A;  4KFB A;  3C94 A;  3DRS A;  1GOC A;  1A5V A;  4FLW A;  1S1U A;  1JL2 A;  4B3O A;  3L3U A;  2ZD1 A;  2KFZ A;  1S1T A;  3KIO A;  3LWM A;  2E4L A;  4NYF A;  4CJV A;  3L8B A;  3MXI A;  4HUE A;  1HPZ A;  1Z26 A;  1X9M A;  4OKJ A;  4ZTF A;  4RW9 A;  3RR7 A;  1TKT A;  1HRH A;  1WAJ A;  4B9S A;  1RDD A;  3NFA A;  4E7H A;  2D0A A;  3NGY A;  4OVL A;  3L2Q A;  3S3O A;  1NK8 A;  4Q0B A;  3M8Q A;  3OYF A;  1IKX A;  2Y1J A;  4FJ5 A;  1TKX A;  3KTQ A;  2LSN A;  1TL3 A;  1L3T A;  1QS4 A;  1VRT A;  5KTQ A;  4FJI A;  2YHA A;  1RIL A;  4J2B A;  2GV9 A;  4BE1 A;  2ZE2 A;  4KKO A;  3ISN C;  2OPQ A;  4CJW A;  3ZSW A;  3CG7 A;  3V9S A;  5E41 A;  4CHQ A;  4DS5 A;  1CZB A;  1K6Y A;  1U45 A;  4CF0 A;  5I3U A;  3RMB A;  1A5X A;  2BAN A;  4FJX A;  1VRU A;  1HQU A;  2B6A A;  2KFN A;  4AHC A;  2IGI A;  4CJF A;  1RT6 A;  3HPO A;  1IG9 A;  1RT7 A;  4B9V A;  2HNY A;  3NBP A;  3DI6 A;  4WE1 A;  4C8N A;  3VQ7 A;  4BWM A;  3V9W A;  4FK4 A;  3SQ2 A;  4ELV A;  3AVA A;  4FK0 A;  1VK0 A;  3AA2 A;  1WSJ A;  1Y97 A;  1SKR A;  4F2R A;  3OYL A;  3QIN A;  4CEQ A;  4FYD A;  1TVR A;  1RTJ A;  1S1V A;  2P5G A;  3HPG A;  3D45 A;  3V9X A;  4AHT A;  3SUN A;  4KI6 A;  3TAP A;  1Z25 A;  3BGR A;  4NCG A;  3BDP A;  2KW4 A;  4AHR A;  4E3S A;  1ZYQ A;  3RMC A;  1NK9 A;  3KKR A;  4LY7 A;  3D0P A;  1NJZ A;  4PA1 A;  4DFP A;  3KD5 E;  3NAE A;  3L2W A;  4RW8 A;  3AO4 A;  3LWL A;  4PUO A;  3ALY A;  3NE6 A;  5C25 A;  3TAG A;  3IAY A;  3ZSQ A;  4CES A;  4JS4 A;  4B08 A;  2XRI A;  5DK5 A;  4DF4 A;  4KV8 A;  3TAE A;  3HVR A;  3I8D A;  4AIL C;  3SCX A;  3F9K A;  3AO2 A;  2X78 A;  2GBZ A;  3SNN A;  4DQR A;  1U4B A;  3KJV A;  2D5R A;  3NH2 A;  2Z1H A;  4UQG A;  3NH0 A;  3LZJ A;  4H8K A;  1XHX A;  2YKN A;  3LP2 A;  3WNF A;  4CHP A;  2R7Y A;  1BL3 A;  5DMR A;  4HHT A;  4FLX A;  1L5U A;  1RBU A;  1KRP A;  4CEZ A;  3K5L A;  1RNH A;  1U48 A;  2HND A;  4YNQ A;  1QHT A;  3QEX A;  4B9U A;  4O44 A;  4CHN A;  4DSL A;  3AVN A;  4M45 A;  3QES A;  1L3U A;  3PO5 A;  1NK7 A;  4HCC A;  4CGD A;  4FM0 A;  3LPT A;  4N5S A;  2EHG A;  3AO1 A;  4FK2 A;  1UAX A;  2F8T A;  1CLQ A;  4DTX A;  2OYQ A;  4N47 A;  3O3G A;  3PX6 A;  3RRG A;  3DYA A;  2YNG A;  4DFK A;  4E7K A;  2PZS A;  1VSF A;  4CK1 A;  4Z0U A;  4M3R A;  4KB1 A;  3OYB A;  5KGX A;  4N41 A;  4FJM A;  1VSI A;  4I7F A;  4CJ4 A;  4DSE A;  1N6Q A;  4CFB A;  4DSK A;  5J2M A;  1JLQ A;  1SV5 A;  2IOC A;  1L3V A;  4KHN A;  2EX3 A;  2X6S A;  3T19 A;  3L3V A;  2OA8 A;  3LP1 A;  4LH4 A;  4OGE A;  1T03 A;  1FK9 A;  1CXQ A;  1RT3 A;  1S1W A;  2OPP A;  3SV4 A;  2OZS A;  1RDC A;  2IAJ A;  4CF1 A;  2WON A;  4K8X A;  1UA0 A;  2YNI A;  3QEV A;  4FJG A;  5HRS A;  3PUF A;  3VQC A;  4CIF A;  1S5J A;  2F8S A;  2JGU A;  4DU3 A;  3IRX A;  2G8W A;  4DSJ A;  4F3O A;  4FJL A;  1VSJ A;  4Z4I A;  2QXF A;  3KLF A;  1NK5 A;  4I2P A;  1TKZ A;  1ZBU A;  1WNS A;  1HYS A;  3AVB A;  4DQI A;  1LWF A;  4MQ3 A;  1QE1 A;  1KVC A;  4M42 A;  1RT2 A;  2HVI A;  4PQU A;  4Y1D A;  4AH9 A;  5CZ1 A;  3AVL A;  2ITG A;  1Q9X A;  2YV0 X;  1LV5 A;  3AVC A;  4IKF A;  4DG1 A;  4FZZ A;  3DLE A;  1GOB A;  1WAF A;  3U3G A;  2A1S A;  2XO7 A;  3OS1 A;  1DTT A;  4HVJ A;  1C1B A;  1WN7 A;  4DF8 A;  5D3G A;  2G8V A;  1U04 A;  2ATQ A;  4FLZ A;  4YFU A;  1IKW A;  3EY1 A;  1EP4 A;  4DTP A;  1C0T A;  2VG7 A;  4EP5 A;  3HXM A;  3RWU A;  4RG8 A;  2WOM A;  3I0R A;  4CCH A;  1J54 A;  3V1O A;  1DLO A;  1LW0 A;  3MEE A;  3C6T A;  3OYA A;  2E6M A;  3OS2 A;  4BDY A;  4DFM A;  4KHU A;  3LAM A;  3VQD A;  1NKC A;  4DLE A;  4DLG A;  1C1A A;  1CZ9 A;  3LPU A;  3O3H A;  4EZ9 A;  1T7P A;  3M8S A;  3HT3 A;  2YKM A;  3B6P A;  3VA0 A;  2FBV A;  3IG1 A;  1RT1 A;  4IFV A;  4M41 A;  3NHG A;  1RDB A;  3KKS A;  3HJF A;  3SZ2 A;  2FC0 A;  1JLC A;  4LSN A;  1QSL A;  1R0A A;  4JRQ A;  1EKE A;  4FJN A;  4Z4F A;  3DMJ A;  2D0C A;  3H08 A;  3I0S A;  4ID5 A;  4O4G A;  5SZT A;  4FM2 A;  3M8P A;  3OS0 A;  4CGH A;  3LP0 A;  2RN2 A;  4GMJ B;  1KFS A;  3ZT4 A;  3QEP A;  3UIQ A;  1B9F A;  5HRO A;  3ZSY A;  1XHZ A;  3VQQ A;  4FJ8 A;  2HW3 A;  2Y1I A;  2HB5 A;  4RW4 A;  4IDK A;  1X9W A;  1HQE A;  3HL8 A;  4CJT A;  4FM1 A;  3LAK A;  2NUB A;  4B8C A;  2OPS A;  3CM6 A;  2HHW A;  4CFD A;  3C6U A;  1ITG A;  1BQN A;  4ZTJ A;  1GOA A;  4TSX A;  1TK0 A;  1QTM A;  4KTQ A;  1UWB A;  3MEC A;  4CJ3 A;  3S3M A;  4KHS A;  4R5P A;  4EZ6 A;  2VG5 A;  3AVH A;  5HRN A;  3RRH A;  4NCA A;  3AO5 A;  1T05 A;  3TAF A;  3OYK A;  2YHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...