3ZSWA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zswA00
4CCHA 1N6QA 3SUNA 4FJGA 4ICLA 4F2SA 2XY5A 3V1OA 2OA8A 3AVJA 3LWMA 3TABA 4Z4EA 2BDPA 4CEEA 2JGUA 2G8KA 2G8IA 1RBUA 2IAJA 4CGFA 4DFMA 1S5JA 1TK8A 4CIEA 1C1AA 2P5GA 1JLEA 3LPUA 3IS9A 4B9UA 4HCBA 1CZ9A 1SV5A 4Z0UA 4J2DA 1D9FA 1NK6A 5CZ1A 1JLAA 1D9DA 3B6OA 3LP3A 4RW4A 4NYFA 1EETA 5C42A 3AA2A 5SZTA 4FM0A 1ZBIA 1J9AA 1IKVA 4CJ5A 1FXXA 4E7JA 4Y1DA 4C8NA 4F4KA 1U04A 3QNOA 3HPGA 2FBVA 1JLGA 4LD0A 4LSNA 1BGXT 3NF9A 1HMVA 3OYGA 1RTJA 4FLTA 4W5NA 1KLMA 4BDZA 4C8MA 2Z1IA 3ZSXA 4FLZA 3MEDA 1DTQA 4XIUA 2IS3A 3V1QA 3K57A 4EZ9A 4CJLA 1C6VA 1SKSA 1WSIA 2D0CA 4KPYA 3SQ0A 4IFVA 4M3YA 1RDAA 5FDLA 2KW4A 2D5RA 3OJUA 3KLGA 3AVMA 4OPKA 4DTRA 1S1VA 4CFDA 1C0MA 4KRFA 1RCHA 4FZYA 4KKOA 1HPZA 4BDYA 1G15A 4NCGA 3AVNA 3L3VA 4E19A 2BANA 3O3FA 2I5JA 3TAFA 3SUQA 3IAYA 4FK0A 1I3AA 2LSNA 2Z1HA 3HVTA 2FBYA 4RW8A 4YFUA 4E7KA 1A5XA 4DS4A 1HNIA 5CY4A 5J2MA 1B9DA 4CFCA 3ZSQA 3HP6A 1TKDA 1NJWA 4L8RB 3HK2A 1QSSA 3VQ8A 4FK2A 1QSYA 3AO2A 1VSIA 2WOMA 2YKNA 2Q3SA 3HO1A 1EX4A 4FJ8A 4JLHA 4GW6A 1L3VA 3UIQA 4ID1A 1WNSA 4FJJA 4DG1A 1Z25A 1TV6A 4B9SA 1ZBHA 3CQ8A 5CYMA 1BHLA 1BL3A 3IRXA 2OPPA 4E1MA 4BE2A 4KTQA 4MFBA 4OLBA 4CJWA 3KJVA 3KK3A 5KI6A 3QETA 2YHBA 1GOCA 3TAEA 1ITGA 1NKEA 2ITGA 3NCIA 3TAPA 4DTOA 2HHVA 4FJKA 4B9VA 4O5BA 1HNVA 4FZZA 3SQ4A 3G10A 3O4QA 2YV0X 4FM1A 3LANA 4DQQA 3T1AA 2QKKA 2QK9A 2RF2A 2HMIA 3AA4A 5C24A 4H8KA 5E41A 1S1UA 4W5RA 1BCMA 3F9KA 1U49A 4DSLA 3LP1A 4AILC 3AVAA 4KHYA 1CLQA 4B9TA 2KFNA 3OYCA 3RR8A 1NOZA 4B8AB 4EP5A 3LPTA 1WLJA 1NJYA 4UQGA 1RNHA 4FJ5A 3C6TA 3VQ5A 1RTDA 4B9LA 1KFDA 5HRSA 4DTJA 1NK9A 4CEBA 3O3GA 4OGEA 2VWJA 2A1RA 4KTZA 1TAUA 3QEIA 2ZD1A 3V6DA 5JS2A 4CEOA 1W9HA 2ATQA 4ELVA 4ID5A 1T03A 3AVCA 5J1EA 2YHAA 2OPQA 3ZSZA 5KGWA 1UAXA 2YNIA 4DTMA 4ZTFA 3VQ6A 4AHVA 1JL1A 3K5MA 3RR7A 1RT4A 1RDCA 2XRIA 3LP2A 1DLOA 4CFBA 3AVLA 4CJUA 1Z26A 4M41A 2WONA 3NH0A 4DTUA 5HRRA 1LW2A 4N41A 2XHBA 2KTQA 1UA0A 2JLEA 3VQEA 4E0DA 4FJIA 1CXQA 4OGCA 3K5OA 3V81A 3QIOA 4J2AA 3ISNC 3NBPA 1QQCA 1JLBA 1ASWA 4O55A 2RN2A 3OY9A 3NGIA 3K59A 4JS4A 4FCYA 3S3NA 3CFOA 1NK5A 1J5OA 5FRNA 1FKOA 4M3TA 1X9MA 4ELTA 1EXQA 1HRHA 1C1BA 2FBXA 1S1TA 1YTAA 2EHGA 3KIOA 3L2QA 1WN7A 4BACA 3KLFA 4E7IA 2GBZA 1REVA 1A5WA 3AO3A 3AVGA 1SKRA 1VSDA 3KK1A 3KD5E 4CIGA 3O3HA 3F73A 1QE1A 1SUQA 4I7FA 2KQ2A 4HTUA 4CK1A 3V9SA 1RT1A 4I2QA 3RWUA 4HCCA 4CEQA 4CJFA 1QS4A 4FXDA 2KZZA 4KREA 5I3UA 4K8ZA 1JXEA 1X9WA 4Q5VA 1KVBA 4DSFA 2KFZA 3NE6A 1I39A 4GMJB 5J2PA 3AVHA 3QEWA 3SYZA 1SL0A 4OKEA 1GOBA 3QERA 4B08A 4PWDA 3CG7A 2ETJA 4KV8A 3HVRA 4CJ3A 1KRPA 4B9MA 2OPRA 4QCLA 4CF9A 3V4IA 4FJ9A 1U48A 3WNFA 4FJ7A 1VSLA 1IKWA 3EZ5A 4BWMA 1S9EA 4CGHA 4FJXA 5JS1A 1YTUA 1WAJA 4W5QA 3ALYA 3RMDA 4OJRA 1UA1A 1WSJA 3O4NA 4CE9A 2IOCA 3S9HA 1WSEA 3CFPA 3AO4A 1NK4A 3MEEA 1EP4A 1JLCA 4LSLA 1JLQA 3ZSYA 3ZT1A 4OPJA 3KTQA 3CYMA 3LDSA 3C95A 4GVMA 2YKMA 4B8CA 1WAFA 1YT3A 4YNQA 3IG1A 3SV4A 2Y1JA 1ZBLA 3U6FA 1LV5A 1J53A 1QSLA 2G8HA 4Z4IA 3AA3A 4JRPA 3OJSA 1L3TA 3CM6A 1RBRA 1KLNA 1KSPA 3VQCA 4B3OA 2VG6A 4CGGA 1MU2A 3PX6A 3V1RA 2HHSA 3NH2A 3QEXA 2NUBA 4N56A 3JSMA 3HJFA 3HM9A 2P1JA 4CJTA 4ZHRA 1IO2A 3SUOA 4J2EA 4DWIA 2F8TA 3NH1A 4NYNA 2BE2A 4FW2A 3AVIA 5C25A 4FJHA 3QIPA 4IKFA 3PX0A 3ASMA 5DK5A 1NK8A 4WE1A 4CF2A 4F3OA 1R0AA 1T05A 4OVLA 4Q0BA 4IDKA 1NJZA 4JRQA 4CESA 4R5PA 3V9UA 1RTIA 1WSGA 1VSEA 4DFKA 4Z4FA 4KHWA 2XY8A 4CECA 1HYSA 3ULDA 2D0AA 1HYZA 2F96A 3MECA 3P5JA 3AA5X 3DLEA 4O0IA 4ZTJA 4M3ZA 4CEDA 2FC0A 1TAQA 1VSHA 1ZYQA 2FBTA 1RDBA 3VQDA 3U3YA 4CHNA 1RDDA 1BIUA 1HJRA 4LY7A 3ZCMA 3EYZA 3M8RA 1C0UA 3SI6A 5D3GA 4QOZB 1TKTA 1X1PA 4QAGA 4M3XA 2HVIA 4EP4A 1F21A 2XY6A 1IKXA 3OYKA 4CIFA 1RT5A 4JS5A 5HROA 3DOLA 1IG9A 3ZT4A 1CZBA 2Y1IA 2O4IA 1S9GA 2HHUA 1LW0A 1QTMA 2Z1JA 3DRPA 1J54A 2D0BA 3SPZA 3RMAA 3B6PA 4DFPA 2X6SA 1TK0A 2A1SA 1T8EA 2PY5A 4KB0A 3PX4A 4PUOA 1RT7A 3QNNA 1Q8IA 1VRUA 1BI4B 4Y1CA 2X78A 1VSFA 1D5AA 3HXMA 4FLVA 4DU1A 1LWFA 4E7LA 3PY8A 1BI4A 4RW7A 1GOAA 1UOCA 3MAQA 1Q9XA 4CGDA 2B5JA 2G8FA 4BE0A 1QHTA 1U4BA 4N76A 2X6NA 3SV3A 3S3OA 3QESA 1S6QA 3QINA 4H4OA 4M3RA 4B9NA 3KLHA 4FJNA 4FW1A 4C8OA 3DRRA 2YNFA 1TK5A 4DTSA 1RILA 3TARA 4BE1A 3K2PA 1WSFA 5J2QA 1JLFA 2VG7A 4C8LA 4IG3A 4FLXA 3QLHA 3PV8A 4LH4A 4CJQA 3HPOA 2XY7A 2OZMA 4DQPA 4KHNA 4HUGA 5HLFA 1VSKA 4CJVA 4CK3A 1EKEA 2O4GA 3SCXA 2HNZA 3WNHA 3OYIA 1LAWA 3K58A 4CF8A 2KZMA 4CGJA 3TAQA 3KLIA 1KVCA 1B92A 5CYQA 4AHTA 1TL3A 3TANA 1T7PA 1UWBA 3HPHA 3VQ9A 2RKIA 2YNHA 3DM2A 1TVRA 3OYBA 1A5VA 4KTWA 4DLEA 4F2RA 3MEGA 4FK4A 1VSJA 1XHXA 2HNDA 3LAMA 3KKSA 2OPSA 3DRSA 1U45A 2E6LA 1RT6A 3U3GA 5EU7A 1XHZA 4CJKA 3DLKA 4H4MA 2R7YA 2G8VA 1S1WA 4HUEA 4C8KA 2HHXA 5DMRA 5J2NA 3P1GA 3V9XA 4CGIA 1O1WA 2E6MA 3QO9A 3JYTA 1BQNA 3LP0A 4DLGA 3S3MA 4DQIA 4FLYA 1BIZA 4DQRA 3G0ZA 4KHUA 5HRNA 4O0JA 2VWKA 1TL1A 1D8YA 1CXUA 1SL1A 1VK0A 3OVNA 2ZE2A 1L5UA 1ASVA 2E4LA 3CM5A 2HVHA 3M8SA 2F8SA 1ZBUA 2EX3A 3SPYA 4DTPA 4DSIA 4AHRA 1FKPA 4CJ4A 4BDPA 4M42A 5HBMA 3AO5A 4CJSA 1SL2A 4KI4A 4RW9A 1FK9A 2IGIA 4Z4CA 4CHZA 1JKHA 3KK2A 1B9FA 1XI1A 5KTQA 4CK2A 1IKYA 2YNGA 3KKRA 5K14A 4AH9A 3LWLA 4KI6A 2HHTA 3M8PA 3MXMA 4W5TA 4OLAA 1C1CA 1XWLA 2QXFA 4O4GA 4RG8A 3TAGA 4DF4A 1LAVA 3NGZA 4CJRA 2XO7A 3TR8A 4DQSA 4AHUA 4N47A 4AHCA 1HYVA 4CHPA 4W5OA 3PUFA 1NJXA 1BISA 1RT2A 5KRSA 3OYMA 4DF8A 3SQ2A 4E3SA 1XC9A 3MXIA 3NDKA 3SQ1A 4IG0A 4CEZA 2HB5A 4M45A 4OKKA 1Q9YA 3BDPA 3DLBA 3I8DA 4KAZA 3D45A 1Y97A 1TKZA 3HP9A 2P51A 3L2UA 1S6PA 1JXBA 3PO4A 4CF0A 3QEVA 2HW3A 2Z1GA 3DYAA 3K5NA 3C94A 1HQEA 3WNEA 2GUIA 3VQ4A 4CF1A 4DU4A 4M3UA 3DI6A 3WNGA 3EY1A 4F8RA 1KVAA 4KB1A 4F3TA 1RBTA 1W0HA 1TGOA 4E7HA 3RMCA 4PA1A 5T7BA 1NK0A 2OYQA 4EZ6A 4DTNA 3L2RA 3VQAA 4MQ3A 3ZSVA 2DY4A 3DLGA 2OZSA 2GV9A 1L3UA 3OYNA 3VA3A 4RW6A 3VQBA 4CEAA 4FVMA 2HNYA 3OYJA 1RBVA 1VRTA 3I0SA 4CEFA 3OYAA 4DMNA 3TWHA 3V9ZA 3KLEA 4DSJA 1C0TA 4KFBA 4NCBA 3ZSOA 1L3SA 3ZT3A 3NF6A 3RMBA 2DTUA 3OYHA 2P5OA 4FM2A 3HT3A 3OS1A 1K6YA 4I9LA 4CHOA 3FFIA 3M8QA 3L2VA 4I2PA 2VG5A 4CHYA 4HUFA 2ZQBA 1RT3A 1NOYA 4G1QA 3LALA 4DU3A 4Z4GA 2G8WA 3LAKA 3VQ7A 3OYLA 3ZT2A 2B4JA 3NHGA 1U47A 1NK7A 2BGGA 1LWCA 3RRGA 1RBSA 1JL2A 3V9WA 1KCFA 4KO0A 4J2BA 4E89A 2W42A 1X9SA 3H08A 3OYEA 4ELUA 5KRTA 2QKBA 3ZSWA 3DOKA 1BQMA 3C6UA 5HP1A 3VQPA 1ASUA 4CFAA 3KD1E 3TI0A 3VA0A 2HHQA 3I0RA 3NAEA 4TSXA 4HHTA 1KFSA 4DSKA 1SKWA 2PYJA 4DTXA 2RPIA 3NF7A 2HHWA 3NF8A 4PQUA 3ZSRA 4OKJA 4Z4HA 4FJLA 3L3UA 4IBNA 3RTVA 4FZXC 4KHQA 1ZBFA 3AVBA 3P83D 4CHQA 3THVA 5HRPA 3PO5A 4K8XA 5FRMA 1S1XA 3TAMA 2IDOA 5CZ2A 2AJQA 3AVFA 4IFYA 4HVJA 3T3FA 3NFAA 4DFJA 3OS2A 3BGRA 3LZIA 2DFHA 3K5LA 3HYFA 4N5SA 3MXJA 4LH5A 3T19A 2G8UA 3AVKA 2PYLA 4NCAA 3LZJA 1TKXA 3E01A 5FROA 3HL8A 4KHSA 5KGXA 2X74A 1IH7A 2DFEA 4I9QA 5I42A 3VN5A 4FLWA 1N5YA 3OS0A 4FYDA 4O44A 3NGYA 4AHSA 3RRHA 4FLUA 1BCOA 3DMJA 4FJMA 3AV9A 1NKBA 4M3WA 3SJJA 4CJPA 3L8BA 1VSMA 3HSTB 4DSEA 4PY5A 3A2FA 3CFRA 1KTQA 4DS5A 3DLHA 3L2WA 3ITHA 1DTTA 2IC3A 3DLRA 4CJEA 2PZSA 1YVUA 2B6AA 3QEPA 4E1NA 3AO1A 3SZ2A 3VQQA 1WSHA 3OYDA 4BWJA 3OYFA 3SNNA 1RTHA 1LWEA 3ZT0A 1NKCA 2DFFA 3D0PA 1HQUA 3SUPA 4CERA 5SWMA
chains in the Genus database with same CATH superfamily
4FJGA 4MLHA 4ICLA 1IG8A 1GLLO 2G8IA 1RBUA 2IAJA 3LDQA 3O9UA 4MO5A 1SV5A 1V4TA 3Q7CA 2Q0RA 5CZ1A 1U6ZA 1D9DA 1VAZA 3LP3A 4RW4A 4AF1A 5SZTA 3VEWA 1ZBIA 1J9AA 1IKVA 2EWSA 4KHPK 2VQEK 3A5LC 5FPDA 4F4KA 4XEIA 4PHTX 3TPQA 2FBVA 1BGXT 4AQYK 1RTJA 1KLMA 3ZSXA 3LDOA 1HLUA 3MEDA 3K57A 3V1QA 5KQDA 2D0CA 3SQ0A 4IFVA 3AAQA 3AVMA 4OPKA 3HI0A 4BRHA 2I5JA 4A62A 3O4WA 1I3AA 4GKJK 3A5OC 3TU5A 4RW8A 5CY4A 3HK2A 1B9DA 2HF3A 4L8RB 2P9LB 4FK2A 1QSYA 3AO2A 2WOMA 4LF9K 4FJ8A 4JLHA 3CMAN 4ID1A 1QQMA 2O8DB 4BRLA 1ZBHA 3P4IA 5CYMA 1BL3A 4OLBA 4MFBA 5AR0A 4DR7K 2HHVA 2A5XA 3VF6A 3G10A 3WXJA 3THWB 5AQSA 3G25A 4DQQA 3T1AA 2QK9A 2RF2A 2HMIA 2NRZA 5E41A 1S1UA 1BCMA 2OTLN 3LP1A 3HM8A 1CLQA 1IJJA 2ASMA 2KFNA 4WFBL 1NOZA 4EP5A 3CETA 1T3VA 3M5RA 4CW7B 4DV5K 1GLCG 3C6TA 1RTDA 5ADXH 4WYBA 2VWJA 1HKBA 5JS2A 4ID5A 1T03A 5J1EA 2V52B 3ZSZA 4ZTFA 3LP2A 3SMPA 2QWRA 1Z26A 4M41A 5H1SQ 1KD1O 2VGMA 3RSEB 1LW2A 4N41A 2UXCK 1Y64A 5AQHA 4E0DA 2NRVA 3QIOA 3NBPA 2CGLA 4O55A 4DKWA 3S3NA 1N33K 1J5OA 5FRNA 1FKOA 4YOUA 5BRFA 4E7IA 1YJWN 2GBZA 5BPNA 3KK1A 3KD5E 3F73A 4ILHA 1JCFA 4Y0WA 1SUQA 3CJ7A 3V9SA 3RWUA 1QS4A 3BF3A 2W6LA 2ZGYA 4Q5VA 1NGEA 3NE6A 3UE5A 1RDWX 3J7ZO 1GOBA 4FWNA 1QHAA 3HVRA 2CH5A 1KRPA 3WNFA 1VSLA 1IKWA 1S9EA 4CGHA 4H5NA 1WAJA 3ALYA 2QWOA 1WSJA 3O4NA 4CE9A 4O8KA 1WSEA 1NK4A 3AO4A 5LMNK 3KTQA 1EP4A 3ZT1A 4LSLA 1VHXA 3CYMA 4FJIA 4YNQA 2YKMA 1WAFA 1YT3A 3GDQA 1ZBLA 1LV5A 3C7NA 3AA3A 1NGGA 3VQCA 2D0PA 5AQOA 3QEXA 2NLXA 4NYNA 3P38A 3AVIA 4FJHA 4IKFA 5JLHA 4CF2A 2YI1A 2W41A 2FSJA 4IDKA 3L4IA 3UKRB 1RTIA 1WSGA 2IVNA 4U67L 2XY8A 1HYSA 3SJHA 4O5FA 1HYZA 3ZX0A 4DQ8A 5AZJA 4CEDA 5AQLA 4BRAA 4Z94A 2ZGZA 4BVPA 4LY7A 1XQSC 1X1PA 1EO1A 2O8CA 4JHDB 4UY8O 1IKXA 4CIFA 4OPHA 1IG9A 1XUPO 2Y1IA 2VYPA 3ATVA 1XNQK 4DFPA 4BRIA 2PY5A 3PX4A 1RT7A 3T69A 2X78A 3HXMA 3L4QA 4FLVA 3VGKA 3M3ZA 2G8FA 1QHTA 1U4BA 3S3OA 4H03B 4M3RA 1BA0A 4FW1A 5M1PA 3CCEN 4C8OA 1NWKA 1TK5A 4DTSA 1VQNN 3K2PA 1SS6A 2VG7A 2UYTA 4C8LA 3O9SA 3QLHA 4KHNA 5C0YA 3AGKA 1YXQA 3CMEN 1QVFM 4XH4A 1LAWA 3K58A 4CGJA 1NG9A 1NGIA 1KVCA 3E66A 1OVYA 4AHTA 3H45C 2QM1A 2RKIA 2YNHA 3UB5A 1QZ6A 2VGNA 3MEGA 4LF6K 1XHXA 4FK4A 3KKSA 5AJ3K 3SBGA 2E6LA 1OH6A 1S1WA 4HUEA 4C8KA 3P1GA 5BRDA 3ID6A 2E6MA 5TKYA 3EO3A 4DQIA 4DLGA 1BIZA 4DQRA 5HRNA 1NGFA 1WBBA 3CC4N 5AQFA 1L5UA 1ASVA 1MA9B 2E4LA 3D2EB 2F8SA 3AARA 4DTPA 4DSIA 2P9NB 3T1HK 3AO5A 2PBDA 3EE8A 3C6HA 1FK9A 2IGIA 1JKHA 1IKYA 2YX6A 1C1CA 2QXFA 5HL7L 4JYAK 1LAVA 3NGZA 4B1YB 3CCLN 3R9PA 3CCQN 2XO7A 3CCRN 1QQNA 1HNXK 4AHUA 3QBWA 1HYVA 3CCUN 4IEIA 2QTDA 2W40A 5KRSA 1HKGA 5LL6Z 1XC9A 4GVEA 2HB5A 3R3LA 4M45A 1Q9YA 3DLBA 4YDUC 4LF5K 1Y97A 4CD3A 1JXBA 5BN9A 1GLJO 4CZMA 4BRFA 2HW3A 2Z1GA 3K5NA 4JEPA 2E5LK 3VTHA 4CF1A 3D2FB 4FWQA 2E1YA 4WCEL 3WNGA 4F8RA 1KVAA 4K0KK 4JI5K 3VENA 3RMCA 5T7BA 1NK0A 3TSQA 4DTNA 5DM6L 3ZSVA 3H46O 3F5TA 4CBUA 1OVQA 1BG3A 3VA3A 4RW6A 4CEAA 3VQBA 4FOEA 4BROA 4FWPA 4K43A 1K73O 3V9ZA 3EEQA 3FE1A 4QS9A 5AZIB 1E3MA 3ZSOA 4I6MB 3ZT3A 2DTUA 4YOWA 4EFHA 4GNIA 2O8FA 4JKBA 1LOTB 4CHOA 3FFIA 4DUZK 3J7AP 1NOYA 1RT3A 5AQRA 5EVZA 2B4JA 1U47A 2BGGA 4EIAA 3RRGA 1RBSA 3BP8A 1BWFO 2OANA 4BRMA 2A3ZA 4CZKA 3KD1E 5IT9O 3QFPA 3I0RA 4BC3A 3TTCA 4BR0A 4X62K 1KFSA 1SKWA 3KHYA 4WFNL 3ZSRA 1OH5A 4FJLA 4FOIA 3L3UA 4JI0K 1HJOA 3AVBA 2V7YA 4CHQA 3SAFA 3THXB 4K8XA 1GLEG 5FRMA 1S3XA 5CZ2A 3TAMA 3AVFA 4IFYA 4HVJA 3T3FA 4DFJA 5FPEA 2HHSA 4JKGA 2WTUA 3T19A 3LZJA 1TKXA 3R8EA 5KGXA 3WQTA 2Q0UA 3OW2M 3VN5A 4FPBA 3HTVA 3RRHA 1QQOA 5GINA 1NKBA 1E4FT 4JAXA 4PY5A 2HMPA 2B6AA 3SZ2A 2P9PA 3OYDA 2QWPA 5B8HA 2DFFA 3SUPA 2P9KA 1X9JA 4HWIA 1N6QA 3SUNA 4F2SA 3AVJA 3LWMA 3TABA 1XC3A 2JGUA 1IBMK 2G8KA 4CGFA 4KH4A 1WBDA 1S5JA 1TK8A 1C1AA 1NGBA 3VF2A 2P5GA 4J2DA 4IZ9A 1D9FA 2IVOA 4FM0A 1GLDG 3C65A 4CJ5A 4Y1DA 5BR9A 4C8NA 5IWAK 3ATUA 2J4RA 1U04A 3QNOA 3GL1A 4LD0A 3NF9A 4X66K 4FLTA 4C8MA 4BR9A 4FLZA 1DTQA 4CJLA 1SKSA 1W7AA 3MX5A 2V7ZA 2HBLA 3CPEA 5AQZA 4YHHK 1S1VA 1MWKA 1C0MA 5BR8K 4BDYA 1XMOK 3VGMA 1G15A 2P9KB 3L3VA 3O3FA 2BANA 3A5MC 2Z1HA 2P9PB 4C1NK 3HVTA 2FBYA 3VOVA 4DS4A 1HNIA 5J2MA 3HP6A 3PSIA 3SMSA 5DM7L 3JS6A 2YKNA 1TUYA 2AP1A 1WNSA 3A0IX 2BTFA 5C12A 2ZF5O 3CQ8A 4KTQA 3KJVA 3QETA 5KI6A 1NKEA 3TAPA 4DTOA 3FLCO 3SQ4A 4ISEA 3ULEB 3O6WA 3KZBA 3AA4A 5C24A 3S41A 2QWQA 1U49A 3AVAA 2O8EA 4B9TA 3MMVA 5F2RA 1KAXA 4B8AB 4JD2A 3LDNA 3U9ZA 1FJGK 4DV7K 3CCSN 3JAMO 1NK9A 5AZJB 1WOQA 4M7XA 2A1RA 4KTZA 2ZD1A 1W9HA 1T44A 3LM9A 1NNEA 1KAYA 4PKGA 3AVCA 3KWIA 1UAXA 3VQ6A 3K5MA 1RT4A 2XRIA 5AZIA 1DLOA 2YHYA 3AVLA 3UKUA 4CJUA 1VQON 4DTUA 3CERA 5AQYA 2XHBA 2KTQA 2CGKA 3H3OB 4J2AA 4BQLA 1ASWA 1JLBA 2RN2A 3OY9A 3CFOA 3C7NB 4M3TA 5C2FA 1X9MA 1NGJA 4B3SK 4BG8A 1C1BA 4BACA 1YTAA 3L2QA 1N36K 1WN7A 3CCMN 3LDPA 3AVGA 1VSDA 3CJCA 4BRPA 2IIRA 4CIGA 3O3HA 1YJNN 4BRNA 2WC9A 2GTDA 4FWOA 4I7FA 4CK1A 4FXDA 4CEQA 4CJFA 1YI2N 2KZZA 3WT0A 3WXKA 4U7BA 5I3UA 4PL7A 1KVBA 5M1NA 4DSFA 5J2PA 3CC2N 3SYZA 1SL0A 1Z05A 3CG7A 4BR2A 3FFKB 5AQMA 4FL9A 4CF9A 1U48A 1FW6A 1YF5L 3GG4A 4ISGA 1YTUA 4W5QA 1ATSA 4WFAL 5JVHL 3ZETA 3K9JA 3MEEA 3R1XA 3ENOA 3ZSYA 4OPJA 1NK8A 4GVMA 2Y1JA 5AQNA 1HKCA 3FZKA 1QSLA 3E1YA 1KSPA 3OBYA 2VG6A 4KBOA 4BRKA 3V1RA 3O5BA 3NH2A 5GIOA 2NUBA 3HJFA 4CZIA 3NVKA 3SUOA 2BE2A 1XMQK 3QIPA 5DK5A 1R59O 2RE2A 2A42A 4CESA 4R5PA 3V9UA 1VSEA 4CECA 3ULDA 2D0AA 2F96A 3BUZB 5JICA 4O0IA 3MCAB 4M3ZA 1VQ6N 1VSHA 4DR3K 4AM6A 5LJVA 1RDDA 1HJRA 3B8AX 3G4SN 3C6AA 3SI6A 5JLFA 4DB3A 4EP4A 3VEOA 4H0XB 2UUBK 1ATNA 4QS7A 3DWLA 3ZT4A 2VWBA 4DCHA 2HHUA 1LW0A 1J54A 2D0BA 3ZYYX 3THWA 3RMAA 3B6PA 1T8EA 4KB0A 3QNNA 1VRUA 1SL1A 3F2KA 1VSFA 3E9LA 4RW7A 1UOCA 3MAQA 2O8DA 2X6NA 3VF4A 4CI6A 3WXLA 3QESA 4H4OA 5EOYA 4B9NA 2O8BB 4GKKK 1WB9A 2YHWA 1WSFA 4JHDA 2P9LA 4IG3A 3PV8A 4CJQA 3HPOA 4DQPA 4LC9B 4YORA 5HLFA 4CK3A 1EKEA 2O4GA 3OYIA 3KLIA 3QMLA 5CYQA 3TANA 1C0GA 2JWLA 3DM2A 4X64K 2P9SB 3FZHA 3OYBA 3F9MA 1VSJA 5LY3A 1U45A 4HTLA 1GLBG 1NBWA 2PAVA 5EU7A 4BGAA 2O8BA 2FSNA 4BGBA 2R7YA 2G8VA 3QFUA 4A57A 5DMRA 3JYTA 3LP0A 3GBTA 3S3MA 2KKZA 4FLYA 3G0ZA 2PFUA 4O0JA 2VWKA 1CXUA 4DHYA 1K8KB 4WQ4A 2CGJA 2HVHA 3M8SA 1ZBUA 3SPYA 1FKPA 2GEMA 3CQXA 4CJSA 1SL2A 3IMXA 4CK2A 3KKRA 2VCPA 2YCHA 4LF7K 3M8PA 3MXMA 1QVGM 4OLAA 3ID8A 3C0BA 3VGLA 1QZ5A 1NJIO 2E2QA 4V19S 2YJFA 4N47A 4AHCA 4W5OA 1BISA 4DF8A 1VQ4N 4H5WA 5KPRA 3SQ1A 2NRWA 4OKKA 3CD6N 1HX1A 4KAZA 1TKZA 3PO4A 4CF0A 4CZJA 3CXCM 4JKDA 2WFBA 3W3DA 3WNEA 1HQEA 1MWMA 2GUIA 1YAGA 4BVOA 4DUYK 3VEYA 4PA1A 2AA4A 3L0QA 4OPAA 2P9UA 4MQ3A 2P9UB 2OZSA 2GV9A 1YUWA 3RSEA 4H0YB 3TWHA 3OYAA 1GLAG 4DSJA 2NRTA 1L3SA 3JXUA 3NF6A 3RMBA 2P5OA 4FM2A 3HT3A 3OS1A 3SAHA 4H5RA 3M8QA 2ZQBA 5E26A 2GUPA 1KQSM 1VQ9N 2G8WA 3VQ7A 3OYLA 3NHGA 1NK7A 3V9WA 1JL2A 5JMVA 5AQWA 3CJ9A 2W42A 4ELUA 1O13A 3ZSWA 4PL8A 3VQPA 3TI0A 4M7YA 2PYJA 4DTXA 4BRQA 3NF7A 4DV3K 5M1KA 2HHWA 3SAGA 5KPZA 4OKJA 3L6QA 4IBNA 4FZXC 1X3NA 4KHQA 3VEXA 4ILJA 5HRPA 3PO5A 1S1XA 4YDUA 2IDOA 1ATRA 3VPZA 2AJQA 3PLAA 1K8KA 3CHWA 3OS2A 3T1YK 2DFHA 4JI1K 4NCAA 5FROA 1X3MA 2ASPA 3HL8A 5AQKA 2X74A 1IH7A 2DFEA 2E1ZA 3LDLA 3UKUB 3OS0A 3NGYA 4FJMA 1BCOA 2BUPA 3AV9A 4MDBA 3SJJA 1VSMA 5AQXA 4DSEA 3CFRA 2P9SA 3O8MA 2IC3A 3DLRA 2PZSA 1YVUA 3QEPA 3AO1A 4JK9A 3VQQA 1WSHA 3WXIA 3OYFA 1RTHA 3ZT0A 1NKCA 2Q1NA 3I33A 4CERA 2F9TA 5SWMA 4CBWA 4IO8A 3P39A 4JD2B 4BG9A 3M6GA 4OX9K 2H3GX 2BDPA 1H1VA 1IBLK 4H0TB 1NM1A 4DFMA 2I7PA 1M90O 3MN7A 3N4QA 4JV5K 2NRXA 1JLEA 3IS9A 1HR0K 4HCBA 5FLXO 1JLAA 4IFEA 4JI8K 3B6OA 5C42A 3AA2A 4BRCA 3ULEA 3K0SA 4OO1J 2HBJA 1ESVA 1FXXA 1N34K 5F1XA 1IV0A 2E2NA 3HPGA 2UXBK 1JLGA 1KAZA 3OYGA 1DKGD 2Z1IA 4XIUA 1C6VA 1WSIA 1BUPA 5FDLA 2D5RA 3KLGA 4DTRA 4KRFA 4FZYA 4KKOA 4H5VA 2HBKA 3AVNA 3CCVN 2Q2RA 4E19A 4FK0A 4QS8A 4YFUA 3CJAA 4H5TA 2VQFK 4G9ZA 3ZSQA 4B1VA 3H6EA 1QSSA 1CZAN 1VSIA 4C1NI 3CJ1A 3R6MA 4GW6A 5GADP 3GE1A 4FJJA 1BHLA 4BE2A 2OPPA 4A2AA 4CJWA 1VQ8N 2YHBA 3TAEA 4DR6K 1ITGA 4YOYA 2ITGA 3NCIA 4FJKA 4FM1A 5AQGA 4W5RA 3F9KA 2ITMA 2CH6A 3ZETB 4BRGA 3H3NO 4DSLA 2HHHK 5I9EB 2WBNA 3OYCA 3LPTA 1JCGA 1G99A 4FPAA 1WLJA 4UQGA 3VQ5A 1KFDA 3E9PA 4DTJA 4BQZA 4OGEA 2HF4A 4JN4A 2ATQA 3CF5L 4ELVA 2YHAA 2OPQA 4DTMA 1JL1A 1U2VB 3RR7A 4CZLA 1SAZA 1J6ZA 1VQKN 2FF6A 2WONA 3NH0A 3AGRA 5HRRA 3A5NC 1M1KO 3VQEA 4JKGB 4NB4A 1CXQA 3I56N 3K5OA 2QEXN 2E20A 3ISNC 1QQCA 4FCYA 3NGIA 3THXA 2NZTA 3TSPA 4IJAA 1HRHA 2FBXA 3FGUA 1S1TA 4GV9A 3KLFA 1REVA 1A5WA 1SKRA 3QDKA 3H1VX 5LMUK 1QE1A 2E88A 4IDHA 2UUAK 2KQ2A 4HTUA 4I2QA 4HCCA 4KREA 1X9WA 2KFZA 1I39A 4GMJB 5EXWA 3QEWA 3MN6A 3MK6A 4PWDA 3QERA 4A59A 4IO9L 2KHOA 3EKUA 2OPRA 4FJ9A 3EZ5A 4ILGB 2O8EB 3RMDA 1UA1A 4I6MA 5AQUA 3S9HA 3CFPA 4A61A 1GLFO 1JLQA 1P90A 3LDSA 4B8CA 3SV4A 3IG1A 4Z4IA 4JRPA 2GELA 1L3TA 1KLNA 4B3OA 3FZLA 4YOVA 4LFAK 4CGGA 1MU2A 3VETA 4YOXA 3QB0A 3HM9A 4ZHRA 1IO2A 1BDGA 4DWIA 4IEEA 3NH1A 2F8TA 3D2FA 5C25A 4CZEA 3PX0A 3Q7BA 1HPMA 1R0AA 1T05A 1NJZA 2FF3B 1JCEA 3IDHA 4BRDA 3FZFA 4CD1A 1Q7YO 3MWTA 4IOCL 4DFKA 4KHWA 3P5JA 3DLEA 3WEEA 5A2QO 1K9MO 2FC0A 4WQ4C 2FBTA 1RDBA 1BIUA 4K42A 1Z6RA 5D3GA 1T6DA 1TKTA 2HVIA 5JVGL 1LCUA 1F21A 3LM2A 3OYKA 4JS5A 1CZBA 2QXLA 2Z1JA 3KVGA 3SPZA 2X6SA 2A1SA 3D2EA 1Q8IA 3P31A 4Y1CA 4M3YA 1JJ2M 1BI4A 1GOAA 1D4XA 1VQ7N 1Q9XA 2W6KA 3D6RA 4K25A 4N76A 3SV3A 1S6QA 3QINA 4FJNA 2YJEA 3TARA 3H1QA 3N4PA 3OHRA 5J2QA 4FLXA 4PKIA 4LH4A 2XY7A 4KH6A 4HUGA 4B3TK 1VSKA 2D0OA 2HNZA 3WNHA 4JI7K 4CF8A 2KZMA 4MLEA 1T7PA 1TL3A 1SZ2A 2QWLA 3VQ9A 3MN9A 1MDUB 3TTDA 1A5VA 4KTWA 2F4VK 3DRSA 1RT6A 3PSFA 4CBXA 3U3GA 4CJKA 4H4MA 5J2NA 3V9XA 4CGIA 3QO9A 5EX5A 1BQNA 3K9KA 4MO4A 5LJWA 4KHUA 3ENBA 5AFUA 1TL1A 1D8YA 1VK0A 3OVNA 4FWLA 2QWNA 1HUXA 3VMFB 1YIJN 2F7TA 4BDPA 4RWTA 4JKHA 4Z4CA 1XI1A 4F3OA 4CHZA 3KK2A 1B9FA 5KTQA 3LWLA 2GX9A 5K14A 4AH9A 3VEVA 2ZJPL 2ASOA 4O8UA 4KI6A 2HHTA 4DR4K 4RG8A 1NU0A 4DF4A 4NO7A 4DQSA 2JWKA 4CHPA 3PUFA 3J80O 1NJXA 3OYMA 3SQ2A 4E3SA 3M1FA 3EL2A 3MXIA 4IG0A 1NGHA 4C23A 1HNZK 1TYQA 3WXMB 3D45A 2P51A 3UKRA 1S6PA 2O8FB 2GWJA 3QEVA 3DYAA 2ZWHA 3C94A 3HSCA 1WUAA 4JI6K 4M3UA 4H0VB 3EY1A 2F9WA 1RBTA 1EWQA 4E7HA 4B9QA 4L3QA 3NMUA 2HSTA 4EZ6A 2DY4A 3DLGA 4LF8K 4FSVA 4F9OA 3CIPA 3MN5A 3E9OA 3OYJA 1VRTA 3PIPL 4CEFA 3I0SA 4DMNA 5AQPA 1C0TA 4JKFA 3OYHA 4NXNK 4AM7A 4I9LA 3L2VA 4I2PA 2VG5A 4CHYA 4G1QA 4DU3A 1NGAA 3ZT2A 4J2BA 3J7YP 4E89A 1X9SA 3H08A 3OYEA 1ZXOA 5KRTA 3I55N 4XH1A 1BQMA 3C6UA 1ASUA 4CFAA 1IBKK 3VA0A 5BRHA 1KXPA 4TSXA 4HHTA 3CJBA 4FVUA 3HOTA 2RPIA 3NF8A 2HOEA 4Z4HA 1N32K 3RTVA 4DV6K 2P9NA 3O9QA 1NMNA 4BREA 4H0PA 5F0XA 4DV0K 3FR0A 3NFAA 4K41A 3BGRA 3K5LA 3HYFA 4N5SA 3MXJA 1VQLN 2G8UA 2PYLA 5GAEP 3SBTA 4KHSA 2P9IB 1NGDA 4FLWA 3VTIA 1VQ5N 4M3WA 1XNRK 4CJPA 3BF1A 3A2FA 3DLHA 3L2WA 3ITHA 1DTTA 4YOTA 4M63C 4CJEA 4E1NA 4CZHA 1KC8O 3J8AA 1EWRA 3D0PA 1HQUA 4CCHA 2FSKA 2XY5A 3V1OA 2OA8A 1VQMN 2Q31A 4Z4EA 4CEEA 4CIEA 3LPUA 4B9UA 4XH5A 1CZ9A 4Z0UA 1NK6A 4JK7A 5FPMA 4NYFA 1EETA 1I94K 5ADXA 2FXUA 4E7JA 4ISFA 4B1ZA 1BO5O 3O80A 4LSNA 1HMVA 4NLCA 1DT9A 2GWKA 1BU6O 4W5NA 4FO0A 1ILYA 4BDZA 2IS3A 4EZ9A 3O08A 4KPYA 4LF4K 1BA1A 1RDAA 2KW4A 3OJUA 2O8CB 4IOXA 2IVPA 4CFDA 1RCHA 1HPZA 4NCGA 2Q97A 5C10A 2NRRA 3TAFA 3SUQA 3IAYA 3QICA 4NXMK 5GIPA 1W2BM 2LSNA 4FWRA 4E7KA 1A5XA 3HZ6A 1TKDA 1S22A 4CFCA 3RVCA 4R79A 1NJWA 3MWPA 4NLBA 3VQ8A 5MLCQ 2Q3SA 1EX4A 3AY9A 1L3VA 3UIQA 2P9IA 4DG1A 1Z25A 1TV6A 4B9SA 3IRXA 3W0LA 4E1MA 3ZX2A 3KK3A 4BR5A 1GOCA 3T7ZA 2A41A 4B9VA 4O5BA 1HNVA 4FZZA 3O4QA 2YV0X 3LANA 1K8AO 2QKKA 2QA4N 4H8KA 4E1JA 4J8FA 5CE3A 4AILC 2E2OA 4CZFA 3RR8A 1NJYA 1RNHA 4FJ5A 4B9LA 5HRSA 4WQ5A 4CEBA 3O3GA 2BH1A 1TAUA 3QEIA 3V6DA 4CEOA 4BC5A 4DV1K 4CVNE 4DR5K 4B1WB 3KWGA 5KGWA 2YNIA 4AHVA 1RDCA 4A2BA 4CFBA 1Q82O 1C0FA 4RTFD 4EHTA 1UA0A 2JLEA 4GY2B 3O9TA 4OGCA 3V81A 4BR7A 4JS4A 3SK3A 3K59A 1NK5A 3TSUA 4ELTA 1EXQA 4NCBA 3CC7N 2EHGA 3KIOA 4IXCA 3DAWA 3AO3A 2OTJN 4BC2A 5E84A 3HOSA 1RT1A 1TYQB 4BY9C 4K8ZA 1JXEA 4MDAA 4FWKA 3AVHA 4KH5A 2UU9K 4OKEA 4B08A 2ETJA 4KV8A 5CR4A 4CJ3A 3WQUA 3V4IA 4QCLA 4PKHA 4FJ7A 1YVNA 3EZWA 4FJXA 4BWMA 4IWVA 5JS1A 5AQVA 4JKEA 1SQKA 4OJRA 2IOCA 1T6CA 1JLCA 3QBXA 4B9MA 1NGCA 4BR4A 3C95A 3HO1A 1TUUA 3CQYA 2G8HA 3U6FA 2ZJQL 1J53A 1OH8A 5KQ8A 5FPNA 5EY4A 3EE9A 3OJSA 1YHQN 3CM6A 1RBRA 1EQYA 3CI5A 1Q18A 3SLCA 4H0OA 3PX6A 3U8XA 4B1XB 5AQIA 2QI2A 4N56A 3JSMA 2P1JA 4CJTA 4J2EA 4JI2K 4BC4A 4B1UB 5CHIA 4FW2A 1RFQA 3ASMA 4WE1A 1OKJA 5KPTA 1U2VA 2NRHA 3IKMA 4OVLA 4Q0BA 4JRQA 1W97L 3IFRA 4DV4K 2NNWA 4Z4FA 3MECA 3AA5X 2FLOA 5C2DA 4ZTJA 1TAQA 1ZYQA 1ZBSA 3VQDA 3BY5A 4CHNA 4EAHD 3EYZA 3ZCMA 3M8RA 1C0UA 4QOZB 4QAGA 4M3XA 2XY6A 1RT5A 5HROA 4B3RK 3DOLA 2O4IA 1S9GA 1QTMA 3DRPA 3MDQA 3HRGA 3CPWM 1TK0A 5BREA 4PUOA 4A5AA 4DU1A 1BI4B 1D5AA 3HBTA 3PY8A 1LWFA 4E7LA 4DR1K 3DLLL 3FZMA 3U9DA 2B5JA 4CGDA 4LFCK 4DR2K 4BE0A 2V51B 5BN8A 3BZCA 3KLHA 3DRRA 2YNFA 1RILA 4BE1A 1JLFA 3GOIA 2OZMA 4RCHA 3D7EO 4CJVA 3ZEUA 3SCXA 3OBWA 1YITN 3WUHA 3TAQA 3WEEB 1B92A 3THYA 2ZM6K 1DEJA 1UWBA 3HPHA 1TVRA 5M1QA 1V4SA 4DLEA 4F2RA 3O9RA 5AFUH 2HNDA 3NVMA 3LAMA 2OPSA 2UUCK 4IJNA 1VQPN 3IUCA 1XHZA 3DLKA 4WQ5C 4EHUA 2HHXA 2WUSA 1O1WA 4IOAL 5ELZA 3VEZA 1NMDA 5M1FA 3MCPA 2ZJRL 3PIOL 3OA9A 2ZE2A 1RGIA 4CJ7A 3CM5A 3O1BA 3AAPA 2EX3A 4AHRA 3BZKA 4CJ4A 4M42A 5HBMA 4KI4A 4RW9A 3BEXA 2YNGA 4W5TA 3G71N 1XWLA 4O4GA 3TAGA 4GV3A 2HBMA 3U4LA 4CJRA 3VERA 3TR8A 5TKWA 5GAHP 3VESA 1RT2A 5GAGP 3TTFA 2Q36A 5AQJA 3NDKA 4CEZA 3BDPA 1BOTO 2DPNA 5C15A 3ZX3A 2RHKA 3I8DA 3HP9A 3L2UA 2QW9A 1NLVA 4JKCA 3OTOK 3A8YA 4JNEA 3DXMA 3VQ4A 4DU4A 3DI6A 4KB1A 4F3TA 3DXKB 1W0HA 1TGOA 2A40A 3ENHA 5M1OA 2OYQA 3LL3A 3L2RA 3VQAA 3MX2A 3J81O 1L3UA 3DXKA 3OYNA 4KHYA 4FVMA 2HNYA 3DJCA 1RBVA 1E4GT 2KLAA 4JK8A 3KLEA 3DXMB 4DV2K 4KFBA 2E8AA 1K6YA 2OCEA 4HUFA 1J5EK 1Q86O 3LALA 4Z4GA 3G6EN 3LAKA 5AQQA 1LWCA 3O1WA 1OH7A 1KCFA 4KO0A 1ZC6A 2D1KA 3I8BA 5BPLA 2QKBA 5AQTA 3DOKA 2UXDK 5HP1A 4CZGA 1HNWK 2HHQA 3NAEA 3CCJN 4DSKA 5BPMA 4YY3K 4PQUA 1N8RO 4LFBK 1ZBFA 4FWMA 2E2PA 3KK7A 3P83D 3THVA 4FWSA 4B3MK 4X65K 4JI4K 2D4WA 4GV6A 1DGKN 2QWMA 3LZIA 2YHXA 4LH5A 3EKSA 3AVKA 1Q81O 4JKAA 3E01A 1S72N 5HOOA 3ZLJA 4I9QA 5I42A 1N5YA 2I7NA 4FYDA 4O44A 4AHSA 4FLUA 3DMJA 4WF9L 3L8BA 3HSTB 1KTQA 4DS5A 1P8ZA 4JI3K 3EN9A 4BWJA 3THYB 3SNNA 1LWEA 4A5BA 2A6AA 1RDUA 1YJ9N 3ZEUB 3U3YA
chains in the Genus database with same CATH topology
4CCHA 1N6QA 3SUNA 4FJGA 4ICLA 4F2SA 2XY5A 3V1OA 2OA8A 3AVJA 3LWMA 3TABA 4Z4EA 2BDPA 4CEEA 2JGUA 2G8KA 2G8IA 1RBUA 2IAJA 4CGFA 4DFMA 1S5JA 1TK8A 4CIEA 1C1AA 2P5GA 1JLEA 3LPUA 3IS9A 4B9UA 4HCBA 1CZ9A 1SV5A 4Z0UA 4J2DA 1D9FA 1NK6A 5CZ1A 1JLAA 1D9DA 3B6OA 3LP3A 4RW4A 4NYFA 1EETA 5C42A 3AA2A 5SZTA 4FM0A 1ZBIA 1J9AA 1IKVA 4CJ5A 1FXXA 4E7JA 4Y1DA 4C8NA 4F4KA 1U04A 3QNOA 3HPGA 2FBVA 1JLGA 4LD0A 4LSNA 1BGXT 3NF9A 1HMVA 3OYGA 1RTJA 4FLTA 4W5NA 1KLMA 4BDZA 4C8MA 2Z1IA 3ZSXA 4FLZA 3MEDA 1DTQA 4XIUA 2IS3A 3V1QA 3K57A 4EZ9A 4CJLA 1C6VA 1SKSA 1WSIA 2D0CA 4KPYA 3SQ0A 4IFVA 4M3YA 1RDAA 5FDLA 2KW4A 2D5RA 3OJUA 3KLGA 3AVMA 4OPKA 4DTRA 1S1VA 4CFDA 1C0MA 4KRFA 1RCHA 4FZYA 4KKOA 1HPZA 4BDYA 1G15A 4NCGA 3AVNA 3L3VA 4E19A 2BANA 3O3FA 2I5JA 3TAFA 3SUQA 3IAYA 4FK0A 1I3AA 2LSNA 2Z1HA 3HVTA 2FBYA 4RW8A 4YFUA 4E7KA 1A5XA 4DS4A 1HNIA 5CY4A 5J2MA 1B9DA 4CFCA 3ZSQA 3HP6A 1TKDA 1NJWA 4L8RB 3HK2A 1QSSA 3VQ8A 4FK2A 1QSYA 3AO2A 1VSIA 2WOMA 2YKNA 2Q3SA 3HO1A 1EX4A 4FJ8A 4JLHA 4GW6A 1L3VA 3UIQA 4ID1A 1WNSA 4FJJA 4DG1A 1Z25A 1TV6A 4B9SA 1ZBHA 3CQ8A 5CYMA 1BHLA 1BL3A 3IRXA 2OPPA 4E1MA 4BE2A 4KTQA 4MFBA 4OLBA 4CJWA 3KJVA 3KK3A 5KI6A 3QETA 2YHBA 1GOCA 3TAEA 1ITGA 1NKEA 2ITGA 3NCIA 3TAPA 4DTOA 2HHVA 4FJKA 4B9VA 4O5BA 1HNVA 4FZZA 3SQ4A 3G10A 3O4QA 2YV0X 4FM1A 3LANA 4DQQA 3T1AA 2QKKA 2QK9A 2RF2A 2HMIA 3AA4A 5C24A 4H8KA 5E41A 1S1UA 4W5RA 1BCMA 3F9KA 1U49A 4DSLA 3LP1A 4AILC 3AVAA 4KHYA 1CLQA 4B9TA 2KFNA 3OYCA 3RR8A 1NOZA 4B8AB 4EP5A 3LPTA 1WLJA 1NJYA 4UQGA 1RNHA 4FJ5A 3C6TA 3VQ5A 1RTDA 4B9LA 1KFDA 5HRSA 4DTJA 1NK9A 4CEBA 3O3GA 4OGEA 2VWJA 2A1RA 4KTZA 1TAUA 3QEIA 2ZD1A 3V6DA 5JS2A 4CEOA 1W9HA 2ATQA 4ELVA 4ID5A 1T03A 3AVCA 5J1EA 2YHAA 2OPQA 3ZSZA 5KGWA 1UAXA 2YNIA 4DTMA 4ZTFA 3VQ6A 4AHVA 1JL1A 3K5MA 3RR7A 1RT4A 1RDCA 2XRIA 3LP2A 1DLOA 4CFBA 3AVLA 4CJUA 1Z26A 4M41A 2WONA 3NH0A 4DTUA 5HRRA 1LW2A 4N41A 2XHBA 2KTQA 1UA0A 2JLEA 3VQEA 4E0DA 4FJIA 1CXQA 4OGCA 3K5OA 3V81A 3QIOA 4J2AA 3ISNC 3NBPA 1QQCA 1JLBA 1ASWA 4O55A 2RN2A 3OY9A 3NGIA 3K59A 4JS4A 4FCYA 3S3NA 3CFOA 1NK5A 1J5OA 5FRNA 1FKOA 4M3TA 1X9MA 4ELTA 1EXQA 1HRHA 1C1BA 2FBXA 1S1TA 1YTAA 2EHGA 3KIOA 3L2QA 1WN7A 4BACA 3KLFA 4E7IA 2GBZA 1REVA 1A5WA 3AO3A 3AVGA 1SKRA 1VSDA 3KK1A 3KD5E 4CIGA 3O3HA 3F73A 1QE1A 1SUQA 4I7FA 2KQ2A 4HTUA 4CK1A 3V9SA 1RT1A 4I2QA 3RWUA 4HCCA 4CEQA 4CJFA 1QS4A 4FXDA 2KZZA 4KREA 5I3UA 4K8ZA 1JXEA 1X9WA 4Q5VA 1KVBA 4DSFA 2KFZA 3NE6A 1I39A 4GMJB 5J2PA 3AVHA 3QEWA 3SYZA 1SL0A 4OKEA 1GOBA 3QERA 4B08A 4PWDA 3CG7A 2ETJA 4KV8A 3HVRA 4CJ3A 1KRPA 4B9MA 2OPRA 4QCLA 4CF9A 3V4IA 4FJ9A 1U48A 3WNFA 4FJ7A 1VSLA 1IKWA 3EZ5A 4BWMA 1S9EA 4CGHA 4FJXA 5JS1A 1YTUA 1WAJA 4W5QA 3ALYA 3RMDA 4OJRA 1UA1A 1WSJA 3O4NA 4CE9A 2IOCA 3S9HA 1WSEA 3CFPA 3AO4A 1NK4A 3MEEA 1EP4A 1JLCA 4LSLA 1JLQA 3ZSYA 3ZT1A 4OPJA 3KTQA 3CYMA 3LDSA 3C95A 4GVMA 2YKMA 4B8CA 1WAFA 1YT3A 4YNQA 3IG1A 3SV4A 2Y1JA 1ZBLA 3U6FA 1LV5A 1J53A 1QSLA 2G8HA 4Z4IA 3AA3A 4JRPA 3OJSA 1L3TA 3CM6A 1RBRA 1KLNA 1KSPA 3VQCA 4B3OA 2VG6A 4CGGA 1MU2A 3PX6A 3V1RA 2HHSA 3NH2A 3QEXA 2NUBA 4N56A 3JSMA 3HJFA 3HM9A 2P1JA 4CJTA 4ZHRA 1IO2A 3SUOA 4J2EA 4DWIA 2F8TA 3NH1A 4NYNA 2BE2A 4FW2A 3AVIA 5C25A 4FJHA 3QIPA 4IKFA 3PX0A 3ASMA 5DK5A 1NK8A 4WE1A 4CF2A 4F3OA 1R0AA 1T05A 4OVLA 4Q0BA 4IDKA 1NJZA 4JRQA 4CESA 4R5PA 3V9UA 1RTIA 1WSGA 1VSEA 4DFKA 4Z4FA 4KHWA 2XY8A 4CECA 1HYSA 3ULDA 2D0AA 1HYZA 2F96A 3MECA 3P5JA 3AA5X 3DLEA 4O0IA 4ZTJA 4M3ZA 4CEDA 2FC0A 1TAQA 1VSHA 1ZYQA 2FBTA 1RDBA 3VQDA 3U3YA 4CHNA 1RDDA 1BIUA 1HJRA 4LY7A 3ZCMA 3EYZA 3M8RA 1C0UA 3SI6A 5D3GA 4QOZB 1TKTA 1X1PA 4QAGA 4M3XA 2HVIA 4EP4A 1F21A 2XY6A 1IKXA 3OYKA 4CIFA 1RT5A 4JS5A 5HROA 3DOLA 1IG9A 3ZT4A 1CZBA 2Y1IA 2O4IA 1S9GA 2HHUA 1LW0A 1QTMA 2Z1JA 3DRPA 1J54A 2D0BA 3SPZA 3RMAA 3B6PA 4DFPA 2X6SA 1TK0A 2A1SA 1T8EA 2PY5A 4KB0A 3PX4A 4PUOA 1RT7A 3QNNA 1Q8IA 1VRUA 1BI4B 4Y1CA 2X78A 1VSFA 1D5AA 3HXMA 4FLVA 4DU1A 1LWFA 4E7LA 3PY8A 1BI4A 4RW7A 1GOAA 1UOCA 3MAQA 1Q9XA 4CGDA 2B5JA 2G8FA 4BE0A 1QHTA 1U4BA 4N76A 2X6NA 3SV3A 3S3OA 3QESA 1S6QA 3QINA 4H4OA 4M3RA 4B9NA 3KLHA 4FJNA 4FW1A 4C8OA 3DRRA 2YNFA 1TK5A 4DTSA 1RILA 3TARA 4BE1A 3K2PA 1WSFA 5J2QA 1JLFA 2VG7A 4C8LA 4IG3A 4FLXA 3QLHA 3PV8A 4LH4A 4CJQA 3HPOA 2XY7A 2OZMA 4DQPA 4KHNA 4HUGA 5HLFA 1VSKA 4CJVA 4CK3A 1EKEA 2O4GA 3SCXA 2HNZA 3WNHA 3OYIA 1LAWA 3K58A 4CF8A 2KZMA 4CGJA 3TAQA 3KLIA 1KVCA 1B92A 5CYQA 4AHTA 1TL3A 3TANA 1T7PA 1UWBA 3HPHA 3VQ9A 2RKIA 2YNHA 3DM2A 1TVRA 3OYBA 1A5VA 4KTWA 4DLEA 4F2RA 3MEGA 4FK4A 1VSJA 1XHXA 2HNDA 3LAMA 3KKSA 2OPSA 3DRSA 1U45A 2E6LA 1RT6A 3U3GA 5EU7A 1XHZA 4CJKA 3DLKA 4H4MA 2R7YA 2G8VA 1S1WA 4HUEA 4C8KA 2HHXA 5DMRA 5J2NA 3P1GA 3V9XA 4CGIA 1O1WA 2E6MA 3QO9A 3JYTA 1BQNA 3LP0A 4DLGA 3S3MA 4DQIA 4FLYA 1BIZA 4DQRA 3G0ZA 4KHUA 5HRNA 4O0JA 2VWKA 1TL1A 1D8YA 1CXUA 1SL1A 1VK0A 3OVNA 2ZE2A 1L5UA 1ASVA 2E4LA 3CM5A 2HVHA 3M8SA 2F8SA 1ZBUA 2EX3A 3SPYA 4DTPA 4DSIA 4AHRA 1FKPA 4CJ4A 4BDPA 4M42A 5HBMA 3AO5A 4CJSA 1SL2A 4KI4A 4RW9A 1FK9A 2IGIA 4Z4CA 4CHZA 1JKHA 3KK2A 1B9FA 1XI1A 5KTQA 4CK2A 1IKYA 2YNGA 3KKRA 5K14A 4AH9A 3LWLA 4KI6A 2HHTA 3M8PA 3MXMA 4W5TA 4OLAA 1C1CA 1XWLA 2QXFA 4O4GA 4RG8A 3TAGA 4DF4A 1LAVA 3NGZA 4CJRA 2XO7A 3TR8A 4DQSA 4AHUA 4N47A 4AHCA 1HYVA 4CHPA 4W5OA 3PUFA 1NJXA 1BISA 1RT2A 5KRSA 3OYMA 4DF8A 3SQ2A 4E3SA 1XC9A 3MXIA 3NDKA 3SQ1A 4IG0A 4CEZA 2HB5A 4M45A 4OKKA 1Q9YA 3BDPA 3DLBA 3I8DA 4KAZA 3D45A 1Y97A 1TKZA 3HP9A 2P51A 3L2UA 1S6PA 1JXBA 3PO4A 4CF0A 3QEVA 2HW3A 2Z1GA 3DYAA 3K5NA 3C94A 1HQEA 3WNEA 2GUIA 3VQ4A 4CF1A 4DU4A 4M3UA 3DI6A 3WNGA 3EY1A 4F8RA 1KVAA 4KB1A 4F3TA 1RBTA 1W0HA 1TGOA 4E7HA 3RMCA 4PA1A 5T7BA 1NK0A 2OYQA 4EZ6A 4DTNA 3L2RA 3VQAA 4MQ3A 3ZSVA 2DY4A 3DLGA 2OZSA 2GV9A 1L3UA 3OYNA 3VA3A 4RW6A 3VQBA 4CEAA 4FVMA 2HNYA 3OYJA 1RBVA 1VRTA 3I0SA 4CEFA 3OYAA 4DMNA 3TWHA 3V9ZA 3KLEA 4DSJA 1C0TA 4KFBA 4NCBA 3ZSOA 1L3SA 3ZT3A 3NF6A 3RMBA 2DTUA 3OYHA 2P5OA 4FM2A 3HT3A 3OS1A 1K6YA 4I9LA 4CHOA 3FFIA 3M8QA 3L2VA 4I2PA 2VG5A 4CHYA 4HUFA 2ZQBA 1RT3A 1NOYA 4G1QA 3LALA 4DU3A 4Z4GA 2G8WA 3LAKA 3VQ7A 3OYLA 3ZT2A 2B4JA 3NHGA 1U47A 1NK7A 2BGGA 1LWCA 3RRGA 1RBSA 1JL2A 3V9WA 1KCFA 4KO0A 4J2BA 4E89A 2W42A 1X9SA 3H08A 3OYEA 4ELUA 5KRTA 2QKBA 3ZSWA 3DOKA 1BQMA 3C6UA 5HP1A 3VQPA 1ASUA 4CFAA 3KD1E 3TI0A 3VA0A 2HHQA 3I0RA 3NAEA 4TSXA 4HHTA 1KFSA 4DSKA 1SKWA 2PYJA 4DTXA 2RPIA 3NF7A 2HHWA 3NF8A 4PQUA 3ZSRA 4OKJA 4Z4HA 4FJLA 3L3UA 4IBNA 3RTVA 4FZXC 4KHQA 1ZBFA 3AVBA 3P83D 4CHQA 3THVA 5HRPA 3PO5A 4K8XA 5FRMA 1S1XA 3TAMA 2IDOA 5CZ2A 2AJQA 3AVFA 4IFYA 4HVJA 3T3FA 3NFAA 4DFJA 3OS2A 3BGRA 3LZIA 2DFHA 3K5LA 3HYFA 4N5SA 3MXJA 4LH5A 3T19A 2G8UA 3AVKA 2PYLA 4NCAA 3LZJA 1TKXA 3E01A 5FROA 3HL8A 4KHSA 5KGXA 2X74A 1IH7A 2DFEA 4I9QA 5I42A 3VN5A 4FLWA 1N5YA 3OS0A 4FYDA 4O44A 3NGYA 4AHSA 3RRHA 4FLUA 1BCOA 3DMJA 4FJMA 3AV9A 1NKBA 4M3WA 3SJJA 4CJPA 3L8BA 1VSMA 3HSTB 4DSEA 4PY5A 3A2FA 3CFRA 1KTQA 4DS5A 3DLHA 3L2WA 3ITHA 1DTTA 2IC3A 3DLRA 4CJEA 2PZSA 1YVUA 2B6AA 3QEPA 4E1NA 3AO1A 3SZ2A 3VQQA 1WSHA 3OYDA 4BWJA 3OYFA 3SNNA 1RTHA 1LWEA 3ZT0A 1NKCA 2DFFA 3D0PA 1HQUA 3SUPA 4CERA 5SWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCH A;  1N6Q A;  3SUN A;  4FJG A;  4ICL A;  4F2S A;  2XY5 A;  3V1O A;  2OA8 A;  3AVJ A;  3LWM A;  3TAB A;  4Z4E A;  2BDP A;  4CEE A;  2JGU A;  2G8K A;  2G8I A;  1RBU A;  2IAJ A;  4CGF A;  4DFM A;  1S5J A;  1TK8 A;  4CIE A;  1C1A A;  2P5G A;  1JLE A;  3LPU A;  3IS9 A;  4B9U A;  4HCB A;  1CZ9 A;  1SV5 A;  4Z0U A;  4J2D A;  1D9F A;  1NK6 A;  5CZ1 A;  1JLA A;  1D9D A;  3B6O A;  3LP3 A;  4RW4 A;  4NYF A;  1EET A;  5C42 A;  3AA2 A;  5SZT A;  4FM0 A;  1ZBI A;  1J9A A;  1IKV A;  4CJ5 A;  1FXX A;  4E7J A;  4Y1D A;  4C8N A;  4F4K A;  1U04 A;  3QNO A;  3HPG A;  2FBV A;  1JLG A;  4LD0 A;  4LSN A;  1BGX T;  3NF9 A;  1HMV A;  3OYG A;  1RTJ A;  4FLT A;  4W5N A;  1KLM A;  4BDZ A;  4C8M A;  2Z1I A;  3ZSX A;  4FLZ A;  3MED A;  1DTQ A;  4XIU A;  2IS3 A;  3V1Q A;  3K57 A;  4EZ9 A;  4CJL A;  1C6V A;  1SKS A;  1WSI A;  2D0C A;  4KPY A;  3SQ0 A;  4IFV A;  4M3Y A;  1RDA A;  5FDL A;  2KW4 A;  2D5R A;  3OJU A;  3KLG A;  3AVM A;  4OPK A;  4DTR A;  1S1V A;  4CFD A;  1C0M A;  4KRF A;  1RCH A;  4FZY A;  4KKO A;  1HPZ A;  4BDY A;  1G15 A;  4NCG A;  3AVN A;  3L3V A;  4E19 A;  2BAN A;  3O3F A;  2I5J A;  3TAF A;  3SUQ A;  3IAY A;  4FK0 A;  1I3A A;  2LSN A;  2Z1H A;  3HVT A;  2FBY A;  4RW8 A;  4YFU A;  4E7K A;  1A5X A;  4DS4 A;  1HNI A;  5CY4 A;  5J2M A;  1B9D A;  4CFC A;  3ZSQ A;  3HP6 A;  1TKD A;  1NJW A;  4L8R B;  3HK2 A;  1QSS A;  3VQ8 A;  4FK2 A;  1QSY A;  3AO2 A;  1VSI A;  2WOM A;  2YKN A;  2Q3S A;  3HO1 A;  1EX4 A;  4FJ8 A;  4JLH A;  4GW6 A;  1L3V A;  3UIQ A;  4ID1 A;  1WNS A;  4FJJ A;  4DG1 A;  1Z25 A;  1TV6 A;  4B9S A;  1ZBH A;  3CQ8 A;  5CYM A;  1BHL A;  1BL3 A;  3IRX A;  2OPP A;  4E1M A;  4BE2 A;  4KTQ A;  4MFB A;  4OLB A;  4CJW A;  3KJV A;  3KK3 A;  5KI6 A;  3QET A;  2YHB A;  1GOC A;  3TAE A;  1ITG A;  1NKE A;  2ITG A;  3NCI A;  3TAP A;  4DTO A;  2HHV A;  4FJK A;  4B9V A;  4O5B A;  1HNV A;  4FZZ A;  3SQ4 A;  3G10 A;  3O4Q A;  2YV0 X;  4FM1 A;  3LAN A;  4DQQ A;  3T1A A;  2QKK A;  2QK9 A;  2RF2 A;  2HMI A;  3AA4 A;  5C24 A;  4H8K A;  5E41 A;  1S1U A;  4W5R A;  1BCM A;  3F9K A;  1U49 A;  4DSL A;  3LP1 A;  4AIL C;  3AVA A;  4KHY A;  1CLQ A;  4B9T A;  2KFN A;  3OYC A;  3RR8 A;  1NOZ A;  4B8A B;  4EP5 A;  3LPT A;  1WLJ A;  1NJY A;  4UQG A;  1RNH A;  4FJ5 A;  3C6T A;  3VQ5 A;  1RTD A;  4B9L A;  1KFD A;  5HRS A;  4DTJ A;  1NK9 A;  4CEB A;  3O3G A;  4OGE A;  2VWJ A;  2A1R A;  4KTZ A;  1TAU A;  3QEI A;  2ZD1 A;  3V6D A;  5JS2 A;  4CEO A;  1W9H A;  2ATQ A;  4ELV A;  4ID5 A;  1T03 A;  3AVC A;  5J1E A;  2YHA A;  2OPQ A;  3ZSZ A;  5KGW A;  1UAX A;  2YNI A;  4DTM A;  4ZTF A;  3VQ6 A;  4AHV A;  1JL1 A;  3K5M A;  3RR7 A;  1RT4 A;  1RDC A;  2XRI A;  3LP2 A;  1DLO A;  4CFB A;  3AVL A;  4CJU A;  1Z26 A;  4M41 A;  2WON A;  3NH0 A;  4DTU A;  5HRR A;  1LW2 A;  4N41 A;  2XHB A;  2KTQ A;  1UA0 A;  2JLE A;  3VQE A;  4E0D A;  4FJI A;  1CXQ A;  4OGC A;  3K5O A;  3V81 A;  3QIO A;  4J2A A;  3ISN C;  3NBP A;  1QQC A;  1JLB A;  1ASW A;  4O55 A;  2RN2 A;  3OY9 A;  3NGI A;  3K59 A;  4JS4 A;  4FCY A;  3S3N A;  3CFO A;  1NK5 A;  1J5O A;  5FRN A;  1FKO A;  4M3T A;  1X9M A;  4ELT A;  1EXQ A;  1HRH A;  1C1B A;  2FBX A;  1S1T A;  1YTA A;  2EHG A;  3KIO A;  3L2Q A;  1WN7 A;  4BAC A;  3KLF A;  4E7I A;  2GBZ A;  1REV A;  1A5W A;  3AO3 A;  3AVG A;  1SKR A;  1VSD A;  3KK1 A;  3KD5 E;  4CIG A;  3O3H A;  3F73 A;  1QE1 A;  1SUQ A;  4I7F A;  2KQ2 A;  4HTU A;  4CK1 A;  3V9S A;  1RT1 A;  4I2Q A;  3RWU A;  4HCC A;  4CEQ A;  4CJF A;  1QS4 A;  4FXD A;  2KZZ A;  4KRE A;  5I3U A;  4K8Z A;  1JXE A;  1X9W A;  4Q5V A;  1KVB A;  4DSF A;  2KFZ A;  3NE6 A;  1I39 A;  4GMJ B;  5J2P A;  3AVH A;  3QEW A;  3SYZ A;  1SL0 A;  4OKE A;  1GOB A;  3QER A;  4B08 A;  4PWD A;  3CG7 A;  2ETJ A;  4KV8 A;  3HVR A;  4CJ3 A;  1KRP A;  4B9M A;  2OPR A;  4QCL A;  4CF9 A;  3V4I A;  4FJ9 A;  1U48 A;  3WNF A;  4FJ7 A;  1VSL A;  1IKW A;  3EZ5 A;  4BWM A;  1S9E A;  4CGH A;  4FJX A;  5JS1 A;  1YTU A;  1WAJ A;  4W5Q A;  3ALY A;  3RMD A;  4OJR A;  1UA1 A;  1WSJ A;  3O4N A;  4CE9 A;  2IOC A;  3S9H A;  1WSE A;  3CFP A;  3AO4 A;  1NK4 A;  3MEE A;  1EP4 A;  1JLC A;  4LSL A;  1JLQ A;  3ZSY A;  3ZT1 A;  4OPJ A;  3KTQ A;  3CYM A;  3LDS A;  3C95 A;  4GVM A;  2YKM A;  4B8C A;  1WAF A;  1YT3 A;  4YNQ A;  3IG1 A;  3SV4 A;  2Y1J A;  1ZBL A;  3U6F A;  1LV5 A;  1J53 A;  1QSL A;  2G8H A;  4Z4I A;  3AA3 A;  4JRP A;  3OJS A;  1L3T A;  3CM6 A;  1RBR A;  1KLN A;  1KSP A;  3VQC A;  4B3O A;  2VG6 A;  4CGG A;  1MU2 A;  3PX6 A;  3V1R A;  2HHS A;  3NH2 A;  3QEX A;  2NUB A;  4N56 A;  3JSM A;  3HJF A;  3HM9 A;  2P1J A;  4CJT A;  4ZHR A;  1IO2 A;  3SUO A;  4J2E A;  4DWI A;  2F8T A;  3NH1 A;  4NYN A;  2BE2 A;  4FW2 A;  3AVI A;  5C25 A;  4FJH A;  3QIP A;  4IKF A;  3PX0 A;  3ASM A;  5DK5 A;  1NK8 A;  4WE1 A;  4CF2 A;  4F3O A;  1R0A A;  1T05 A;  4OVL A;  4Q0B A;  4IDK A;  1NJZ A;  4JRQ A;  4CES A;  4R5P A;  3V9U A;  1RTI A;  1WSG A;  1VSE A;  4DFK A;  4Z4F A;  4KHW A;  2XY8 A;  4CEC A;  1HYS A;  3ULD A;  2D0A A;  1HYZ A;  2F96 A;  3MEC A;  3P5J A;  3AA5 X;  3DLE A;  4O0I A;  4ZTJ A;  4M3Z A;  4CED A;  2FC0 A;  1TAQ A;  1VSH A;  1ZYQ A;  2FBT A;  1RDB A;  3VQD A;  3U3Y A;  4CHN A;  1RDD A;  1BIU A;  1HJR A;  4LY7 A;  3ZCM A;  3EYZ A;  3M8R A;  1C0U A;  3SI6 A;  5D3G A;  4QOZ B;  1TKT A;  1X1P A;  4QAG A;  4M3X A;  2HVI A;  4EP4 A;  1F21 A;  2XY6 A;  1IKX A;  3OYK A;  4CIF A;  1RT5 A;  4JS5 A;  5HRO A;  3DOL A;  1IG9 A;  3ZT4 A;  1CZB A;  2Y1I A;  2O4I A;  1S9G A;  2HHU A;  1LW0 A;  1QTM A;  2Z1J A;  3DRP A;  1J54 A;  2D0B A;  3SPZ A;  3RMA A;  3B6P A;  4DFP A;  2X6S A;  1TK0 A;  2A1S A;  1T8E A;  2PY5 A;  4KB0 A;  3PX4 A;  4PUO A;  1RT7 A;  3QNN A;  1Q8I A;  1VRU A;  1BI4 B;  4Y1C A;  2X78 A;  1VSF A;  1D5A A;  3HXM A;  4FLV A;  4DU1 A;  1LWF A;  4E7L A;  3PY8 A;  1BI4 A;  4RW7 A;  1GOA A;  1UOC A;  3MAQ A;  1Q9X A;  4CGD A;  2B5J A;  2G8F A;  4BE0 A;  1QHT A;  1U4B A;  4N76 A;  2X6N A;  3SV3 A;  3S3O A;  3QES A;  1S6Q A;  3QIN A;  4H4O A;  4M3R A;  4B9N A;  3KLH A;  4FJN A;  4FW1 A;  4C8O A;  3DRR A;  2YNF A;  1TK5 A;  4DTS A;  1RIL A;  3TAR A;  4BE1 A;  3K2P A;  1WSF A;  5J2Q A;  1JLF A;  2VG7 A;  4C8L A;  4IG3 A;  4FLX A;  3QLH A;  3PV8 A;  4LH4 A;  4CJQ A;  3HPO A;  2XY7 A;  2OZM A;  4DQP A;  4KHN A;  4HUG A;  5HLF A;  1VSK A;  4CJV A;  4CK3 A;  1EKE A;  2O4G A;  3SCX A;  2HNZ A;  3WNH A;  3OYI A;  1LAW A;  3K58 A;  4CF8 A;  2KZM A;  4CGJ A;  3TAQ A;  3KLI A;  1KVC A;  1B92 A;  5CYQ A;  4AHT A;  1TL3 A;  3TAN A;  1T7P A;  1UWB A;  3HPH A;  3VQ9 A;  2RKI A;  2YNH A;  3DM2 A;  1TVR A;  3OYB A;  1A5V A;  4KTW A;  4DLE A;  4F2R A;  3MEG A;  4FK4 A;  1VSJ A;  1XHX A;  2HND A;  3LAM A;  3KKS A;  2OPS A;  3DRS A;  1U45 A;  2E6L A;  1RT6 A;  3U3G A;  5EU7 A;  1XHZ A;  4CJK A;  3DLK A;  4H4M A;  2R7Y A;  2G8V A;  1S1W A;  4HUE A;  4C8K A;  2HHX A;  5DMR A;  5J2N A;  3P1G A;  3V9X A;  4CGI A;  1O1W A;  2E6M A;  3QO9 A;  3JYT A;  1BQN A;  3LP0 A;  4DLG A;  3S3M A;  4DQI A;  4FLY A;  1BIZ A;  4DQR A;  3G0Z A;  4KHU A;  5HRN A;  4O0J A;  2VWK A;  1TL1 A;  1D8Y A;  1CXU A;  1SL1 A;  1VK0 A;  3OVN A;  2ZE2 A;  1L5U A;  1ASV A;  2E4L A;  3CM5 A;  2HVH A;  3M8S A;  2F8S A;  1ZBU A;  2EX3 A;  3SPY A;  4DTP A;  4DSI A;  4AHR A;  1FKP A;  4CJ4 A;  4BDP A;  4M42 A;  5HBM A;  3AO5 A;  4CJS A;  1SL2 A;  4KI4 A;  4RW9 A;  1FK9 A;  2IGI A;  4Z4C A;  4CHZ A;  1JKH A;  3KK2 A;  1B9F A;  1XI1 A;  5KTQ A;  4CK2 A;  1IKY A;  2YNG A;  3KKR A;  5K14 A;  4AH9 A;  3LWL A;  4KI6 A;  2HHT A;  3M8P A;  3MXM A;  4W5T A;  4OLA A;  1C1C A;  1XWL A;  2QXF A;  4O4G A;  4RG8 A;  3TAG A;  4DF4 A;  1LAV A;  3NGZ A;  4CJR A;  2XO7 A;  3TR8 A;  4DQS A;  4AHU A;  4N47 A;  4AHC A;  1HYV A;  4CHP A;  4W5O A;  3PUF A;  1NJX A;  1BIS A;  1RT2 A;  5KRS A;  3OYM A;  4DF8 A;  3SQ2 A;  4E3S A;  1XC9 A;  3MXI A;  3NDK A;  3SQ1 A;  4IG0 A;  4CEZ A;  2HB5 A;  4M45 A;  4OKK A;  1Q9Y A;  3BDP A;  3DLB A;  3I8D A;  4KAZ A;  3D45 A;  1Y97 A;  1TKZ A;  3HP9 A;  2P51 A;  3L2U A;  1S6P A;  1JXB A;  3PO4 A;  4CF0 A;  3QEV A;  2HW3 A;  2Z1G A;  3DYA A;  3K5N A;  3C94 A;  1HQE A;  3WNE A;  2GUI A;  3VQ4 A;  4CF1 A;  4DU4 A;  4M3U A;  3DI6 A;  3WNG A;  3EY1 A;  4F8R A;  1KVA A;  4KB1 A;  4F3T A;  1RBT A;  1W0H A;  1TGO A;  4E7H A;  3RMC A;  4PA1 A;  5T7B A;  1NK0 A;  2OYQ A;  4EZ6 A;  4DTN A;  3L2R A;  3VQA A;  4MQ3 A;  3ZSV A;  2DY4 A;  3DLG A;  2OZS A;  2GV9 A;  1L3U A;  3OYN A;  3VA3 A;  4RW6 A;  3VQB A;  4CEA A;  4FVM A;  2HNY A;  3OYJ A;  1RBV A;  1VRT A;  3I0S A;  4CEF A;  3OYA A;  4DMN A;  3TWH A;  3V9Z A;  3KLE A;  4DSJ A;  1C0T A;  4KFB A;  4NCB A;  3ZSO A;  1L3S A;  3ZT3 A;  3NF6 A;  3RMB A;  2DTU A;  3OYH A;  2P5O A;  4FM2 A;  3HT3 A;  3OS1 A;  1K6Y A;  4I9L A;  4CHO A;  3FFI A;  3M8Q A;  3L2V A;  4I2P A;  2VG5 A;  4CHY A;  4HUF A;  2ZQB A;  1RT3 A;  1NOY A;  4G1Q A;  3LAL A;  4DU3 A;  4Z4G A;  2G8W A;  3LAK A;  3VQ7 A;  3OYL A;  3ZT2 A;  2B4J A;  3NHG A;  1U47 A;  1NK7 A;  2BGG A;  1LWC A;  3RRG A;  1RBS A;  1JL2 A;  3V9W A;  1KCF A;  4KO0 A;  4J2B A;  4E89 A;  2W42 A;  1X9S A;  3H08 A;  3OYE A;  4ELU A;  5KRT A;  2QKB A;  3ZSW A;  3DOK A;  1BQM A;  3C6U A;  5HP1 A;  3VQP A;  1ASU A;  4CFA A;  3KD1 E;  3TI0 A;  3VA0 A;  2HHQ A;  3I0R A;  3NAE A;  4TSX A;  4HHT A;  1KFS A;  4DSK A;  1SKW A;  2PYJ A;  4DTX A;  2RPI A;  3NF7 A;  2HHW A;  3NF8 A;  4PQU A;  3ZSR A;  4OKJ A;  4Z4H A;  4FJL A;  3L3U A;  4IBN A;  3RTV A;  4FZX C;  4KHQ A;  1ZBF A;  3AVB A;  3P83 D;  4CHQ A;  3THV A;  5HRP A;  3PO5 A;  4K8X A;  5FRM A;  1S1X A;  3TAM A;  2IDO A;  5CZ2 A;  2AJQ A;  3AVF A;  4IFY A;  4HVJ A;  3T3F A;  3NFA A;  4DFJ A;  3OS2 A;  3BGR A;  3LZI A;  2DFH A;  3K5L A;  3HYF A;  4N5S A;  3MXJ A;  4LH5 A;  3T19 A;  2G8U A;  3AVK A;  2PYL A;  4NCA A;  3LZJ A;  1TKX A;  3E01 A;  5FRO A;  3HL8 A;  4KHS A;  5KGX A;  2X74 A;  1IH7 A;  2DFE A;  4I9Q A;  5I42 A;  3VN5 A;  4FLW A;  1N5Y A;  3OS0 A;  4FYD A;  4O44 A;  3NGY A;  4AHS A;  3RRH A;  4FLU A;  1BCO A;  3DMJ A;  4FJM A;  3AV9 A;  1NKB A;  4M3W A;  3SJJ A;  4CJP A;  3L8B A;  1VSM A;  3HST B;  4DSE A;  4PY5 A;  3A2F A;  3CFR A;  1KTQ A;  4DS5 A;  3DLH A;  3L2W A;  3ITH A;  1DTT A;  2IC3 A;  3DLR A;  4CJE A;  2PZS A;  1YVU A;  2B6A A;  3QEP A;  4E1N A;  3AO1 A;  3SZ2 A;  3VQQ A;  1WSH A;  3OYD A;  4BWJ A;  3OYF A;  3SNN A;  1RTH A;  1LWE A;  3ZT0 A;  1NKC A;  2DFF A;  3D0P A;  1HQU A;  3SUP A;  4CER A;  5SWM A; 
#chains in the Genus database with same CATH topology
 4FJG A;  4MLH A;  4ICL A;  1IG8 A;  1GLL O;  2G8I A;  1RBU A;  2IAJ A;  3LDQ A;  3O9U A;  4MO5 A;  1SV5 A;  1V4T A;  3Q7C A;  2Q0R A;  5CZ1 A;  1U6Z A;  1D9D A;  1VAZ A;  3LP3 A;  4RW4 A;  4AF1 A;  5SZT A;  3VEW A;  1ZBI A;  1J9A A;  1IKV A;  2EWS A;  4KHP K;  2VQE K;  3A5L C;  5FPD A;  4F4K A;  4XEI A;  4PHT X;  3TPQ A;  2FBV A;  1BGX T;  4AQY K;  1RTJ A;  1KLM A;  3ZSX A;  3LDO A;  1HLU A;  3MED A;  3K57 A;  3V1Q A;  5KQD A;  2D0C A;  3SQ0 A;  4IFV A;  3AAQ A;  3AVM A;  4OPK A;  3HI0 A;  4BRH A;  2I5J A;  4A62 A;  3O4W A;  1I3A A;  4GKJ K;  3A5O C;  3TU5 A;  4RW8 A;  5CY4 A;  3HK2 A;  1B9D A;  2HF3 A;  4L8R B;  2P9L B;  4FK2 A;  1QSY A;  3AO2 A;  2WOM A;  4LF9 K;  4FJ8 A;  4JLH A;  3CMA N;  4ID1 A;  1QQM A;  2O8D B;  4BRL A;  1ZBH A;  3P4I A;  5CYM A;  1BL3 A;  4OLB A;  4MFB A;  5AR0 A;  4DR7 K;  2HHV A;  2A5X A;  3VF6 A;  3G10 A;  3WXJ A;  3THW B;  5AQS A;  3G25 A;  4DQQ A;  3T1A A;  2QK9 A;  2RF2 A;  2HMI A;  2NRZ A;  5E41 A;  1S1U A;  1BCM A;  2OTL N;  3LP1 A;  3HM8 A;  1CLQ A;  1IJJ A;  2ASM A;  2KFN A;  4WFB L;  1NOZ A;  4EP5 A;  3CET A;  1T3V A;  3M5R A;  4CW7 B;  4DV5 K;  1GLC G;  3C6T A;  1RTD A;  5ADX H;  4WYB A;  2VWJ A;  1HKB A;  5JS2 A;  4ID5 A;  1T03 A;  5J1E A;  2V52 B;  3ZSZ A;  4ZTF A;  3LP2 A;  3SMP A;  2QWR A;  1Z26 A;  4M41 A;  5H1S Q;  1KD1 O;  2VGM A;  3RSE B;  1LW2 A;  4N41 A;  2UXC K;  1Y64 A;  5AQH A;  4E0D A;  2NRV A;  3QIO A;  3NBP A;  2CGL A;  4O55 A;  4DKW A;  3S3N A;  1N33 K;  1J5O A;  5FRN A;  1FKO A;  4YOU A;  5BRF A;  4E7I A;  1YJW N;  2GBZ A;  5BPN A;  3KK1 A;  3KD5 E;  3F73 A;  4ILH A;  1JCF A;  4Y0W A;  1SUQ A;  3CJ7 A;  3V9S A;  3RWU A;  1QS4 A;  3BF3 A;  2W6L A;  2ZGY A;  4Q5V A;  1NGE A;  3NE6 A;  3UE5 A;  1RDW X;  3J7Z O;  1GOB A;  4FWN A;  1QHA A;  3HVR A;  2CH5 A;  1KRP A;  3WNF A;  1VSL A;  1IKW A;  1S9E A;  4CGH A;  4H5N A;  1WAJ A;  3ALY A;  2QWO A;  1WSJ A;  3O4N A;  4CE9 A;  4O8K A;  1WSE A;  1NK4 A;  3AO4 A;  5LMN K;  3KTQ A;  1EP4 A;  3ZT1 A;  4LSL A;  1VHX A;  3CYM A;  4FJI A;  4YNQ A;  2YKM A;  1WAF A;  1YT3 A;  3GDQ A;  1ZBL A;  1LV5 A;  3C7N A;  3AA3 A;  1NGG A;  3VQC A;  2D0P A;  5AQO A;  3QEX A;  2NLX A;  4NYN A;  3P38 A;  3AVI A;  4FJH A;  4IKF A;  5JLH A;  4CF2 A;  2YI1 A;  2W41 A;  2FSJ A;  4IDK A;  3L4I A;  3UKR B;  1RTI A;  1WSG A;  2IVN A;  4U67 L;  2XY8 A;  1HYS A;  3SJH A;  4O5F A;  1HYZ A;  3ZX0 A;  4DQ8 A;  5AZJ A;  4CED A;  5AQL A;  4BRA A;  4Z94 A;  2ZGZ A;  4BVP A;  4LY7 A;  1XQS C;  1X1P A;  1EO1 A;  2O8C A;  4JHD B;  4UY8 O;  1IKX A;  4CIF A;  4OPH A;  1IG9 A;  1XUP O;  2Y1I A;  2VYP A;  3ATV A;  1XNQ K;  4DFP A;  4BRI A;  2PY5 A;  3PX4 A;  1RT7 A;  3T69 A;  2X78 A;  3HXM A;  3L4Q A;  4FLV A;  3VGK A;  3M3Z A;  2G8F A;  1QHT A;  1U4B A;  3S3O A;  4H03 B;  4M3R A;  1BA0 A;  4FW1 A;  5M1P A;  3CCE N;  4C8O A;  1NWK A;  1TK5 A;  4DTS A;  1VQN N;  3K2P A;  1SS6 A;  2VG7 A;  2UYT A;  4C8L A;  3O9S A;  3QLH A;  4KHN A;  5C0Y A;  3AGK A;  1YXQ A;  3CME N;  1QVF M;  4XH4 A;  1LAW A;  3K58 A;  4CGJ A;  1NG9 A;  1NGI A;  1KVC A;  3E66 A;  1OVY A;  4AHT A;  3H45 C;  2QM1 A;  2RKI A;  2YNH A;  3UB5 A;  1QZ6 A;  2VGN A;  3MEG A;  4LF6 K;  1XHX A;  4FK4 A;  3KKS A;  5AJ3 K;  3SBG A;  2E6L A;  1OH6 A;  1S1W A;  4HUE A;  4C8K A;  3P1G A;  5BRD A;  3ID6 A;  2E6M A;  5TKY A;  3EO3 A;  4DQI A;  4DLG A;  1BIZ A;  4DQR A;  5HRN A;  1NGF A;  1WBB A;  3CC4 N;  5AQF A;  1L5U A;  1ASV A;  1MA9 B;  2E4L A;  3D2E B;  2F8S A;  3AAR A;  4DTP A;  4DSI A;  2P9N B;  3T1H K;  3AO5 A;  2PBD A;  3EE8 A;  3C6H A;  1FK9 A;  2IGI A;  1JKH A;  1IKY A;  2YX6 A;  1C1C A;  2QXF A;  5HL7 L;  4JYA K;  1LAV A;  3NGZ A;  4B1Y B;  3CCL N;  3R9P A;  3CCQ N;  2XO7 A;  3CCR N;  1QQN A;  1HNX K;  4AHU A;  3QBW A;  1HYV A;  3CCU N;  4IEI A;  2QTD A;  2W40 A;  5KRS A;  1HKG A;  5LL6 Z;  1XC9 A;  4GVE A;  2HB5 A;  3R3L A;  4M45 A;  1Q9Y A;  3DLB A;  4YDU C;  4LF5 K;  1Y97 A;  4CD3 A;  1JXB A;  5BN9 A;  1GLJ O;  4CZM A;  4BRF A;  2HW3 A;  2Z1G A;  3K5N A;  4JEP A;  2E5L K;  3VTH A;  4CF1 A;  3D2F B;  4FWQ A;  2E1Y A;  4WCE L;  3WNG A;  4F8R A;  1KVA A;  4K0K K;  4JI5 K;  3VEN A;  3RMC A;  5T7B A;  1NK0 A;  3TSQ A;  4DTN A;  5DM6 L;  3ZSV A;  3H46 O;  3F5T A;  4CBU A;  1OVQ A;  1BG3 A;  3VA3 A;  4RW6 A;  4CEA A;  3VQB A;  4FOE A;  4BRO A;  4FWP A;  4K43 A;  1K73 O;  3V9Z A;  3EEQ A;  3FE1 A;  4QS9 A;  5AZI B;  1E3M A;  3ZSO A;  4I6M B;  3ZT3 A;  2DTU A;  4YOW A;  4EFH A;  4GNI A;  2O8F A;  4JKB A;  1LOT B;  4CHO A;  3FFI A;  4DUZ K;  3J7A P;  1NOY A;  1RT3 A;  5AQR A;  5EVZ A;  2B4J A;  1U47 A;  2BGG A;  4EIA A;  3RRG A;  1RBS A;  3BP8 A;  1BWF O;  2OAN A;  4BRM A;  2A3Z A;  4CZK A;  3KD1 E;  5IT9 O;  3QFP A;  3I0R A;  4BC3 A;  3TTC A;  4BR0 A;  4X62 K;  1KFS A;  1SKW A;  3KHY A;  4WFN L;  3ZSR A;  1OH5 A;  4FJL A;  4FOI A;  3L3U A;  4JI0 K;  1HJO A;  3AVB A;  2V7Y A;  4CHQ A;  3SAF A;  3THX B;  4K8X A;  1GLE G;  5FRM A;  1S3X A;  5CZ2 A;  3TAM A;  3AVF A;  4IFY A;  4HVJ A;  3T3F A;  4DFJ A;  5FPE A;  2HHS A;  4JKG A;  2WTU A;  3T19 A;  3LZJ A;  1TKX A;  3R8E A;  5KGX A;  3WQT A;  2Q0U A;  3OW2 M;  3VN5 A;  4FPB A;  3HTV A;  3RRH A;  1QQO A;  5GIN A;  1NKB A;  1E4F T;  4JAX A;  4PY5 A;  2HMP A;  2B6A A;  3SZ2 A;  2P9P A;  3OYD A;  2QWP A;  5B8H A;  2DFF A;  3SUP A;  2P9K A;  1X9J A;  4HWI A;  1N6Q A;  3SUN A;  4F2S A;  3AVJ A;  3LWM A;  3TAB A;  1XC3 A;  2JGU A;  1IBM K;  2G8K A;  4CGF A;  4KH4 A;  1WBD A;  1S5J A;  1TK8 A;  1C1A A;  1NGB A;  3VF2 A;  2P5G A;  4J2D A;  4IZ9 A;  1D9F A;  2IVO A;  4FM0 A;  1GLD G;  3C65 A;  4CJ5 A;  4Y1D A;  5BR9 A;  4C8N A;  5IWA K;  3ATU A;  2J4R A;  1U04 A;  3QNO A;  3GL1 A;  4LD0 A;  3NF9 A;  4X66 K;  4FLT A;  4C8M A;  4BR9 A;  4FLZ A;  1DTQ A;  4CJL A;  1SKS A;  1W7A A;  3MX5 A;  2V7Z A;  2HBL A;  3CPE A;  5AQZ A;  4YHH K;  1S1V A;  1MWK A;  1C0M A;  5BR8 K;  4BDY A;  1XMO K;  3VGM A;  1G15 A;  2P9K B;  3L3V A;  3O3F A;  2BAN A;  3A5M C;  2Z1H A;  2P9P B;  4C1N K;  3HVT A;  2FBY A;  3VOV A;  4DS4 A;  1HNI A;  5J2M A;  3HP6 A;  3PSI A;  3SMS A;  5DM7 L;  3JS6 A;  2YKN A;  1TUY A;  2AP1 A;  1WNS A;  3A0I X;  2BTF A;  5C12 A;  2ZF5 O;  3CQ8 A;  4KTQ A;  3KJV A;  3QET A;  5KI6 A;  1NKE A;  3TAP A;  4DTO A;  3FLC O;  3SQ4 A;  4ISE A;  3ULE B;  3O6W A;  3KZB A;  3AA4 A;  5C24 A;  3S41 A;  2QWQ A;  1U49 A;  3AVA A;  2O8E A;  4B9T A;  3MMV A;  5F2R A;  1KAX A;  4B8A B;  4JD2 A;  3LDN A;  3U9Z A;  1FJG K;  4DV7 K;  3CCS N;  3JAM O;  1NK9 A;  5AZJ B;  1WOQ A;  4M7X A;  2A1R A;  4KTZ A;  2ZD1 A;  1W9H A;  1T44 A;  3LM9 A;  1NNE A;  1KAY A;  4PKG A;  3AVC A;  3KWI A;  1UAX A;  3VQ6 A;  3K5M A;  1RT4 A;  2XRI A;  5AZI A;  1DLO A;  2YHY A;  3AVL A;  3UKU A;  4CJU A;  1VQO N;  4DTU A;  3CER A;  5AQY A;  2XHB A;  2KTQ A;  2CGK A;  3H3O B;  4J2A A;  4BQL A;  1ASW A;  1JLB A;  2RN2 A;  3OY9 A;  3CFO A;  3C7N B;  4M3T A;  5C2F A;  1X9M A;  1NGJ A;  4B3S K;  4BG8 A;  1C1B A;  4BAC A;  1YTA A;  3L2Q A;  1N36 K;  1WN7 A;  3CCM N;  3LDP A;  3AVG A;  1VSD A;  3CJC A;  4BRP A;  2IIR A;  4CIG A;  3O3H A;  1YJN N;  4BRN A;  2WC9 A;  2GTD A;  4FWO A;  4I7F A;  4CK1 A;  4FXD A;  4CEQ A;  4CJF A;  1YI2 N;  2KZZ A;  3WT0 A;  3WXK A;  4U7B A;  5I3U A;  4PL7 A;  1KVB A;  5M1N A;  4DSF A;  5J2P A;  3CC2 N;  3SYZ A;  1SL0 A;  1Z05 A;  3CG7 A;  4BR2 A;  3FFK B;  5AQM A;  4FL9 A;  4CF9 A;  1U48 A;  1FW6 A;  1YF5 L;  3GG4 A;  4ISG A;  1YTU A;  4W5Q A;  1ATS A;  4WFA L;  5JVH L;  3ZET A;  3K9J A;  3MEE A;  3R1X A;  3ENO A;  3ZSY A;  4OPJ A;  1NK8 A;  4GVM A;  2Y1J A;  5AQN A;  1HKC A;  3FZK A;  1QSL A;  3E1Y A;  1KSP A;  3OBY A;  2VG6 A;  4KBO A;  4BRK A;  3V1R A;  3O5B A;  3NH2 A;  5GIO A;  2NUB A;  3HJF A;  4CZI A;  3NVK A;  3SUO A;  2BE2 A;  1XMQ K;  3QIP A;  5DK5 A;  1R59 O;  2RE2 A;  2A42 A;  4CES A;  4R5P A;  3V9U A;  1VSE A;  4CEC A;  3ULD A;  2D0A A;  2F96 A;  3BUZ B;  5JIC A;  4O0I A;  3MCA B;  4M3Z A;  1VQ6 N;  1VSH A;  4DR3 K;  4AM6 A;  5LJV A;  1RDD A;  1HJR A;  3B8A X;  3G4S N;  3C6A A;  3SI6 A;  5JLF A;  4DB3 A;  4EP4 A;  3VEO A;  4H0X B;  2UUB K;  1ATN A;  4QS7 A;  3DWL A;  3ZT4 A;  2VWB A;  4DCH A;  2HHU A;  1LW0 A;  1J54 A;  2D0B A;  3ZYY X;  3THW A;  3RMA A;  3B6P A;  1T8E A;  4KB0 A;  3QNN A;  1VRU A;  1SL1 A;  3F2K A;  1VSF A;  3E9L A;  4RW7 A;  1UOC A;  3MAQ A;  2O8D A;  2X6N A;  3VF4 A;  4CI6 A;  3WXL A;  3QES A;  4H4O A;  5EOY A;  4B9N A;  2O8B B;  4GKK K;  1WB9 A;  2YHW A;  1WSF A;  4JHD A;  2P9L A;  4IG3 A;  3PV8 A;  4CJQ A;  3HPO A;  4DQP A;  4LC9 B;  4YOR A;  5HLF A;  4CK3 A;  1EKE A;  2O4G A;  3OYI A;  3KLI A;  3QML A;  5CYQ A;  3TAN A;  1C0G A;  2JWL A;  3DM2 A;  4X64 K;  2P9S B;  3FZH A;  3OYB A;  3F9M A;  1VSJ A;  5LY3 A;  1U45 A;  4HTL A;  1GLB G;  1NBW A;  2PAV A;  5EU7 A;  4BGA A;  2O8B A;  2FSN A;  4BGB A;  2R7Y A;  2G8V A;  3QFU A;  4A57 A;  5DMR A;  3JYT A;  3LP0 A;  3GBT A;  3S3M A;  2KKZ A;  4FLY A;  3G0Z A;  2PFU A;  4O0J A;  2VWK A;  1CXU A;  4DHY A;  1K8K B;  4WQ4 A;  2CGJ A;  2HVH A;  3M8S A;  1ZBU A;  3SPY A;  1FKP A;  2GEM A;  3CQX A;  4CJS A;  1SL2 A;  3IMX A;  4CK2 A;  3KKR A;  2VCP A;  2YCH A;  4LF7 K;  3M8P A;  3MXM A;  1QVG M;  4OLA A;  3ID8 A;  3C0B A;  3VGL A;  1QZ5 A;  1NJI O;  2E2Q A;  4V19 S;  2YJF A;  4N47 A;  4AHC A;  4W5O A;  1BIS A;  4DF8 A;  1VQ4 N;  4H5W A;  5KPR A;  3SQ1 A;  2NRW A;  4OKK A;  3CD6 N;  1HX1 A;  4KAZ A;  1TKZ A;  3PO4 A;  4CF0 A;  4CZJ A;  3CXC M;  4JKD A;  2WFB A;  3W3D A;  3WNE A;  1HQE A;  1MWM A;  2GUI A;  1YAG A;  4BVO A;  4DUY K;  3VEY A;  4PA1 A;  2AA4 A;  3L0Q A;  4OPA A;  2P9U A;  4MQ3 A;  2P9U B;  2OZS A;  2GV9 A;  1YUW A;  3RSE A;  4H0Y B;  3TWH A;  3OYA A;  1GLA G;  4DSJ A;  2NRT A;  1L3S A;  3JXU A;  3NF6 A;  3RMB A;  2P5O A;  4FM2 A;  3HT3 A;  3OS1 A;  3SAH A;  4H5R A;  3M8Q A;  2ZQB A;  5E26 A;  2GUP A;  1KQS M;  1VQ9 N;  2G8W A;  3VQ7 A;  3OYL A;  3NHG A;  1NK7 A;  3V9W A;  1JL2 A;  5JMV A;  5AQW A;  3CJ9 A;  2W42 A;  4ELU A;  1O13 A;  3ZSW A;  4PL8 A;  3VQP A;  3TI0 A;  4M7Y A;  2PYJ A;  4DTX A;  4BRQ A;  3NF7 A;  4DV3 K;  5M1K A;  2HHW A;  3SAG A;  5KPZ A;  4OKJ A;  3L6Q A;  4IBN A;  4FZX C;  1X3N A;  4KHQ A;  3VEX A;  4ILJ A;  5HRP A;  3PO5 A;  1S1X A;  4YDU A;  2IDO A;  1ATR A;  3VPZ A;  2AJQ A;  3PLA A;  1K8K A;  3CHW A;  3OS2 A;  3T1Y K;  2DFH A;  4JI1 K;  4NCA A;  5FRO A;  1X3M A;  2ASP A;  3HL8 A;  5AQK A;  2X74 A;  1IH7 A;  2DFE A;  2E1Z A;  3LDL A;  3UKU B;  3OS0 A;  3NGY A;  4FJM A;  1BCO A;  2BUP A;  3AV9 A;  4MDB A;  3SJJ A;  1VSM A;  5AQX A;  4DSE A;  3CFR A;  2P9S A;  3O8M A;  2IC3 A;  3DLR A;  2PZS A;  1YVU A;  3QEP A;  3AO1 A;  4JK9 A;  3VQQ A;  1WSH A;  3WXI A;  3OYF A;  1RTH A;  3ZT0 A;  1NKC A;  2Q1N A;  3I33 A;  4CER A;  2F9T A;  5SWM A;  4CBW A;  4IO8 A;  3P39 A;  4JD2 B;  4BG9 A;  3M6G A;  4OX9 K;  2H3G X;  2BDP A;  1H1V A;  1IBL K;  4H0T B;  1NM1 A;  4DFM A;  2I7P A;  1M90 O;  3MN7 A;  3N4Q A;  4JV5 K;  2NRX A;  1JLE A;  3IS9 A;  1HR0 K;  4HCB A;  5FLX O;  1JLA A;  4IFE A;  4JI8 K;  3B6O A;  5C42 A;  3AA2 A;  4BRC A;  3ULE A;  3K0S A;  4OO1 J;  2HBJ A;  1ESV A;  1FXX A;  1N34 K;  5F1X A;  1IV0 A;  2E2N A;  3HPG A;  2UXB K;  1JLG A;  1KAZ A;  3OYG A;  1DKG D;  2Z1I A;  4XIU A;  1C6V A;  1WSI A;  1BUP A;  5FDL A;  2D5R A;  3KLG A;  4DTR A;  4KRF A;  4FZY A;  4KKO A;  4H5V A;  2HBK A;  3AVN A;  3CCV N;  2Q2R A;  4E19 A;  4FK0 A;  4QS8 A;  4YFU A;  3CJA A;  4H5T A;  2VQF K;  4G9Z A;  3ZSQ A;  4B1V A;  3H6E A;  1QSS A;  1CZA N;  1VSI A;  4C1N I;  3CJ1 A;  3R6M A;  4GW6 A;  5GAD P;  3GE1 A;  4FJJ A;  1BHL A;  4BE2 A;  2OPP A;  4A2A A;  4CJW A;  1VQ8 N;  2YHB A;  3TAE A;  4DR6 K;  1ITG A;  4YOY A;  2ITG A;  3NCI A;  4FJK A;  4FM1 A;  5AQG A;  4W5R A;  3F9K A;  2ITM A;  2CH6 A;  3ZET B;  4BRG A;  3H3N O;  4DSL A;  2HHH K;  5I9E B;  2WBN A;  3OYC A;  3LPT A;  1JCG A;  1G99 A;  4FPA A;  1WLJ A;  4UQG A;  3VQ5 A;  1KFD A;  3E9P A;  4DTJ A;  4BQZ A;  4OGE A;  2HF4 A;  4JN4 A;  2ATQ A;  3CF5 L;  4ELV A;  2YHA A;  2OPQ A;  4DTM A;  1JL1 A;  1U2V B;  3RR7 A;  4CZL A;  1SAZ A;  1J6Z A;  1VQK N;  2FF6 A;  2WON A;  3NH0 A;  3AGR A;  5HRR A;  3A5N C;  1M1K O;  3VQE A;  4JKG B;  4NB4 A;  1CXQ A;  3I56 N;  3K5O A;  2QEX N;  2E20 A;  3ISN C;  1QQC A;  4FCY A;  3NGI A;  3THX A;  2NZT A;  3TSP A;  4IJA A;  1HRH A;  2FBX A;  3FGU A;  1S1T A;  4GV9 A;  3KLF A;  1REV A;  1A5W A;  1SKR A;  3QDK A;  3H1V X;  5LMU K;  1QE1 A;  2E88 A;  4IDH A;  2UUA K;  2KQ2 A;  4HTU A;  4I2Q A;  4HCC A;  4KRE A;  1X9W A;  2KFZ A;  1I39 A;  4GMJ B;  5EXW A;  3QEW A;  3MN6 A;  3MK6 A;  4PWD A;  3QER A;  4A59 A;  4IO9 L;  2KHO A;  3EKU A;  2OPR A;  4FJ9 A;  3EZ5 A;  4ILG B;  2O8E B;  3RMD A;  1UA1 A;  4I6M A;  5AQU A;  3S9H A;  3CFP A;  4A61 A;  1GLF O;  1JLQ A;  1P90 A;  3LDS A;  4B8C A;  3SV4 A;  3IG1 A;  4Z4I A;  4JRP A;  2GEL A;  1L3T A;  1KLN A;  4B3O A;  3FZL A;  4YOV A;  4LFA K;  4CGG A;  1MU2 A;  3VET A;  4YOX A;  3QB0 A;  3HM9 A;  4ZHR A;  1IO2 A;  1BDG A;  4DWI A;  4IEE A;  3NH1 A;  2F8T A;  3D2F A;  5C25 A;  4CZE A;  3PX0 A;  3Q7B A;  1HPM A;  1R0A A;  1T05 A;  1NJZ A;  2FF3 B;  1JCE A;  3IDH A;  4BRD A;  3FZF A;  4CD1 A;  1Q7Y O;  3MWT A;  4IOC L;  4DFK A;  4KHW A;  3P5J A;  3DLE A;  3WEE A;  5A2Q O;  1K9M O;  2FC0 A;  4WQ4 C;  2FBT A;  1RDB A;  1BIU A;  4K42 A;  1Z6R A;  5D3G A;  1T6D A;  1TKT A;  2HVI A;  5JVG L;  1LCU A;  1F21 A;  3LM2 A;  3OYK A;  4JS5 A;  1CZB A;  2QXL A;  2Z1J A;  3KVG A;  3SPZ A;  2X6S A;  2A1S A;  3D2E A;  1Q8I A;  3P31 A;  4Y1C A;  4M3Y A;  1JJ2 M;  1BI4 A;  1GOA A;  1D4X A;  1VQ7 N;  1Q9X A;  2W6K A;  3D6R A;  4K25 A;  4N76 A;  3SV3 A;  1S6Q A;  3QIN A;  4FJN A;  2YJE A;  3TAR A;  3H1Q A;  3N4P A;  3OHR A;  5J2Q A;  4FLX A;  4PKI A;  4LH4 A;  2XY7 A;  4KH6 A;  4HUG A;  4B3T K;  1VSK A;  2D0O A;  2HNZ A;  3WNH A;  4JI7 K;  4CF8 A;  2KZM A;  4MLE A;  1T7P A;  1TL3 A;  1SZ2 A;  2QWL A;  3VQ9 A;  3MN9 A;  1MDU B;  3TTD A;  1A5V A;  4KTW A;  2F4V K;  3DRS A;  1RT6 A;  3PSF A;  4CBX A;  3U3G A;  4CJK A;  4H4M A;  5J2N A;  3V9X A;  4CGI A;  3QO9 A;  5EX5 A;  1BQN A;  3K9K A;  4MO4 A;  5LJW A;  4KHU A;  3ENB A;  5AFU A;  1TL1 A;  1D8Y A;  1VK0 A;  3OVN A;  4FWL A;  2QWN A;  1HUX A;  3VMF B;  1YIJ N;  2F7T A;  4BDP A;  4RWT A;  4JKH A;  4Z4C A;  1XI1 A;  4F3O A;  4CHZ A;  3KK2 A;  1B9F A;  5KTQ A;  3LWL A;  2GX9 A;  5K14 A;  4AH9 A;  3VEV A;  2ZJP L;  2ASO A;  4O8U A;  4KI6 A;  2HHT A;  4DR4 K;  4RG8 A;  1NU0 A;  4DF4 A;  4NO7 A;  4DQS A;  2JWK A;  4CHP A;  3PUF A;  3J80 O;  1NJX A;  3OYM A;  3SQ2 A;  4E3S A;  3M1F A;  3EL2 A;  3MXI A;  4IG0 A;  1NGH A;  4C23 A;  1HNZ K;  1TYQ A;  3WXM B;  3D45 A;  2P51 A;  3UKR A;  1S6P A;  2O8F B;  2GWJ A;  3QEV A;  3DYA A;  2ZWH A;  3C94 A;  3HSC A;  1WUA A;  4JI6 K;  4M3U A;  4H0V B;  3EY1 A;  2F9W A;  1RBT A;  1EWQ A;  4E7H A;  4B9Q A;  4L3Q A;  3NMU A;  2HST A;  4EZ6 A;  2DY4 A;  3DLG A;  4LF8 K;  4FSV A;  4F9O A;  3CIP A;  3MN5 A;  3E9O A;  3OYJ A;  1VRT A;  3PIP L;  4CEF A;  3I0S A;  4DMN A;  5AQP A;  1C0T A;  4JKF A;  3OYH A;  4NXN K;  4AM7 A;  4I9L A;  3L2V A;  4I2P A;  2VG5 A;  4CHY A;  4G1Q A;  4DU3 A;  1NGA A;  3ZT2 A;  4J2B A;  3J7Y P;  4E89 A;  1X9S A;  3H08 A;  3OYE A;  1ZXO A;  5KRT A;  3I55 N;  4XH1 A;  1BQM A;  3C6U A;  1ASU A;  4CFA A;  1IBK K;  3VA0 A;  5BRH A;  1KXP A;  4TSX A;  4HHT A;  3CJB A;  4FVU A;  3HOT A;  2RPI A;  3NF8 A;  2HOE A;  4Z4H A;  1N32 K;  3RTV A;  4DV6 K;  2P9N A;  3O9Q A;  1NMN A;  4BRE A;  4H0P A;  5F0X A;  4DV0 K;  3FR0 A;  3NFA A;  4K41 A;  3BGR A;  3K5L A;  3HYF A;  4N5S A;  3MXJ A;  1VQL N;  2G8U A;  2PYL A;  5GAE P;  3SBT A;  4KHS A;  2P9I B;  1NGD A;  4FLW A;  3VTI A;  1VQ5 N;  4M3W A;  1XNR K;  4CJP A;  3BF1 A;  3A2F A;  3DLH A;  3L2W A;  3ITH A;  1DTT A;  4YOT A;  4M63 C;  4CJE A;  4E1N A;  4CZH A;  1KC8 O;  3J8A A;  1EWR A;  3D0P A;  1HQU A;  4CCH A;  2FSK A;  2XY5 A;  3V1O A;  2OA8 A;  1VQM N;  2Q31 A;  4Z4E A;  4CEE A;  4CIE A;  3LPU A;  4B9U A;  4XH5 A;  1CZ9 A;  4Z0U A;  1NK6 A;  4JK7 A;  5FPM A;  4NYF A;  1EET A;  1I94 K;  5ADX A;  2FXU A;  4E7J A;  4ISF A;  4B1Z A;  1BO5 O;  3O80 A;  4LSN A;  1HMV A;  4NLC A;  1DT9 A;  2GWK A;  1BU6 O;  4W5N A;  4FO0 A;  1ILY A;  4BDZ A;  2IS3 A;  4EZ9 A;  3O08 A;  4KPY A;  4LF4 K;  1BA1 A;  1RDA A;  2KW4 A;  3OJU A;  2O8C B;  4IOX A;  2IVP A;  4CFD A;  1RCH A;  1HPZ A;  4NCG A;  2Q97 A;  5C10 A;  2NRR A;  3TAF A;  3SUQ A;  3IAY A;  3QIC A;  4NXM K;  5GIP A;  1W2B M;  2LSN A;  4FWR A;  4E7K A;  1A5X A;  3HZ6 A;  1TKD A;  1S22 A;  4CFC A;  3RVC A;  4R79 A;  1NJW A;  3MWP A;  4NLB A;  3VQ8 A;  5MLC Q;  2Q3S A;  1EX4 A;  3AY9 A;  1L3V A;  3UIQ A;  2P9I A;  4DG1 A;  1Z25 A;  1TV6 A;  4B9S A;  3IRX A;  3W0L A;  4E1M A;  3ZX2 A;  3KK3 A;  4BR5 A;  1GOC A;  3T7Z A;  2A41 A;  4B9V A;  4O5B A;  1HNV A;  4FZZ A;  3O4Q A;  2YV0 X;  3LAN A;  1K8A O;  2QKK A;  2QA4 N;  4H8K A;  4E1J A;  4J8F A;  5CE3 A;  4AIL C;  2E2O A;  4CZF A;  3RR8 A;  1NJY A;  1RNH A;  4FJ5 A;  4B9L A;  5HRS A;  4WQ5 A;  4CEB A;  3O3G A;  2BH1 A;  1TAU A;  3QEI A;  3V6D A;  4CEO A;  4BC5 A;  4DV1 K;  4CVN E;  4DR5 K;  4B1W B;  3KWG A;  5KGW A;  2YNI A;  4AHV A;  1RDC A;  4A2B A;  4CFB A;  1Q82 O;  1C0F A;  4RTF D;  4EHT A;  1UA0 A;  2JLE A;  4GY2 B;  3O9T A;  4OGC A;  3V81 A;  4BR7 A;  4JS4 A;  3SK3 A;  3K59 A;  1NK5 A;  3TSU A;  4ELT A;  1EXQ A;  4NCB A;  3CC7 N;  2EHG A;  3KIO A;  4IXC A;  3DAW A;  3AO3 A;  2OTJ N;  4BC2 A;  5E84 A;  3HOS A;  1RT1 A;  1TYQ B;  4BY9 C;  4K8Z A;  1JXE A;  4MDA A;  4FWK A;  3AVH A;  4KH5 A;  2UU9 K;  4OKE A;  4B08 A;  2ETJ A;  4KV8 A;  5CR4 A;  4CJ3 A;  3WQU A;  3V4I A;  4QCL A;  4PKH A;  4FJ7 A;  1YVN A;  3EZW A;  4FJX A;  4BWM A;  4IWV A;  5JS1 A;  5AQV A;  4JKE A;  1SQK A;  4OJR A;  2IOC A;  1T6C A;  1JLC A;  3QBX A;  4B9M A;  1NGC A;  4BR4 A;  3C95 A;  3HO1 A;  1TUU A;  3CQY A;  2G8H A;  3U6F A;  2ZJQ L;  1J53 A;  1OH8 A;  5KQ8 A;  5FPN A;  5EY4 A;  3EE9 A;  3OJS A;  1YHQ N;  3CM6 A;  1RBR A;  1EQY A;  3CI5 A;  1Q18 A;  3SLC A;  4H0O A;  3PX6 A;  3U8X A;  4B1X B;  5AQI A;  2QI2 A;  4N56 A;  3JSM A;  2P1J A;  4CJT A;  4J2E A;  4JI2 K;  4BC4 A;  4B1U B;  5CHI A;  4FW2 A;  1RFQ A;  3ASM A;  4WE1 A;  1OKJ A;  5KPT A;  1U2V A;  2NRH A;  3IKM A;  4OVL A;  4Q0B A;  4JRQ A;  1W97 L;  3IFR A;  4DV4 K;  2NNW A;  4Z4F A;  3MEC A;  3AA5 X;  2FLO A;  5C2D A;  4ZTJ A;  1TAQ A;  1ZYQ A;  1ZBS A;  3VQD A;  3BY5 A;  4CHN A;  4EAH D;  3EYZ A;  3ZCM A;  3M8R A;  1C0U A;  4QOZ B;  4QAG A;  4M3X A;  2XY6 A;  1RT5 A;  5HRO A;  4B3R K;  3DOL A;  2O4I A;  1S9G A;  1QTM A;  3DRP A;  3MDQ A;  3HRG A;  3CPW M;  1TK0 A;  5BRE A;  4PUO A;  4A5A A;  4DU1 A;  1BI4 B;  1D5A A;  3HBT A;  3PY8 A;  1LWF A;  4E7L A;  4DR1 K;  3DLL L;  3FZM A;  3U9D A;  2B5J A;  4CGD A;  4LFC K;  4DR2 K;  4BE0 A;  2V51 B;  5BN8 A;  3BZC A;  3KLH A;  3DRR A;  2YNF A;  1RIL A;  4BE1 A;  1JLF A;  3GOI A;  2OZM A;  4RCH A;  3D7E O;  4CJV A;  3ZEU A;  3SCX A;  3OBW A;  1YIT N;  3WUH A;  3TAQ A;  3WEE B;  1B92 A;  3THY A;  2ZM6 K;  1DEJ A;  1UWB A;  3HPH A;  1TVR A;  5M1Q A;  1V4S A;  4DLE A;  4F2R A;  3O9R A;  5AFU H;  2HND A;  3NVM A;  3LAM A;  2OPS A;  2UUC K;  4IJN A;  1VQP N;  3IUC A;  1XHZ A;  3DLK A;  4WQ5 C;  4EHU A;  2HHX A;  2WUS A;  1O1W A;  4IOA L;  5ELZ A;  3VEZ A;  1NMD A;  5M1F A;  3MCP A;  2ZJR L;  3PIO L;  3OA9 A;  2ZE2 A;  1RGI A;  4CJ7 A;  3CM5 A;  3O1B A;  3AAP A;  2EX3 A;  4AHR A;  3BZK A;  4CJ4 A;  4M42 A;  5HBM A;  4KI4 A;  4RW9 A;  3BEX A;  2YNG A;  4W5T A;  3G71 N;  1XWL A;  4O4G A;  3TAG A;  4GV3 A;  2HBM A;  3U4L A;  4CJR A;  3VER A;  3TR8 A;  5TKW A;  5GAH P;  3VES A;  1RT2 A;  5GAG P;  3TTF A;  2Q36 A;  5AQJ A;  3NDK A;  4CEZ A;  3BDP A;  1BOT O;  2DPN A;  5C15 A;  3ZX3 A;  2RHK A;  3I8D A;  3HP9 A;  3L2U A;  2QW9 A;  1NLV A;  4JKC A;  3OTO K;  3A8Y A;  4JNE A;  3DXM A;  3VQ4 A;  4DU4 A;  3DI6 A;  4KB1 A;  4F3T A;  3DXK B;  1W0H A;  1TGO A;  2A40 A;  3ENH A;  5M1O A;  2OYQ A;  3LL3 A;  3L2R A;  3VQA A;  3MX2 A;  3J81 O;  1L3U A;  3DXK A;  3OYN A;  4KHY A;  4FVM A;  2HNY A;  3DJC A;  1RBV A;  1E4G T;  2KLA A;  4JK8 A;  3KLE A;  3DXM B;  4DV2 K;  4KFB A;  2E8A A;  1K6Y A;  2OCE A;  4HUF A;  1J5E K;  1Q86 O;  3LAL A;  4Z4G A;  3G6E N;  3LAK A;  5AQQ A;  1LWC A;  3O1W A;  1OH7 A;  1KCF A;  4KO0 A;  1ZC6 A;  2D1K A;  3I8B A;  5BPL A;  2QKB A;  5AQT A;  3DOK A;  2UXD K;  5HP1 A;  4CZG A;  1HNW K;  2HHQ A;  3NAE A;  3CCJ N;  4DSK A;  5BPM A;  4YY3 K;  4PQU A;  1N8R O;  4LFB K;  1ZBF A;  4FWM A;  2E2P A;  3KK7 A;  3P83 D;  3THV A;  4FWS A;  4B3M K;  4X65 K;  4JI4 K;  2D4W A;  4GV6 A;  1DGK N;  2QWM A;  3LZI A;  2YHX A;  4LH5 A;  3EKS A;  3AVK A;  1Q81 O;  4JKA A;  3E01 A;  1S72 N;  5HOO A;  3ZLJ A;  4I9Q A;  5I42 A;  1N5Y A;  2I7N A;  4FYD A;  4O44 A;  4AHS A;  4FLU A;  3DMJ A;  4WF9 L;  3L8B A;  3HST B;  1KTQ A;  4DS5 A;  1P8Z A;  4JI3 K;  3EN9 A;  4BWJ A;  3THY B;  3SNN A;  1LWE A;  4A5B A;  2A6A A;  1RDU A;  1YJ9 N;  3ZEU B;  3U3Y A; 
#chains in the Genus database with same CATH homology
 4CCH A;  1N6Q A;  3SUN A;  4FJG A;  4ICL A;  4F2S A;  2XY5 A;  3V1O A;  2OA8 A;  3AVJ A;  3LWM A;  3TAB A;  4Z4E A;  2BDP A;  4CEE A;  2JGU A;  2G8K A;  2G8I A;  1RBU A;  2IAJ A;  4CGF A;  4DFM A;  1S5J A;  1TK8 A;  4CIE A;  1C1A A;  2P5G A;  1JLE A;  3LPU A;  3IS9 A;  4B9U A;  4HCB A;  1CZ9 A;  1SV5 A;  4Z0U A;  4J2D A;  1D9F A;  1NK6 A;  5CZ1 A;  1JLA A;  1D9D A;  3B6O A;  3LP3 A;  4RW4 A;  4NYF A;  1EET A;  5C42 A;  3AA2 A;  5SZT A;  4FM0 A;  1ZBI A;  1J9A A;  1IKV A;  4CJ5 A;  1FXX A;  4E7J A;  4Y1D A;  4C8N A;  4F4K A;  1U04 A;  3QNO A;  3HPG A;  2FBV A;  1JLG A;  4LD0 A;  4LSN A;  1BGX T;  3NF9 A;  1HMV A;  3OYG A;  1RTJ A;  4FLT A;  4W5N A;  1KLM A;  4BDZ A;  4C8M A;  2Z1I A;  3ZSX A;  4FLZ A;  3MED A;  1DTQ A;  4XIU A;  2IS3 A;  3V1Q A;  3K57 A;  4EZ9 A;  4CJL A;  1C6V A;  1SKS A;  1WSI A;  2D0C A;  4KPY A;  3SQ0 A;  4IFV A;  4M3Y A;  1RDA A;  5FDL A;  2KW4 A;  2D5R A;  3OJU A;  3KLG A;  3AVM A;  4OPK A;  4DTR A;  1S1V A;  4CFD A;  1C0M A;  4KRF A;  1RCH A;  4FZY A;  4KKO A;  1HPZ A;  4BDY A;  1G15 A;  4NCG A;  3AVN A;  3L3V A;  4E19 A;  2BAN A;  3O3F A;  2I5J A;  3TAF A;  3SUQ A;  3IAY A;  4FK0 A;  1I3A A;  2LSN A;  2Z1H A;  3HVT A;  2FBY A;  4RW8 A;  4YFU A;  4E7K A;  1A5X A;  4DS4 A;  1HNI A;  5CY4 A;  5J2M A;  1B9D A;  4CFC A;  3ZSQ A;  3HP6 A;  1TKD A;  1NJW A;  4L8R B;  3HK2 A;  1QSS A;  3VQ8 A;  4FK2 A;  1QSY A;  3AO2 A;  1VSI A;  2WOM A;  2YKN A;  2Q3S A;  3HO1 A;  1EX4 A;  4FJ8 A;  4JLH A;  4GW6 A;  1L3V A;  3UIQ A;  4ID1 A;  1WNS A;  4FJJ A;  4DG1 A;  1Z25 A;  1TV6 A;  4B9S A;  1ZBH A;  3CQ8 A;  5CYM A;  1BHL A;  1BL3 A;  3IRX A;  2OPP A;  4E1M A;  4BE2 A;  4KTQ A;  4MFB A;  4OLB A;  4CJW A;  3KJV A;  3KK3 A;  5KI6 A;  3QET A;  2YHB A;  1GOC A;  3TAE A;  1ITG A;  1NKE A;  2ITG A;  3NCI A;  3TAP A;  4DTO A;  2HHV A;  4FJK A;  4B9V A;  4O5B A;  1HNV A;  4FZZ A;  3SQ4 A;  3G10 A;  3O4Q A;  2YV0 X;  4FM1 A;  3LAN A;  4DQQ A;  3T1A A;  2QKK A;  2QK9 A;  2RF2 A;  2HMI A;  3AA4 A;  5C24 A;  4H8K A;  5E41 A;  1S1U A;  4W5R A;  1BCM A;  3F9K A;  1U49 A;  4DSL A;  3LP1 A;  4AIL C;  3AVA A;  4KHY A;  1CLQ A;  4B9T A;  2KFN A;  3OYC A;  3RR8 A;  1NOZ A;  4B8A B;  4EP5 A;  3LPT A;  1WLJ A;  1NJY A;  4UQG A;  1RNH A;  4FJ5 A;  3C6T A;  3VQ5 A;  1RTD A;  4B9L A;  1KFD A;  5HRS A;  4DTJ A;  1NK9 A;  4CEB A;  3O3G A;  4OGE A;  2VWJ A;  2A1R A;  4KTZ A;  1TAU A;  3QEI A;  2ZD1 A;  3V6D A;  5JS2 A;  4CEO A;  1W9H A;  2ATQ A;  4ELV A;  4ID5 A;  1T03 A;  3AVC A;  5J1E A;  2YHA A;  2OPQ A;  3ZSZ A;  5KGW A;  1UAX A;  2YNI A;  4DTM A;  4ZTF A;  3VQ6 A;  4AHV A;  1JL1 A;  3K5M A;  3RR7 A;  1RT4 A;  1RDC A;  2XRI A;  3LP2 A;  1DLO A;  4CFB A;  3AVL A;  4CJU A;  1Z26 A;  4M41 A;  2WON A;  3NH0 A;  4DTU A;  5HRR A;  1LW2 A;  4N41 A;  2XHB A;  2KTQ A;  1UA0 A;  2JLE A;  3VQE A;  4E0D A;  4FJI A;  1CXQ A;  4OGC A;  3K5O A;  3V81 A;  3QIO A;  4J2A A;  3ISN C;  3NBP A;  1QQC A;  1JLB A;  1ASW A;  4O55 A;  2RN2 A;  3OY9 A;  3NGI A;  3K59 A;  4JS4 A;  4FCY A;  3S3N A;  3CFO A;  1NK5 A;  1J5O A;  5FRN A;  1FKO A;  4M3T A;  1X9M A;  4ELT A;  1EXQ A;  1HRH A;  1C1B A;  2FBX A;  1S1T A;  1YTA A;  2EHG A;  3KIO A;  3L2Q A;  1WN7 A;  4BAC A;  3KLF A;  4E7I A;  2GBZ A;  1REV A;  1A5W A;  3AO3 A;  3AVG A;  1SKR A;  1VSD A;  3KK1 A;  3KD5 E;  4CIG A;  3O3H A;  3F73 A;  1QE1 A;  1SUQ A;  4I7F A;  2KQ2 A;  4HTU A;  4CK1 A;  3V9S A;  1RT1 A;  4I2Q A;  3RWU A;  4HCC A;  4CEQ A;  4CJF A;  1QS4 A;  4FXD A;  2KZZ A;  4KRE A;  5I3U A;  4K8Z A;  1JXE A;  1X9W A;  4Q5V A;  1KVB A;  4DSF A;  2KFZ A;  3NE6 A;  1I39 A;  4GMJ B;  5J2P A;  3AVH A;  3QEW A;  3SYZ A;  1SL0 A;  4OKE A;  1GOB A;  3QER A;  4B08 A;  4PWD A;  3CG7 A;  2ETJ A;  4KV8 A;  3HVR A;  4CJ3 A;  1KRP A;  4B9M A;  2OPR A;  4QCL A;  4CF9 A;  3V4I A;  4FJ9 A;  1U48 A;  3WNF A;  4FJ7 A;  1VSL A;  1IKW A;  3EZ5 A;  4BWM A;  1S9E A;  4CGH A;  4FJX A;  5JS1 A;  1YTU A;  1WAJ A;  4W5Q A;  3ALY A;  3RMD A;  4OJR A;  1UA1 A;  1WSJ A;  3O4N A;  4CE9 A;  2IOC A;  3S9H A;  1WSE A;  3CFP A;  3AO4 A;  1NK4 A;  3MEE A;  1EP4 A;  1JLC A;  4LSL A;  1JLQ A;  3ZSY A;  3ZT1 A;  4OPJ A;  3KTQ A;  3CYM A;  3LDS A;  3C95 A;  4GVM A;  2YKM A;  4B8C A;  1WAF A;  1YT3 A;  4YNQ A;  3IG1 A;  3SV4 A;  2Y1J A;  1ZBL A;  3U6F A;  1LV5 A;  1J53 A;  1QSL A;  2G8H A;  4Z4I A;  3AA3 A;  4JRP A;  3OJS A;  1L3T A;  3CM6 A;  1RBR A;  1KLN A;  1KSP A;  3VQC A;  4B3O A;  2VG6 A;  4CGG A;  1MU2 A;  3PX6 A;  3V1R A;  2HHS A;  3NH2 A;  3QEX A;  2NUB A;  4N56 A;  3JSM A;  3HJF A;  3HM9 A;  2P1J A;  4CJT A;  4ZHR A;  1IO2 A;  3SUO A;  4J2E A;  4DWI A;  2F8T A;  3NH1 A;  4NYN A;  2BE2 A;  4FW2 A;  3AVI A;  5C25 A;  4FJH A;  3QIP A;  4IKF A;  3PX0 A;  3ASM A;  5DK5 A;  1NK8 A;  4WE1 A;  4CF2 A;  4F3O A;  1R0A A;  1T05 A;  4OVL A;  4Q0B A;  4IDK A;  1NJZ A;  4JRQ A;  4CES A;  4R5P A;  3V9U A;  1RTI A;  1WSG A;  1VSE A;  4DFK A;  4Z4F A;  4KHW A;  2XY8 A;  4CEC A;  1HYS A;  3ULD A;  2D0A A;  1HYZ A;  2F96 A;  3MEC A;  3P5J A;  3AA5 X;  3DLE A;  4O0I A;  4ZTJ A;  4M3Z A;  4CED A;  2FC0 A;  1TAQ A;  1VSH A;  1ZYQ A;  2FBT A;  1RDB A;  3VQD A;  3U3Y A;  4CHN A;  1RDD A;  1BIU A;  1HJR A;  4LY7 A;  3ZCM A;  3EYZ A;  3M8R A;  1C0U A;  3SI6 A;  5D3G A;  4QOZ B;  1TKT A;  1X1P A;  4QAG A;  4M3X A;  2HVI A;  4EP4 A;  1F21 A;  2XY6 A;  1IKX A;  3OYK A;  4CIF A;  1RT5 A;  4JS5 A;  5HRO A;  3DOL A;  1IG9 A;  3ZT4 A;  1CZB A;  2Y1I A;  2O4I A;  1S9G A;  2HHU A;  1LW0 A;  1QTM A;  2Z1J A;  3DRP A;  1J54 A;  2D0B A;  3SPZ A;  3RMA A;  3B6P A;  4DFP A;  2X6S A;  1TK0 A;  2A1S A;  1T8E A;  2PY5 A;  4KB0 A;  3PX4 A;  4PUO A;  1RT7 A;  3QNN A;  1Q8I A;  1VRU A;  1BI4 B;  4Y1C A;  2X78 A;  1VSF A;  1D5A A;  3HXM A;  4FLV A;  4DU1 A;  1LWF A;  4E7L A;  3PY8 A;  1BI4 A;  4RW7 A;  1GOA A;  1UOC A;  3MAQ A;  1Q9X A;  4CGD A;  2B5J A;  2G8F A;  4BE0 A;  1QHT A;  1U4B A;  4N76 A;  2X6N A;  3SV3 A;  3S3O A;  3QES A;  1S6Q A;  3QIN A;  4H4O A;  4M3R A;  4B9N A;  3KLH A;  4FJN A;  4FW1 A;  4C8O A;  3DRR A;  2YNF A;  1TK5 A;  4DTS A;  1RIL A;  3TAR A;  4BE1 A;  3K2P A;  1WSF A;  5J2Q A;  1JLF A;  2VG7 A;  4C8L A;  4IG3 A;  4FLX A;  3QLH A;  3PV8 A;  4LH4 A;  4CJQ A;  3HPO A;  2XY7 A;  2OZM A;  4DQP A;  4KHN A;  4HUG A;  5HLF A;  1VSK A;  4CJV A;  4CK3 A;  1EKE A;  2O4G A;  3SCX A;  2HNZ A;  3WNH A;  3OYI A;  1LAW A;  3K58 A;  4CF8 A;  2KZM A;  4CGJ A;  3TAQ A;  3KLI A;  1KVC A;  1B92 A;  5CYQ A;  4AHT A;  1TL3 A;  3TAN A;  1T7P A;  1UWB A;  3HPH A;  3VQ9 A;  2RKI A;  2YNH A;  3DM2 A;  1TVR A;  3OYB A;  1A5V A;  4KTW A;  4DLE A;  4F2R A;  3MEG A;  4FK4 A;  1VSJ A;  1XHX A;  2HND A;  3LAM A;  3KKS A;  2OPS A;  3DRS A;  1U45 A;  2E6L A;  1RT6 A;  3U3G A;  5EU7 A;  1XHZ A;  4CJK A;  3DLK A;  4H4M A;  2R7Y A;  2G8V A;  1S1W A;  4HUE A;  4C8K A;  2HHX A;  5DMR A;  5J2N A;  3P1G A;  3V9X A;  4CGI A;  1O1W A;  2E6M A;  3QO9 A;  3JYT A;  1BQN A;  3LP0 A;  4DLG A;  3S3M A;  4DQI A;  4FLY A;  1BIZ A;  4DQR A;  3G0Z A;  4KHU A;  5HRN A;  4O0J A;  2VWK A;  1TL1 A;  1D8Y A;  1CXU A;  1SL1 A;  1VK0 A;  3OVN A;  2ZE2 A;  1L5U A;  1ASV A;  2E4L A;  3CM5 A;  2HVH A;  3M8S A;  2F8S A;  1ZBU A;  2EX3 A;  3SPY A;  4DTP A;  4DSI A;  4AHR A;  1FKP A;  4CJ4 A;  4BDP A;  4M42 A;  5HBM A;  3AO5 A;  4CJS A;  1SL2 A;  4KI4 A;  4RW9 A;  1FK9 A;  2IGI A;  4Z4C A;  4CHZ A;  1JKH A;  3KK2 A;  1B9F A;  1XI1 A;  5KTQ A;  4CK2 A;  1IKY A;  2YNG A;  3KKR A;  5K14 A;  4AH9 A;  3LWL A;  4KI6 A;  2HHT A;  3M8P A;  3MXM A;  4W5T A;  4OLA A;  1C1C A;  1XWL A;  2QXF A;  4O4G A;  4RG8 A;  3TAG A;  4DF4 A;  1LAV A;  3NGZ A;  4CJR A;  2XO7 A;  3TR8 A;  4DQS A;  4AHU A;  4N47 A;  4AHC A;  1HYV A;  4CHP A;  4W5O A;  3PUF A;  1NJX A;  1BIS A;  1RT2 A;  5KRS A;  3OYM A;  4DF8 A;  3SQ2 A;  4E3S A;  1XC9 A;  3MXI A;  3NDK A;  3SQ1 A;  4IG0 A;  4CEZ A;  2HB5 A;  4M45 A;  4OKK A;  1Q9Y A;  3BDP A;  3DLB A;  3I8D A;  4KAZ A;  3D45 A;  1Y97 A;  1TKZ A;  3HP9 A;  2P51 A;  3L2U A;  1S6P A;  1JXB A;  3PO4 A;  4CF0 A;  3QEV A;  2HW3 A;  2Z1G A;  3DYA A;  3K5N A;  3C94 A;  1HQE A;  3WNE A;  2GUI A;  3VQ4 A;  4CF1 A;  4DU4 A;  4M3U A;  3DI6 A;  3WNG A;  3EY1 A;  4F8R A;  1KVA A;  4KB1 A;  4F3T A;  1RBT A;  1W0H A;  1TGO A;  4E7H A;  3RMC A;  4PA1 A;  5T7B A;  1NK0 A;  2OYQ A;  4EZ6 A;  4DTN A;  3L2R A;  3VQA A;  4MQ3 A;  3ZSV A;  2DY4 A;  3DLG A;  2OZS A;  2GV9 A;  1L3U A;  3OYN A;  3VA3 A;  4RW6 A;  3VQB A;  4CEA A;  4FVM A;  2HNY A;  3OYJ A;  1RBV A;  1VRT A;  3I0S A;  4CEF A;  3OYA A;  4DMN A;  3TWH A;  3V9Z A;  3KLE A;  4DSJ A;  1C0T A;  4KFB A;  4NCB A;  3ZSO A;  1L3S A;  3ZT3 A;  3NF6 A;  3RMB A;  2DTU A;  3OYH A;  2P5O A;  4FM2 A;  3HT3 A;  3OS1 A;  1K6Y A;  4I9L A;  4CHO A;  3FFI A;  3M8Q A;  3L2V A;  4I2P A;  2VG5 A;  4CHY A;  4HUF A;  2ZQB A;  1RT3 A;  1NOY A;  4G1Q A;  3LAL A;  4DU3 A;  4Z4G A;  2G8W A;  3LAK A;  3VQ7 A;  3OYL A;  3ZT2 A;  2B4J A;  3NHG A;  1U47 A;  1NK7 A;  2BGG A;  1LWC A;  3RRG A;  1RBS A;  1JL2 A;  3V9W A;  1KCF A;  4KO0 A;  4J2B A;  4E89 A;  2W42 A;  1X9S A;  3H08 A;  3OYE A;  4ELU A;  5KRT A;  2QKB A;  3ZSW A;  3DOK A;  1BQM A;  3C6U A;  5HP1 A;  3VQP A;  1ASU A;  4CFA A;  3KD1 E;  3TI0 A;  3VA0 A;  2HHQ A;  3I0R A;  3NAE A;  4TSX A;  4HHT A;  1KFS A;  4DSK A;  1SKW A;  2PYJ A;  4DTX A;  2RPI A;  3NF7 A;  2HHW A;  3NF8 A;  4PQU A;  3ZSR A;  4OKJ A;  4Z4H A;  4FJL A;  3L3U A;  4IBN A;  3RTV A;  4FZX C;  4KHQ A;  1ZBF A;  3AVB A;  3P83 D;  4CHQ A;  3THV A;  5HRP A;  3PO5 A;  4K8X A;  5FRM A;  1S1X A;  3TAM A;  2IDO A;  5CZ2 A;  2AJQ A;  3AVF A;  4IFY A;  4HVJ A;  3T3F A;  3NFA A;  4DFJ A;  3OS2 A;  3BGR A;  3LZI A;  2DFH A;  3K5L A;  3HYF A;  4N5S A;  3MXJ A;  4LH5 A;  3T19 A;  2G8U A;  3AVK A;  2PYL A;  4NCA A;  3LZJ A;  1TKX A;  3E01 A;  5FRO A;  3HL8 A;  4KHS A;  5KGX A;  2X74 A;  1IH7 A;  2DFE A;  4I9Q A;  5I42 A;  3VN5 A;  4FLW A;  1N5Y A;  3OS0 A;  4FYD A;  4O44 A;  3NGY A;  4AHS A;  3RRH A;  4FLU A;  1BCO A;  3DMJ A;  4FJM A;  3AV9 A;  1NKB A;  4M3W A;  3SJJ A;  4CJP A;  3L8B A;  1VSM A;  3HST B;  4DSE A;  4PY5 A;  3A2F A;  3CFR A;  1KTQ A;  4DS5 A;  3DLH A;  3L2W A;  3ITH A;  1DTT A;  2IC3 A;  3DLR A;  4CJE A;  2PZS A;  1YVU A;  2B6A A;  3QEP A;  4E1N A;  3AO1 A;  3SZ2 A;  3VQQ A;  1WSH A;  3OYD A;  4BWJ A;  3OYF A;  3SNN A;  1RTH A;  1LWE A;  3ZT0 A;  1NKC A;  2DFF A;  3D0P A;  1HQU A;  3SUP A;  4CER A;  5SWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...