3ZSWA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zswA00
2BANA 2FBVA 3QEWA 3S9HA 4CIFA 1X1PA 3QINA 5C42A 4MQ3A 4OKEA 4HCCA 4N47A 4CK2A 4CHOA 2D0CA 1LAWA 4CHPA 3NH1A 3HPGA 1TL3A 2PYJA 2A1SA 3OYDA 4N76A 3MEGA 2BGGA 4HUGA 4OKJA 3VQAA 4OGCA 3L2RA 1CZ9A 2G8HA 1JLEA 1JLFA 1WSHA 3WNHA 4JRQA 5KI6A 4B9LA 1C0TA 3HP9A 3HP6A 3QEIA 1N6QA 3UIQA 3KLEA 1Q8IA 3HL8A 4E7IA 1K6YA 1SV5A 4E7JA 4FLUA 3MEEA 3RTVA 3AVGA 3K5OA 4CEEA 1NOZA 2EHGA 3TI0A 3ZT4A 3SYZA 1UA0A 4FK0A 1RCHA 1FXXA 1IH7A 2P51A 4KTZA 4DLGA 4ZTFA 4DQRA 4DTNA 3SI6A 1GOBA 4CF9A 1NKCA 4Z4EA 1ZBIA 1BIZA 3D0PA 4ELUA 3V81A 1VSHA 4HCBA 4BE0A 3CM5A 4AHSA 4LSNA 1KVBA 3VQDA 4AH9A 4KO0A 4CEFA 3RR7A 4FJKA 2G8FA 2G8WA 3DRSA 1JL1A 1A5XA 1XHXA 3KLIA 3AV9A 1TKZA 1FK9A 3AA4A 4FJNA 4KHNA 1DTQA 4DSIA 3LP0A 5T7BA 3NDKA 3K59A 4AHCA 4UQGA 1RT3A 3MAQA 1Q9XA 4KB1A 3RR8A 2P5OA 3DLEA 1ZYQA 4F2SA 2QK9A 2YHBA 1LW0A 1QS4A 5SWMA 2XY8A 4FXDA 1DLOA 3AA5X 3AVHA 3F73A 4FM1A 4ID5A 4E1MA 2BDPA 4FJGA 4CEQA 5CZ1A 1QSYA 4GMJB 5HRRA 4B9VA 3SPZA 3RWUA 1SL1A 4OGEA 5CZ2A 4Z4CA 3O4QA 2G8IA 2QKBA 4RG8A 1S9GA 2B5JA 2ZQBA 3KKRA 3HVTA 1T7PA 4TSXA 4O5BA 1J5OA 4BWMA 4AILC 4C8OA 1IKYA 4CJVA 2E6MA 4F2RA 3VQ5A 4E7KA 4M42A 2HHVA 3L2VA 1J53A 5DK5A 2BE2A 1W9HA 4RW6A 4F4KA 4FK4A 3S3MA 3ZCMA 2DTUA 1YTUA 5HP1A 4J2DA 1NOYA 1HJRA 4DQIA 4KB0A 1D5AA 2VWKA 3DLBA 3HJFA 3VQ6A 4IG0A 1KFDA 4I2QA 4K8XA 3L2UA 2XHBA 3V9ZA 1I3AA 1RDCA 2IS3A 4LY7A 1KSPA 4XIUA 3V6DA 1KVAA 1S1UA 2ATQA 1TAUA 5I3UA 4DLEA 3SQ0A 1BI4A 4K8ZA 2O4IA 3VQ9A 2HHSA 2YKMA 2YNHA 1EXQA 3HSTB 1ZBHA 2DFFA 3K58A 3AVNA 2HHUA 2B4JA 3NF9A 4CEAA 3U6FA 2HNDA 3NCIA 2YNFA 2HMIA 4KKOA 4M41A 2Z1HA 4KV8A 3SUOA 4OKKA 1NKEA 1LV5A 3I0RA 2OA8A 3NGYA 1ZBUA 4NCGA 3H08A 1QQCA 1A5VA 3K5LA 3HXMA 4HHTA 4CF8A 4B9TA 4WE1A 4FLYA 4ZTJA 4ELVA 1U04A 2PYLA 1Q9YA 2ETJA 1HQEA 4DQPA 3VQ4A 3DLHA 3D45A 2IAJA 3ZSOA 1TK0A 3L2QA 4CFBA 4CHNA 1NJXA 4FW1A 3SUNA 4HTUA 1TKDA 4CFDA 1BCMA 3AVBA 1KTQA 4N5SA 5J2NA 3MEDA 4I9LA 2IDOA 4CJ4A 1HYSA 1L5UA 2GV9A 3WNFA 3LALA 5JS2A 1SKWA 1W0HA 4Z0UA 3ZSYA 3KJVA 5EU7A 1NK6A 3NHGA 1A5WA 3MXJA 3AVIA 3VQ8A 4DMNA 4CJRA 3CFPA 3PV8A 2OPSA 5FRNA 3VA3A 3E01A 3TARA 1LW2A 3AVKA 4CJ5A 1VSLA 3OYCA 2X78A 4GW6A 3WNEA 4DFMA 3WNGA 3NF8A 4LSLA 4N41A 3KD5E 5KGWA 4FCYA 4H4MA 5DMRA 4FVMA 5KGXA 3VA0A 3RRGA 1CZBA 3T3FA 3AVJA 4AHTA 4N56A 3QNNA 1WSFA 3P83D 3CG7A 3SJJA 3EY1A 1U47A 3V9XA 1F21A 1RBTA 4E7HA 5K14A 4OPJA 4DWIA 3PX4A 1VRUA 3L3VA 3L2WA 4CJKA 3V9SA 1RDDA 1RT2A 3ZSQA 4CGDA 3JYTA 2QKKA 2XRIA 3C6TA 3M8SA 3V4IA 4CF0A 3V9WA 2G8KA 4B9NA 4OVLA 1L3TA 1Z26A 4DF8A 1HNIA 4DTJA 3TAEA 1UA1A 2X74A 1YVUA 3SQ2A 4M3TA 3QIOA 1KVCA 2Y1JA 4O55A 1X9MA 4FZZA 1BISA 1C0MA 1WSGA 1VRTA 3T19A 3AVCA 3O3FA 3OYMA 4BDZA 4BDPA 4QOZB 4NYFA 1WNSA 4KHSA 4CJ3A 1HYVA 2WONA 3AO1A 3ZT2A 3KK3A 2VG5A 3HK2A 1QSSA 1TV6A 3I0SA 3NF7A 5CYQA 1REVA 5J2QA 4BACA 4J2AA 1J54A 1RBRA 3SQ4A 2XO7A 3VQBA 3KIOA 3KLFA 3ULDA 1U48A 3KLHA 1D9FA 3IAYA 5J1EA 2RN2A 4CGIA 1VK0A 4R5PA 3K5NA 3QEVA 5HROA 4KAZA 4DTSA 1JLGA 4DFKA 4OLBA 2HW3A 1VSJA 2GBZA 4HUEA 1JL2A 1WN7A 4EP5A 3LZJA 2P5GA 4FJ5A 1RTDA 1ASUA 4M3RA 2KTQA 4B8AB 2HVIA 4H8KA 4CHQA 1TAQA 2FC0A 3NH0A 3OY9A 1NK8A 4NCBA 1Y97A 3V1RA 1HNVA 4ICLA 1IKXA 1XHZA 1NKBA 4IFVA 4RW4A 4I2PA 4M3YA 1RDBA 3LPUA 2HNYA 4W5RA 2W42A 1HQUA 4IDKA 2KFNA 1XWLA 4DTPA 3QESA 2DY4A 1RBVA 4CEBA 3OJUA 2X6SA 4CGFA 4CE9A 1B9FA 1GOAA 1UOCA 3QIPA 4C8NA 1NK5A 4CEOA 1JLCA 4EZ9A 4EZ6A 1C1CA 2R7YA 4PWDA 3HPHA 1D9DA 1LWFA 3ZT0A 1U49A 4KRFA 3OYKA 1WAJA 4CIGA 4DF4A 3OYIA 2HB5A 2D0AA 4OJRA 3G0ZA 4KHQA 3M8PA 2YHAA 3O3GA 4FJ9A 1MU2A 2OPPA 2E4LA 4YFUA 1BGXT 1NK4A 1BQMA 3RRHA 1C1AA 4L8RB 4FJ8A 4DTUA 1B9DA 5KRTA 3PX0A 4FJHA 5CY4A 3SV3A 3CFRA 3RMBA 4CESA 2G8UA 1DTTA 3NH2A 2YKNA 2HHWA 2EX3A 4ZHRA 1CXQA 4OPKA 1TL1A 4FM2A 1RTIA 3EZ5A 3K5MA 2LSNA 3AO2A 3DOLA 1WSEA 5FDLA 4LH5A 3PX6A 3NE6A 1UAXA 1IG9A 4CECA 1D8YA 3PY8A 4FZYA 2IOCA 3OVNA 1JLBA 1TK8A 2HNZA 1YTAA 3LWLA 4KTQA 3OS0A 4DQQA 1C0UA 1S6QA 3OS1A 5HRPA 1TKTA 5KTQA 1JKHA 1JLQA 4B9UA 4W5QA 2ITGA 4J2EA 2WOMA 1EX4A 3O3HA 1JXBA 1BQNA 3CQ8A 4M3XA 2X6NA 2FBTA 4M3UA 1RILA 3S3NA 1RT6A 2Z1JA 4G1QA 4BE1A 2RKIA 4DFJA 3C94A 3TAQA 5CYMA 4JLHA 3DRRA 4CJQA 2XY6A 1U4BA 1ASVA 1RT7A 3OYEA 5I42A 3U3YA 4FJLA 4I9QA 1HRHA 2F8SA 4KREA 4FLVA 2NUBA 3NFAA 3SUQA 2G8VA 2Y1IA 4KHYA 1BL3A 3CFOA 3DOKA 2FBYA 4JS5A 3SNNA 3KKSA 3LP2A 1C6VA 4FJXA 4Q0BA 4E19A 4Y1DA 2A1RA 3LWMA 2HHTA 1ZBFA 4CJUA 1BHLA 4CHZA 4DSJA 5J2MA 4CJPA 2KFZA 3V1QA 1T8EA 3RMCA 4DS4A 3SZ2A 1S1TA 3OJSA 1VSKA 3RMAA 4FLXA 4M3WA 4CJSA 4CF2A 4CCHA 4O44A 4CJFA 3NBPA 1FKOA 3NGZA 1S9EA 4CGGA 3QEPA 2PY5A 4NCAA 3TABA 4PUOA 1WLJA 3FFIA 3THVA 1G15A 2Q3SA 4C8LA 1HPZA 3F9KA 3KLGA 2OZSA 4IKFA 3MECA 1RT1A 3HM9A 4DFPA 4Z4FA 4B3OA 4CERA 3TAFA 4IFYA 4AHUA 1U45A 2D0BA 1X9WA 2IGIA 3OYBA 1RNHA 4NYNA 1R0AA 4ID1A 5C24A 3ZSZA 2VG6A 3HVRA 1B92A 3VQCA 4FJIA 1YT3A 4I7FA 4KI4A 1EP4A 4YNQA 2B6AA 4Y1CA 1L3UA 2RF2A 3OYAA 2OYQA 3VQQA 2RPIA 3OYHA 3SPYA 1GOCA 4DSKA 3TR8A 4RW9A 4FZXC 3PUFA 3QLHA 2O4GA 1VSMA 3AO5A 3VQ7A 2AJQA 3HYFA 4FYDA 5HLFA 3PO4A 4KHUA 2Z1GA 1ASWA 3LZIA 2OPQA 5FRMA 1JXEA 2E6LA 3JSMA 1KFSA 3LDSA 1IKWA 1RBUA 1RTHA 3P5JA 3QNOA 1UWBA 2HHQA 3NGIA 1LWCA 3VQPA 3TAGA 3I8DA 3LP1A 4FLWA 4PA1A 1TVRA 3C95A 3S3OA 1NJYA 3OS2A 3LAMA 4W5NA 3TAPA 3DM2A 4IBNA 1RT5A 4QAGA 4M3ZA 1T05A 4Z4HA 1RBSA 4ELTA 4E0DA 3AVAA 1X9SA 1KLMA 1RT4A 3DLGA 1NK9A 1LAVA 1L3SA 3ASMA 5HRNA 2ZE2A 4GVMA 4W5TA 3NAEA 4DS5A 4DU1A 4DU3A 3ITHA 2YNIA 3AO4A 1TK5A 3ZT3A 1EKEA 3AO3A 4AHRA 4C8MA 4CFCA 4FJJA 4DQSA 3LAKA 4H4OA 4FM0A 1SKSA 3CM6A 4CHYA 1BIUA 1HYZA 4CEZA 1NK0A 5D3GA 2F8TA 4BE2A 3EYZA 1O1WA 1TKXA 3QERA 3L3UA 2DFHA 1NJWA 1QTMA 4DSEA 3B6OA 4J2BA 3BGRA 3U3GA 1QE1A 1KLNA 3SV4A 3VN5A 4JRPA 4HUFA 3V9UA 1XI1A 4KHWA 2QXFA 1IO2A 4RW8A 1JLAA 3HT3A 3L8BA 3TWHA 4PY5A 3DLRA 3DLKA 4CF1A 3TANA 2KZZA 4BDYA 2KW4A 3DRPA 3MXIA 1SL2A 3DYAA 4DTMA 3K2PA 1FKPA 1HMVA 2VWJA 4Z4GA 1NK7A 3SCXA 2FBXA 3NF6A 3KTQA 1J9AA 1WSJA 1RDAA 3T1AA 3LP3A 4CEDA 4B9SA 1BCOA 4CK1A 1I39A 2ZD1A 2KQ2A 2P1JA 3LANA 3M8RA 1S1XA 4CJTA 3KD1E 2KZMA 4F3TA 3AVMA 3O4NA 4FLTA 3ZSWA 4DTOA 1NJZA 4FJMA 4FK2A 4Z4IA 3AA3A 3BDPA 4RW7A 3LPTA 2I5JA 4M45A 4HVJA 4PQUA 2HVHA 1RTJA 3ZSVA 2YNGA 4E1NA 3AVFA 4KTWA 3IRXA 4KPYA 4FJ7A 2D5RA 3ZSRA 1SUQA 4O4GA 4KFBA 1XC9A 1S5JA 4O0IA 1Z25A 4O0JA 4LH4A 5E41A 3PO5A 1LWEA 1S1WA 2JGUA 4CK3A 5HRSA 3DMJA 1VSIA 4CGHA 1VSFA 1SL0A 3OYJA 4QCLA 4FLZA 2GUIA 4BWJA 3A2FA 3ALYA 4B08A 2OPRA 5KRSA 3G10A 3KK2A 2OZMA 3B6PA 1WAFA 4Q5VA 3P1GA 3ZT1A 5C25A 2DFEA 1VSDA 4KI6A 1CLQA 1QSLA 3OYGA 4B8CA 3KK1A 2F96A 5HBMA 4MFBA 3VQEA 3QEXA 1TGOA 3DI6A 4F8RA 2XY7A 1S6PA 1WSIA 4CIEA 3ISNC 3QO9A 4CJLA 3AA2A 3K57A 3HPOA 4DSFA 4DU4A 3SUPA 1N5YA 4LD0A 1KRPA 4F3OA 4OLAA 4FW2A 2VG7A 1BI4B 3RMDA 3IG1A 1SKRA 4DG1A 1ZBLA 4DSLA 1VSEA 5J2PA 1T03A 1S1VA 4C8KA 4AHVA 1QHTA 2IC3A 3C6UA 1IKVA 4CJWA 2PZSA 5FROA 4W5OA 4DTRA 4B9MA 4E3SA 3IS9A 3ZSXA 4CFAA 1ITGA 3HO1A 3M8QA 3CYMA 4E7LA 4CGJA 3QETA 1EETA 2XY5A 2HHXA 3TAMA 5JS1A 4JS4A 2Z1IA 1C1BA 3OYNA 4CJEA 3SQ1A 4IG3A 1CXUA 1KCFA 4EP4A 3OYFA 3OYLA 4E89A 2JLEA 2YV0X 3AVLA 4DTXA 3MXMA 3V1OA 1L3VA 5SZTA
chains in the Genus database with same CATH superfamily
4CVNE 1X1PA 5JVHL 1KAZA 4OKEA 1TUYA 1LAWA 2D0CA 4CHPA 1VHXA 2A5XA 3EE9A 3W0LA 4EAHD 3MWPA 4H0TB 3OYDA 4N76A 3L2RA 4OGCA 1WSHA 5JICA 4B9LA 2YHXA 5KI6A 3HP9A 1RDUA 4WF9L 4A2AA 4E7IA 1EO1A 3WEEA 4JKAA 3RTVA 4CEEA 3K5OA 5M1PA 2YHWA 2EHGA 1KQSM 1OVYA 2RE2A 3UE5A 4DQRA 4DTNA 1NKCA 4Z4EA 1ZBIA 3D0PA 4ELUA 4HCBA 1ZXOA 4JI7K 4AHSA 4LSNA 4KO0A 3D7EO 3VETA 3R8EA 1A5XA 2QA4N 3CPWM 3FR0A 2QWPA 3AA4A 1DTQA 3WEEB 4YHHK 3NDKA 1Q9XA 1RT3A 4KB1A 3RR8A 2P5OA 1NJIO 1DLOA 3JXUA 2Q36A 3AVHA 4ID5A 4DV2K 4O8KA 1QSYA 4GMJB 4A2BA 1SS6A 1HNWK 5CZ2A 4Z4CA 3EO3A 1S9GA 2HBLA 2B5JA 3ZX0A 3WXMB 4K0KK 2BE2A 3GL1A 2CGJA 3VMFB 5BPNA 1NGBA 1XUPO 4J2DA 1D5AA 5AQFA 5BN8A 3KWGA 3L2UA 3H1QA 4XIUA 1KVAA 2I7NA 1KXPA 1BA0A 4DLEA 3DWLA 2HHSA 4LF9K 3VQ9A 4LF7K 2YKMA 3ATUA 2HHUA 3U6FA 5AFUA 2HNDA 3N4PA 2YNFA 5AQVA 3SUOA 3WXLA 1EWQA 3NGYA 5FPMA 5CHIA 4B9TA 5GAEP 4ZTJA 4ELVA 2ETJA 4DQPA 5LY3A 3IKMA 5ADXA 4CJ7A 4CHNA 5AQTA 1XNRK 4HTUA 3CJ9A 1BCMA 4CFDA 3MEDA 4I9LA 2IDOA 5AQKA 1HYSA 1L5UA 1RDWX 2D0PA 2YI1A 3O1WA 5JS2A 1SKWA 3M6GA 3VQ8A 3PV8A 3E01A 2FSJA 2QEXN 4ISFA 3AVKA 4CJ5A 3OYCA 4GW6A 3K9JA 4LSLA 4N41A 4FCYA 5DMRA 1CZBA 3T3FA 3BZKA 1WSFA 3P83D 4DR5K 3V9XA 1RBTA 3E66A 4OPJA 1Q82O 5GAGP 3VF2A 4OO1J 1RT2A 4CGDA 4HTLA 2W41A 4B9NA 3SAGA 4M3TA 1X9MA 2UU9K 3CXCM 4BREA 1VRTA 3T19A 4NYFA 4B1XB 4RWTA 2ZJQL 3KK3A 1HLUA 3HK2A 5FPEA 5CYQA 3TPQA 3HOSA 3SQ4A 2XO7A 3ULDA 3CJ1A 1NMNA 2NNWA 2FSNA 3VGMA 1JLGA 2EWSA 4CZHA 4HUEA 4BRGA 3WQUA 1RTDA 2KTQA 3O80A 4YOUA 3U4LA 1ZC6A 4F9OA 1XHZA 4WFNL 1NKBA 5EX5A 2KKZA 1XWLA 2DY4A 1RBVA 1B9FA 3QIPA 4PWDA 4PL8A 3BEXA 3CCSN 3G0ZA 4KHQA 4C23A 2HBMA 1EQYA 2E4LA 1VQ8N 3RRHA 1C1AA 4L8RB 4DTUA 5KRTA 4DQ8A 2CH5A 4JKEA 3NH2A 4FL9A 2YKNA 4DV3K 5AQSA 3HSCA 4ZHRA 1CXQA 2F9TA 4OPKA 3E1YA 3PX6A 3CHWA 4GVEA 2HNZA 3RVCA 3LWLA 4BR9A 1S6QA 1YHQN 5HRPA 2ITGA 4J2EA 2CGKA 3MN7A 1BQNA 2VGNA 5EXWA 3CQ8A 1BA1A 3GE1A 1VQPN 1RT6A 4G1QA 4JLHA 1ASVA 4FJLA 1BO5O 3FFKB 4I9QA 4KREA 3NFAA 2WTUA 4JS5A 4FJXA 4I6MA 3LP2A 4CBXA 4CW7B 2A1RA 4CJUA 1BHLA 4CHZA 2GEMA 2ZGYA 3MX2A 2Q0UA 3C65A 4CI6A 4H5NA 3V1QA 5A2QO 3SZ2A 3WQTA 1FKOA 2FLOA 1S9EA 3IDHA 3BP8A 1BDGA 3THVA 1G15A 2Q3SA 4C8LA 1HPZA 1LCUA 4IKFA 3HM9A 4B3OA 4AHUA 2QWMA 4ID1A 2VG6A 1B92A 4KI4A 3GG4A 4FOEA 4Y1CA 2RF2A 3OYAA 3CJCA 2RPIA 3SPYA 4AM7A 4RW9A 4FZXC 3PUFA 3AO5A 3HYFA 5EOYA 3CCEN 4BR2A 3THWA 2Z1GA 1ASWA 2OPQA 1JXEA 2E6LA 1QVFM 1IKWA 2GX9A 3F9MA 5F1XA 1UWBA 2HHQA 5GADP 1LWCA 3NGIA 3VQPA 3VF4A 2O8EA 3I8DA 2UUCK 2P9NB 5BRHA 3R6MA 3LAMA 4YOYA 2OCEA 3J7ZO 2E8AA 2A41A 2IVOA 3O4WA 3E9LA 4BR7A 2E20A 1G99A 4JI5K 1X9SA 3THWB 4JEPA 3Q7CA 1L3SA 2E2NA 4GVMA 4AM6A 5HRNA 1JCFA 3ITHA 2YNIA 3M5RA 3ZT3A 4IOXA 4H0OA 4H4OA 2GELA 1DGKN 1HYZA 1GLLO 5D3GA 4C1NK 4BE2A 3CCVN 3QERA 1NGJA 2D1KA 4J2BA 3EKUA 3U3GA 1QE1A 3SV4A 3V9UA 4KHWA 4MDAA 1D4XA 4CZLA 3TWHA 4NO7A 3HOTA 1QZ5A 4PY5A 4GY2B 3RSEA 3DRPA 4GV9A 2E1YA 3K2PA 2VWJA 4MDBA 1NK7A 3SCXA 4DR1K 3ID6A 1S3XA 4B9SA 4CK1A 2ZD1A 2P1JA 3TSQA 3LANA 4DV7K 1S1XA 3QBWA 2KZMA 3VESA 2ZJPL 4RW7A 3LPTA 4MO5A 2HVHA 3J81O 3AVFA 3RSEB 4KTWA 1X9JA 3WT0A 3IRXA 3MDQA 1S5JA 3MX5A 3I8BA 4LH4A 5E41A 4WFAL 2JGUA 2F9WA 4LFAK 4CGHA 1SL0A 4FO0A 4B08A 5KRSA 2V7YA 2OZMA 5M1QA 1VSDA 4B8CA 1W97L 2PBDA 2F4VK 3DI6A 2WUSA 4F8RA 4X66K 4EIAA 3K57A 4DSFA 3CETA 1LOTB 4F3OA 1QZ6A 1BI4B 1VSEA 4H5VA 1QHTA 2IC3A 3MN6A 4BR4A 1P90A 5C0YA 3WXIA 1VAZA 3ZSXA 3CYMA 4E7LA 1EETA 5AQGA 3D6RA 5M1OA 2Z1IA 1CXUA 3TAEA 4JK7A 1UA1A 2YV0X 2PFUA 3MXMA 3V1OA 1J5EK 4BY9C 1S22A 2ZWHA 3S9HA 4CIFA 4NLCA 1HJOA 5C42A 4HCCA 4CHOA 1ATNA 3LDOA 4BC3A 3BZCA 1TL3A 5F2RA 2PYJA 5IT9O 2QTDA 3LM2A 5AQXA 5JLFA 4OKJA 1CZ9A 1JLEA 1JLFA 1HKGA 1C0TA 3ZETA 4OPHA 1SV5A 5KPZA 1SQKA 3ZT4A 4PKHA 4K43A 1RCHA 2P51A 2E2PA 3TTFA 3IMXA 2YCHA 5AZIA 1GOBA 4CF9A 4YY3K 3I56N 3L6QA 4JV5K 1HNZK 2G8FA 2G8WA 3CIPA 1JL1A 1WUAA 1XHXA 3ZETB 3AV9A 1TKZA 1FK9A 4DSIA 4AHCA 3MCPA 3DLEA 5AZIB 2QK9A 2QM1A 2XY8A 3F73A 4BRPA 2BDPA 4FJGA 5HRRA 3A5OC 2D0OA 3SPZA 2YX6A 1TYQA 3RWUA 1IV0A 4BRAA 2QKBA 1FW6A 1T7PA 1EWRA 4TSXA 1J5OA 1IKYA 4CJVA 2E6MA 3O9SA 4JNEA 3ULEA 4M42A 1J53A 2Q31A 5DK5A 3LDQA 2ZJRL 4RW6A 3S3MA 4BRQA 3ZCMA 1YTUA 5HP1A 1HJRA 3PIPL 3VQ6A 4I2QA 4K8XA 1TYQB 3TTCA 1RDCA 1QQOA 1C0GA 4IZ9A 4NXNK 4YDUA 3A5NC 4X62K 1EXQA 3HSTB 1ZBHA 3AGRA 3ULEB 3NF9A 4CEAA 2ASOA 3DAWA 4XH5A 4KKOA 3EL2A 4M41A 2QXLA 4OKKA 3CC2N 3BF3A 1ZBUA 4NCGA 3W3DA 4JK8A 4CF8A 2P9LA 1U04A 3R3LA 1Q9YA 3VQ4A 3DLHA 3C6AA 3D45A 2IAJA 3ZSOA 4OX9K 3L2QA 1NJXA 3KVGA 3SUNA 1NNEA 5C2FA 3E9PA 1W0HA 4DV4K 1A5WA 4CJRA 4DMNA 3CFPA 3TARA 1LW2A 2QW9A 3CCMN 2X78A 4IO9L 3K0SA 3WNGA 3NF8A 3CCRN 3C7NA 2HF3A 4N56A 3L4IA 5GAHP 1VQMN 1MA9B 4FWNA 4JI4K 3EY1A 3L3VA 3VTHA 3LM9A 3H3OB 1DT9A 1P8ZA 5HL7L 4DB3A 3ENBA 3V4IA 3PLAA 4CF0A 2G8KA 4DSLA 1HNIA 2X74A 1YVUA 3C7NB 1YXQA 2Y1JA 3SQ2A 4IJAA 4O55A 4FZZA 1BISA 1C0MA 3O3FA 3OYMA 1QHAA 4BDZA 4BDPA 4KHSA 2H3GX 4LF4K 5AQIA 2WONA 3ZT2A 4J2AA 1REVA 4BACA 2KLAA 4C1NI 3VQBA 1VQ7N 4Z94A 3KLFA 1D9FA 3IAYA 2CH6A 4LC9B 4CGIA 1VK0A 3SBTA 4KAZA 4OLBA 3VERA 1VSJA 2GBZA 1JL2A 3LZJA 4M3RA 4B8AB 3SBGA 4H8KA 4CHQA 2FC0A 3NH0A 1NK8A 3TTDA 3V1RA 1IKXA 3SLCA 1VQ5N 3IFRA 1Q86O 1RDBA 3LPUA 2WC9A 3THYA 5GIPA 2W42A 4DTPA 4BVPA 4CE9A 1GOAA 4FOIA 1JLCA 4EZ6A 2VGMA 4KRFA 3OYKA 5M1FA 4DF4A 1NGHA 2HSTA 4OJRA 2Q1NA 2P9SA 3CC7N 4H0XB 2YHAA 4YFUA 1NK4A 3AGKA 1BQMA 1XC3A 4FJ8A 4QS7A 1B9DA 5LMNK 3PX0A 3RMBA 4CESA 3THYB 1TL1A 3PSIA 3EZ5A 1QQNA 3AO2A 3U8XA 3PY8A 1IG9A 2A42A 1D8YA 3J80O 3OVNA 1JLBA 3EE8A 1TK8A 2BH1A 2P9SB 4DQQA 5GINA 5KTQA 1TKTA 1JKHA 1V4SA 4W5QA 3O3HA 2RHKA 1JXBA 5AQPA 3H1VX 3FGUA 2X6NA 2E1ZA 4FWPA 4BC5A 3O08A 1JJ2M 3TAQA 3C94A 4JKDA 3DRRA 4CJQA 3FZKA 1Q18A 3OYEA 5I42A 3U3YA 1HRHA 2F8SA 4PKIA 4L3QA 4FLVA 2NRXA 2Y1IA 4M7YA 3DOKA 3T1YK 3SJHA 4Q0BA 1K9MO 4IOCL 3LWMA 1ZBFA 3G25A 1E3MA 1KAXA 5J2MA 1T8EA 1BUPA 5AQNA 2WFBA 4CCHA 2ASMA 4O44A 3NBPA 3NGZA 4FWLA 3QEPA 5JVGL 3O9RA 3U9DA 2PY5A 2GUPA 3ZLJA 4NXMK 3FZMA 2OZSA 1RT1A 4BG9A 4CERA 2AP1A 4IFYA 4CZFA 3TAFA 4B3MK 3VEXA 1GLFO 2OTLN 1R0AA 4NYNA 1IBKK 3R9PA 3HVRA 4FJIA 5C10A 3IUCA 4YNQA 2B6AA 1L3UA 4H5WA 2OYQA 3CQXA 3VQQA 3TR8A 5KQDA 4JI0K 3P31A 3PO4A 4KHUA 5C2DA 3VF6A 4FWQA 4H0PA 3WUHA 1KFSA 1YVNA 1T6CA 1OH5A 4PA1A 1NJYA 3OS2A 3TAPA 2Q97A 4Z4HA 1RBSA 2HF4A 3FZHA 5EVZA 3CMAN 5BRDA 3DLGA 5BN9A 3ASMA 4V19S 4W5TA 4NB4A 4WCEL 4DS5A 4DU3A 4DV1K 4DU1A 1NBWA 5AZJA 1EKEA 3AO3A 4DR3K 4AHRA 1GLBG 4FJJA 4CD1A 5DM7L 4DQSA 2E5LK 4FM0A 4CHYA 5MLCQ 3CMEN 4WYBA 1NK0A 4FWOA 3G6EN 2F8TA 5C15A 3VEOA 1QTMA 2ZF5O 2QI2A 3B6OA 1U6ZA 4A59A 2IVNA 2YJFA 1IO2A 5AZJB 3DLRA 3DLKA 2KW4A 3HZ6A 1SL2A 1XNQK 3CCLN 3MN5A 1VQ6N 1XMQK 3CCUN 3AY9A 3T1AA 1ZBSA 5LJVA 5DM6L 4JYAK 4BR0A 4CJTA 1GLJO 3CQYA 3O4NA 4FLTA 2VWBA 4FJMA 2KHOA 5E26A 3AARA 3HRGA 4A61A 4PQUA 3ZSVA 1Z6RA 2PAVA 4IJNA 1N36K 3OA9A 3VEZA 2O8FA 2D5RA 1MWKA 4O0JA 1YAGA 1LWEA 4YOVA 3O1BA 5I9EB 4QCLA 3DMJA 4FLZA 3SMSA 3A2FA 2OPRA 3G10A 3FLCO 4KHPK 1K73O 5HBMA 1NGEA 1TUUA 3QEXA 2P9IA 3VTIA 2O8FB 1S6PA 3UKUA 4DU4A 2IVPA 4FW2A 3IG1A 3UB5A 1SKRA 1NGIA 4DG1A 3WXKA 4NLBA 1S1VA 4C8KA 4AHVA 3C6UA 4CJWA 3SAHA 4DTRA 1XQSC 3CF5L 1ITGA 4JKCA 4A62A 3HO1A 3D2FA 3EKSA 1X3NA 2P9NA 1C1BA 2P9IB 3OYNA 4CJEA 3SQ1A 4CZJA 5AQMA 4EP4A 1KCFA 4A5BA 3OYFA 3UKUB 2JLEA 4IEIA 2BANA 2FBVA 4B9QA 3BY5A 3QINA 4MQ3A 4N47A 3NH1A 3ATVA 4YOTA 3HPGA 2A1SA 4U7BA 3VQAA 3D2FB 3AAPA 2G8HA 4JRQA 1OKJA 2GWJA 3UIQA 3HP6A 3QEIA 3KLEA 3KK7A 4MLHA 1Q8IA 2NRWA 3HL8A 1K6YA 3VGKA 4E7JA 4FLUA 3MEEA 3TI0A 1NOZA 1VQ9N 4FK0A 2HHHK 4KTZA 5AQLA 4ZTFA 1K8AO 4DR4K 3V81A 3CM5A 4FJKA 3VQDA 1KVBA 4CEFA 1BWFO 3DRSA 4XEIA 2P9PA 4FJNA 3OW2M 3LP0A 5T7BA 4UQGA 3MAQA 4F2SA 1YIJN 1LW0A 4FXDA 4K42A 3AA5X 4JKBA 4X65K 4E1MA 4CEQA 5CZ1A 4YOWA 1SL1A 4OGEA 5KPTA 3LDPA 3O4QA 4RG8A 2P9PB 1IG8A 2ZQBA 4H5TA 3HVTA 4HWIA 4O5BA 4C8OA 2HHVA 4F2RA 4E7KA 4B1YB 1W9HA 3SAFA 1NGFA 2DTUA 4EHUA 1NOYA 4DQIA 3SK3A 4XH1A 1I3AA 4BRIA 2IS3A 4BRHA 5I3UA 1Q81O 3SQ0A 1YJWN 3FZLA 4MO4A 1BI4A 5IWAK 4K8ZA 2O4IA 2VQEK 3AVNA 4BRLA 1BU6O 4OPAA 2Z1HA 1NKEA 4R79A 2OA8A 4IOAL 1QQCA 3K5LA 3HXMA 1XMOK 4HHTA 5AQOA 3ZX3A 3A8YA 1NMDA 1M1KO 4ISEA 1C0FA 3QICA 1TK0A 1TKDA 3AVBA 1KTQA 2O8DA 4CJ4A 4FWRA 2GV9A 3LALA 3T1HK 3C6HA 3ZSYA 5EU7A 3NHGA 3MXJA 5FRNA 4WQ5C 2OPSA 3WNEA 4DFMA 2BUPA 1V4TA 4WQ4C 3KD5E 2ITMA 4FVMA 5KGXA 3VA0A 3B8AX 5AQQA 3RRGA 1NU0A 3QNNA 1GLDG 4GNIA 2UXCK 1F21A 3H45C 4E7HA 2O8DB 4M7XA 4DWIA 3HTVA 1VRUA 1DEJA 4H5RA 4H0YB 3V9SA 1RDDA 2FXUA 3KZBA 3VEVA 2HBKA 4DF8A 4BRMA 1KVCA 4JD2A 4RTFD 3AVCA 5KPRA 1HYVA 2NRHA 2NRZA 4GKJK 1U2VA 2VG5A 3NF7A 4CZMA 4DUYK 5J2QA 1J54A 3KIOA 1U48A 5J1EA 4R5PA 3QEVA 5HROA 3FZFA 2HW3A 2NRTA 4JD2B 2D4WA 4EP5A 2P5GA 1ASUA 2HVIA 4DKWA 3GOIA 3T69A 1T3VA 1U2VB 3OY9A 4NCBA 4Y0WA 1Y97A 1HNVA 2OTJN 4RW4A 4M3YA 1MDUB 4W5RA 1HQUA 4IDKA 5F0XA 1VQ4N 3QESA 4ISGA 4CEBA 5J2NA 2X6SA 4CGFA 1NK5A 4CBWA 4EZ9A 4CEOA 2R7YA 3HPHA 1D9DA 1KAYA 1LWFA 3ZT0A 1WAJA 4CIGA 3O6WA 3OYIA 3O5BA 2HB5A 2D0AA 3O3GA 4FJ9A 1MU2A 2OPPA 2W6LA 1BGXT 1WBBA 3O9TA 5CY4A 3MN9A 3NMUA 5AFUH 3CFRA 2NLXA 2G8UA 3QB0A 4G9ZA 2EX3A 3ZX2A 4FM2A 1RTIA 3K5MA 4LF6K 2LSNA 5FDLA 1WSEA 4FZYA 3NE6A 1UAXA 4CECA 2IOCA 4B3RK 1YTAA 4WQ5A 3OS0A 2E2QA 3KHYA 5ADXH 1JLQA 2WOMA 1T44A 4WQ4A 5C12A 3O8MA 4M3XA 2FBTA 3THXB 1RILA 3S3NA 5FPNA 2Z1JA 2WBNA 3ID8A 4BE1A 4DFJA 1IBMK 2QWNA 5CYMA 3CCQN 1U4BA 3H46O 4B1VA 4CBUA 3P4IA 3VEWA 1YI2N 2UXDK 5H1SQ 3EZWA 3SUQA 2AA4A 1BL3A 3CFOA 1O13A 4E19A 2HHTA 5EY4A 4DSJA 1X3MA 2E2OA 4DS4A 4JHDA 4RCHA 4BG8A 4FLXA 4M3WA 4CF2A 5BPMA 4CGGA 2UUBK 1JCEA 1GLEG 1WLJA 3FFIA 3Q7BA 2V7ZA 3F9KA 5FLXO 4DFPA 4O5FA 4GV6A 3T7ZA 1U45A 4FSVA 5BRFA 3ZSZA 4AQYK 1Z05A 2JWLA 5LL6Z 3VQCA 3VGLA 4JHDB 1EP4A 2V51B 3OYHA 5AQWA 3GBTA 3UKRA 4JKHA 5HLFA 3LZIA 4YORA 3LDSA 1RTHA 1RBUA 3A5LC 3P5JA 3TAGA 3LP1A 4FLWA 1TVRA 3OTOK 3S3OA 1W2BM 4W5NA 1VQON 4M3ZA 3M1FA 1T05A 4UY8O 1N32K 4ELTA 1R59O 3UKRB 4E0DA 1KLMA 1RT4A 2O8CA 1NK9A 1LAVA 2ZE2A 3AO4A 1K8KA 4DUZK 4AF1A 3A0IX 3CCJN 1ILYA 4C8MA 4CFCA 2O8BA 1FJGK 5KQ8A 4CEZA 3OHRA 3EYZA 3TSUA 3MMVA 1O1WA 2FF6A 3L3UA 2UYTA 4O8UA 2O8CB 4DSEA 4LF5K 1WB9A 1KLNA 3VN5A 4HUFA 1K8KB 4E1JA 3QDKA 4RW8A 3HT3A 3GDQA 3LL3A 4X64K 4CF1A 2KZZA 2O8BB 4B3TK 4DTMA 3QFUA 1FKPA 1HMVA 4Z4GA 1YJ9N 2FBXA 3NF6A 3KTQA 1RGIA 4JKFA 4CEDA 4DV6K 4M63C 2ZM6K 1I39A 2KQ2A 3ZYYX 4BRNA 3AVMA 2E88A 3ZSWA 4DTOA 1NJZA 3CJ7A 4FK2A 5B8HA 4Z4IA 2I5JA 1RTJA 2YNGA 4KPYA 4FJ7A 1SUQA 4O4GA 4KFBA 4FVUA 1XC9A 4O0IA 3JS6A 3PO5A 5BREA 1DKGD 4CK3A 3OYJA 4BWJA 3B6PA 3J7AP 4B1ZA 5C25A 1HNXK 2DFEA 4J8FA 1CLQA 1QSLA 4DR6K 4JI2K 3KK1A 1TGOA 1WSIA 4CIEA 3ISNC 3CJAA 3AA2A 2OANA 3PIOL 3HPOA 3SUPA 1N5YA 4LD0A 1KRPA 1OH7A 1NM1A 2VG7A 1NGDA 3SMPA 5J2PA 1T03A 3OBYA 1IKVA 4FPAA 2CGLA 2A6AA 5FROA 4W5OA 3DLLL 4B9MA 4FPBA 3L4QA 3TSPA 3K9KA 4CGJA 3VEYA 4BROA 3TAMA 4QS8A 5TKWA 1E4FT 3AVLA 2NZTA 1L3VA 1W7AA 3QEWA 4KH4A 4BGBA 1YITN 3G4SN 4CK2A 2P9UA 1YUWA 4DHYA 1S72N 1OH6A 4IFEA 1JCGA 3MEGA 2BGGA 1NGGA 1SZ2A 4HUGA 3MK6A 3WNHA 1M90O 1N6QA 3J8AA 4YOXA 4H03B 2ZGZA 1H1VA 3NVKA 2QWQA 3AVGA 1UA0A 3SYZA 1FXXA 1IH7A 4EHTA 4DLGA 2P9UB 3SI6A 3O9QA 3DXMA 4CD3A 1BIZA 2VQFK 1VSHA 4BE0A 4AH9A 3RR7A 3KLIA 1KD1O 4BRDA 4CZIA 1CZAN 4KHNA 3K59A 5ELZA 3CI5A 1ZYQA 1QQMA 2YHBA 1QS4A 5SWMA 3DXMB 4A57A 4FM1A 3J7YP 3EEQA 4PL7A 4B9VA 1WBDA 2G8IA 4EFHA 3KKRA 3C0BA 4BWMA 4AILC 1GLAG 3VQ5A 3L2VA 4DV5K 2IIRA 4F4KA 4FK4A 4K41A 4B1UB 4KB0A 3DLBA 2VWKA 3HJFA 4IG0A 1KFDA 5AQZA 2XHBA 3V9ZA 4LY7A 1KSPA 3V6DA 1S1UA 2ATQA 1TAUA 2YNHA 2DFFA 3K58A 2B4JA 3AAQA 4CZKA 3NCIA 3G71N 2HMIA 3KWIA 5M1NA 4KV8A 1LV5A 3I0RA 1Q7YO 2J4RA 2JWKA 3H08A 1A5VA 4WE1A 4FLYA 4ILGB 1HKBA 2PYLA 1HQEA 3OBWA 4CFBA 4MLEA 4FW1A 4WFBL 3QFPA 4N5SA 4BGAA 3E9OA 3WNFA 4Z0UA 2W40A 3KJVA 1NK6A 4CZEA 3AVIA 4IEEA 3VA3A 1VSLA 3HI0A 4KBOA 3S41A 4FWMA 5KGWA 4H4MA 2YJEA 3AVJA 1N34K 4AHTA 3SJJA 3CG7A 1U47A 2GWKA 5JLHA 5K14A 1N8RO 1IJJA 3PX4A 4I6MB 3L2WA 3P38A 4CJKA 2I7PA 3JYTA 2NRVA 3ZSQA 2QKKA 2XRIA 5AQUA 3C6TA 3M8SA 3BUZB 5LMUK 4ILHA 3V9WA 4JI8K 4GKKK 1HX1A 4OVLA 1L3TA 1Z26A 4DTJA 4DCHA 4LFBK 3TU5A 3QIOA 5FRMA 1WSGA 4QOZB 1ESVA 1WNSA 4FWSA 4CJ3A 3F2KA 3CD6N 3AO1A 1QSSA 1TV6A 3I0SA 4BR5A 4JI3K 1RBRA 4BRCA 4JK9A 4XH4A 1IBLK 1VQNN 3KLHA 2RN2A 3K5NA 1YF5L 4DTSA 4DFKA 1WN7A 5AJ3K 3VPZA 4FJ5A 3ENHA 4KH5A 3CJBA 2Q2RA 5HOOA 1TAQA 3DJCA 5E84A 4ICLA 5BR9A 2O8EB 1BG3A 4KH6A 4IFVA 3DXKA 4I2PA 1T6DA 2HNYA 2KFNA 3F5TA 4FWKA 3OJUA 4ILJA 4C8NA 1UOCA 3QMLA 2QWRA 1C1CA 3M3ZA 1U49A 3CERA 4BC2A 3M8PA 4BQLA 2V52B 4GV3A 5CR4A 2A40A 4FJHA 2FSKA 3DXKB 3SV3A 3EN9A 3HM8A 1I94K 1DTTA 2HHWA 1SAZA 2F7TA 2HMPA 3DOLA 4LH5A 2DPNA 4PKGA 1N33K 1YJNN 4KTQA 2BTFA 2FF3B 1VQKN 1C0UA 4B9UA 3OS1A 1J6ZA 5JMVA 1EX4A 5M1KA 4M3UA 2RKIA 2XY6A 1RT7A 4QS9A 3NVMA 4DV0K 2NUBA 3JAMO 2G8VA 4KHYA 2Q0RA 2FBYA 3H3NO 3SNNA 3KKSA 1C6VA 3I33A 2YHYA 3PSFA 4Y1DA 4JI1K 3I55N 4CJPA 4IWVA 1Y64A 2KFZA 3RMCA 1S1TA 3OJSA 1VSKA 3RMAA 4B3SK 4CJSA 4CJFA 3ENOA 4NCAA 4PUOA 3TABA 4YDUC 5AQJA 3ZEUA 3KLGA 4Z4FA 1RFQA 3MECA 2D0BA 1X9WA 2IGIA 3OYBA 1RNHA 3H6EA 5C24A 1QVGM 1YT3A 4I7FA 4JN4A 1GOCA 4DSKA 3QLHA 2O4GA 1VSMA 3VQ7A 2AJQA 1ATRA 4FYDA 4LFCK 3ZEUB 3JSMA 3QNOA 4JI6K 1NLVA 4LF8K 2QWLA 3O9UA 3C95A 2HBJA 5AR0A 3DM2A 4IBNA 2ASPA 1RT5A 4QAGA 1BOTO 1VQLN 3AVAA 5TKYA 1NGCA 3LDLA 1WOQA 5GIOA 3NAEA 2HOEA 4H0VB 3LDNA 3MWTA 1KC8O 1TK5A 2A3ZA 4IDHA 3LAKA 1SKSA 3CM6A 1BIUA 1NWKA 2VYPA 3HBTA 3CC4N 1TKXA 3U9ZA 5FPDA 4DR2K 3R1XA 2DFHA 3L0QA 5LJWA 4BC4A 1NJWA 3BGRA 4PHTX 4JRPA 5AQYA 1XI1A 2QXFA 3L8BA 1JLAA 1HUXA 3TANA 4BDYA 3THXA 3MXIA 2UXBK 3DYAA 1OH8A 4JKGA 1J9AA 4CZGA 1WSJA 2P9KA 1RDAA 3LP3A 3FE1A 1BCOA 3WXJA 3M8RA 2GTDA 3KD1E 4F3TA 1HR0K 2UUAK 4IO8A 3AA3A 3BDPA 4IXCA 4HVJA 3A5MC 4M45A 3N4QA 4E1NA 4BRFA 1ATSA 3ZSRA 4U67L 5BR8K 4JKGB 5AQHA 1Z25A 2P9KB 3QBXA 1S1WA 4A5AA 5HRSA 1VSIA 1VSFA 4JAXA 2GUIA 3ALYA 4K25A 3KK2A 1WAFA 1NGAA 4Q5VA 2NRRA 3P1GA 3ZT1A 3D2EA 4BRKA 4KI6A 3OYGA 4BVOA 2F96A 1HPMA 4MFBA 3VQEA 3P39A 4BQZA 1GLCG 1MWMA 5BPLA 2XY7A 4B1WB 3QO9A 4CJLA 4OLAA 3BF1A 3RMDA 1OVQA 1ZBLA 2W6KA 5AQRA 2PZSA 5CE3A 4E3SA 3CPEA 3IS9A 3D2EB 4CFAA 3M8QA 2VCPA 3QETA 2XY5A 2QWOA 2HHXA 5JS1A 4JS4A 1E4GT 3VENA 1NG9A 2P9LB 3VOVA 4IG3A 4DR7K 3MCAB 3OYLA 4E89A 4DTXA 1HKCA 5SZTA
chains in the Genus database with same CATH topology
2BANA 2FBVA 3QEWA 3S9HA 4CIFA 1X1PA 3QINA 5C42A 4MQ3A 4OKEA 4HCCA 4N47A 4CK2A 4CHOA 2D0CA 1LAWA 4CHPA 3NH1A 3HPGA 1TL3A 2PYJA 2A1SA 3OYDA 4N76A 3MEGA 2BGGA 4HUGA 4OKJA 3VQAA 4OGCA 3L2RA 1CZ9A 2G8HA 1JLEA 1JLFA 1WSHA 3WNHA 4JRQA 5KI6A 4B9LA 1C0TA 3HP9A 3HP6A 3QEIA 1N6QA 3UIQA 3KLEA 1Q8IA 3HL8A 4E7IA 1K6YA 1SV5A 4E7JA 4FLUA 3MEEA 3RTVA 3AVGA 3K5OA 4CEEA 1NOZA 2EHGA 3TI0A 3ZT4A 3SYZA 1UA0A 4FK0A 1RCHA 1FXXA 1IH7A 2P51A 4KTZA 4DLGA 4ZTFA 4DQRA 4DTNA 3SI6A 1GOBA 4CF9A 1NKCA 4Z4EA 1ZBIA 1BIZA 3D0PA 4ELUA 3V81A 1VSHA 4HCBA 4BE0A 3CM5A 4AHSA 4LSNA 1KVBA 3VQDA 4AH9A 4KO0A 4CEFA 3RR7A 4FJKA 2G8FA 2G8WA 3DRSA 1JL1A 1A5XA 1XHXA 3KLIA 3AV9A 1TKZA 1FK9A 3AA4A 4FJNA 4KHNA 1DTQA 4DSIA 3LP0A 5T7BA 3NDKA 3K59A 4AHCA 4UQGA 1RT3A 3MAQA 1Q9XA 4KB1A 3RR8A 2P5OA 3DLEA 1ZYQA 4F2SA 2QK9A 2YHBA 1LW0A 1QS4A 5SWMA 2XY8A 4FXDA 1DLOA 3AA5X 3AVHA 3F73A 4FM1A 4ID5A 4E1MA 2BDPA 4FJGA 4CEQA 5CZ1A 1QSYA 4GMJB 5HRRA 4B9VA 3SPZA 3RWUA 1SL1A 4OGEA 5CZ2A 4Z4CA 3O4QA 2G8IA 2QKBA 4RG8A 1S9GA 2B5JA 2ZQBA 3KKRA 3HVTA 1T7PA 4TSXA 4O5BA 1J5OA 4BWMA 4AILC 4C8OA 1IKYA 4CJVA 2E6MA 4F2RA 3VQ5A 4E7KA 4M42A 2HHVA 3L2VA 1J53A 5DK5A 2BE2A 1W9HA 4RW6A 4F4KA 4FK4A 3S3MA 3ZCMA 2DTUA 1YTUA 5HP1A 4J2DA 1NOYA 1HJRA 4DQIA 4KB0A 1D5AA 2VWKA 3DLBA 3HJFA 3VQ6A 4IG0A 1KFDA 4I2QA 4K8XA 3L2UA 2XHBA 3V9ZA 1I3AA 1RDCA 2IS3A 4LY7A 1KSPA 4XIUA 3V6DA 1KVAA 1S1UA 2ATQA 1TAUA 5I3UA 4DLEA 3SQ0A 1BI4A 4K8ZA 2O4IA 3VQ9A 2HHSA 2YKMA 2YNHA 1EXQA 3HSTB 1ZBHA 2DFFA 3K58A 3AVNA 2HHUA 2B4JA 3NF9A 4CEAA 3U6FA 2HNDA 3NCIA 2YNFA 2HMIA 4KKOA 4M41A 2Z1HA 4KV8A 3SUOA 4OKKA 1NKEA 1LV5A 3I0RA 2OA8A 3NGYA 1ZBUA 4NCGA 3H08A 1QQCA 1A5VA 3K5LA 3HXMA 4HHTA 4CF8A 4B9TA 4WE1A 4FLYA 4ZTJA 4ELVA 1U04A 2PYLA 1Q9YA 2ETJA 1HQEA 4DQPA 3VQ4A 3DLHA 3D45A 2IAJA 3ZSOA 1TK0A 3L2QA 4CFBA 4CHNA 1NJXA 4FW1A 3SUNA 4HTUA 1TKDA 4CFDA 1BCMA 3AVBA 1KTQA 4N5SA 5J2NA 3MEDA 4I9LA 2IDOA 4CJ4A 1HYSA 1L5UA 2GV9A 3WNFA 3LALA 5JS2A 1SKWA 1W0HA 4Z0UA 3ZSYA 3KJVA 5EU7A 1NK6A 3NHGA 1A5WA 3MXJA 3AVIA 3VQ8A 4DMNA 4CJRA 3CFPA 3PV8A 2OPSA 5FRNA 3VA3A 3E01A 3TARA 1LW2A 3AVKA 4CJ5A 1VSLA 3OYCA 2X78A 4GW6A 3WNEA 4DFMA 3WNGA 3NF8A 4LSLA 4N41A 3KD5E 5KGWA 4FCYA 4H4MA 5DMRA 4FVMA 5KGXA 3VA0A 3RRGA 1CZBA 3T3FA 3AVJA 4AHTA 4N56A 3QNNA 1WSFA 3P83D 3CG7A 3SJJA 3EY1A 1U47A 3V9XA 1F21A 1RBTA 4E7HA 5K14A 4OPJA 4DWIA 3PX4A 1VRUA 3L3VA 3L2WA 4CJKA 3V9SA 1RDDA 1RT2A 3ZSQA 4CGDA 3JYTA 2QKKA 2XRIA 3C6TA 3M8SA 3V4IA 4CF0A 3V9WA 2G8KA 4B9NA 4OVLA 1L3TA 1Z26A 4DF8A 1HNIA 4DTJA 3TAEA 1UA1A 2X74A 1YVUA 3SQ2A 4M3TA 3QIOA 1KVCA 2Y1JA 4O55A 1X9MA 4FZZA 1BISA 1C0MA 1WSGA 1VRTA 3T19A 3AVCA 3O3FA 3OYMA 4BDZA 4BDPA 4QOZB 4NYFA 1WNSA 4KHSA 4CJ3A 1HYVA 2WONA 3AO1A 3ZT2A 3KK3A 2VG5A 3HK2A 1QSSA 1TV6A 3I0SA 3NF7A 5CYQA 1REVA 5J2QA 4BACA 4J2AA 1J54A 1RBRA 3SQ4A 2XO7A 3VQBA 3KIOA 3KLFA 3ULDA 1U48A 3KLHA 1D9FA 3IAYA 5J1EA 2RN2A 4CGIA 1VK0A 4R5PA 3K5NA 3QEVA 5HROA 4KAZA 4DTSA 1JLGA 4DFKA 4OLBA 2HW3A 1VSJA 2GBZA 4HUEA 1JL2A 1WN7A 4EP5A 3LZJA 2P5GA 4FJ5A 1RTDA 1ASUA 4M3RA 2KTQA 4B8AB 2HVIA 4H8KA 4CHQA 1TAQA 2FC0A 3NH0A 3OY9A 1NK8A 4NCBA 1Y97A 3V1RA 1HNVA 4ICLA 1IKXA 1XHZA 1NKBA 4IFVA 4RW4A 4I2PA 4M3YA 1RDBA 3LPUA 2HNYA 4W5RA 2W42A 1HQUA 4IDKA 2KFNA 1XWLA 4DTPA 3QESA 2DY4A 1RBVA 4CEBA 3OJUA 2X6SA 4CGFA 4CE9A 1B9FA 1GOAA 1UOCA 3QIPA 4C8NA 1NK5A 4CEOA 1JLCA 4EZ9A 4EZ6A 1C1CA 2R7YA 4PWDA 3HPHA 1D9DA 1LWFA 3ZT0A 1U49A 4KRFA 3OYKA 1WAJA 4CIGA 4DF4A 3OYIA 2HB5A 2D0AA 4OJRA 3G0ZA 4KHQA 3M8PA 2YHAA 3O3GA 4FJ9A 1MU2A 2OPPA 2E4LA 4YFUA 1BGXT 1NK4A 1BQMA 3RRHA 1C1AA 4L8RB 4FJ8A 4DTUA 1B9DA 5KRTA 3PX0A 4FJHA 5CY4A 3SV3A 3CFRA 3RMBA 4CESA 2G8UA 1DTTA 3NH2A 2YKNA 2HHWA 2EX3A 4ZHRA 1CXQA 4OPKA 1TL1A 4FM2A 1RTIA 3EZ5A 3K5MA 2LSNA 3AO2A 3DOLA 1WSEA 5FDLA 4LH5A 3PX6A 3NE6A 1UAXA 1IG9A 4CECA 1D8YA 3PY8A 4FZYA 2IOCA 3OVNA 1JLBA 1TK8A 2HNZA 1YTAA 3LWLA 4KTQA 3OS0A 4DQQA 1C0UA 1S6QA 3OS1A 5HRPA 1TKTA 5KTQA 1JKHA 1JLQA 4B9UA 4W5QA 2ITGA 4J2EA 2WOMA 1EX4A 3O3HA 1JXBA 1BQNA 3CQ8A 4M3XA 2X6NA 2FBTA 4M3UA 1RILA 3S3NA 1RT6A 2Z1JA 4G1QA 4BE1A 2RKIA 4DFJA 3C94A 3TAQA 5CYMA 4JLHA 3DRRA 4CJQA 2XY6A 1U4BA 1ASVA 1RT7A 3OYEA 5I42A 3U3YA 4FJLA 4I9QA 1HRHA 2F8SA 4KREA 4FLVA 2NUBA 3NFAA 3SUQA 2G8VA 2Y1IA 4KHYA 1BL3A 3CFOA 3DOKA 2FBYA 4JS5A 3SNNA 3KKSA 3LP2A 1C6VA 4FJXA 4Q0BA 4E19A 4Y1DA 2A1RA 3LWMA 2HHTA 1ZBFA 4CJUA 1BHLA 4CHZA 4DSJA 5J2MA 4CJPA 2KFZA 3V1QA 1T8EA 3RMCA 4DS4A 3SZ2A 1S1TA 3OJSA 1VSKA 3RMAA 4FLXA 4M3WA 4CJSA 4CF2A 4CCHA 4O44A 4CJFA 3NBPA 1FKOA 3NGZA 1S9EA 4CGGA 3QEPA 2PY5A 4NCAA 3TABA 4PUOA 1WLJA 3FFIA 3THVA 1G15A 2Q3SA 4C8LA 1HPZA 3F9KA 3KLGA 2OZSA 4IKFA 3MECA 1RT1A 3HM9A 4DFPA 4Z4FA 4B3OA 4CERA 3TAFA 4IFYA 4AHUA 1U45A 2D0BA 1X9WA 2IGIA 3OYBA 1RNHA 4NYNA 1R0AA 4ID1A 5C24A 3ZSZA 2VG6A 3HVRA 1B92A 3VQCA 4FJIA 1YT3A 4I7FA 4KI4A 1EP4A 4YNQA 2B6AA 4Y1CA 1L3UA 2RF2A 3OYAA 2OYQA 3VQQA 2RPIA 3OYHA 3SPYA 1GOCA 4DSKA 3TR8A 4RW9A 4FZXC 3PUFA 3QLHA 2O4GA 1VSMA 3AO5A 3VQ7A 2AJQA 3HYFA 4FYDA 5HLFA 3PO4A 4KHUA 2Z1GA 1ASWA 3LZIA 2OPQA 5FRMA 1JXEA 2E6LA 3JSMA 1KFSA 3LDSA 1IKWA 1RBUA 1RTHA 3P5JA 3QNOA 1UWBA 2HHQA 3NGIA 1LWCA 3VQPA 3TAGA 3I8DA 3LP1A 4FLWA 4PA1A 1TVRA 3C95A 3S3OA 1NJYA 3OS2A 3LAMA 4W5NA 3TAPA 3DM2A 4IBNA 1RT5A 4QAGA 4M3ZA 1T05A 4Z4HA 1RBSA 4ELTA 4E0DA 3AVAA 1X9SA 1KLMA 1RT4A 3DLGA 1NK9A 1LAVA 1L3SA 3ASMA 5HRNA 2ZE2A 4GVMA 4W5TA 3NAEA 4DS5A 4DU1A 4DU3A 3ITHA 2YNIA 3AO4A 1TK5A 3ZT3A 1EKEA 3AO3A 4AHRA 4C8MA 4CFCA 4FJJA 4DQSA 3LAKA 4H4OA 4FM0A 1SKSA 3CM6A 4CHYA 1BIUA 1HYZA 4CEZA 1NK0A 5D3GA 2F8TA 4BE2A 3EYZA 1O1WA 1TKXA 3QERA 3L3UA 2DFHA 1NJWA 1QTMA 4DSEA 3B6OA 4J2BA 3BGRA 3U3GA 1QE1A 1KLNA 3SV4A 3VN5A 4JRPA 4HUFA 3V9UA 1XI1A 4KHWA 2QXFA 1IO2A 4RW8A 1JLAA 3HT3A 3L8BA 3TWHA 4PY5A 3DLRA 3DLKA 4CF1A 3TANA 2KZZA 4BDYA 2KW4A 3DRPA 3MXIA 1SL2A 3DYAA 4DTMA 3K2PA 1FKPA 1HMVA 2VWJA 4Z4GA 1NK7A 3SCXA 2FBXA 3NF6A 3KTQA 1J9AA 1WSJA 1RDAA 3T1AA 3LP3A 4CEDA 4B9SA 1BCOA 4CK1A 1I39A 2ZD1A 2KQ2A 2P1JA 3LANA 3M8RA 1S1XA 4CJTA 3KD1E 2KZMA 4F3TA 3AVMA 3O4NA 4FLTA 3ZSWA 4DTOA 1NJZA 4FJMA 4FK2A 4Z4IA 3AA3A 3BDPA 4RW7A 3LPTA 2I5JA 4M45A 4HVJA 4PQUA 2HVHA 1RTJA 3ZSVA 2YNGA 4E1NA 3AVFA 4KTWA 3IRXA 4KPYA 4FJ7A 2D5RA 3ZSRA 1SUQA 4O4GA 4KFBA 1XC9A 1S5JA 4O0IA 1Z25A 4O0JA 4LH4A 5E41A 3PO5A 1LWEA 1S1WA 2JGUA 4CK3A 5HRSA 3DMJA 1VSIA 4CGHA 1VSFA 1SL0A 3OYJA 4QCLA 4FLZA 2GUIA 4BWJA 3A2FA 3ALYA 4B08A 2OPRA 5KRSA 3G10A 3KK2A 2OZMA 3B6PA 1WAFA 4Q5VA 3P1GA 3ZT1A 5C25A 2DFEA 1VSDA 4KI6A 1CLQA 1QSLA 3OYGA 4B8CA 3KK1A 2F96A 5HBMA 4MFBA 3VQEA 3QEXA 1TGOA 3DI6A 4F8RA 2XY7A 1S6PA 1WSIA 4CIEA 3ISNC 3QO9A 4CJLA 3AA2A 3K57A 3HPOA 4DSFA 4DU4A 3SUPA 1N5YA 4LD0A 1KRPA 4F3OA 4OLAA 4FW2A 2VG7A 1BI4B 3RMDA 3IG1A 1SKRA 4DG1A 1ZBLA 4DSLA 1VSEA 5J2PA 1T03A 1S1VA 4C8KA 4AHVA 1QHTA 2IC3A 3C6UA 1IKVA 4CJWA 2PZSA 5FROA 4W5OA 4DTRA 4B9MA 4E3SA 3IS9A 3ZSXA 4CFAA 1ITGA 3HO1A 3M8QA 3CYMA 4E7LA 4CGJA 3QETA 1EETA 2XY5A 2HHXA 3TAMA 5JS1A 4JS4A 2Z1IA 1C1BA 3OYNA 4CJEA 3SQ1A 4IG3A 1CXUA 1KCFA 4EP4A 3OYFA 3OYLA 4E89A 2JLEA 2YV0X 3AVLA 4DTXA 3MXMA 3V1OA 1L3VA 5SZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BAN A;  2FBV A;  3QEW A;  3S9H A;  4CIF A;  1X1P A;  3QIN A;  5C42 A;  4MQ3 A;  4OKE A;  4HCC A;  4N47 A;  4CK2 A;  4CHO A;  2D0C A;  1LAW A;  4CHP A;  3NH1 A;  3HPG A;  1TL3 A;  2PYJ A;  2A1S A;  3OYD A;  4N76 A;  3MEG A;  2BGG A;  4HUG A;  4OKJ A;  3VQA A;  4OGC A;  3L2R A;  1CZ9 A;  2G8H A;  1JLE A;  1JLF A;  1WSH A;  3WNH A;  4JRQ A;  5KI6 A;  4B9L A;  1C0T A;  3HP9 A;  3HP6 A;  3QEI A;  1N6Q A;  3UIQ A;  3KLE A;  1Q8I A;  3HL8 A;  4E7I A;  1K6Y A;  1SV5 A;  4E7J A;  4FLU A;  3MEE A;  3RTV A;  3AVG A;  3K5O A;  4CEE A;  1NOZ A;  2EHG A;  3TI0 A;  3ZT4 A;  3SYZ A;  1UA0 A;  4FK0 A;  1RCH A;  1FXX A;  1IH7 A;  2P51 A;  4KTZ A;  4DLG A;  4ZTF A;  4DQR A;  4DTN A;  3SI6 A;  1GOB A;  4CF9 A;  1NKC A;  4Z4E A;  1ZBI A;  1BIZ A;  3D0P A;  4ELU A;  3V81 A;  1VSH A;  4HCB A;  4BE0 A;  3CM5 A;  4AHS A;  4LSN A;  1KVB A;  3VQD A;  4AH9 A;  4KO0 A;  4CEF A;  3RR7 A;  4FJK A;  2G8F A;  2G8W A;  3DRS A;  1JL1 A;  1A5X A;  1XHX A;  3KLI A;  3AV9 A;  1TKZ A;  1FK9 A;  3AA4 A;  4FJN A;  4KHN A;  1DTQ A;  4DSI A;  3LP0 A;  5T7B A;  3NDK A;  3K59 A;  4AHC A;  4UQG A;  1RT3 A;  3MAQ A;  1Q9X A;  4KB1 A;  3RR8 A;  2P5O A;  3DLE A;  1ZYQ A;  4F2S A;  2QK9 A;  2YHB A;  1LW0 A;  1QS4 A;  5SWM A;  2XY8 A;  4FXD A;  1DLO A;  3AA5 X;  3AVH A;  3F73 A;  4FM1 A;  4ID5 A;  4E1M A;  2BDP A;  4FJG A;  4CEQ A;  5CZ1 A;  1QSY A;  4GMJ B;  5HRR A;  4B9V A;  3SPZ A;  3RWU A;  1SL1 A;  4OGE A;  5CZ2 A;  4Z4C A;  3O4Q A;  2G8I A;  2QKB A;  4RG8 A;  1S9G A;  2B5J A;  2ZQB A;  3KKR A;  3HVT A;  1T7P A;  4TSX A;  4O5B A;  1J5O A;  4BWM A;  4AIL C;  4C8O A;  1IKY A;  4CJV A;  2E6M A;  4F2R A;  3VQ5 A;  4E7K A;  4M42 A;  2HHV A;  3L2V A;  1J53 A;  5DK5 A;  2BE2 A;  1W9H A;  4RW6 A;  4F4K A;  4FK4 A;  3S3M A;  3ZCM A;  2DTU A;  1YTU A;  5HP1 A;  4J2D A;  1NOY A;  1HJR A;  4DQI A;  4KB0 A;  1D5A A;  2VWK A;  3DLB A;  3HJF A;  3VQ6 A;  4IG0 A;  1KFD A;  4I2Q A;  4K8X A;  3L2U A;  2XHB A;  3V9Z A;  1I3A A;  1RDC A;  2IS3 A;  4LY7 A;  1KSP A;  4XIU A;  3V6D A;  1KVA A;  1S1U A;  2ATQ A;  1TAU A;  5I3U A;  4DLE A;  3SQ0 A;  1BI4 A;  4K8Z A;  2O4I A;  3VQ9 A;  2HHS A;  2YKM A;  2YNH A;  1EXQ A;  3HST B;  1ZBH A;  2DFF A;  3K58 A;  3AVN A;  2HHU A;  2B4J A;  3NF9 A;  4CEA A;  3U6F A;  2HND A;  3NCI A;  2YNF A;  2HMI A;  4KKO A;  4M41 A;  2Z1H A;  4KV8 A;  3SUO A;  4OKK A;  1NKE A;  1LV5 A;  3I0R A;  2OA8 A;  3NGY A;  1ZBU A;  4NCG A;  3H08 A;  1QQC A;  1A5V A;  3K5L A;  3HXM A;  4HHT A;  4CF8 A;  4B9T A;  4WE1 A;  4FLY A;  4ZTJ A;  4ELV A;  1U04 A;  2PYL A;  1Q9Y A;  2ETJ A;  1HQE A;  4DQP A;  3VQ4 A;  3DLH A;  3D45 A;  2IAJ A;  3ZSO A;  1TK0 A;  3L2Q A;  4CFB A;  4CHN A;  1NJX A;  4FW1 A;  3SUN A;  4HTU A;  1TKD A;  4CFD A;  1BCM A;  3AVB A;  1KTQ A;  4N5S A;  5J2N A;  3MED A;  4I9L A;  2IDO A;  4CJ4 A;  1HYS A;  1L5U A;  2GV9 A;  3WNF A;  3LAL A;  5JS2 A;  1SKW A;  1W0H A;  4Z0U A;  3ZSY A;  3KJV A;  5EU7 A;  1NK6 A;  3NHG A;  1A5W A;  3MXJ A;  3AVI A;  3VQ8 A;  4DMN A;  4CJR A;  3CFP A;  3PV8 A;  2OPS A;  5FRN A;  3VA3 A;  3E01 A;  3TAR A;  1LW2 A;  3AVK A;  4CJ5 A;  1VSL A;  3OYC A;  2X78 A;  4GW6 A;  3WNE A;  4DFM A;  3WNG A;  3NF8 A;  4LSL A;  4N41 A;  3KD5 E;  5KGW A;  4FCY A;  4H4M A;  5DMR A;  4FVM A;  5KGX A;  3VA0 A;  3RRG A;  1CZB A;  3T3F A;  3AVJ A;  4AHT A;  4N56 A;  3QNN A;  1WSF A;  3P83 D;  3CG7 A;  3SJJ A;  3EY1 A;  1U47 A;  3V9X A;  1F21 A;  1RBT A;  4E7H A;  5K14 A;  4OPJ A;  4DWI A;  3PX4 A;  1VRU A;  3L3V A;  3L2W A;  4CJK A;  3V9S A;  1RDD A;  1RT2 A;  3ZSQ A;  4CGD A;  3JYT A;  2QKK A;  2XRI A;  3C6T A;  3M8S A;  3V4I A;  4CF0 A;  3V9W A;  2G8K A;  4B9N A;  4OVL A;  1L3T A;  1Z26 A;  4DF8 A;  1HNI A;  4DTJ A;  3TAE A;  1UA1 A;  2X74 A;  1YVU A;  3SQ2 A;  4M3T A;  3QIO A;  1KVC A;  2Y1J A;  4O55 A;  1X9M A;  4FZZ A;  1BIS A;  1C0M A;  1WSG A;  1VRT A;  3T19 A;  3AVC A;  3O3F A;  3OYM A;  4BDZ A;  4BDP A;  4QOZ B;  4NYF A;  1WNS A;  4KHS A;  4CJ3 A;  1HYV A;  2WON A;  3AO1 A;  3ZT2 A;  3KK3 A;  2VG5 A;  3HK2 A;  1QSS A;  1TV6 A;  3I0S A;  3NF7 A;  5CYQ A;  1REV A;  5J2Q A;  4BAC A;  4J2A A;  1J54 A;  1RBR A;  3SQ4 A;  2XO7 A;  3VQB A;  3KIO A;  3KLF A;  3ULD A;  1U48 A;  3KLH A;  1D9F A;  3IAY A;  5J1E A;  2RN2 A;  4CGI A;  1VK0 A;  4R5P A;  3K5N A;  3QEV A;  5HRO A;  4KAZ A;  4DTS A;  1JLG A;  4DFK A;  4OLB A;  2HW3 A;  1VSJ A;  2GBZ A;  4HUE A;  1JL2 A;  1WN7 A;  4EP5 A;  3LZJ A;  2P5G A;  4FJ5 A;  1RTD A;  1ASU A;  4M3R A;  2KTQ A;  4B8A B;  2HVI A;  4H8K A;  4CHQ A;  1TAQ A;  2FC0 A;  3NH0 A;  3OY9 A;  1NK8 A;  4NCB A;  1Y97 A;  3V1R A;  1HNV A;  4ICL A;  1IKX A;  1XHZ A;  1NKB A;  4IFV A;  4RW4 A;  4I2P A;  4M3Y A;  1RDB A;  3LPU A;  2HNY A;  4W5R A;  2W42 A;  1HQU A;  4IDK A;  2KFN A;  1XWL A;  4DTP A;  3QES A;  2DY4 A;  1RBV A;  4CEB A;  3OJU A;  2X6S A;  4CGF A;  4CE9 A;  1B9F A;  1GOA A;  1UOC A;  3QIP A;  4C8N A;  1NK5 A;  4CEO A;  1JLC A;  4EZ9 A;  4EZ6 A;  1C1C A;  2R7Y A;  4PWD A;  3HPH A;  1D9D A;  1LWF A;  3ZT0 A;  1U49 A;  4KRF A;  3OYK A;  1WAJ A;  4CIG A;  4DF4 A;  3OYI A;  2HB5 A;  2D0A A;  4OJR A;  3G0Z A;  4KHQ A;  3M8P A;  2YHA A;  3O3G A;  4FJ9 A;  1MU2 A;  2OPP A;  2E4L A;  4YFU A;  1BGX T;  1NK4 A;  1BQM A;  3RRH A;  1C1A A;  4L8R B;  4FJ8 A;  4DTU A;  1B9D A;  5KRT A;  3PX0 A;  4FJH A;  5CY4 A;  3SV3 A;  3CFR A;  3RMB A;  4CES A;  2G8U A;  1DTT A;  3NH2 A;  2YKN A;  2HHW A;  2EX3 A;  4ZHR A;  1CXQ A;  4OPK A;  1TL1 A;  4FM2 A;  1RTI A;  3EZ5 A;  3K5M A;  2LSN A;  3AO2 A;  3DOL A;  1WSE A;  5FDL A;  4LH5 A;  3PX6 A;  3NE6 A;  1UAX A;  1IG9 A;  4CEC A;  1D8Y A;  3PY8 A;  4FZY A;  2IOC A;  3OVN A;  1JLB A;  1TK8 A;  2HNZ A;  1YTA A;  3LWL A;  4KTQ A;  3OS0 A;  4DQQ A;  1C0U A;  1S6Q A;  3OS1 A;  5HRP A;  1TKT A;  5KTQ A;  1JKH A;  1JLQ A;  4B9U A;  4W5Q A;  2ITG A;  4J2E A;  2WOM A;  1EX4 A;  3O3H A;  1JXB A;  1BQN A;  3CQ8 A;  4M3X A;  2X6N A;  2FBT A;  4M3U A;  1RIL A;  3S3N A;  1RT6 A;  2Z1J A;  4G1Q A;  4BE1 A;  2RKI A;  4DFJ A;  3C94 A;  3TAQ A;  5CYM A;  4JLH A;  3DRR A;  4CJQ A;  2XY6 A;  1U4B A;  1ASV A;  1RT7 A;  3OYE A;  5I42 A;  3U3Y A;  4FJL A;  4I9Q A;  1HRH A;  2F8S A;  4KRE A;  4FLV A;  2NUB A;  3NFA A;  3SUQ A;  2G8V A;  2Y1I A;  4KHY A;  1BL3 A;  3CFO A;  3DOK A;  2FBY A;  4JS5 A;  3SNN A;  3KKS A;  3LP2 A;  1C6V A;  4FJX A;  4Q0B A;  4E19 A;  4Y1D A;  2A1R A;  3LWM A;  2HHT A;  1ZBF A;  4CJU A;  1BHL A;  4CHZ A;  4DSJ A;  5J2M A;  4CJP A;  2KFZ A;  3V1Q A;  1T8E A;  3RMC A;  4DS4 A;  3SZ2 A;  1S1T A;  3OJS A;  1VSK A;  3RMA A;  4FLX A;  4M3W A;  4CJS A;  4CF2 A;  4CCH A;  4O44 A;  4CJF A;  3NBP A;  1FKO A;  3NGZ A;  1S9E A;  4CGG A;  3QEP A;  2PY5 A;  4NCA A;  3TAB A;  4PUO A;  1WLJ A;  3FFI A;  3THV A;  1G15 A;  2Q3S A;  4C8L A;  1HPZ A;  3F9K A;  3KLG A;  2OZS A;  4IKF A;  3MEC A;  1RT1 A;  3HM9 A;  4DFP A;  4Z4F A;  4B3O A;  4CER A;  3TAF A;  4IFY A;  4AHU A;  1U45 A;  2D0B A;  1X9W A;  2IGI A;  3OYB A;  1RNH A;  4NYN A;  1R0A A;  4ID1 A;  5C24 A;  3ZSZ A;  2VG6 A;  3HVR A;  1B92 A;  3VQC A;  4FJI A;  1YT3 A;  4I7F A;  4KI4 A;  1EP4 A;  4YNQ A;  2B6A A;  4Y1C A;  1L3U A;  2RF2 A;  3OYA A;  2OYQ A;  3VQQ A;  2RPI A;  3OYH A;  3SPY A;  1GOC A;  4DSK A;  3TR8 A;  4RW9 A;  4FZX C;  3PUF A;  3QLH A;  2O4G A;  1VSM A;  3AO5 A;  3VQ7 A;  2AJQ A;  3HYF A;  4FYD A;  5HLF A;  3PO4 A;  4KHU A;  2Z1G A;  1ASW A;  3LZI A;  2OPQ A;  5FRM A;  1JXE A;  2E6L A;  3JSM A;  1KFS A;  3LDS A;  1IKW A;  1RBU A;  1RTH A;  3P5J A;  3QNO A;  1UWB A;  2HHQ A;  3NGI A;  1LWC A;  3VQP A;  3TAG A;  3I8D A;  3LP1 A;  4FLW A;  4PA1 A;  1TVR A;  3C95 A;  3S3O A;  1NJY A;  3OS2 A;  3LAM A;  4W5N A;  3TAP A;  3DM2 A;  4IBN A;  1RT5 A;  4QAG A;  4M3Z A;  1T05 A;  4Z4H A;  1RBS A;  4ELT A;  4E0D A;  3AVA A;  1X9S A;  1KLM A;  1RT4 A;  3DLG A;  1NK9 A;  1LAV A;  1L3S A;  3ASM A;  5HRN A;  2ZE2 A;  4GVM A;  4W5T A;  3NAE A;  4DS5 A;  4DU1 A;  4DU3 A;  3ITH A;  2YNI A;  3AO4 A;  1TK5 A;  3ZT3 A;  1EKE A;  3AO3 A;  4AHR A;  4C8M A;  4CFC A;  4FJJ A;  4DQS A;  3LAK A;  4H4O A;  4FM0 A;  1SKS A;  3CM6 A;  4CHY A;  1BIU A;  1HYZ A;  4CEZ A;  1NK0 A;  5D3G A;  2F8T A;  4BE2 A;  3EYZ A;  1O1W A;  1TKX A;  3QER A;  3L3U A;  2DFH A;  1NJW A;  1QTM A;  4DSE A;  3B6O A;  4J2B A;  3BGR A;  3U3G A;  1QE1 A;  1KLN A;  3SV4 A;  3VN5 A;  4JRP A;  4HUF A;  3V9U A;  1XI1 A;  4KHW A;  2QXF A;  1IO2 A;  4RW8 A;  1JLA A;  3HT3 A;  3L8B A;  3TWH A;  4PY5 A;  3DLR A;  3DLK A;  4CF1 A;  3TAN A;  2KZZ A;  4BDY A;  2KW4 A;  3DRP A;  3MXI A;  1SL2 A;  3DYA A;  4DTM A;  3K2P A;  1FKP A;  1HMV A;  2VWJ A;  4Z4G A;  1NK7 A;  3SCX A;  2FBX A;  3NF6 A;  3KTQ A;  1J9A A;  1WSJ A;  1RDA A;  3T1A A;  3LP3 A;  4CED A;  4B9S A;  1BCO A;  4CK1 A;  1I39 A;  2ZD1 A;  2KQ2 A;  2P1J A;  3LAN A;  3M8R A;  1S1X A;  4CJT A;  3KD1 E;  2KZM A;  4F3T A;  3AVM A;  3O4N A;  4FLT A;  3ZSW A;  4DTO A;  1NJZ A;  4FJM A;  4FK2 A;  4Z4I A;  3AA3 A;  3BDP A;  4RW7 A;  3LPT A;  2I5J A;  4M45 A;  4HVJ A;  4PQU A;  2HVH A;  1RTJ A;  3ZSV A;  2YNG A;  4E1N A;  3AVF A;  4KTW A;  3IRX A;  4KPY A;  4FJ7 A;  2D5R A;  3ZSR A;  1SUQ A;  4O4G A;  4KFB A;  1XC9 A;  1S5J A;  4O0I A;  1Z25 A;  4O0J A;  4LH4 A;  5E41 A;  3PO5 A;  1LWE A;  1S1W A;  2JGU A;  4CK3 A;  5HRS A;  3DMJ A;  1VSI A;  4CGH A;  1VSF A;  1SL0 A;  3OYJ A;  4QCL A;  4FLZ A;  2GUI A;  4BWJ A;  3A2F A;  3ALY A;  4B08 A;  2OPR A;  5KRS A;  3G10 A;  3KK2 A;  2OZM A;  3B6P A;  1WAF A;  4Q5V A;  3P1G A;  3ZT1 A;  5C25 A;  2DFE A;  1VSD A;  4KI6 A;  1CLQ A;  1QSL A;  3OYG A;  4B8C A;  3KK1 A;  2F96 A;  5HBM A;  4MFB A;  3VQE A;  3QEX A;  1TGO A;  3DI6 A;  4F8R A;  2XY7 A;  1S6P A;  1WSI A;  4CIE A;  3ISN C;  3QO9 A;  4CJL A;  3AA2 A;  3K57 A;  3HPO A;  4DSF A;  4DU4 A;  3SUP A;  1N5Y A;  4LD0 A;  1KRP A;  4F3O A;  4OLA A;  4FW2 A;  2VG7 A;  1BI4 B;  3RMD A;  3IG1 A;  1SKR A;  4DG1 A;  1ZBL A;  4DSL A;  1VSE A;  5J2P A;  1T03 A;  1S1V A;  4C8K A;  4AHV A;  1QHT A;  2IC3 A;  3C6U A;  1IKV A;  4CJW A;  2PZS A;  5FRO A;  4W5O A;  4DTR A;  4B9M A;  4E3S A;  3IS9 A;  3ZSX A;  4CFA A;  1ITG A;  3HO1 A;  3M8Q A;  3CYM A;  4E7L A;  4CGJ A;  3QET A;  1EET A;  2XY5 A;  2HHX A;  3TAM A;  5JS1 A;  4JS4 A;  2Z1I A;  1C1B A;  3OYN A;  4CJE A;  3SQ1 A;  4IG3 A;  1CXU A;  1KCF A;  4EP4 A;  3OYF A;  3OYL A;  4E89 A;  2JLE A;  2YV0 X;  3AVL A;  4DTX A;  3MXM A;  3V1O A;  1L3V A;  5SZT A; 
#chains in the Genus database with same CATH topology
 4CVN E;  1X1P A;  5JVH L;  1KAZ A;  4OKE A;  1TUY A;  1LAW A;  2D0C A;  4CHP A;  1VHX A;  2A5X A;  3EE9 A;  3W0L A;  4EAH D;  3MWP A;  4H0T B;  3OYD A;  4N76 A;  3L2R A;  4OGC A;  1WSH A;  5JIC A;  4B9L A;  2YHX A;  5KI6 A;  3HP9 A;  1RDU A;  4WF9 L;  4A2A A;  4E7I A;  1EO1 A;  3WEE A;  4JKA A;  3RTV A;  4CEE A;  3K5O A;  5M1P A;  2YHW A;  2EHG A;  1KQS M;  1OVY A;  2RE2 A;  3UE5 A;  4DQR A;  4DTN A;  1NKC A;  4Z4E A;  1ZBI A;  3D0P A;  4ELU A;  4HCB A;  1ZXO A;  4JI7 K;  4AHS A;  4LSN A;  4KO0 A;  3D7E O;  3VET A;  3R8E A;  1A5X A;  2QA4 N;  3CPW M;  3FR0 A;  2QWP A;  3AA4 A;  1DTQ A;  3WEE B;  4YHH K;  3NDK A;  1Q9X A;  1RT3 A;  4KB1 A;  3RR8 A;  2P5O A;  1NJI O;  1DLO A;  3JXU A;  2Q36 A;  3AVH A;  4ID5 A;  4DV2 K;  4O8K A;  1QSY A;  4GMJ B;  4A2B A;  1SS6 A;  1HNW K;  5CZ2 A;  4Z4C A;  3EO3 A;  1S9G A;  2HBL A;  2B5J A;  3ZX0 A;  3WXM B;  4K0K K;  2BE2 A;  3GL1 A;  2CGJ A;  3VMF B;  5BPN A;  1NGB A;  1XUP O;  4J2D A;  1D5A A;  5AQF A;  5BN8 A;  3KWG A;  3L2U A;  3H1Q A;  4XIU A;  1KVA A;  2I7N A;  1KXP A;  1BA0 A;  4DLE A;  3DWL A;  2HHS A;  4LF9 K;  3VQ9 A;  4LF7 K;  2YKM A;  3ATU A;  2HHU A;  3U6F A;  5AFU A;  2HND A;  3N4P A;  2YNF A;  5AQV A;  3SUO A;  3WXL A;  1EWQ A;  3NGY A;  5FPM A;  5CHI A;  4B9T A;  5GAE P;  4ZTJ A;  4ELV A;  2ETJ A;  4DQP A;  5LY3 A;  3IKM A;  5ADX A;  4CJ7 A;  4CHN A;  5AQT A;  1XNR K;  4HTU A;  3CJ9 A;  1BCM A;  4CFD A;  3MED A;  4I9L A;  2IDO A;  5AQK A;  1HYS A;  1L5U A;  1RDW X;  2D0P A;  2YI1 A;  3O1W A;  5JS2 A;  1SKW A;  3M6G A;  3VQ8 A;  3PV8 A;  3E01 A;  2FSJ A;  2QEX N;  4ISF A;  3AVK A;  4CJ5 A;  3OYC A;  4GW6 A;  3K9J A;  4LSL A;  4N41 A;  4FCY A;  5DMR A;  1CZB A;  3T3F A;  3BZK A;  1WSF A;  3P83 D;  4DR5 K;  3V9X A;  1RBT A;  3E66 A;  4OPJ A;  1Q82 O;  5GAG P;  3VF2 A;  4OO1 J;  1RT2 A;  4CGD A;  4HTL A;  2W41 A;  4B9N A;  3SAG A;  4M3T A;  1X9M A;  2UU9 K;  3CXC M;  4BRE A;  1VRT A;  3T19 A;  4NYF A;  4B1X B;  4RWT A;  2ZJQ L;  3KK3 A;  1HLU A;  3HK2 A;  5FPE A;  5CYQ A;  3TPQ A;  3HOS A;  3SQ4 A;  2XO7 A;  3ULD A;  3CJ1 A;  1NMN A;  2NNW A;  2FSN A;  3VGM A;  1JLG A;  2EWS A;  4CZH A;  4HUE A;  4BRG A;  3WQU A;  1RTD A;  2KTQ A;  3O80 A;  4YOU A;  3U4L A;  1ZC6 A;  4F9O A;  1XHZ A;  4WFN L;  1NKB A;  5EX5 A;  2KKZ A;  1XWL A;  2DY4 A;  1RBV A;  1B9F A;  3QIP A;  4PWD A;  4PL8 A;  3BEX A;  3CCS N;  3G0Z A;  4KHQ A;  4C23 A;  2HBM A;  1EQY A;  2E4L A;  1VQ8 N;  3RRH A;  1C1A A;  4L8R B;  4DTU A;  5KRT A;  4DQ8 A;  2CH5 A;  4JKE A;  3NH2 A;  4FL9 A;  2YKN A;  4DV3 K;  5AQS A;  3HSC A;  4ZHR A;  1CXQ A;  2F9T A;  4OPK A;  3E1Y A;  3PX6 A;  3CHW A;  4GVE A;  2HNZ A;  3RVC A;  3LWL A;  4BR9 A;  1S6Q A;  1YHQ N;  5HRP A;  2ITG A;  4J2E A;  2CGK A;  3MN7 A;  1BQN A;  2VGN A;  5EXW A;  3CQ8 A;  1BA1 A;  3GE1 A;  1VQP N;  1RT6 A;  4G1Q A;  4JLH A;  1ASV A;  4FJL A;  1BO5 O;  3FFK B;  4I9Q A;  4KRE A;  3NFA A;  2WTU A;  4JS5 A;  4FJX A;  4I6M A;  3LP2 A;  4CBX A;  4CW7 B;  2A1R A;  4CJU A;  1BHL A;  4CHZ A;  2GEM A;  2ZGY A;  3MX2 A;  2Q0U A;  3C65 A;  4CI6 A;  4H5N A;  3V1Q A;  5A2Q O;  3SZ2 A;  3WQT A;  1FKO A;  2FLO A;  1S9E A;  3IDH A;  3BP8 A;  1BDG A;  3THV A;  1G15 A;  2Q3S A;  4C8L A;  1HPZ A;  1LCU A;  4IKF A;  3HM9 A;  4B3O A;  4AHU A;  2QWM A;  4ID1 A;  2VG6 A;  1B92 A;  4KI4 A;  3GG4 A;  4FOE A;  4Y1C A;  2RF2 A;  3OYA A;  3CJC A;  2RPI A;  3SPY A;  4AM7 A;  4RW9 A;  4FZX C;  3PUF A;  3AO5 A;  3HYF A;  5EOY A;  3CCE N;  4BR2 A;  3THW A;  2Z1G A;  1ASW A;  2OPQ A;  1JXE A;  2E6L A;  1QVF M;  1IKW A;  2GX9 A;  3F9M A;  5F1X A;  1UWB A;  2HHQ A;  5GAD P;  1LWC A;  3NGI A;  3VQP A;  3VF4 A;  2O8E A;  3I8D A;  2UUC K;  2P9N B;  5BRH A;  3R6M A;  3LAM A;  4YOY A;  2OCE A;  3J7Z O;  2E8A A;  2A41 A;  2IVO A;  3O4W A;  3E9L A;  4BR7 A;  2E20 A;  1G99 A;  4JI5 K;  1X9S A;  3THW B;  4JEP A;  3Q7C A;  1L3S A;  2E2N A;  4GVM A;  4AM6 A;  5HRN A;  1JCF A;  3ITH A;  2YNI A;  3M5R A;  3ZT3 A;  4IOX A;  4H0O A;  4H4O A;  2GEL A;  1DGK N;  1HYZ A;  1GLL O;  5D3G A;  4C1N K;  4BE2 A;  3CCV N;  3QER A;  1NGJ A;  2D1K A;  4J2B A;  3EKU A;  3U3G A;  1QE1 A;  3SV4 A;  3V9U A;  4KHW A;  4MDA A;  1D4X A;  4CZL A;  3TWH A;  4NO7 A;  3HOT A;  1QZ5 A;  4PY5 A;  4GY2 B;  3RSE A;  3DRP A;  4GV9 A;  2E1Y A;  3K2P A;  2VWJ A;  4MDB A;  1NK7 A;  3SCX A;  4DR1 K;  3ID6 A;  1S3X A;  4B9S A;  4CK1 A;  2ZD1 A;  2P1J A;  3TSQ A;  3LAN A;  4DV7 K;  1S1X A;  3QBW A;  2KZM A;  3VES A;  2ZJP L;  4RW7 A;  3LPT A;  4MO5 A;  2HVH A;  3J81 O;  3AVF A;  3RSE B;  4KTW A;  1X9J A;  3WT0 A;  3IRX A;  3MDQ A;  1S5J A;  3MX5 A;  3I8B A;  4LH4 A;  5E41 A;  4WFA L;  2JGU A;  2F9W A;  4LFA K;  4CGH A;  1SL0 A;  4FO0 A;  4B08 A;  5KRS A;  2V7Y A;  2OZM A;  5M1Q A;  1VSD A;  4B8C A;  1W97 L;  2PBD A;  2F4V K;  3DI6 A;  2WUS A;  4F8R A;  4X66 K;  4EIA A;  3K57 A;  4DSF A;  3CET A;  1LOT B;  4F3O A;  1QZ6 A;  1BI4 B;  1VSE A;  4H5V A;  1QHT A;  2IC3 A;  3MN6 A;  4BR4 A;  1P90 A;  5C0Y A;  3WXI A;  1VAZ A;  3ZSX A;  3CYM A;  4E7L A;  1EET A;  5AQG A;  3D6R A;  5M1O A;  2Z1I A;  1CXU A;  3TAE A;  4JK7 A;  1UA1 A;  2YV0 X;  2PFU A;  3MXM A;  3V1O A;  1J5E K;  4BY9 C;  1S22 A;  2ZWH A;  3S9H A;  4CIF A;  4NLC A;  1HJO A;  5C42 A;  4HCC A;  4CHO A;  1ATN A;  3LDO A;  4BC3 A;  3BZC A;  1TL3 A;  5F2R A;  2PYJ A;  5IT9 O;  2QTD A;  3LM2 A;  5AQX A;  5JLF A;  4OKJ A;  1CZ9 A;  1JLE A;  1JLF A;  1HKG A;  1C0T A;  3ZET A;  4OPH A;  1SV5 A;  5KPZ A;  1SQK A;  3ZT4 A;  4PKH A;  4K43 A;  1RCH A;  2P51 A;  2E2P A;  3TTF A;  3IMX A;  2YCH A;  5AZI A;  1GOB A;  4CF9 A;  4YY3 K;  3I56 N;  3L6Q A;  4JV5 K;  1HNZ K;  2G8F A;  2G8W A;  3CIP A;  1JL1 A;  1WUA A;  1XHX A;  3ZET B;  3AV9 A;  1TKZ A;  1FK9 A;  4DSI A;  4AHC A;  3MCP A;  3DLE A;  5AZI B;  2QK9 A;  2QM1 A;  2XY8 A;  3F73 A;  4BRP A;  2BDP A;  4FJG A;  5HRR A;  3A5O C;  2D0O A;  3SPZ A;  2YX6 A;  1TYQ A;  3RWU A;  1IV0 A;  4BRA A;  2QKB A;  1FW6 A;  1T7P A;  1EWR A;  4TSX A;  1J5O A;  1IKY A;  4CJV A;  2E6M A;  3O9S A;  4JNE A;  3ULE A;  4M42 A;  1J53 A;  2Q31 A;  5DK5 A;  3LDQ A;  2ZJR L;  4RW6 A;  3S3M A;  4BRQ A;  3ZCM A;  1YTU A;  5HP1 A;  1HJR A;  3PIP L;  3VQ6 A;  4I2Q A;  4K8X A;  1TYQ B;  3TTC A;  1RDC A;  1QQO A;  1C0G A;  4IZ9 A;  4NXN K;  4YDU A;  3A5N C;  4X62 K;  1EXQ A;  3HST B;  1ZBH A;  3AGR A;  3ULE B;  3NF9 A;  4CEA A;  2ASO A;  3DAW A;  4XH5 A;  4KKO A;  3EL2 A;  4M41 A;  2QXL A;  4OKK A;  3CC2 N;  3BF3 A;  1ZBU A;  4NCG A;  3W3D A;  4JK8 A;  4CF8 A;  2P9L A;  1U04 A;  3R3L A;  1Q9Y A;  3VQ4 A;  3DLH A;  3C6A A;  3D45 A;  2IAJ A;  3ZSO A;  4OX9 K;  3L2Q A;  1NJX A;  3KVG A;  3SUN A;  1NNE A;  5C2F A;  3E9P A;  1W0H A;  4DV4 K;  1A5W A;  4CJR A;  4DMN A;  3CFP A;  3TAR A;  1LW2 A;  2QW9 A;  3CCM N;  2X78 A;  4IO9 L;  3K0S A;  3WNG A;  3NF8 A;  3CCR N;  3C7N A;  2HF3 A;  4N56 A;  3L4I A;  5GAH P;  1VQM N;  1MA9 B;  4FWN A;  4JI4 K;  3EY1 A;  3L3V A;  3VTH A;  3LM9 A;  3H3O B;  1DT9 A;  1P8Z A;  5HL7 L;  4DB3 A;  3ENB A;  3V4I A;  3PLA A;  4CF0 A;  2G8K A;  4DSL A;  1HNI A;  2X74 A;  1YVU A;  3C7N B;  1YXQ A;  2Y1J A;  3SQ2 A;  4IJA A;  4O55 A;  4FZZ A;  1BIS A;  1C0M A;  3O3F A;  3OYM A;  1QHA A;  4BDZ A;  4BDP A;  4KHS A;  2H3G X;  4LF4 K;  5AQI A;  2WON A;  3ZT2 A;  4J2A A;  1REV A;  4BAC A;  2KLA A;  4C1N I;  3VQB A;  1VQ7 N;  4Z94 A;  3KLF A;  1D9F A;  3IAY A;  2CH6 A;  4LC9 B;  4CGI A;  1VK0 A;  3SBT A;  4KAZ A;  4OLB A;  3VER A;  1VSJ A;  2GBZ A;  1JL2 A;  3LZJ A;  4M3R A;  4B8A B;  3SBG A;  4H8K A;  4CHQ A;  2FC0 A;  3NH0 A;  1NK8 A;  3TTD A;  3V1R A;  1IKX A;  3SLC A;  1VQ5 N;  3IFR A;  1Q86 O;  1RDB A;  3LPU A;  2WC9 A;  3THY A;  5GIP A;  2W42 A;  4DTP A;  4BVP A;  4CE9 A;  1GOA A;  4FOI A;  1JLC A;  4EZ6 A;  2VGM A;  4KRF A;  3OYK A;  5M1F A;  4DF4 A;  1NGH A;  2HST A;  4OJR A;  2Q1N A;  2P9S A;  3CC7 N;  4H0X B;  2YHA A;  4YFU A;  1NK4 A;  3AGK A;  1BQM A;  1XC3 A;  4FJ8 A;  4QS7 A;  1B9D A;  5LMN K;  3PX0 A;  3RMB A;  4CES A;  3THY B;  1TL1 A;  3PSI A;  3EZ5 A;  1QQN A;  3AO2 A;  3U8X A;  3PY8 A;  1IG9 A;  2A42 A;  1D8Y A;  3J80 O;  3OVN A;  1JLB A;  3EE8 A;  1TK8 A;  2BH1 A;  2P9S B;  4DQQ A;  5GIN A;  5KTQ A;  1TKT A;  1JKH A;  1V4S A;  4W5Q A;  3O3H A;  2RHK A;  1JXB A;  5AQP A;  3H1V X;  3FGU A;  2X6N A;  2E1Z A;  4FWP A;  4BC5 A;  3O08 A;  1JJ2 M;  3TAQ A;  3C94 A;  4JKD A;  3DRR A;  4CJQ A;  3FZK A;  1Q18 A;  3OYE A;  5I42 A;  3U3Y A;  1HRH A;  2F8S A;  4PKI A;  4L3Q A;  4FLV A;  2NRX A;  2Y1I A;  4M7Y A;  3DOK A;  3T1Y K;  3SJH A;  4Q0B A;  1K9M O;  4IOC L;  3LWM A;  1ZBF A;  3G25 A;  1E3M A;  1KAX A;  5J2M A;  1T8E A;  1BUP A;  5AQN A;  2WFB A;  4CCH A;  2ASM A;  4O44 A;  3NBP A;  3NGZ A;  4FWL A;  3QEP A;  5JVG L;  3O9R A;  3U9D A;  2PY5 A;  2GUP A;  3ZLJ A;  4NXM K;  3FZM A;  2OZS A;  1RT1 A;  4BG9 A;  4CER A;  2AP1 A;  4IFY A;  4CZF A;  3TAF A;  4B3M K;  3VEX A;  1GLF O;  2OTL N;  1R0A A;  4NYN A;  1IBK K;  3R9P A;  3HVR A;  4FJI A;  5C10 A;  3IUC A;  4YNQ A;  2B6A A;  1L3U A;  4H5W A;  2OYQ A;  3CQX A;  3VQQ A;  3TR8 A;  5KQD A;  4JI0 K;  3P31 A;  3PO4 A;  4KHU A;  5C2D A;  3VF6 A;  4FWQ A;  4H0P A;  3WUH A;  1KFS A;  1YVN A;  1T6C A;  1OH5 A;  4PA1 A;  1NJY A;  3OS2 A;  3TAP A;  2Q97 A;  4Z4H A;  1RBS A;  2HF4 A;  3FZH A;  5EVZ A;  3CMA N;  5BRD A;  3DLG A;  5BN9 A;  3ASM A;  4V19 S;  4W5T A;  4NB4 A;  4WCE L;  4DS5 A;  4DU3 A;  4DV1 K;  4DU1 A;  1NBW A;  5AZJ A;  1EKE A;  3AO3 A;  4DR3 K;  4AHR A;  1GLB G;  4FJJ A;  4CD1 A;  5DM7 L;  4DQS A;  2E5L K;  4FM0 A;  4CHY A;  5MLC Q;  3CME N;  4WYB A;  1NK0 A;  4FWO A;  3G6E N;  2F8T A;  5C15 A;  3VEO A;  1QTM A;  2ZF5 O;  2QI2 A;  3B6O A;  1U6Z A;  4A59 A;  2IVN A;  2YJF A;  1IO2 A;  5AZJ B;  3DLR A;  3DLK A;  2KW4 A;  3HZ6 A;  1SL2 A;  1XNQ K;  3CCL N;  3MN5 A;  1VQ6 N;  1XMQ K;  3CCU N;  3AY9 A;  3T1A A;  1ZBS A;  5LJV A;  5DM6 L;  4JYA K;  4BR0 A;  4CJT A;  1GLJ O;  3CQY A;  3O4N A;  4FLT A;  2VWB A;  4FJM A;  2KHO A;  5E26 A;  3AAR A;  3HRG A;  4A61 A;  4PQU A;  3ZSV A;  1Z6R A;  2PAV A;  4IJN A;  1N36 K;  3OA9 A;  3VEZ A;  2O8F A;  2D5R A;  1MWK A;  4O0J A;  1YAG A;  1LWE A;  4YOV A;  3O1B A;  5I9E B;  4QCL A;  3DMJ A;  4FLZ A;  3SMS A;  3A2F A;  2OPR A;  3G10 A;  3FLC O;  4KHP K;  1K73 O;  5HBM A;  1NGE A;  1TUU A;  3QEX A;  2P9I A;  3VTI A;  2O8F B;  1S6P A;  3UKU A;  4DU4 A;  2IVP A;  4FW2 A;  3IG1 A;  3UB5 A;  1SKR A;  1NGI A;  4DG1 A;  3WXK A;  4NLB A;  1S1V A;  4C8K A;  4AHV A;  3C6U A;  4CJW A;  3SAH A;  4DTR A;  1XQS C;  3CF5 L;  1ITG A;  4JKC A;  4A62 A;  3HO1 A;  3D2F A;  3EKS A;  1X3N A;  2P9N A;  1C1B A;  2P9I B;  3OYN A;  4CJE A;  3SQ1 A;  4CZJ A;  5AQM A;  4EP4 A;  1KCF A;  4A5B A;  3OYF A;  3UKU B;  2JLE A;  4IEI A;  2BAN A;  2FBV A;  4B9Q A;  3BY5 A;  3QIN A;  4MQ3 A;  4N47 A;  3NH1 A;  3ATV A;  4YOT A;  3HPG A;  2A1S A;  4U7B A;  3VQA A;  3D2F B;  3AAP A;  2G8H A;  4JRQ A;  1OKJ A;  2GWJ A;  3UIQ A;  3HP6 A;  3QEI A;  3KLE A;  3KK7 A;  4MLH A;  1Q8I A;  2NRW A;  3HL8 A;  1K6Y A;  3VGK A;  4E7J A;  4FLU A;  3MEE A;  3TI0 A;  1NOZ A;  1VQ9 N;  4FK0 A;  2HHH K;  4KTZ A;  5AQL A;  4ZTF A;  1K8A O;  4DR4 K;  3V81 A;  3CM5 A;  4FJK A;  3VQD A;  1KVB A;  4CEF A;  1BWF O;  3DRS A;  4XEI A;  2P9P A;  4FJN A;  3OW2 M;  3LP0 A;  5T7B A;  4UQG A;  3MAQ A;  4F2S A;  1YIJ N;  1LW0 A;  4FXD A;  4K42 A;  3AA5 X;  4JKB A;  4X65 K;  4E1M A;  4CEQ A;  5CZ1 A;  4YOW A;  1SL1 A;  4OGE A;  5KPT A;  3LDP A;  3O4Q A;  4RG8 A;  2P9P B;  1IG8 A;  2ZQB A;  4H5T A;  3HVT A;  4HWI A;  4O5B A;  4C8O A;  2HHV A;  4F2R A;  4E7K A;  4B1Y B;  1W9H A;  3SAF A;  1NGF A;  2DTU A;  4EHU A;  1NOY A;  4DQI A;  3SK3 A;  4XH1 A;  1I3A A;  4BRI A;  2IS3 A;  4BRH A;  5I3U A;  1Q81 O;  3SQ0 A;  1YJW N;  3FZL A;  4MO4 A;  1BI4 A;  5IWA K;  4K8Z A;  2O4I A;  2VQE K;  3AVN A;  4BRL A;  1BU6 O;  4OPA A;  2Z1H A;  1NKE A;  4R79 A;  2OA8 A;  4IOA L;  1QQC A;  3K5L A;  3HXM A;  1XMO K;  4HHT A;  5AQO A;  3ZX3 A;  3A8Y A;  1NMD A;  1M1K O;  4ISE A;  1C0F A;  3QIC A;  1TK0 A;  1TKD A;  3AVB A;  1KTQ A;  2O8D A;  4CJ4 A;  4FWR A;  2GV9 A;  3LAL A;  3T1H K;  3C6H A;  3ZSY A;  5EU7 A;  3NHG A;  3MXJ A;  5FRN A;  4WQ5 C;  2OPS A;  3WNE A;  4DFM A;  2BUP A;  1V4T A;  4WQ4 C;  3KD5 E;  2ITM A;  4FVM A;  5KGX A;  3VA0 A;  3B8A X;  5AQQ A;  3RRG A;  1NU0 A;  3QNN A;  1GLD G;  4GNI A;  2UXC K;  1F21 A;  3H45 C;  4E7H A;  2O8D B;  4M7X A;  4DWI A;  3HTV A;  1VRU A;  1DEJ A;  4H5R A;  4H0Y B;  3V9S A;  1RDD A;  2FXU A;  3KZB A;  3VEV A;  2HBK A;  4DF8 A;  4BRM A;  1KVC A;  4JD2 A;  4RTF D;  3AVC A;  5KPR A;  1HYV A;  2NRH A;  2NRZ A;  4GKJ K;  1U2V A;  2VG5 A;  3NF7 A;  4CZM A;  4DUY K;  5J2Q A;  1J54 A;  3KIO A;  1U48 A;  5J1E A;  4R5P A;  3QEV A;  5HRO A;  3FZF A;  2HW3 A;  2NRT A;  4JD2 B;  2D4W A;  4EP5 A;  2P5G A;  1ASU A;  2HVI A;  4DKW A;  3GOI A;  3T69 A;  1T3V A;  1U2V B;  3OY9 A;  4NCB A;  4Y0W A;  1Y97 A;  1HNV A;  2OTJ N;  4RW4 A;  4M3Y A;  1MDU B;  4W5R A;  1HQU A;  4IDK A;  5F0X A;  1VQ4 N;  3QES A;  4ISG A;  4CEB A;  5J2N A;  2X6S A;  4CGF A;  1NK5 A;  4CBW A;  4EZ9 A;  4CEO A;  2R7Y A;  3HPH A;  1D9D A;  1KAY A;  1LWF A;  3ZT0 A;  1WAJ A;  4CIG A;  3O6W A;  3OYI A;  3O5B A;  2HB5 A;  2D0A A;  3O3G A;  4FJ9 A;  1MU2 A;  2OPP A;  2W6L A;  1BGX T;  1WBB A;  3O9T A;  5CY4 A;  3MN9 A;  3NMU A;  5AFU H;  3CFR A;  2NLX A;  2G8U A;  3QB0 A;  4G9Z A;  2EX3 A;  3ZX2 A;  4FM2 A;  1RTI A;  3K5M A;  4LF6 K;  2LSN A;  5FDL A;  1WSE A;  4FZY A;  3NE6 A;  1UAX A;  4CEC A;  2IOC A;  4B3R K;  1YTA A;  4WQ5 A;  3OS0 A;  2E2Q A;  3KHY A;  5ADX H;  1JLQ A;  2WOM A;  1T44 A;  4WQ4 A;  5C12 A;  3O8M A;  4M3X A;  2FBT A;  3THX B;  1RIL A;  3S3N A;  5FPN A;  2Z1J A;  2WBN A;  3ID8 A;  4BE1 A;  4DFJ A;  1IBM K;  2QWN A;  5CYM A;  3CCQ N;  1U4B A;  3H46 O;  4B1V A;  4CBU A;  3P4I A;  3VEW A;  1YI2 N;  2UXD K;  5H1S Q;  3EZW A;  3SUQ A;  2AA4 A;  1BL3 A;  3CFO A;  1O13 A;  4E19 A;  2HHT A;  5EY4 A;  4DSJ A;  1X3M A;  2E2O A;  4DS4 A;  4JHD A;  4RCH A;  4BG8 A;  4FLX A;  4M3W A;  4CF2 A;  5BPM A;  4CGG A;  2UUB K;  1JCE A;  1GLE G;  1WLJ A;  3FFI A;  3Q7B A;  2V7Z A;  3F9K A;  5FLX O;  4DFP A;  4O5F A;  4GV6 A;  3T7Z A;  1U45 A;  4FSV A;  5BRF A;  3ZSZ A;  4AQY K;  1Z05 A;  2JWL A;  5LL6 Z;  3VQC A;  3VGL A;  4JHD B;  1EP4 A;  2V51 B;  3OYH A;  5AQW A;  3GBT A;  3UKR A;  4JKH A;  5HLF A;  3LZI A;  4YOR A;  3LDS A;  1RTH A;  1RBU A;  3A5L C;  3P5J A;  3TAG A;  3LP1 A;  4FLW A;  1TVR A;  3OTO K;  3S3O A;  1W2B M;  4W5N A;  1VQO N;  4M3Z A;  3M1F A;  1T05 A;  4UY8 O;  1N32 K;  4ELT A;  1R59 O;  3UKR B;  4E0D A;  1KLM A;  1RT4 A;  2O8C A;  1NK9 A;  1LAV A;  2ZE2 A;  3AO4 A;  1K8K A;  4DUZ K;  4AF1 A;  3A0I X;  3CCJ N;  1ILY A;  4C8M A;  4CFC A;  2O8B A;  1FJG K;  5KQ8 A;  4CEZ A;  3OHR A;  3EYZ A;  3TSU A;  3MMV A;  1O1W A;  2FF6 A;  3L3U A;  2UYT A;  4O8U A;  2O8C B;  4DSE A;  4LF5 K;  1WB9 A;  1KLN A;  3VN5 A;  4HUF A;  1K8K B;  4E1J A;  3QDK A;  4RW8 A;  3HT3 A;  3GDQ A;  3LL3 A;  4X64 K;  4CF1 A;  2KZZ A;  2O8B B;  4B3T K;  4DTM A;  3QFU A;  1FKP A;  1HMV A;  4Z4G A;  1YJ9 N;  2FBX A;  3NF6 A;  3KTQ A;  1RGI A;  4JKF A;  4CED A;  4DV6 K;  4M63 C;  2ZM6 K;  1I39 A;  2KQ2 A;  3ZYY X;  4BRN A;  3AVM A;  2E88 A;  3ZSW A;  4DTO A;  1NJZ A;  3CJ7 A;  4FK2 A;  5B8H A;  4Z4I A;  2I5J A;  1RTJ A;  2YNG A;  4KPY A;  4FJ7 A;  1SUQ A;  4O4G A;  4KFB A;  4FVU A;  1XC9 A;  4O0I A;  3JS6 A;  3PO5 A;  5BRE A;  1DKG D;  4CK3 A;  3OYJ A;  4BWJ A;  3B6P A;  3J7A P;  4B1Z A;  5C25 A;  1HNX K;  2DFE A;  4J8F A;  1CLQ A;  1QSL A;  4DR6 K;  4JI2 K;  3KK1 A;  1TGO A;  1WSI A;  4CIE A;  3ISN C;  3CJA A;  3AA2 A;  2OAN A;  3PIO L;  3HPO A;  3SUP A;  1N5Y A;  4LD0 A;  1KRP A;  1OH7 A;  1NM1 A;  2VG7 A;  1NGD A;  3SMP A;  5J2P A;  1T03 A;  3OBY A;  1IKV A;  4FPA A;  2CGL A;  2A6A A;  5FRO A;  4W5O A;  3DLL L;  4B9M A;  4FPB A;  3L4Q A;  3TSP A;  3K9K A;  4CGJ A;  3VEY A;  4BRO A;  3TAM A;  4QS8 A;  5TKW A;  1E4F T;  3AVL A;  2NZT A;  1L3V A;  1W7A A;  3QEW A;  4KH4 A;  4BGB A;  1YIT N;  3G4S N;  4CK2 A;  2P9U A;  1YUW A;  4DHY A;  1S72 N;  1OH6 A;  4IFE A;  1JCG A;  3MEG A;  2BGG A;  1NGG A;  1SZ2 A;  4HUG A;  3MK6 A;  3WNH A;  1M90 O;  1N6Q A;  3J8A A;  4YOX A;  4H03 B;  2ZGZ A;  1H1V A;  3NVK A;  2QWQ A;  3AVG A;  1UA0 A;  3SYZ A;  1FXX A;  1IH7 A;  4EHT A;  4DLG A;  2P9U B;  3SI6 A;  3O9Q A;  3DXM A;  4CD3 A;  1BIZ A;  2VQF K;  1VSH A;  4BE0 A;  4AH9 A;  3RR7 A;  3KLI A;  1KD1 O;  4BRD A;  4CZI A;  1CZA N;  4KHN A;  3K59 A;  5ELZ A;  3CI5 A;  1ZYQ A;  1QQM A;  2YHB A;  1QS4 A;  5SWM A;  3DXM B;  4A57 A;  4FM1 A;  3J7Y P;  3EEQ A;  4PL7 A;  4B9V A;  1WBD A;  2G8I A;  4EFH A;  3KKR A;  3C0B A;  4BWM A;  4AIL C;  1GLA G;  3VQ5 A;  3L2V A;  4DV5 K;  2IIR A;  4F4K A;  4FK4 A;  4K41 A;  4B1U B;  4KB0 A;  3DLB A;  2VWK A;  3HJF A;  4IG0 A;  1KFD A;  5AQZ A;  2XHB A;  3V9Z A;  4LY7 A;  1KSP A;  3V6D A;  1S1U A;  2ATQ A;  1TAU A;  2YNH A;  2DFF A;  3K58 A;  2B4J A;  3AAQ A;  4CZK A;  3NCI A;  3G71 N;  2HMI A;  3KWI A;  5M1N A;  4KV8 A;  1LV5 A;  3I0R A;  1Q7Y O;  2J4R A;  2JWK A;  3H08 A;  1A5V A;  4WE1 A;  4FLY A;  4ILG B;  1HKB A;  2PYL A;  1HQE A;  3OBW A;  4CFB A;  4MLE A;  4FW1 A;  4WFB L;  3QFP A;  4N5S A;  4BGA A;  3E9O A;  3WNF A;  4Z0U A;  2W40 A;  3KJV A;  1NK6 A;  4CZE A;  3AVI A;  4IEE A;  3VA3 A;  1VSL A;  3HI0 A;  4KBO A;  3S41 A;  4FWM A;  5KGW A;  4H4M A;  2YJE A;  3AVJ A;  1N34 K;  4AHT A;  3SJJ A;  3CG7 A;  1U47 A;  2GWK A;  5JLH A;  5K14 A;  1N8R O;  1IJJ A;  3PX4 A;  4I6M B;  3L2W A;  3P38 A;  4CJK A;  2I7P A;  3JYT A;  2NRV A;  3ZSQ A;  2QKK A;  2XRI A;  5AQU A;  3C6T A;  3M8S A;  3BUZ B;  5LMU K;  4ILH A;  3V9W A;  4JI8 K;  4GKK K;  1HX1 A;  4OVL A;  1L3T A;  1Z26 A;  4DTJ A;  4DCH A;  4LFB K;  3TU5 A;  3QIO A;  5FRM A;  1WSG A;  4QOZ B;  1ESV A;  1WNS A;  4FWS A;  4CJ3 A;  3F2K A;  3CD6 N;  3AO1 A;  1QSS A;  1TV6 A;  3I0S A;  4BR5 A;  4JI3 K;  1RBR A;  4BRC A;  4JK9 A;  4XH4 A;  1IBL K;  1VQN N;  3KLH A;  2RN2 A;  3K5N A;  1YF5 L;  4DTS A;  4DFK A;  1WN7 A;  5AJ3 K;  3VPZ A;  4FJ5 A;  3ENH A;  4KH5 A;  3CJB A;  2Q2R A;  5HOO A;  1TAQ A;  3DJC A;  5E84 A;  4ICL A;  5BR9 A;  2O8E B;  1BG3 A;  4KH6 A;  4IFV A;  3DXK A;  4I2P A;  1T6D A;  2HNY A;  2KFN A;  3F5T A;  4FWK A;  3OJU A;  4ILJ A;  4C8N A;  1UOC A;  3QML A;  2QWR A;  1C1C A;  3M3Z A;  1U49 A;  3CER A;  4BC2 A;  3M8P A;  4BQL A;  2V52 B;  4GV3 A;  5CR4 A;  2A40 A;  4FJH A;  2FSK A;  3DXK B;  3SV3 A;  3EN9 A;  3HM8 A;  1I94 K;  1DTT A;  2HHW A;  1SAZ A;  2F7T A;  2HMP A;  3DOL A;  4LH5 A;  2DPN A;  4PKG A;  1N33 K;  1YJN N;  4KTQ A;  2BTF A;  2FF3 B;  1VQK N;  1C0U A;  4B9U A;  3OS1 A;  1J6Z A;  5JMV A;  1EX4 A;  5M1K A;  4M3U A;  2RKI A;  2XY6 A;  1RT7 A;  4QS9 A;  3NVM A;  4DV0 K;  2NUB A;  3JAM O;  2G8V A;  4KHY A;  2Q0R A;  2FBY A;  3H3N O;  3SNN A;  3KKS A;  1C6V A;  3I33 A;  2YHY A;  3PSF A;  4Y1D A;  4JI1 K;  3I55 N;  4CJP A;  4IWV A;  1Y64 A;  2KFZ A;  3RMC A;  1S1T A;  3OJS A;  1VSK A;  3RMA A;  4B3S K;  4CJS A;  4CJF A;  3ENO A;  4NCA A;  4PUO A;  3TAB A;  4YDU C;  5AQJ A;  3ZEU A;  3KLG A;  4Z4F A;  1RFQ A;  3MEC A;  2D0B A;  1X9W A;  2IGI A;  3OYB A;  1RNH A;  3H6E A;  5C24 A;  1QVG M;  1YT3 A;  4I7F A;  4JN4 A;  1GOC A;  4DSK A;  3QLH A;  2O4G A;  1VSM A;  3VQ7 A;  2AJQ A;  1ATR A;  4FYD A;  4LFC K;  3ZEU B;  3JSM A;  3QNO A;  4JI6 K;  1NLV A;  4LF8 K;  2QWL A;  3O9U A;  3C95 A;  2HBJ A;  5AR0 A;  3DM2 A;  4IBN A;  2ASP A;  1RT5 A;  4QAG A;  1BOT O;  1VQL N;  3AVA A;  5TKY A;  1NGC A;  3LDL A;  1WOQ A;  5GIO A;  3NAE A;  2HOE A;  4H0V B;  3LDN A;  3MWT A;  1KC8 O;  1TK5 A;  2A3Z A;  4IDH A;  3LAK A;  1SKS A;  3CM6 A;  1BIU A;  1NWK A;  2VYP A;  3HBT A;  3CC4 N;  1TKX A;  3U9Z A;  5FPD A;  4DR2 K;  3R1X A;  2DFH A;  3L0Q A;  5LJW A;  4BC4 A;  1NJW A;  3BGR A;  4PHT X;  4JRP A;  5AQY A;  1XI1 A;  2QXF A;  3L8B A;  1JLA A;  1HUX A;  3TAN A;  4BDY A;  3THX A;  3MXI A;  2UXB K;  3DYA A;  1OH8 A;  4JKG A;  1J9A A;  4CZG A;  1WSJ A;  2P9K A;  1RDA A;  3LP3 A;  3FE1 A;  1BCO A;  3WXJ A;  3M8R A;  2GTD A;  3KD1 E;  4F3T A;  1HR0 K;  2UUA K;  4IO8 A;  3AA3 A;  3BDP A;  4IXC A;  4HVJ A;  3A5M C;  4M45 A;  3N4Q A;  4E1N A;  4BRF A;  1ATS A;  3ZSR A;  4U67 L;  5BR8 K;  4JKG B;  5AQH A;  1Z25 A;  2P9K B;  3QBX A;  1S1W A;  4A5A A;  5HRS A;  1VSI A;  1VSF A;  4JAX A;  2GUI A;  3ALY A;  4K25 A;  3KK2 A;  1WAF A;  1NGA A;  4Q5V A;  2NRR A;  3P1G A;  3ZT1 A;  3D2E A;  4BRK A;  4KI6 A;  3OYG A;  4BVO A;  2F96 A;  1HPM A;  4MFB A;  3VQE A;  3P39 A;  4BQZ A;  1GLC G;  1MWM A;  5BPL A;  2XY7 A;  4B1W B;  3QO9 A;  4CJL A;  4OLA A;  3BF1 A;  3RMD A;  1OVQ A;  1ZBL A;  2W6K A;  5AQR A;  2PZS A;  5CE3 A;  4E3S A;  3CPE A;  3IS9 A;  3D2E B;  4CFA A;  3M8Q A;  2VCP A;  3QET A;  2XY5 A;  2QWO A;  2HHX A;  5JS1 A;  4JS4 A;  1E4G T;  3VEN A;  1NG9 A;  2P9L B;  3VOV A;  4IG3 A;  4DR7 K;  3MCA B;  3OYL A;  4E89 A;  4DTX A;  1HKC A;  5SZT A; 
#chains in the Genus database with same CATH homology
 2BAN A;  2FBV A;  3QEW A;  3S9H A;  4CIF A;  1X1P A;  3QIN A;  5C42 A;  4MQ3 A;  4OKE A;  4HCC A;  4N47 A;  4CK2 A;  4CHO A;  2D0C A;  1LAW A;  4CHP A;  3NH1 A;  3HPG A;  1TL3 A;  2PYJ A;  2A1S A;  3OYD A;  4N76 A;  3MEG A;  2BGG A;  4HUG A;  4OKJ A;  3VQA A;  4OGC A;  3L2R A;  1CZ9 A;  2G8H A;  1JLE A;  1JLF A;  1WSH A;  3WNH A;  4JRQ A;  5KI6 A;  4B9L A;  1C0T A;  3HP9 A;  3HP6 A;  3QEI A;  1N6Q A;  3UIQ A;  3KLE A;  1Q8I A;  3HL8 A;  4E7I A;  1K6Y A;  1SV5 A;  4E7J A;  4FLU A;  3MEE A;  3RTV A;  3AVG A;  3K5O A;  4CEE A;  1NOZ A;  2EHG A;  3TI0 A;  3ZT4 A;  3SYZ A;  1UA0 A;  4FK0 A;  1RCH A;  1FXX A;  1IH7 A;  2P51 A;  4KTZ A;  4DLG A;  4ZTF A;  4DQR A;  4DTN A;  3SI6 A;  1GOB A;  4CF9 A;  1NKC A;  4Z4E A;  1ZBI A;  1BIZ A;  3D0P A;  4ELU A;  3V81 A;  1VSH A;  4HCB A;  4BE0 A;  3CM5 A;  4AHS A;  4LSN A;  1KVB A;  3VQD A;  4AH9 A;  4KO0 A;  4CEF A;  3RR7 A;  4FJK A;  2G8F A;  2G8W A;  3DRS A;  1JL1 A;  1A5X A;  1XHX A;  3KLI A;  3AV9 A;  1TKZ A;  1FK9 A;  3AA4 A;  4FJN A;  4KHN A;  1DTQ A;  4DSI A;  3LP0 A;  5T7B A;  3NDK A;  3K59 A;  4AHC A;  4UQG A;  1RT3 A;  3MAQ A;  1Q9X A;  4KB1 A;  3RR8 A;  2P5O A;  3DLE A;  1ZYQ A;  4F2S A;  2QK9 A;  2YHB A;  1LW0 A;  1QS4 A;  5SWM A;  2XY8 A;  4FXD A;  1DLO A;  3AA5 X;  3AVH A;  3F73 A;  4FM1 A;  4ID5 A;  4E1M A;  2BDP A;  4FJG A;  4CEQ A;  5CZ1 A;  1QSY A;  4GMJ B;  5HRR A;  4B9V A;  3SPZ A;  3RWU A;  1SL1 A;  4OGE A;  5CZ2 A;  4Z4C A;  3O4Q A;  2G8I A;  2QKB A;  4RG8 A;  1S9G A;  2B5J A;  2ZQB A;  3KKR A;  3HVT A;  1T7P A;  4TSX A;  4O5B A;  1J5O A;  4BWM A;  4AIL C;  4C8O A;  1IKY A;  4CJV A;  2E6M A;  4F2R A;  3VQ5 A;  4E7K A;  4M42 A;  2HHV A;  3L2V A;  1J53 A;  5DK5 A;  2BE2 A;  1W9H A;  4RW6 A;  4F4K A;  4FK4 A;  3S3M A;  3ZCM A;  2DTU A;  1YTU A;  5HP1 A;  4J2D A;  1NOY A;  1HJR A;  4DQI A;  4KB0 A;  1D5A A;  2VWK A;  3DLB A;  3HJF A;  3VQ6 A;  4IG0 A;  1KFD A;  4I2Q A;  4K8X A;  3L2U A;  2XHB A;  3V9Z A;  1I3A A;  1RDC A;  2IS3 A;  4LY7 A;  1KSP A;  4XIU A;  3V6D A;  1KVA A;  1S1U A;  2ATQ A;  1TAU A;  5I3U A;  4DLE A;  3SQ0 A;  1BI4 A;  4K8Z A;  2O4I A;  3VQ9 A;  2HHS A;  2YKM A;  2YNH A;  1EXQ A;  3HST B;  1ZBH A;  2DFF A;  3K58 A;  3AVN A;  2HHU A;  2B4J A;  3NF9 A;  4CEA A;  3U6F A;  2HND A;  3NCI A;  2YNF A;  2HMI A;  4KKO A;  4M41 A;  2Z1H A;  4KV8 A;  3SUO A;  4OKK A;  1NKE A;  1LV5 A;  3I0R A;  2OA8 A;  3NGY A;  1ZBU A;  4NCG A;  3H08 A;  1QQC A;  1A5V A;  3K5L A;  3HXM A;  4HHT A;  4CF8 A;  4B9T A;  4WE1 A;  4FLY A;  4ZTJ A;  4ELV A;  1U04 A;  2PYL A;  1Q9Y A;  2ETJ A;  1HQE A;  4DQP A;  3VQ4 A;  3DLH A;  3D45 A;  2IAJ A;  3ZSO A;  1TK0 A;  3L2Q A;  4CFB A;  4CHN A;  1NJX A;  4FW1 A;  3SUN A;  4HTU A;  1TKD A;  4CFD A;  1BCM A;  3AVB A;  1KTQ A;  4N5S A;  5J2N A;  3MED A;  4I9L A;  2IDO A;  4CJ4 A;  1HYS A;  1L5U A;  2GV9 A;  3WNF A;  3LAL A;  5JS2 A;  1SKW A;  1W0H A;  4Z0U A;  3ZSY A;  3KJV A;  5EU7 A;  1NK6 A;  3NHG A;  1A5W A;  3MXJ A;  3AVI A;  3VQ8 A;  4DMN A;  4CJR A;  3CFP A;  3PV8 A;  2OPS A;  5FRN A;  3VA3 A;  3E01 A;  3TAR A;  1LW2 A;  3AVK A;  4CJ5 A;  1VSL A;  3OYC A;  2X78 A;  4GW6 A;  3WNE A;  4DFM A;  3WNG A;  3NF8 A;  4LSL A;  4N41 A;  3KD5 E;  5KGW A;  4FCY A;  4H4M A;  5DMR A;  4FVM A;  5KGX A;  3VA0 A;  3RRG A;  1CZB A;  3T3F A;  3AVJ A;  4AHT A;  4N56 A;  3QNN A;  1WSF A;  3P83 D;  3CG7 A;  3SJJ A;  3EY1 A;  1U47 A;  3V9X A;  1F21 A;  1RBT A;  4E7H A;  5K14 A;  4OPJ A;  4DWI A;  3PX4 A;  1VRU A;  3L3V A;  3L2W A;  4CJK A;  3V9S A;  1RDD A;  1RT2 A;  3ZSQ A;  4CGD A;  3JYT A;  2QKK A;  2XRI A;  3C6T A;  3M8S A;  3V4I A;  4CF0 A;  3V9W A;  2G8K A;  4B9N A;  4OVL A;  1L3T A;  1Z26 A;  4DF8 A;  1HNI A;  4DTJ A;  3TAE A;  1UA1 A;  2X74 A;  1YVU A;  3SQ2 A;  4M3T A;  3QIO A;  1KVC A;  2Y1J A;  4O55 A;  1X9M A;  4FZZ A;  1BIS A;  1C0M A;  1WSG A;  1VRT A;  3T19 A;  3AVC A;  3O3F A;  3OYM A;  4BDZ A;  4BDP A;  4QOZ B;  4NYF A;  1WNS A;  4KHS A;  4CJ3 A;  1HYV A;  2WON A;  3AO1 A;  3ZT2 A;  3KK3 A;  2VG5 A;  3HK2 A;  1QSS A;  1TV6 A;  3I0S A;  3NF7 A;  5CYQ A;  1REV A;  5J2Q A;  4BAC A;  4J2A A;  1J54 A;  1RBR A;  3SQ4 A;  2XO7 A;  3VQB A;  3KIO A;  3KLF A;  3ULD A;  1U48 A;  3KLH A;  1D9F A;  3IAY A;  5J1E A;  2RN2 A;  4CGI A;  1VK0 A;  4R5P A;  3K5N A;  3QEV A;  5HRO A;  4KAZ A;  4DTS A;  1JLG A;  4DFK A;  4OLB A;  2HW3 A;  1VSJ A;  2GBZ A;  4HUE A;  1JL2 A;  1WN7 A;  4EP5 A;  3LZJ A;  2P5G A;  4FJ5 A;  1RTD A;  1ASU A;  4M3R A;  2KTQ A;  4B8A B;  2HVI A;  4H8K A;  4CHQ A;  1TAQ A;  2FC0 A;  3NH0 A;  3OY9 A;  1NK8 A;  4NCB A;  1Y97 A;  3V1R A;  1HNV A;  4ICL A;  1IKX A;  1XHZ A;  1NKB A;  4IFV A;  4RW4 A;  4I2P A;  4M3Y A;  1RDB A;  3LPU A;  2HNY A;  4W5R A;  2W42 A;  1HQU A;  4IDK A;  2KFN A;  1XWL A;  4DTP A;  3QES A;  2DY4 A;  1RBV A;  4CEB A;  3OJU A;  2X6S A;  4CGF A;  4CE9 A;  1B9F A;  1GOA A;  1UOC A;  3QIP A;  4C8N A;  1NK5 A;  4CEO A;  1JLC A;  4EZ9 A;  4EZ6 A;  1C1C A;  2R7Y A;  4PWD A;  3HPH A;  1D9D A;  1LWF A;  3ZT0 A;  1U49 A;  4KRF A;  3OYK A;  1WAJ A;  4CIG A;  4DF4 A;  3OYI A;  2HB5 A;  2D0A A;  4OJR A;  3G0Z A;  4KHQ A;  3M8P A;  2YHA A;  3O3G A;  4FJ9 A;  1MU2 A;  2OPP A;  2E4L A;  4YFU A;  1BGX T;  1NK4 A;  1BQM A;  3RRH A;  1C1A A;  4L8R B;  4FJ8 A;  4DTU A;  1B9D A;  5KRT A;  3PX0 A;  4FJH A;  5CY4 A;  3SV3 A;  3CFR A;  3RMB A;  4CES A;  2G8U A;  1DTT A;  3NH2 A;  2YKN A;  2HHW A;  2EX3 A;  4ZHR A;  1CXQ A;  4OPK A;  1TL1 A;  4FM2 A;  1RTI A;  3EZ5 A;  3K5M A;  2LSN A;  3AO2 A;  3DOL A;  1WSE A;  5FDL A;  4LH5 A;  3PX6 A;  3NE6 A;  1UAX A;  1IG9 A;  4CEC A;  1D8Y A;  3PY8 A;  4FZY A;  2IOC A;  3OVN A;  1JLB A;  1TK8 A;  2HNZ A;  1YTA A;  3LWL A;  4KTQ A;  3OS0 A;  4DQQ A;  1C0U A;  1S6Q A;  3OS1 A;  5HRP A;  1TKT A;  5KTQ A;  1JKH A;  1JLQ A;  4B9U A;  4W5Q A;  2ITG A;  4J2E A;  2WOM A;  1EX4 A;  3O3H A;  1JXB A;  1BQN A;  3CQ8 A;  4M3X A;  2X6N A;  2FBT A;  4M3U A;  1RIL A;  3S3N A;  1RT6 A;  2Z1J A;  4G1Q A;  4BE1 A;  2RKI A;  4DFJ A;  3C94 A;  3TAQ A;  5CYM A;  4JLH A;  3DRR A;  4CJQ A;  2XY6 A;  1U4B A;  1ASV A;  1RT7 A;  3OYE A;  5I42 A;  3U3Y A;  4FJL A;  4I9Q A;  1HRH A;  2F8S A;  4KRE A;  4FLV A;  2NUB A;  3NFA A;  3SUQ A;  2G8V A;  2Y1I A;  4KHY A;  1BL3 A;  3CFO A;  3DOK A;  2FBY A;  4JS5 A;  3SNN A;  3KKS A;  3LP2 A;  1C6V A;  4FJX A;  4Q0B A;  4E19 A;  4Y1D A;  2A1R A;  3LWM A;  2HHT A;  1ZBF A;  4CJU A;  1BHL A;  4CHZ A;  4DSJ A;  5J2M A;  4CJP A;  2KFZ A;  3V1Q A;  1T8E A;  3RMC A;  4DS4 A;  3SZ2 A;  1S1T A;  3OJS A;  1VSK A;  3RMA A;  4FLX A;  4M3W A;  4CJS A;  4CF2 A;  4CCH A;  4O44 A;  4CJF A;  3NBP A;  1FKO A;  3NGZ A;  1S9E A;  4CGG A;  3QEP A;  2PY5 A;  4NCA A;  3TAB A;  4PUO A;  1WLJ A;  3FFI A;  3THV A;  1G15 A;  2Q3S A;  4C8L A;  1HPZ A;  3F9K A;  3KLG A;  2OZS A;  4IKF A;  3MEC A;  1RT1 A;  3HM9 A;  4DFP A;  4Z4F A;  4B3O A;  4CER A;  3TAF A;  4IFY A;  4AHU A;  1U45 A;  2D0B A;  1X9W A;  2IGI A;  3OYB A;  1RNH A;  4NYN A;  1R0A A;  4ID1 A;  5C24 A;  3ZSZ A;  2VG6 A;  3HVR A;  1B92 A;  3VQC A;  4FJI A;  1YT3 A;  4I7F A;  4KI4 A;  1EP4 A;  4YNQ A;  2B6A A;  4Y1C A;  1L3U A;  2RF2 A;  3OYA A;  2OYQ A;  3VQQ A;  2RPI A;  3OYH A;  3SPY A;  1GOC A;  4DSK A;  3TR8 A;  4RW9 A;  4FZX C;  3PUF A;  3QLH A;  2O4G A;  1VSM A;  3AO5 A;  3VQ7 A;  2AJQ A;  3HYF A;  4FYD A;  5HLF A;  3PO4 A;  4KHU A;  2Z1G A;  1ASW A;  3LZI A;  2OPQ A;  5FRM A;  1JXE A;  2E6L A;  3JSM A;  1KFS A;  3LDS A;  1IKW A;  1RBU A;  1RTH A;  3P5J A;  3QNO A;  1UWB A;  2HHQ A;  3NGI A;  1LWC A;  3VQP A;  3TAG A;  3I8D A;  3LP1 A;  4FLW A;  4PA1 A;  1TVR A;  3C95 A;  3S3O A;  1NJY A;  3OS2 A;  3LAM A;  4W5N A;  3TAP A;  3DM2 A;  4IBN A;  1RT5 A;  4QAG A;  4M3Z A;  1T05 A;  4Z4H A;  1RBS A;  4ELT A;  4E0D A;  3AVA A;  1X9S A;  1KLM A;  1RT4 A;  3DLG A;  1NK9 A;  1LAV A;  1L3S A;  3ASM A;  5HRN A;  2ZE2 A;  4GVM A;  4W5T A;  3NAE A;  4DS5 A;  4DU1 A;  4DU3 A;  3ITH A;  2YNI A;  3AO4 A;  1TK5 A;  3ZT3 A;  1EKE A;  3AO3 A;  4AHR A;  4C8M A;  4CFC A;  4FJJ A;  4DQS A;  3LAK A;  4H4O A;  4FM0 A;  1SKS A;  3CM6 A;  4CHY A;  1BIU A;  1HYZ A;  4CEZ A;  1NK0 A;  5D3G A;  2F8T A;  4BE2 A;  3EYZ A;  1O1W A;  1TKX A;  3QER A;  3L3U A;  2DFH A;  1NJW A;  1QTM A;  4DSE A;  3B6O A;  4J2B A;  3BGR A;  3U3G A;  1QE1 A;  1KLN A;  3SV4 A;  3VN5 A;  4JRP A;  4HUF A;  3V9U A;  1XI1 A;  4KHW A;  2QXF A;  1IO2 A;  4RW8 A;  1JLA A;  3HT3 A;  3L8B A;  3TWH A;  4PY5 A;  3DLR A;  3DLK A;  4CF1 A;  3TAN A;  2KZZ A;  4BDY A;  2KW4 A;  3DRP A;  3MXI A;  1SL2 A;  3DYA A;  4DTM A;  3K2P A;  1FKP A;  1HMV A;  2VWJ A;  4Z4G A;  1NK7 A;  3SCX A;  2FBX A;  3NF6 A;  3KTQ A;  1J9A A;  1WSJ A;  1RDA A;  3T1A A;  3LP3 A;  4CED A;  4B9S A;  1BCO A;  4CK1 A;  1I39 A;  2ZD1 A;  2KQ2 A;  2P1J A;  3LAN A;  3M8R A;  1S1X A;  4CJT A;  3KD1 E;  2KZM A;  4F3T A;  3AVM A;  3O4N A;  4FLT A;  3ZSW A;  4DTO A;  1NJZ A;  4FJM A;  4FK2 A;  4Z4I A;  3AA3 A;  3BDP A;  4RW7 A;  3LPT A;  2I5J A;  4M45 A;  4HVJ A;  4PQU A;  2HVH A;  1RTJ A;  3ZSV A;  2YNG A;  4E1N A;  3AVF A;  4KTW A;  3IRX A;  4KPY A;  4FJ7 A;  2D5R A;  3ZSR A;  1SUQ A;  4O4G A;  4KFB A;  1XC9 A;  1S5J A;  4O0I A;  1Z25 A;  4O0J A;  4LH4 A;  5E41 A;  3PO5 A;  1LWE A;  1S1W A;  2JGU A;  4CK3 A;  5HRS A;  3DMJ A;  1VSI A;  4CGH A;  1VSF A;  1SL0 A;  3OYJ A;  4QCL A;  4FLZ A;  2GUI A;  4BWJ A;  3A2F A;  3ALY A;  4B08 A;  2OPR A;  5KRS A;  3G10 A;  3KK2 A;  2OZM A;  3B6P A;  1WAF A;  4Q5V A;  3P1G A;  3ZT1 A;  5C25 A;  2DFE A;  1VSD A;  4KI6 A;  1CLQ A;  1QSL A;  3OYG A;  4B8C A;  3KK1 A;  2F96 A;  5HBM A;  4MFB A;  3VQE A;  3QEX A;  1TGO A;  3DI6 A;  4F8R A;  2XY7 A;  1S6P A;  1WSI A;  4CIE A;  3ISN C;  3QO9 A;  4CJL A;  3AA2 A;  3K57 A;  3HPO A;  4DSF A;  4DU4 A;  3SUP A;  1N5Y A;  4LD0 A;  1KRP A;  4F3O A;  4OLA A;  4FW2 A;  2VG7 A;  1BI4 B;  3RMD A;  3IG1 A;  1SKR A;  4DG1 A;  1ZBL A;  4DSL A;  1VSE A;  5J2P A;  1T03 A;  1S1V A;  4C8K A;  4AHV A;  1QHT A;  2IC3 A;  3C6U A;  1IKV A;  4CJW A;  2PZS A;  5FRO A;  4W5O A;  4DTR A;  4B9M A;  4E3S A;  3IS9 A;  3ZSX A;  4CFA A;  1ITG A;  3HO1 A;  3M8Q A;  3CYM A;  4E7L A;  4CGJ A;  3QET A;  1EET A;  2XY5 A;  2HHX A;  3TAM A;  5JS1 A;  4JS4 A;  2Z1I A;  1C1B A;  3OYN A;  4CJE A;  3SQ1 A;  4IG3 A;  1CXU A;  1KCF A;  4EP4 A;  3OYF A;  3OYL A;  4E89 A;  2JLE A;  2YV0 X;  3AVL A;  4DTX A;  3MXM A;  3V1O A;  1L3V A;  5SZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...