3ZSWA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zswA00
4ZTFA 1D9DA 3KK1A 4W5TA 5J1EA 4E7IA 3QEXA 4KB1A 5C24A 4CIGA 5CYQA 3K5NA 4IFYA 4RW4A 4CEEA 4RW9A 4CFCA 4RG8A 4I9LA 3TAEA 1QTMA 4Z4GA 1RDAA 1U45A 1VSIA 1MU2A 5CZ2A 4CESA 3LPUA 3SPZA 4KRFA 4PA1A 2GV9A 4AHVA 3MEDA 1Q9XA 4B9NA 4AHTA 1WSEA 2DFFA 3I8DA 4CGFA 1QSYA 2Y1JA 3LP3A 2YKMA 4DTSA 2OPRA 4KB0A 1ZBLA 4JLHA 1U49A 4M3WA 3AA5X 3NF7A 3RMCA 3OYHA 1UA0A 4DFJA 4FLUA 1U4BA 1GOAA 4Z4HA 4O0IA 3OYCA 3WNFA 4EZ6A 3SYZA 4O44A 4DQPA 4K8XA 1RTDA 1QE1A 4E7KA 4DS5A 2PYJA 1GOBA 1IKVA 4DSEA 3OYFA 3CFRA 4N5SA 1BL3A 4E1NA 4B9UA 2IDOA 2YNGA 3U3GA 4HUEA 2P51A 3B6PA 2WOMA 2F8TA 3M8RA 4F4KA 3KTQA 4DWIA 3HO1A 2RF2A 3L3VA 3O3GA 3O3HA 2DY4A 3ZT3A 1KLNA 2P1JA 5CZ1A 1R0AA 3UIQA 1IO2A 4Y1DA 4GW6A 3TR8A 4OLAA 1HQUA 1LAWA 4G1QA 4CK1A 4FLVA 2BDPA 1BHLA 3S3NA 1L5UA 3LAMA 2O4IA 3OYJA 3C95A 1C1BA 2LSNA 4CHNA 1L3SA 4M3RA 4E89A 1WNSA 1VRUA 3WNGA 5HRNA 5KRSA 4CF9A 4R5PA 4CEDA 2KW4A 4FM1A 3K5MA 2GBZA 4FJ7A 2YKNA 1WSGA 1VSJA 2ETJA 3OYMA 1SL0A 1HJRA 1ZBIA 4FVMA 2D5RA 3KLIA 4F8RA 2F8SA 2KZZA 4FLYA 1RDCA 4M42A 1D9FA 4KHUA 1BQNA 4CGGA 4LD0A 1HPZA 4BWJA 3QLHA 1NKEA 1XHXA 4B9MA 4W5QA 1S5JA 1S1XA 2X78A 1ZBUA 2EX3A 4OGEA 3VQQA 3NH1A 4BE1A 4BDPA 1TK8A 4IFVA 1CZBA 1W0HA 1UA1A 4I2QA 1QSSA 2B4JA 4FJLA 1HRHA 1JL1A 3ZCMA 2YV0X 5J2PA 4DS4A 3S9HA 3EZ5A 3RRHA 4ZHRA 5KGXA 1NJWA 1KFSA 3CG7A 2BANA 2IC3A 3L2UA 3LZJA 3L8BA 4CGJA 4DFKA 1N5YA 3RRGA 3M8QA 2RN2A 3SPYA 3AA4A 1GOCA 3LWLA 4B8AB 2OPPA 3KKRA 2D0AA 3K5LA 2G8KA 4E7HA 4HCBA 1BI4B 3AVKA 1BIUA 3LANA 1RTJA 4I2PA 4FLXA 2E6LA 1NK4A 2X74A 3BDPA 4C8LA 4CK3A 4FLTA 3T19A 1RBRA 1IKWA 1EX4A 3K2PA 3IS9A 4DTRA 1NKCA 1TL3A 3L2QA 2A1SA 1BQMA 3DRPA 4RW8A 3V81A 4ICLA 2B6AA 5C42A 1C0TA 2I5JA 3HJFA 1WSIA 4O0JA 3OY9A 1NK7A 2G8UA 2HNDA 1Z25A 5I42A 4FJ8A 1LWCA 4CGHA 3LWMA 1QSLA 2F96A 3HM9A 4DU3A 2ATQA 4KI6A 2VG7A 2X6SA 4OKJA 3AO4A 3QINA 4HCCA 3AVIA 3K57A 3TAQA 2BGGA 3AO1A 4IG3A 5E41A 5SWMA 3SJJA 3OS2A 2AJQA 1RT7A 4FW1A 1ASWA 2VG6A 1REVA 3ZSXA 3RTVA 3PO5A 2ZQBA 3O4NA 3OJUA 4FJXA 3THVA 5D3GA 4CF1A 3SZ2A 1XI1A 1KVAA 2WONA 3KLHA 1WSFA 1TKDA 2KFNA 3QNNA 2YHAA 3HVRA 1N6QA 4PY5A 4UQGA 5HLFA 1JLAA 3NGYA 1A5XA 4CECA 4W5NA 2DFEA 3ZSYA 3ZSOA 5HRRA 4ID1A 3TAGA 3HXMA 2PYLA 4CERA 2E4LA 1S1UA 4N56A 2KFZA 3HPGA 1T03A 4DSLA 4CJSA 4FK0A 1BIZA 2G8WA 3L2WA 1LAVA 2Z1HA 3O3FA 4KTQA 3QIOA 3NF6A 2YHBA 1RT3A 3DLKA 4CJ4A 3OYGA 2YNHA 4CHQA 4RW6A 1SKWA 4CEQA 4HTUA 1L3UA 1ZBHA 4DQQA 1SKRA 3DLRA 3DOLA 4O4GA 2VWJA 4FJ5A 1RBSA 3VQ7A 2XO7A 2XY8A 4NYNA 1NJXA 3PO4A 3NF9A 4KO0A 1S1WA 3NCIA 3DLHA 4YFUA 3AVCA 1BISA 3KK2A 4FW2A 2FC0A 4FZXC 1Y97A 3LZIA 4EP4A 3TAMA 4JRPA 3TABA 3RMDA 2G8IA 3CFPA 4CIFA 3MXJA 1ZBFA 4CFBA 3JSMA 3O4QA 4AHCA 1JL2A 1WAJA 2FBVA 4BE0A 3AO2A 3B6OA 4CJTA 2P5OA 2HHWA 1IG9A 2HNZA 2Z1JA 1Q9YA 4RW7A 2HHUA 4PQUA 3ASMA 3VN5A 3OYIA 4NCGA 1D8YA 2NUBA 4CHYA 3EYZA 1SV5A 4FLWA 3TI0A 3TWHA 4H4OA 4DSIA 4DF4A 3TAFA 1T8EA 1RCHA 2HW3A 3DLGA 5HROA 1HYZA 2HB5A 4F2RA 3NFAA 3KIOA 3LP2A 2HMIA 4DQIA 3SQ4A 4XIUA 3C6TA 3C6UA 4GMJB 4KTWA 4B9VA 3G0ZA 3VQ9A 1O1WA 4FJKA 1RT6A 2D0CA 3SUNA 1TGOA 3NHGA 3OYEA 3LPTA 1VRTA 4OJRA 2HNYA 3FFIA 4CHPA 3HT3A 4FLZA 1TKTA 3V9WA 1NJZA 3TARA 4CJFA 3AVBA 2E6MA 1YTAA 4CJQA 1NK8A 3TANA 3T1AA 4FJNA 4HHTA 1C1CA 3SNNA 1SL2A 4WE1A 2HVIA 2HHSA 5K14A 2XRIA 1Q8IA 3OYBA 1NOYA 2KQ2A 4O55A 1TKZA 4FCYA 1B9FA 4E1MA 3PY8A 3DLBA 4CJUA 3VQ6A 2QKBA 1JLEA 5CYMA 4CF2A 3MAQA 2DTUA 3VQCA 3PX4A 1C0UA 1TAQA 4C8MA 3IAYA 3AA2A 4FJIA 4FZZA 4E7LA 5HBMA 3T3FA 2XY6A 1X9WA 4CCHA 3KD5E 3V9SA 3M8PA 1KVBA 4KKOA 3OYLA 1CZ9A 3E01A 3QEIA 1SUQA 3RR8A 4M3YA 4CEOA 3LAKA 3OS0A 4BE2A 4DQSA 1VSHA 4CJPA 5J2NA 5FROA 4KPYA 2G8FA 4H4MA 3U6FA 1KFDA 4HVJA 2OPSA 1HNIA 3HPHA 4Y1CA 1TVRA 4CGIA 5J2MA 4Z4FA 2HVHA 4DLGA 4ELUA 3NE6A 4PWDA 3AVLA 5DMRA 1KRPA 2OZMA 1CLQA 2YNFA 3HP9A 4AHRA 3K59A 4KI4A 1TL1A 3L3UA 4OPKA 1RT5A 4CEBA 1WSJA 1RTIA 4CFAA 4CJEA 3OJSA 2HHQA 3IG1A 3AVHA 3DI6A 4I7FA 3PV8A 4QAGA 2OA8A 4N41A 1A5WA 3EY1A 3OYAA 1BGXT 4DTPA 1ASUA 3CM5A 4Z4CA 3ZSQA 4CJ5A 2GUIA 1WSHA 3V1OA 3NGIA 2XY7A 4BDZA 3QEVA 1Z26A 1VSKA 3SUQA 4CEFA 4ID5A 1X9MA 1EP4A 4OPJA 4DSKA 3AVGA 1VSFA 1XWLA 4LH5A 4HUGA 3ZSWA 1I3AA 4JS4A 5KTQA 4DLEA 1VSLA 1YT3A 3MEGA 1VK0A 1J5OA 5FRNA 1RT1A 5FDLA 1NKBA 4CGDA 4CE9A 2W42A 3G10A 4CJRA 4DU1A 1CXUA 2B5JA 1T7PA 4CFDA 4DF8A 4KHWA 1QS4A 1L3VA 1UWBA 1B9DA 1EETA 1S6PA 3OVNA 5HRSA 3VQBA 4C8KA 4NCBA 1S1VA 1BCOA 1G15A 4OKKA 4CK2A 4LSLA 3V1RA 4DTMA 4C8OA 3QNOA 4DSJA 4KHQA 2IGIA 3SQ1A 2XHBA 2A1RA 5SZTA 2YNIA 3IRXA 1J54A 1JXBA 5DK5A 3OYKA 5C25A 4J2EA 3L2VA 3JYTA 1SKSA 1X9SA 5KI6A 4M45A 1WN7A 1K6YA 4MFBA 3SQ0A 4AH9A 1RDBA 1NK6A 4K8ZA 4QOZB 1WLJA 4CJWA 4J2AA 2ZD1A 4CF8A 4FM2A 1UAXA 4CIEA 4DTUA 4EP5A 4PUOA 1QQCA 3AVAA 3KLEA 1T05A 3V6DA 4DTNA 1IH7A 3CFOA 1RBVA 2IS3A 4JS5A 4F3OA 3NH0A 1J53A 3KKSA 4L8RB 1LWFA 4CHZA 1JLCA 4FJ9A 1ITGA 5KGWA 4FJMA 1S1TA 4CHOA 4E3SA 3MECA 2OZSA 1JLFA 4FM0A 1BCMA 4B08A 2PY5A 1ZYQA 4AHSA 4FJGA 3K58A 2QXFA 4ELTA 2KTQA 4ZTJA 4E7JA 5EU7A 3KLFA 3QERA 4DG1A 1ASVA 3NF8A 4E19A 1J9AA 4W5RA 2Z1IA 4KTZA 3I0SA 3AVMA 3KK3A 4BACA 1TV6A 3RR7A 3BGRA 1NK9A 4LH4A 1B92A 2G8VA 4OVLA 3VQEA 2XY5A 4M3UA 4Z4EA 1HYVA 4C8NA 4AHUA 3AVNA 1HMVA 3ZT1A 3LDSA 5CY4A 1NK5A 4KAZA 2QK9A 2RPIA 4J2DA 4B8CA 1RT4A 1C1AA 4IG0A 2D0BA 1RT2A 1BI4A 5HP1A 3V1QA 1HYSA 2EHGA 3CM6A 5T7BA 1LW0A 4GVMA 4I9QA 2IOCA 4M3ZA 3AVJA 3ZSZA 3S3MA 3QIPA 3HK2A 2ZE2A 4OLBA 1NJYA 3HL8A 1TK5A 1DLOA 1RNHA 2VWKA 3VQ5A 1DTTA 5KRTA 3ULDA 3ALYA 5JS1A 4CJLA 3QESA 4QCLA 3ZT0A 1RBUA 2FBTA 4Q5VA 4FXDA 3QETA 4CJVA 4Q0BA 2BE2A 1C0MA 1FKOA 1YVUA 1DTQA 3P5JA 4CEZA 4M3XA 1YTUA 3V9UA 4KHNA 1LWEA 4Z4IA 1HNVA 3HYFA 3NAEA 1TK0A 4F3TA 3A2FA 2RKIA 3LALA 4TSXA 3DLEA 3WNHA 3ZSRA 3ZT4A 3OS1A 3QEPA 3F9KA 1NK0A 4DU4A 4B9LA 4F2SA 3HP6A 4B3OA 4FK4A 3M8SA 1U47A 3S3OA 3LP0A 3D0PA 3U3YA 1LV5A 3PX0A 2ITGA 5HRPA 3AVFA 3KLGA 2Y1IA 2OYQA 3H08A 1FXXA 3C94A 4CJKA 3SV3A 3MXIA 4B9TA 2X6NA 1JLQA 3L2RA 4O5BA 4J2BA 1LW2A 1WAFA 1KCFA 4KV8A 3VQAA 4N76A 1TAUA 3DYAA 2VG5A 5J2QA 5I3UA 4DMNA 3HVTA 1U48A 3VQ4A 4KFBA 3MXMA 4H8KA 2DFHA 3VQDA 1EKEA 4CEAA 3CYMA 1VSEA 4FYDA 4E0DA 4DTXA 3RMBA 3NDKA 2QKKA 3OYDA 3QO9A 3LP1A 3AA3A 1KTQA 4CJ3A 3RMAA 1XC9A 1VSMA 3SI6A 3KJVA 3V9ZA 1D5AA 1JLBA 2OPQA 1JXEA 1RBTA 4W5OA 3DOKA 2P5GA 2HHXA 2JLEA 3HSTB 4LY7A 3ZSVA 1RILA 4DTJA 1KVCA 1S6QA 3AV9A 3P83D 4YNQA 3DRRA 4NYFA 3V9XA 3AO5A 3SUPA 4LSNA 3TAPA 1UOCA 2FBYA 4DQRA 1F21A 1CXQA 4OKEA 1XHZA 4BWMA 4FZYA 4NCAA 1FKPA 4EZ9A 1FK9A 2G8HA 4B9SA 3KD1E 3SV4A 4DFMA 2Q3SA 1TKXA 3HPOA 3AO3A 4HUFA 1JLGA 3P1GA 4IBNA 2R7YA 3V4IA 1W9HA 3ISNC 3CQ8A 4KHYA 1HQEA 3VA0A 4M41A 2HHVA 3F73A 1IKXA 4M3TA 1KLMA 3VA3A 3VQ8A 3PX6A 3DMJA 4IDKA 5JS2A 4DFPA 2IAJA 3RWUA 4IKFA 4JRQA 4DSFA 3K5OA 3PUFA 3NBPA 2O4GA 3ZT2A 1RTHA 4FJHA 2JGUA 3VQPA 2HHTA 2Z1GA 1QHTA 3QEWA 3NH2A 1A5VA 1EXQA 3DRSA 4AILC 3SQ2A 3OYNA 2PZSA 1VSDA 3MEEA 3WNEA 4KHSA 3DM2A 1I39A 4OGCA 1NOZA 1RDDA 1S9GA 1KSPA 4ELVA 4FK2A 4KREA 3NGZA 4N47A 4CF0A 3ITHA 1S9EA 1X1PA 4BDYA 1SL1A 2FBXA 2KZMA 4MQ3A 3SCXA 1C6VA 3D45A 1L3TA 1U04A 4DTOA 1JKHA 4FJJA 5FRMA 3SUOA 3I0RA 1IKYA 4Z0UA
chains in the Genus database with same CATH superfamily
3KK1A 1P8ZA 4A2AA 2E2OA 2O8DB 5J1EA 4E7IA 5C24A 3M1FA 4DV0K 3E9OA 4LFCK 3O5BA 3HRGA 4PA1A 4BVPA 5LMUK 2QWRA 4AHTA 5JVGL 4CGFA 1QSYA 3G4SN 4NXMK 1NGHA 4E1JA 2OPRA 4KB0A 3LDOA 3NF7A 3WQUA 4DFJA 1U4BA 2P9SB 1GOAA 3OYCA 3SYZA 1Q81O 3H3NO 1GOBA 3OYFA 1BA1A 3N4PA 4IOXA 2IDOA 4K43A 2P51A 3B6PA 4KH6A 3KTQA 3O3HA 3L3VA 5AQNA 3ZT3A 1KLNA 2IVNA 1R0AA 3UIQA 4MDAA 2QWQA 2ZF5O 2WUSA 4BRAA 4KH5A 1LAWA 4G1QA 3U9ZA 1T44A 2BDPA 5F0XA 2UUCK 3OYJA 1C1BA 3TTCA 3WNGA 1J6ZA 1GLJO 3K5MA 4FJ7A 1ZBIA 5DM6L 3EE9A 4M42A 4WQ5C 4LD0A 2BH1A 3QLHA 3SBGA 1NKEA 3H1QA 1XHXA 1NM1A 2F9WA 1H1VA 4W5QA 1QZ5A 3W3DA 2EX3A 4I2QA 1HRHA 5AQKA 5J2PA 3S9HA 3RRHA 3FZHA 3L2UA 4DFKA 4CGJA 2AA4A 4FVUA 3SPYA 2P9LA 1NBWA 5TKYA 2D0AA 2G8KA 3FGUA 1SAZA 3LANA 1BIUA 2KHOA 4B1WB 4I2PA 1NK4A 3CJAA 3BDPA 1IKWA 3K2PA 4HTLA 1IJJA 3L2QA 1QQMA 3I33A 5C42A 2NRVA 2VGNA 4O0JA 4A59A 1N8RO 3LWMA 3VTIA 4JKFA 4KI6A 2VG7A 4OKJA 2FXUA 4HCCA 2BGGA 5E41A 3VGLA 3OS2A 1RT7A 3HZ6A 4B1UB 1XMOK 2Q1NA 2JWLA 1KVAA 3KLHA 1TKDA 2HMPA 2YHAA 1O13A 1N6QA 3CC4N 5HLFA 3MK6A 4CECA 2W41A 3ZSYA 3M3ZA 3ZSOA 3TAGA 2O8EB 3BY5A 3HPGA 4FK0A 4BRKA 3DXKB 1LAVA 4KTQA 3QIOA 2YHBA 4CJ4A 1SKWA 1ZBHA 3NVMA 3ULEB 4O4GA 4QS8A 2VWJA 3VQ7A 2XY8A 3ZX2A 2WC9A 3NF9A 3DLHA 1XQSC 4FZXC 3LZIA 4G9ZA 3BF3A 4MO5A 3TABA 4JI7K 1HR0K 1ZBFA 3JSMA 3O4QA 1LOTB 3H3OB 1JL2A 1WAJA 3UKUA 4DV1K 3B6OA 1K8AO 4FLWA 4BRQA 3C6HA 4RTFD 1MA9B 3TWHA 1GLDG 1T8EA 1HNZK 3DLGA 4F2RA 3NFAA 3C6TA 3C6UA 5GADP 2FSJA 3VQ9A 4A5BA 4FJKA 1NGGA 4LFAK 1TGOA 3NHGA 3V9WA 5AZJA 1VQ5N 3TANA 2HHSA 1C0FA 1YVNA 4L3QA 4AM7A 2XRIA 1NOYA 3QFPA 4DCHA 1B9FA 4E1MA 3SMSA 3VQ6A 2QKBA 1JLEA 4DV4K 4B1XB 3VQCA 3CC2N 4BR7A 4MO4A 2QWPA 4CCHA 4O8UA 2XY6A 1KAXA 1HLUA 3V9SA 1KVBA 4KKOA 3OYLA 4BY9C 3VEZA 4M3YA 3THYA 2WTUA 4JKAA 3OS0A 5LJWA 4DQSA 1VSHA 4V19S 4KPYA 2G8FA 4H4MA 1U2VA 1IBMK 2OPSA 1HNIA 1TVRA 4CGIA 5J2MA 3DWLA 2OZMA 5IT9O 4B3SK 4BR4A 1QQOA 3CCJN 2HBKA 1RTIA 2IVPA 3IG1A 1WBBA 4N41A 4QAGA 1BGXT 5AQIA 1WSHA 3V1OA 3NGIA 3TTDA 3ULEA 4BRHA 4A61A 3QEVA 1X9MA 4R79A 1EP4A 1QVFM 1EWQA 1XWLA 4LH5A 4HUGA 4X64K 4DLEA 1VSLA 1NGIA 1VK0A 5FRNA 1RT1A 2P9IA 1NKBA 3A5NC 4CJRA 3CI5A 1SQKA 4FPBA 5HRSA 4JK7A 4C8KA 4CK2A 3QNOA 2IGIA 2A1RA 2BUPA 4H5NA 4A5AA 2A40A 3IRXA 4JEPA 4JKCA 5C25A 4J2EA 3A0IX 4M45A 1WN7A 4K8ZA 1BU6O 4CJWA 4CF8A 4DTUA 4ISFA 2P9UA 3CCSN 2ASPA 3O9SA 1IH7A 3CFOA 5IWAK 1JLCA 4BREA 3ATVA 3DLLL 2PY5A 1BCMA 4B08A 1ZYQA 4ZTJA 1DGKN 3U8XA 4KTZA 5GAHP 3I0SA 3KK3A 4H0YB 4OPAA 1B92A 4OVLA 2NZTA 3VQEA 4M3UA 1HYVA 4C8NA 4AHUA 5LMNK 1HMVA 3ZT1A 3L4QA 3WT0A 4BQLA 1BI4A 3V1QA 5T7BA 3MWPA 3CCRN 5AQVA 4I9QA 3S3MA 1RNHA 4WCEL 1DTTA 5KRTA 3ULDA 3ALYA 5BN8A 1N34K 3AARA 3QESA 5M1FA 4QCLA 2FSKA 1RBUA 2D1KA 4CEZA 1GLLO 3J7AP 3HBTA 3CC7N 3MX5A 4JI3K 1TK0A 4TSXA 1NK0A 2ZGZA 4H5WA 2YHYA 4EHTA 3M8SA 1NGCA 2ITGA 3AVFA 3KLGA 3H08A 2P9KB 5EX5A 1JLQA 3L2RA 1LW2A 4N76A 1TAUA 4LF6K 5I3UA 5J2QA 1Q7YO 3CPEA 4KFBA 2DFHA 4FWMA 5AFUH 4CEAA 1NG9A 4FYDA 4WQ4C 4DTXA 1OKJA 3QO9A 1JJ2M 4KHPK 1VSMA 1GLFO 1D5AA 2OPQA 1RBTA 3DOKA 3ZSVA 3EL2A 4YNQA 3P83D 3AO5A 3MCPA 3TAPA 3C7NA 5FLXO 2W6KA 1CZAN 1XHZA 4EZ9A 4FWLA 4WF9L 4FWPA 2G8HA 1TKXA 4LF8K 3AO3A 2V52B 3V4IA 3LDPA 1HQEA 4M41A 3K0SA 5JS2A 4JKDA 3K5OA 4DUZK 1V4TA 3NBPA 2O4GA 2Z1GA 1YJ9N 3D6RA 1EXQA 3ATUA 1W2BM 5C2DA 3WNEA 4ELVA 4FK2A 4OGCA 1NJIO 4B1VA 1KSPA 3NGZA 1KD1O 2P9PB 3RVCA 4AF1A 3ZLJA 4JK9A 3CIPA 3VOVA 4JHDB 1C6VA 5I9EB 4FJJA 3SUOA 3GOIA 1IKYA 4FPAA 4C1NK 4ZTFA 2O8CA 4BRDA 4W5TA 1Z05A 2V7YA 3QEXA 1XNQK 3H1VX 5CYQA 3PIOL 4IFYA 1NGFA 4RW4A 4CFCA 4RW9A 4RG8A 5AR0A 5A2QO 1RDAA 1VSIA 1MU2A 5CZ2A 5GIOA 5AQMA 3MEDA 1Q9XA 4B9NA 3LDNA 1WSEA 2DFFA 4XH1A 3I8DA 2Y1JA 3LP3A 1U49A 4M3WA 3RMCA 3N4QA 4YOYA 4DR4K 4DQPA 4O44A 1YUWA 4K8XA 1QE1A 4QS9A 4DSEA 4N5SA 1YI2N 2QTDA 4JKEA 2WOMA 2P9NA 4F4KA 5LJVA 2RF2A 1YITN 3CJ7A 2ASMA 3WXLA 3OBYA 4Y1DA 4OLAA 5F2RA 1HQUA 4B3TK 1BHLA 3LAMA 2LSNA 1L3SA 4M3RA 4DR6K 4E89A 1WNSA 2E1ZA 4PL8A 1VQKN 2KW4A 4FM1A 2QM1A 2GBZA 2Q2RA 2YKNA 1VSJA 3KLIA 2F8SA 4FLYA 1D9FA 4KHUA 1M1KO 4CGGA 4JI0K 4B3RK 4BWJA 1KQSM 1RDWX 4BRNA 4B9MA 1S5JA 2A42A 2X78A 4OGEA 3NH1A 3VQQA 5TKWA 4BDPA 4IFVA 1CZBA 2B4JA 4DHYA 3F9MA 5KGXA 1KFSA 1N5YA 1KAZA 2IC3A 3LZJA 2P9PA 3M8QA 1E4GT 3IUCA 3AAPA 4B8AB 2OPPA 2VQFK 4O5FA 4DB3A 4HCBA 4BG8A 4LF5K 3KK7A 4C8LA 4NLBA 2HBLA 1RBRA 2UXDK 4YOWA 1SZ2A 1TL3A 1C0GA 3D7EO 3CF5L 3NVKA 2B6AA 1C0TA 3THXA 3A8YA 4CGHA 3BF1A 1QSLA 4DU3A 2ATQA 2X6SA 1YJNN 3QINA 4FWRA 2FSNA 5SWMA 5M1NA 5AQQA 4EIAA 2VCPA 5GAEP 4U67L 5AQRA 1REVA 4ILJA 3PO5A 3THVA 2VQEK 4CF1A 2KFNA 1WSFA 2Q36A 3QNNA 4K41A 1HKGA 3GL1A 4FWOA 3ZEUA 4UQGA 1JLAA 3NGYA 3MCAB 2PFUA 5ADXA 3LM9A 5M1PA 5HRRA 4ID1A 3HXMA 3EKSA 5M1KA 4M63C 4N56A 2G8WA 3L2WA 3O3FA 4IZ9A 3MX2A 4DR3K 1QZ6A 3NMUA 3DLKA 2YNHA 2O8FB 2YJEA 1SKRA 3DOLA 1TUYA 2XO7A 4NYNA 5KPTA 3PO4A 1ILYA 3O9RA 2H3GX 3AVCA 1BISA 5LY3A 2FC0A 1Y97A 1N33K 4UY8O 4CIFA 4JV5K 3IKMA 2QEXN 1X3MA 3AO2A 4CJTA 1IG9A 1Q9YA 4RW7A 5FPMA 4BRPA 3ASMA 3VN5A 1YJWN 1D8YA 4CHYA 3EYZA 3EZWA 4IFEA 4DF4A 2HW3A 3MN6A 1HYZA 4JK8A 2HB5A 2F4VK 2PAVA 4PHTX 4BC4A 2HMIA 4BC2A 3SBTA 4KTWA 3G0ZA 4YOVA 5HL7L 3LPTA 4CHPA 1TKTA 2D0PA 4CZJA 4CJFA 1NK8A 2E6MA 4FJNA 4NLCA 3BZCA 4YDUC 3T1AA 1C1CA 4HHTA 3SNNA 2HVIA 4QS7A 2DPNA 2KQ2A 1TKZA 4BRMA 2NLXA 4J8FA 3MAQA 5CYMA 5CE3A 4CF2A 3FZMA 3WQTA 4H0PA 4C8MA 4FJIA 3AA2A 2NRXA 5HBMA 3RR8A 3M8PA 4DWIA 5AZIA 3QEIA 1SUQA 4LFBK 4CEOA 3LAKA 4CJPA 3T1HK 5FROA 5AJ3K 4YORA 4HVJA 3KHYA 4Y1CA 3D2FA 2DTUA 4DLGA 2E1YA 3NE6A 4HWIA 2J4RA 5DMRA 4ELUA 4PWDA 2O8DA 2YNFA 4AHRA 1E3MA 3UE5A 1TL1A 3ID6A 1WSJA 4CFAA 4XH5A 3WEEB 2FLOA 1RDUA 3OYAA 4PKHA 1ASUA 4H0OA 3ZSQA 2O8FA 3SUQA 1VSKA 4CEFA 4OPJA 4DSKA 3AVGA 1VSFA 2YHWA 4K42A 1DKGD 3T7ZA 1NNEA 5ELZA 4CE9A 4RCHA 2W42A 2P9SA 3ZETB 3VESA 1T7PA 4DF8A 1VQPN 4KHWA 2PBDA 4B1ZA 1B9DA 1EETA 4YOUA 1G15A 4KRFA 3V1RA 4DSJA 1X3NA 5SZTA 2FF3B 1J54A 1JXBA 3JYTA 1SKSA 1K6YA 4MFBA 3SQ0A 4CW7B 1NK6A 4QOZB 4OO1J 1NGJA 4H5TA 4FM2A 2WFBA 3WUHA 1T05A 3AVAA 3MN9A 1RBVA 4JS5A 3NH0A 1LWFA 3GE1A 4FJMA 3J7YP 4E3SA 1VQNN 2GEMA 5F1XA 1JLFA 4B9QA 4FJGA 3EEQA 2QXFA 4ELTA 2KTQA 4IO9L 2RHKA 3LDLA 3KLFA 3CJCA 3QDKA 4DG1A 3NF8A 3IFRA 3AVMA 2ZJRL 4BACA 2BTFA 4BC3A 4H0XB 5CY4A 4KAZA 1D4XA 5FPDA 4B8CA 4IG0A 5HP1A 1RT2A 5KPRA 1JCEA 3CM6A 3DXMB 1XMQK 1LW0A 4M3ZA 4DV6K 3QIPA 3HK2A 1VAZA 1DLOA 3O8MA 4CJLA 3O80A 3CD6N 3CJ9A 3VPZA 1S3XA 4NB4A 4CJVA 2NRWA 4Q0BA 4M3XA 4KHNA 1LWEA 4RWTA 4BVOA 3NAEA 1Y64A 2DY4A 3ZT4A 3OS1A 1VHXA 2O8BB 3O1BA 1U47A 3U3YA 1LV5A 4JN4A 3T69A 4LF4K 5HRPA 4FWNA 2Y1IA 1WOQA 1I94K 3MXIA 4FSVA 1KCFA 4KV8A 4JYAK 3ZX3A 2VG5A 4DMNA 4CJ7A 3G71N 3HVTA 2D4WA 3MXMA 4H8KA 5EOYA 2ASOA 1EKEA 3LM2A 2O8EA 3WXJA 1YIJN 3CYMA 1VSEA 3PSFA 4CVNE 1RFQA 2QWLA 3DXKA 2GWJA 2QKKA 4LF7K 3LP1A 3AA3A 3RMAA 1XC9A 3SI6A 3V9ZA 4W5OA 1JLBA 1K73O 1HX1A 2HHXA 1KVCA 3V9XA 4NYFA 4NXNK 4NO7A 5DM7L 1UOCA 4DQRA 1F21A 4NCAA 2ZM6K 3KD1E 3SV4A 2Q3SA 3AGRA 1JLGA 3VA0A 4ILHA 1ZBSA 3DMJA 3GG4A 1GLCG 4IDKA 1R59O 3EN9A 4A57A 1VQLN 3RWUA 1IV0A 1TYQB 3ZT2A 4FJHA 3VQPA 2HHTA 1QHTA 3QEWA 3NH2A 3OYNA 4DV3K 1GLBG 1S9GA 4BR2A 4CF0A 3ITHA 1X1PA 4BDYA 4YY3K 2FBXA 2GTDA 3BP8A 4FWSA 4MQ3A 3SCXA 1L3TA 1V4SA 1YHQN 3VEWA 3H46O 4DV7K 4O8KA 2E20A 2I7NA 2QWOA 2V51B 4CIGA 2UYTA 4CEEA 3TAEA 4Z4GA 3O9TA 1QTMA 1ATNA 4CESA 3LPUA 4AHVA 2VYPA 2A6AA 3IDHA 2YKMA 4DTSA 1ZBLA 1RGIA 4JLHA 3OYHA 1UA0A 5C2FA 4IJNA 4Z4HA 4EZ6A 1RTDA 4E7KA 2GWKA 3BZKA 2PYJA 1IKVA 4E1NA 4GV9A 2YNGA 1EWRA 1T6CA 1NLVA 4HUEA 3O3GA 2P1JA 3A5LC 3U9DA 3C0BA 3TR8A 4AM6A 3S3NA 4DR1K 2O4IA 3FZLA 4CZHA 4CHNA 3O6WA 4CF9A 4WFBL 4YOXA 4LF9K 4CEDA 2QW9A 1VQ7N 1Q18A 1WSGA 2ETJA 3OYMA 2QWNA 1SL0A 5AQOA 5BR8K 4FVMA 4F8RA 4C23A 1WBDA 1T6DA 4YOTA 3MWTA 4C1NI 1S1XA 4BE1A 1ZBUA 1JCGA 1TK8A 4FJLA 1UA1A 1W0HA 1QSSA 1XNRK 4IOCL 5BPNA 2YV0X 3J81O 4DS4A 3EZ5A 3TPQA 4ZHRA 1NJWA 4BRLA 3RRGA 4F9OA 5BN9A 1M90O 2RN2A 1KC8O 1GOCA 3KKRA 3K5LA 1N36K 3H45C 3K9JA 4E7HA 1ZXOA 4IO8A 2ZWHA 3L4IA 3G25A 2X74A 5AQZA 5EVZA 4CK3A 2FF6A 2ITMA 1K8KB 1NKCA 2A1SA 3F2KA 2HHHK 4ICLA 3EO3A 4KH4A 2I5JA 1WSIA 4FOEA 3OY9A 2A41A 2HNDA 1Z25A 4JD2B 4FJ8A 1LWCA 3MMVA 3C65A 3HM9A 1WB9A 1NMNA 3AVIA 3TAQA 4IG3A 3RTVA 3O4NA 3OJUA 3FZFA 1P90A 5D3GA 1XI1A 2WONA 2F7TA 3ENOA 4BRIA 4PY5A 2HBMA 3QICA 5C12A 4W5NA 2DFEA 3FLCO 3P39A 4XH4A 3ENBA 3OTOK 2PYLA 3BUZB 3WXIA 1S1UA 2KFZA 4DSLA 1T03A 4CJSA 4CZLA 4ISGA 1RT3A 3I8BA 3VGMA 4HTUA 3CJBA 3HM8A 4DQQA 4CZFA 5GINA 5AQWA 4IEIA 1NJXA 5AQUA 4GNIA 1S1WA 2P9KA 5JVHL 3RSEB 3EE8A 4YFUA 4FW2A 3ENHA 4EP4A 3TAMA 4JRPA 3RMDA 4ILGB 2I7PA 4DR7K 4AHCA 4BE0A 2HHWA 3EKUA 4IEEA 4BRGA 4CBUA 1MWKA 2Q0RA 3TSPA 3OYIA 4CZGA 2NUBA 3TI0A 3OW2M 1EO1A 3TAFA 4JKGB 3SAGA 2A3ZA 5HROA 4BR5A 1BA0A 3QBXA 5BRFA 3UKRB 3SQ4A 4DQIA 4B9VA 1RT6A 2D0CA 4EFHA 3OYEA 4CBWA 2HNYA 3HT3A 1K8KA 1BOTO 4I6MB 3AVBA 3QB0A 5JLFA 5K14A 3OYBA 5ADXH 4FCYA 1ESVA 3PY8A 4CJUA 3CMAN 1BDGA 1QQNA 2HF3A 3PX4A 4FZZA 3IAYA 3G6EN 1X9WA 1DEJA 4DV2K 3THWB 4BE2A 4JHDA 1BUPA 3CQXA 2HVHA 1KRPA 3SLCA 3K59A 4KI4A 3L3UA 1RT5A 4CJEA 4DKWA 3OJSA 3PV8A 3VMFB 1A5WA 3EY1A 4DTPA 3K9KA 3CM5A 4DR2K 5GIPA 4EAHD 3VERA 4BDZA 2HF4A 1Z26A 1HKBA 4H5VA 3ZSWA 4JS4A 5KTQA 1J5OA 1YT3A 3MEGA 5KPZA 3SK3A 4LC9B 3MN7A 1CXUA 2OTJN 2B5JA 4KBOA 4CFDA 1SS6A 3P4IA 3P31A 1S6PA 3CCLN 1S1VA 4NCBA 4LSLA 3AGKA 2ZJPL 2XHBA 2OANA 3M6GA 2QXLA 4BR0A 1X9SA 4MLHA 5JMVA 1HKCA 1RDBA 5BR9A 4PL7A 4K0KK 2ZD1A 1UAXA 4CIEA 4EP5A 1QQCA 3KLEA 4GKJK 3V6DA 3SJHA 4JKBA 4JI1K 3R1XA 2IS3A 4BC5A 1IBLK 3FZKA 1J53A 4I6MA 1QHAA 1ITGA 5KGWA 3MECA 2OZSA 2E88A 4Z94A 3O4WA 4AHSA 3K58A 4BGAA 3VEOA 5EU7A 3QERA 4E19A 4WYBA 4GVEA 4EHUA 2IVOA 3RR7A 1TV6A 3BGRA 4FO0A 2VGMA 2G8VA 2XY5A 3THWA 1VQ4N 4Z4EA 3HI0A 2QK9A 3LDSA 1OH8A 4J2DA 1C1AA 2UUAK 4DV5K 5EXWA 1HYSA 1NMDA 4U7BA 3ZSZA 1N32K 1NJYA 3LDQA 4CZEA 4CI6A 4XEIA 3ZT0A 4JI8K 2FBTA 3QETA 2BE2A 1FKOA 3P5JA 4IWVA 3V9UA 4Z4IA 3O1WA 3VENA 4FL9A 2W6LA 1HNXK 3B8AX 1NGBA 3A2FA 2RKIA 3WNHA 3QEPA 3ZSRA 3ZX0A 4A2BA 4DU4A 4F2SA 3WXMB 1Z6RA 2A5XA 1BWFO 3LP0A 1ATRA 5H1SQ 5AQPA 2OYQA 2E2NA 1X9JA 1FXXA 3C94A 4CJKA 3SV3A 2X6NA 2UXBK 3R8EA 1WAFA 3VQAA 4FWKA 3GBTA 3R3LA 3JXUA 3WXKA 3VQ4A 1GLAG 4MDBA 3UKUB 3L6QA 3KZBA 4E0DA 3RMBA 4BR9A 3OYDA 3SAFA 4CJ3A 4OX9K 1WUAA 1W97L 3MDQA 3KJVA 1JXEA 2Q31A 3HSTB 2E2PA 1RILA 4DTJA 4BQZA 3AV9A 5FPEA 3DRRA 4LSNA 2AP1A 4X66K 1CXQA 4FZYA 5AZJB 1NGEA 1FK9A 4B9SA 4CD3A 3HPOA 4HUFA 3P1GA 4IBNA 1W9HA 4KHYA 3ZYYX 3F73A 4M3TA 3VA3A 3VQ8A 2IAJA 3Q7BA 4BRCA 4JRQA 3L0QA 4DSFA 3PUFA 3SQ2A 1A5VA 4AILC 2PZSA 1VSDA 3MEEA 4KHSA 3DM2A 1RDDA 4KREA 4X65K 1W7AA 1KAYA 2YX6A 1SL1A 1E4FT 3THYB 5AQJA 2KZMA 3Q7CA 1U04A 4DTOA 1JKHA 4BRFA 4H03B 3I0RA 1U2VB 4Z0UA 5BPMA 4WFNL 1D9DA 2Q97A 2CH6A 3TU5A 3FE1A 3KWIA 4KB1A 4H5RA 5BRHA 3K5NA 4JNEA 3GDQA 3C6AA 3P38A 4I9LA 3VGKA 3J7ZO 1U45A 3SPZA 4BGBA 2GV9A 5GAGP 5MLCQ 2CGKA 3DAWA 2EWSA 2NRHA 3AA5X 3SMPA 3UB5A 2P9IB 5CHIA 4CZMA 4FLUA 4O0IA 3WNFA 1DT9A 4DS5A 4YDUA 3CFRA 4WQ5A 1BL3A 4B9UA 3TSUA 1S72N 3U3GA 1G99A 3J8AA 1OVYA 3U4LA 2F8TA 3M8RA 3WEEA 3HO1A 5AQGA 3M5RA 5AQSA 2ZGYA 5CZ1A 4PKIA 3PLAA 1IO2A 2W40A 4GW6A 5AQHA 2UXCK 4CK1A 4FLVA 1L5UA 3C95A 3PSIA 5AQTA 3E9LA 2P9UB 2YCHA 1VRUA 5HRNA 5KRSA 4R5PA 3CMEN 1HJRA 4FWQA 3ZETA 2D5RA 2KZZA 1RDCA 2WBNA 1BQNA 4A62A 1HPZA 3CQYA 2UUBK 1OH6A 3H6EA 1JL1A 3ZCMA 1OH5A 3CHWA 3DJCA 3CG7A 2BANA 3L8BA 3S41A 1FW6A 4BROA 3AA4A 2CGJA 1MDUB 3LWLA 3OA9A 3E1YA 1IG8A 1NGDA 1OH7A 2QI2A 1BI4B 3AVKA 1RTJA 4FLXA 2E6LA 4IXCA 3VETA 5BREA 4FLTA 3T19A 1EX4A 3IS9A 4DTRA 1BQMA 3DRPA 4RW8A 3W0LA 3V81A 4JI2K 2ZJQL 3HJFA 4Y0WA 2G8UA 1NK7A 2Q0UA 5FPNA 5I42A 2CH5A 3VF4A 2F96A 2YHXA 3MN5A 3AO4A 3K57A 3AO1A 3SJJA 2AJQA 1VQMN 4FW1A 1ASWA 2VG6A 3ZSXA 4FJXA 2ZQBA 4X62K 1KXPA 3DXMA 1JCFA 3TTFA 3SZ2A 3D2EB 4GKKK 2QA4N 3HVRA 1EQYA 1QVGM 1A5XA 4CERA 2E4LA 2E2QA 3O08A 1BIZA 5JICA 2Z1HA 3KWGA 1T3VA 3NF6A 3IMXA 3OYGA 2O8BA 2VWBA 4CHQA 4RW6A 1L3UA 3F5TA 4CEQA 5BPLA 4PKGA 3DLRA 4FJ5A 1RBSA 3SAHA 4KO0A 3C7NB 4ISEA 3NCIA 3VEXA 3I55N 3KK2A 5AQYA 3A5OC 4IOAL 2YJFA 5EY4A 1OVQA 2G8IA 3CFPA 1ZC6A 5E26A 3MXJA 1MWMA 4CFBA 5C10A 2FBVA 1NWKA 2P5OA 2HHUA 2HNZA 2Z1JA 4DR5K 4PQUA 3HTVA 2GELA 4NCGA 4JKHA 3VEVA 4DSIA 1SV5A 4M7YA 4H4OA 1RCHA 3KIOA 3LP2A 3OHRA 4XIUA 4GMJB 1O1WA 2GX9A 3SUNA 3A5MC 2OCEA 3CPWM 1VRTA 4OJRA 3FFIA 1NJZA 4FLZA 3E66A 3TARA 1Q86O 5KQDA 2O8CB 1YTAA 4CJQA 1SL2A 4WE1A 1Q8IA 2RE2A 4O55A 3QMLA 1TYQA 1YXQA 3T1YK 1VQ6N 4H0VB 3DLBA 3FFKB 3FR0A 1C0UA 1TAQA 3CCQN 4E7LA 3T3FA 3TSQA 3KD5E 2D0OA 1CZ9A 3E01A 4B3MK 3AY9A 5J2NA 3CETA 2NRTA 2QWMA 2V7ZA 3D2EA 3U6FA 5E84A 2YI1A 1KFDA 4JAXA 3HPHA 4GY2B 4Z4FA 3AVLA 1CLQA 3HP9A 1YF5L 4OPKA 4CEBA 5KQ8A 2HHQA 3AVHA 3DI6A 2P9NB 3CJ1A 4I7FA 2OA8A 2OTLN 4Z4CA 4CJ5A 2GUIA 5BRDA 2XY7A 1VQON 4ID5A 4CZKA 1I3AA 4GV6A 2KLAA 5FDLA 4CGDA 3G10A 4DU1A 5M1QA 4CD1A 1QS4A 1L3VA 1UWBA 3OVNA 3VQBA 1K9MO 2JWKA 2NRZA 1BCOA 4KHQA 4OKKA 4DTMA 4C8OA 1FJGK 3SQ1A 2YNIA 5DK5A 3OYKA 3AAQA 3E9PA 3L2VA 3O9QA 5AQLA 5KI6A 4IJAA 4AH9A 3VF6A 1WLJA 4B1YB 4J2AA 3KVGA 4PUOA 4DTNA 3O9UA 4F3OA 1HNWK 3KKSA 4L8RB 3I56N 4CHZA 4FJ9A 2F9TA 1S1TA 4CHOA 1VQ9N 5AFUA 2HOEA 4FM0A 1BO5O 4JI4K 4CBXA 3PIPL 3VEYA 2CGLA 4E7JA 1ASVA 3THXB 1J9AA 4W5RA 1NU0A 2IIRA 2Z1IA 2E8AA 4K25A 1NK9A 4LH4A 3J80O 1S22A 1LCUA 3AVNA 1NK5A 2RPIA 4OPHA 1RT4A 2D0BA 2EHGA 4GVMA 2IOCA 3AVJA 3HSCA 2ZE2A 4OLBA 3HL8A 1TK5A 2GUPA 2VWKA 1HUXA 3VQ5A 3ZEUB 3CERA 5JS1A 3CCUN 1J5EK 1HPMA 4Q5VA 4FXDA 3LL3A 4FOIA 1C0MA 1XC3A 1YVUA 1DTQA 1YTUA 1U6ZA 4WQ4A 1NGAA 4JD2A 1HNVA 3HYFA 4DUYK 4F3TA 3LALA 3DLEA 1Q82O 3F9KA 3JS6A 5LL6Z 4B9LA 2NNWA 3HP6A 4B3OA 4JI6K 4FK4A 3S3OA 3D0PA 1XUPO 3PX0A 5CR4A 5M1OA 1HJOA 4B9TA 3CCVN 3BEXA 4O5BA 4J2BA 4M7XA 4IDHA 4JI5K 3DYAA 4CZIA 5AQXA 5B8HA 1U48A 3CXCM 1GLEG 5C15A 3VQDA 3HOTA 2NRRA 3NDKA 1YAGA 2HSTA 1KTQA 3OBWA 1VQ8N 5C0YA 2P5GA 5AQFA 2JLEA 4LY7A 2KKZA 3QFUA 3CCMN 3R9PA 1S6QA 3SUPA 2FBYA 1IBKK 3HOSA 4OKEA 3RSEA 3VF2A 4BWMA 1FKPA 5HOOA 3R6MA 1BG3A 4DFMA 4GV3A 2R7YA 3ISNC 3CQ8A 3CCEN 2HHVA 1IKXA 1KLMA 3PX6A 5JLHA 4IKFA 4DFPA 4MLEA 2UU9K 3VTHA 1RTHA 2JGUA 4BG9A 3DRSA 4DQ8A 1TUUA 4JKGA 3JAMO 1I39A 1NOZA 4N47A 5AZIB 1S9EA 2P9LB 3QBWA 4AQYK 3UKRA 1ATSA 2HBJA 3D45A 4H0TB 3ID8A 5FRMA 2E5LK 4YHHK 4WFAL 3D2FB
chains in the Genus database with same CATH topology
4ZTFA 1D9DA 3KK1A 4W5TA 5J1EA 4E7IA 3QEXA 4KB1A 5C24A 4CIGA 5CYQA 3K5NA 4IFYA 4RW4A 4CEEA 4RW9A 4CFCA 4RG8A 4I9LA 3TAEA 1QTMA 4Z4GA 1RDAA 1U45A 1VSIA 1MU2A 5CZ2A 4CESA 3LPUA 3SPZA 4KRFA 4PA1A 2GV9A 4AHVA 3MEDA 1Q9XA 4B9NA 4AHTA 1WSEA 2DFFA 3I8DA 4CGFA 1QSYA 2Y1JA 3LP3A 2YKMA 4DTSA 2OPRA 4KB0A 1ZBLA 4JLHA 1U49A 4M3WA 3AA5X 3NF7A 3RMCA 3OYHA 1UA0A 4DFJA 4FLUA 1U4BA 1GOAA 4Z4HA 4O0IA 3OYCA 3WNFA 4EZ6A 3SYZA 4O44A 4DQPA 4K8XA 1RTDA 1QE1A 4E7KA 4DS5A 2PYJA 1GOBA 1IKVA 4DSEA 3OYFA 3CFRA 4N5SA 1BL3A 4E1NA 4B9UA 2IDOA 2YNGA 3U3GA 4HUEA 2P51A 3B6PA 2WOMA 2F8TA 3M8RA 4F4KA 3KTQA 4DWIA 3HO1A 2RF2A 3L3VA 3O3GA 3O3HA 2DY4A 3ZT3A 1KLNA 2P1JA 5CZ1A 1R0AA 3UIQA 1IO2A 4Y1DA 4GW6A 3TR8A 4OLAA 1HQUA 1LAWA 4G1QA 4CK1A 4FLVA 2BDPA 1BHLA 3S3NA 1L5UA 3LAMA 2O4IA 3OYJA 3C95A 1C1BA 2LSNA 4CHNA 1L3SA 4M3RA 4E89A 1WNSA 1VRUA 3WNGA 5HRNA 5KRSA 4CF9A 4R5PA 4CEDA 2KW4A 4FM1A 3K5MA 2GBZA 4FJ7A 2YKNA 1WSGA 1VSJA 2ETJA 3OYMA 1SL0A 1HJRA 1ZBIA 4FVMA 2D5RA 3KLIA 4F8RA 2F8SA 2KZZA 4FLYA 1RDCA 4M42A 1D9FA 4KHUA 1BQNA 4CGGA 4LD0A 1HPZA 4BWJA 3QLHA 1NKEA 1XHXA 4B9MA 4W5QA 1S5JA 1S1XA 2X78A 1ZBUA 2EX3A 4OGEA 3VQQA 3NH1A 4BE1A 4BDPA 1TK8A 4IFVA 1CZBA 1W0HA 1UA1A 4I2QA 1QSSA 2B4JA 4FJLA 1HRHA 1JL1A 3ZCMA 2YV0X 5J2PA 4DS4A 3S9HA 3EZ5A 3RRHA 4ZHRA 5KGXA 1NJWA 1KFSA 3CG7A 2BANA 2IC3A 3L2UA 3LZJA 3L8BA 4CGJA 4DFKA 1N5YA 3RRGA 3M8QA 2RN2A 3SPYA 3AA4A 1GOCA 3LWLA 4B8AB 2OPPA 3KKRA 2D0AA 3K5LA 2G8KA 4E7HA 4HCBA 1BI4B 3AVKA 1BIUA 3LANA 1RTJA 4I2PA 4FLXA 2E6LA 1NK4A 2X74A 3BDPA 4C8LA 4CK3A 4FLTA 3T19A 1RBRA 1IKWA 1EX4A 3K2PA 3IS9A 4DTRA 1NKCA 1TL3A 3L2QA 2A1SA 1BQMA 3DRPA 4RW8A 3V81A 4ICLA 2B6AA 5C42A 1C0TA 2I5JA 3HJFA 1WSIA 4O0JA 3OY9A 1NK7A 2G8UA 2HNDA 1Z25A 5I42A 4FJ8A 1LWCA 4CGHA 3LWMA 1QSLA 2F96A 3HM9A 4DU3A 2ATQA 4KI6A 2VG7A 2X6SA 4OKJA 3AO4A 3QINA 4HCCA 3AVIA 3K57A 3TAQA 2BGGA 3AO1A 4IG3A 5E41A 5SWMA 3SJJA 3OS2A 2AJQA 1RT7A 4FW1A 1ASWA 2VG6A 1REVA 3ZSXA 3RTVA 3PO5A 2ZQBA 3O4NA 3OJUA 4FJXA 3THVA 5D3GA 4CF1A 3SZ2A 1XI1A 1KVAA 2WONA 3KLHA 1WSFA 1TKDA 2KFNA 3QNNA 2YHAA 3HVRA 1N6QA 4PY5A 4UQGA 5HLFA 1JLAA 3NGYA 1A5XA 4CECA 4W5NA 2DFEA 3ZSYA 3ZSOA 5HRRA 4ID1A 3TAGA 3HXMA 2PYLA 4CERA 2E4LA 1S1UA 4N56A 2KFZA 3HPGA 1T03A 4DSLA 4CJSA 4FK0A 1BIZA 2G8WA 3L2WA 1LAVA 2Z1HA 3O3FA 4KTQA 3QIOA 3NF6A 2YHBA 1RT3A 3DLKA 4CJ4A 3OYGA 2YNHA 4CHQA 4RW6A 1SKWA 4CEQA 4HTUA 1L3UA 1ZBHA 4DQQA 1SKRA 3DLRA 3DOLA 4O4GA 2VWJA 4FJ5A 1RBSA 3VQ7A 2XO7A 2XY8A 4NYNA 1NJXA 3PO4A 3NF9A 4KO0A 1S1WA 3NCIA 3DLHA 4YFUA 3AVCA 1BISA 3KK2A 4FW2A 2FC0A 4FZXC 1Y97A 3LZIA 4EP4A 3TAMA 4JRPA 3TABA 3RMDA 2G8IA 3CFPA 4CIFA 3MXJA 1ZBFA 4CFBA 3JSMA 3O4QA 4AHCA 1JL2A 1WAJA 2FBVA 4BE0A 3AO2A 3B6OA 4CJTA 2P5OA 2HHWA 1IG9A 2HNZA 2Z1JA 1Q9YA 4RW7A 2HHUA 4PQUA 3ASMA 3VN5A 3OYIA 4NCGA 1D8YA 2NUBA 4CHYA 3EYZA 1SV5A 4FLWA 3TI0A 3TWHA 4H4OA 4DSIA 4DF4A 3TAFA 1T8EA 1RCHA 2HW3A 3DLGA 5HROA 1HYZA 2HB5A 4F2RA 3NFAA 3KIOA 3LP2A 2HMIA 4DQIA 3SQ4A 4XIUA 3C6TA 3C6UA 4GMJB 4KTWA 4B9VA 3G0ZA 3VQ9A 1O1WA 4FJKA 1RT6A 2D0CA 3SUNA 1TGOA 3NHGA 3OYEA 3LPTA 1VRTA 4OJRA 2HNYA 3FFIA 4CHPA 3HT3A 4FLZA 1TKTA 3V9WA 1NJZA 3TARA 4CJFA 3AVBA 2E6MA 1YTAA 4CJQA 1NK8A 3TANA 3T1AA 4FJNA 4HHTA 1C1CA 3SNNA 1SL2A 4WE1A 2HVIA 2HHSA 5K14A 2XRIA 1Q8IA 3OYBA 1NOYA 2KQ2A 4O55A 1TKZA 4FCYA 1B9FA 4E1MA 3PY8A 3DLBA 4CJUA 3VQ6A 2QKBA 1JLEA 5CYMA 4CF2A 3MAQA 2DTUA 3VQCA 3PX4A 1C0UA 1TAQA 4C8MA 3IAYA 3AA2A 4FJIA 4FZZA 4E7LA 5HBMA 3T3FA 2XY6A 1X9WA 4CCHA 3KD5E 3V9SA 3M8PA 1KVBA 4KKOA 3OYLA 1CZ9A 3E01A 3QEIA 1SUQA 3RR8A 4M3YA 4CEOA 3LAKA 3OS0A 4BE2A 4DQSA 1VSHA 4CJPA 5J2NA 5FROA 4KPYA 2G8FA 4H4MA 3U6FA 1KFDA 4HVJA 2OPSA 1HNIA 3HPHA 4Y1CA 1TVRA 4CGIA 5J2MA 4Z4FA 2HVHA 4DLGA 4ELUA 3NE6A 4PWDA 3AVLA 5DMRA 1KRPA 2OZMA 1CLQA 2YNFA 3HP9A 4AHRA 3K59A 4KI4A 1TL1A 3L3UA 4OPKA 1RT5A 4CEBA 1WSJA 1RTIA 4CFAA 4CJEA 3OJSA 2HHQA 3IG1A 3AVHA 3DI6A 4I7FA 3PV8A 4QAGA 2OA8A 4N41A 1A5WA 3EY1A 3OYAA 1BGXT 4DTPA 1ASUA 3CM5A 4Z4CA 3ZSQA 4CJ5A 2GUIA 1WSHA 3V1OA 3NGIA 2XY7A 4BDZA 3QEVA 1Z26A 1VSKA 3SUQA 4CEFA 4ID5A 1X9MA 1EP4A 4OPJA 4DSKA 3AVGA 1VSFA 1XWLA 4LH5A 4HUGA 3ZSWA 1I3AA 4JS4A 5KTQA 4DLEA 1VSLA 1YT3A 3MEGA 1VK0A 1J5OA 5FRNA 1RT1A 5FDLA 1NKBA 4CGDA 4CE9A 2W42A 3G10A 4CJRA 4DU1A 1CXUA 2B5JA 1T7PA 4CFDA 4DF8A 4KHWA 1QS4A 1L3VA 1UWBA 1B9DA 1EETA 1S6PA 3OVNA 5HRSA 3VQBA 4C8KA 4NCBA 1S1VA 1BCOA 1G15A 4OKKA 4CK2A 4LSLA 3V1RA 4DTMA 4C8OA 3QNOA 4DSJA 4KHQA 2IGIA 3SQ1A 2XHBA 2A1RA 5SZTA 2YNIA 3IRXA 1J54A 1JXBA 5DK5A 3OYKA 5C25A 4J2EA 3L2VA 3JYTA 1SKSA 1X9SA 5KI6A 4M45A 1WN7A 1K6YA 4MFBA 3SQ0A 4AH9A 1RDBA 1NK6A 4K8ZA 4QOZB 1WLJA 4CJWA 4J2AA 2ZD1A 4CF8A 4FM2A 1UAXA 4CIEA 4DTUA 4EP5A 4PUOA 1QQCA 3AVAA 3KLEA 1T05A 3V6DA 4DTNA 1IH7A 3CFOA 1RBVA 2IS3A 4JS5A 4F3OA 3NH0A 1J53A 3KKSA 4L8RB 1LWFA 4CHZA 1JLCA 4FJ9A 1ITGA 5KGWA 4FJMA 1S1TA 4CHOA 4E3SA 3MECA 2OZSA 1JLFA 4FM0A 1BCMA 4B08A 2PY5A 1ZYQA 4AHSA 4FJGA 3K58A 2QXFA 4ELTA 2KTQA 4ZTJA 4E7JA 5EU7A 3KLFA 3QERA 4DG1A 1ASVA 3NF8A 4E19A 1J9AA 4W5RA 2Z1IA 4KTZA 3I0SA 3AVMA 3KK3A 4BACA 1TV6A 3RR7A 3BGRA 1NK9A 4LH4A 1B92A 2G8VA 4OVLA 3VQEA 2XY5A 4M3UA 4Z4EA 1HYVA 4C8NA 4AHUA 3AVNA 1HMVA 3ZT1A 3LDSA 5CY4A 1NK5A 4KAZA 2QK9A 2RPIA 4J2DA 4B8CA 1RT4A 1C1AA 4IG0A 2D0BA 1RT2A 1BI4A 5HP1A 3V1QA 1HYSA 2EHGA 3CM6A 5T7BA 1LW0A 4GVMA 4I9QA 2IOCA 4M3ZA 3AVJA 3ZSZA 3S3MA 3QIPA 3HK2A 2ZE2A 4OLBA 1NJYA 3HL8A 1TK5A 1DLOA 1RNHA 2VWKA 3VQ5A 1DTTA 5KRTA 3ULDA 3ALYA 5JS1A 4CJLA 3QESA 4QCLA 3ZT0A 1RBUA 2FBTA 4Q5VA 4FXDA 3QETA 4CJVA 4Q0BA 2BE2A 1C0MA 1FKOA 1YVUA 1DTQA 3P5JA 4CEZA 4M3XA 1YTUA 3V9UA 4KHNA 1LWEA 4Z4IA 1HNVA 3HYFA 3NAEA 1TK0A 4F3TA 3A2FA 2RKIA 3LALA 4TSXA 3DLEA 3WNHA 3ZSRA 3ZT4A 3OS1A 3QEPA 3F9KA 1NK0A 4DU4A 4B9LA 4F2SA 3HP6A 4B3OA 4FK4A 3M8SA 1U47A 3S3OA 3LP0A 3D0PA 3U3YA 1LV5A 3PX0A 2ITGA 5HRPA 3AVFA 3KLGA 2Y1IA 2OYQA 3H08A 1FXXA 3C94A 4CJKA 3SV3A 3MXIA 4B9TA 2X6NA 1JLQA 3L2RA 4O5BA 4J2BA 1LW2A 1WAFA 1KCFA 4KV8A 3VQAA 4N76A 1TAUA 3DYAA 2VG5A 5J2QA 5I3UA 4DMNA 3HVTA 1U48A 3VQ4A 4KFBA 3MXMA 4H8KA 2DFHA 3VQDA 1EKEA 4CEAA 3CYMA 1VSEA 4FYDA 4E0DA 4DTXA 3RMBA 3NDKA 2QKKA 3OYDA 3QO9A 3LP1A 3AA3A 1KTQA 4CJ3A 3RMAA 1XC9A 1VSMA 3SI6A 3KJVA 3V9ZA 1D5AA 1JLBA 2OPQA 1JXEA 1RBTA 4W5OA 3DOKA 2P5GA 2HHXA 2JLEA 3HSTB 4LY7A 3ZSVA 1RILA 4DTJA 1KVCA 1S6QA 3AV9A 3P83D 4YNQA 3DRRA 4NYFA 3V9XA 3AO5A 3SUPA 4LSNA 3TAPA 1UOCA 2FBYA 4DQRA 1F21A 1CXQA 4OKEA 1XHZA 4BWMA 4FZYA 4NCAA 1FKPA 4EZ9A 1FK9A 2G8HA 4B9SA 3KD1E 3SV4A 4DFMA 2Q3SA 1TKXA 3HPOA 3AO3A 4HUFA 1JLGA 3P1GA 4IBNA 2R7YA 3V4IA 1W9HA 3ISNC 3CQ8A 4KHYA 1HQEA 3VA0A 4M41A 2HHVA 3F73A 1IKXA 4M3TA 1KLMA 3VA3A 3VQ8A 3PX6A 3DMJA 4IDKA 5JS2A 4DFPA 2IAJA 3RWUA 4IKFA 4JRQA 4DSFA 3K5OA 3PUFA 3NBPA 2O4GA 3ZT2A 1RTHA 4FJHA 2JGUA 3VQPA 2HHTA 2Z1GA 1QHTA 3QEWA 3NH2A 1A5VA 1EXQA 3DRSA 4AILC 3SQ2A 3OYNA 2PZSA 1VSDA 3MEEA 3WNEA 4KHSA 3DM2A 1I39A 4OGCA 1NOZA 1RDDA 1S9GA 1KSPA 4ELVA 4FK2A 4KREA 3NGZA 4N47A 4CF0A 3ITHA 1S9EA 1X1PA 4BDYA 1SL1A 2FBXA 2KZMA 4MQ3A 3SCXA 1C6VA 3D45A 1L3TA 1U04A 4DTOA 1JKHA 4FJJA 5FRMA 3SUOA 3I0RA 1IKYA 4Z0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZTF A;  1D9D A;  3KK1 A;  4W5T A;  5J1E A;  4E7I A;  3QEX A;  4KB1 A;  5C24 A;  4CIG A;  5CYQ A;  3K5N A;  4IFY A;  4RW4 A;  4CEE A;  4RW9 A;  4CFC A;  4RG8 A;  4I9L A;  3TAE A;  1QTM A;  4Z4G A;  1RDA A;  1U45 A;  1VSI A;  1MU2 A;  5CZ2 A;  4CES A;  3LPU A;  3SPZ A;  4KRF A;  4PA1 A;  2GV9 A;  4AHV A;  3MED A;  1Q9X A;  4B9N A;  4AHT A;  1WSE A;  2DFF A;  3I8D A;  4CGF A;  1QSY A;  2Y1J A;  3LP3 A;  2YKM A;  4DTS A;  2OPR A;  4KB0 A;  1ZBL A;  4JLH A;  1U49 A;  4M3W A;  3AA5 X;  3NF7 A;  3RMC A;  3OYH A;  1UA0 A;  4DFJ A;  4FLU A;  1U4B A;  1GOA A;  4Z4H A;  4O0I A;  3OYC A;  3WNF A;  4EZ6 A;  3SYZ A;  4O44 A;  4DQP A;  4K8X A;  1RTD A;  1QE1 A;  4E7K A;  4DS5 A;  2PYJ A;  1GOB A;  1IKV A;  4DSE A;  3OYF A;  3CFR A;  4N5S A;  1BL3 A;  4E1N A;  4B9U A;  2IDO A;  2YNG A;  3U3G A;  4HUE A;  2P51 A;  3B6P A;  2WOM A;  2F8T A;  3M8R A;  4F4K A;  3KTQ A;  4DWI A;  3HO1 A;  2RF2 A;  3L3V A;  3O3G A;  3O3H A;  2DY4 A;  3ZT3 A;  1KLN A;  2P1J A;  5CZ1 A;  1R0A A;  3UIQ A;  1IO2 A;  4Y1D A;  4GW6 A;  3TR8 A;  4OLA A;  1HQU A;  1LAW A;  4G1Q A;  4CK1 A;  4FLV A;  2BDP A;  1BHL A;  3S3N A;  1L5U A;  3LAM A;  2O4I A;  3OYJ A;  3C95 A;  1C1B A;  2LSN A;  4CHN A;  1L3S A;  4M3R A;  4E89 A;  1WNS A;  1VRU A;  3WNG A;  5HRN A;  5KRS A;  4CF9 A;  4R5P A;  4CED A;  2KW4 A;  4FM1 A;  3K5M A;  2GBZ A;  4FJ7 A;  2YKN A;  1WSG A;  1VSJ A;  2ETJ A;  3OYM A;  1SL0 A;  1HJR A;  1ZBI A;  4FVM A;  2D5R A;  3KLI A;  4F8R A;  2F8S A;  2KZZ A;  4FLY A;  1RDC A;  4M42 A;  1D9F A;  4KHU A;  1BQN A;  4CGG A;  4LD0 A;  1HPZ A;  4BWJ A;  3QLH A;  1NKE A;  1XHX A;  4B9M A;  4W5Q A;  1S5J A;  1S1X A;  2X78 A;  1ZBU A;  2EX3 A;  4OGE A;  3VQQ A;  3NH1 A;  4BE1 A;  4BDP A;  1TK8 A;  4IFV A;  1CZB A;  1W0H A;  1UA1 A;  4I2Q A;  1QSS A;  2B4J A;  4FJL A;  1HRH A;  1JL1 A;  3ZCM A;  2YV0 X;  5J2P A;  4DS4 A;  3S9H A;  3EZ5 A;  3RRH A;  4ZHR A;  5KGX A;  1NJW A;  1KFS A;  3CG7 A;  2BAN A;  2IC3 A;  3L2U A;  3LZJ A;  3L8B A;  4CGJ A;  4DFK A;  1N5Y A;  3RRG A;  3M8Q A;  2RN2 A;  3SPY A;  3AA4 A;  1GOC A;  3LWL A;  4B8A B;  2OPP A;  3KKR A;  2D0A A;  3K5L A;  2G8K A;  4E7H A;  4HCB A;  1BI4 B;  3AVK A;  1BIU A;  3LAN A;  1RTJ A;  4I2P A;  4FLX A;  2E6L A;  1NK4 A;  2X74 A;  3BDP A;  4C8L A;  4CK3 A;  4FLT A;  3T19 A;  1RBR A;  1IKW A;  1EX4 A;  3K2P A;  3IS9 A;  4DTR A;  1NKC A;  1TL3 A;  3L2Q A;  2A1S A;  1BQM A;  3DRP A;  4RW8 A;  3V81 A;  4ICL A;  2B6A A;  5C42 A;  1C0T A;  2I5J A;  3HJF A;  1WSI A;  4O0J A;  3OY9 A;  1NK7 A;  2G8U A;  2HND A;  1Z25 A;  5I42 A;  4FJ8 A;  1LWC A;  4CGH A;  3LWM A;  1QSL A;  2F96 A;  3HM9 A;  4DU3 A;  2ATQ A;  4KI6 A;  2VG7 A;  2X6S A;  4OKJ A;  3AO4 A;  3QIN A;  4HCC A;  3AVI A;  3K57 A;  3TAQ A;  2BGG A;  3AO1 A;  4IG3 A;  5E41 A;  5SWM A;  3SJJ A;  3OS2 A;  2AJQ A;  1RT7 A;  4FW1 A;  1ASW A;  2VG6 A;  1REV A;  3ZSX A;  3RTV A;  3PO5 A;  2ZQB A;  3O4N A;  3OJU A;  4FJX A;  3THV A;  5D3G A;  4CF1 A;  3SZ2 A;  1XI1 A;  1KVA A;  2WON A;  3KLH A;  1WSF A;  1TKD A;  2KFN A;  3QNN A;  2YHA A;  3HVR A;  1N6Q A;  4PY5 A;  4UQG A;  5HLF A;  1JLA A;  3NGY A;  1A5X A;  4CEC A;  4W5N A;  2DFE A;  3ZSY A;  3ZSO A;  5HRR A;  4ID1 A;  3TAG A;  3HXM A;  2PYL A;  4CER A;  2E4L A;  1S1U A;  4N56 A;  2KFZ A;  3HPG A;  1T03 A;  4DSL A;  4CJS A;  4FK0 A;  1BIZ A;  2G8W A;  3L2W A;  1LAV A;  2Z1H A;  3O3F A;  4KTQ A;  3QIO A;  3NF6 A;  2YHB A;  1RT3 A;  3DLK A;  4CJ4 A;  3OYG A;  2YNH A;  4CHQ A;  4RW6 A;  1SKW A;  4CEQ A;  4HTU A;  1L3U A;  1ZBH A;  4DQQ A;  1SKR A;  3DLR A;  3DOL A;  4O4G A;  2VWJ A;  4FJ5 A;  1RBS A;  3VQ7 A;  2XO7 A;  2XY8 A;  4NYN A;  1NJX A;  3PO4 A;  3NF9 A;  4KO0 A;  1S1W A;  3NCI A;  3DLH A;  4YFU A;  3AVC A;  1BIS A;  3KK2 A;  4FW2 A;  2FC0 A;  4FZX C;  1Y97 A;  3LZI A;  4EP4 A;  3TAM A;  4JRP A;  3TAB A;  3RMD A;  2G8I A;  3CFP A;  4CIF A;  3MXJ A;  1ZBF A;  4CFB A;  3JSM A;  3O4Q A;  4AHC A;  1JL2 A;  1WAJ A;  2FBV A;  4BE0 A;  3AO2 A;  3B6O A;  4CJT A;  2P5O A;  2HHW A;  1IG9 A;  2HNZ A;  2Z1J A;  1Q9Y A;  4RW7 A;  2HHU A;  4PQU A;  3ASM A;  3VN5 A;  3OYI A;  4NCG A;  1D8Y A;  2NUB A;  4CHY A;  3EYZ A;  1SV5 A;  4FLW A;  3TI0 A;  3TWH A;  4H4O A;  4DSI A;  4DF4 A;  3TAF A;  1T8E A;  1RCH A;  2HW3 A;  3DLG A;  5HRO A;  1HYZ A;  2HB5 A;  4F2R A;  3NFA A;  3KIO A;  3LP2 A;  2HMI A;  4DQI A;  3SQ4 A;  4XIU A;  3C6T A;  3C6U A;  4GMJ B;  4KTW A;  4B9V A;  3G0Z A;  3VQ9 A;  1O1W A;  4FJK A;  1RT6 A;  2D0C A;  3SUN A;  1TGO A;  3NHG A;  3OYE A;  3LPT A;  1VRT A;  4OJR A;  2HNY A;  3FFI A;  4CHP A;  3HT3 A;  4FLZ A;  1TKT A;  3V9W A;  1NJZ A;  3TAR A;  4CJF A;  3AVB A;  2E6M A;  1YTA A;  4CJQ A;  1NK8 A;  3TAN A;  3T1A A;  4FJN A;  4HHT A;  1C1C A;  3SNN A;  1SL2 A;  4WE1 A;  2HVI A;  2HHS A;  5K14 A;  2XRI A;  1Q8I A;  3OYB A;  1NOY A;  2KQ2 A;  4O55 A;  1TKZ A;  4FCY A;  1B9F A;  4E1M A;  3PY8 A;  3DLB A;  4CJU A;  3VQ6 A;  2QKB A;  1JLE A;  5CYM A;  4CF2 A;  3MAQ A;  2DTU A;  3VQC A;  3PX4 A;  1C0U A;  1TAQ A;  4C8M A;  3IAY A;  3AA2 A;  4FJI A;  4FZZ A;  4E7L A;  5HBM A;  3T3F A;  2XY6 A;  1X9W A;  4CCH A;  3KD5 E;  3V9S A;  3M8P A;  1KVB A;  4KKO A;  3OYL A;  1CZ9 A;  3E01 A;  3QEI A;  1SUQ A;  3RR8 A;  4M3Y A;  4CEO A;  3LAK A;  3OS0 A;  4BE2 A;  4DQS A;  1VSH A;  4CJP A;  5J2N A;  5FRO A;  4KPY A;  2G8F A;  4H4M A;  3U6F A;  1KFD A;  4HVJ A;  2OPS A;  1HNI A;  3HPH A;  4Y1C A;  1TVR A;  4CGI A;  5J2M A;  4Z4F A;  2HVH A;  4DLG A;  4ELU A;  3NE6 A;  4PWD A;  3AVL A;  5DMR A;  1KRP A;  2OZM A;  1CLQ A;  2YNF A;  3HP9 A;  4AHR A;  3K59 A;  4KI4 A;  1TL1 A;  3L3U A;  4OPK A;  1RT5 A;  4CEB A;  1WSJ A;  1RTI A;  4CFA A;  4CJE A;  3OJS A;  2HHQ A;  3IG1 A;  3AVH A;  3DI6 A;  4I7F A;  3PV8 A;  4QAG A;  2OA8 A;  4N41 A;  1A5W A;  3EY1 A;  3OYA A;  1BGX T;  4DTP A;  1ASU A;  3CM5 A;  4Z4C A;  3ZSQ A;  4CJ5 A;  2GUI A;  1WSH A;  3V1O A;  3NGI A;  2XY7 A;  4BDZ A;  3QEV A;  1Z26 A;  1VSK A;  3SUQ A;  4CEF A;  4ID5 A;  1X9M A;  1EP4 A;  4OPJ A;  4DSK A;  3AVG A;  1VSF A;  1XWL A;  4LH5 A;  4HUG A;  3ZSW A;  1I3A A;  4JS4 A;  5KTQ A;  4DLE A;  1VSL A;  1YT3 A;  3MEG A;  1VK0 A;  1J5O A;  5FRN A;  1RT1 A;  5FDL A;  1NKB A;  4CGD A;  4CE9 A;  2W42 A;  3G10 A;  4CJR A;  4DU1 A;  1CXU A;  2B5J A;  1T7P A;  4CFD A;  4DF8 A;  4KHW A;  1QS4 A;  1L3V A;  1UWB A;  1B9D A;  1EET A;  1S6P A;  3OVN A;  5HRS A;  3VQB A;  4C8K A;  4NCB A;  1S1V A;  1BCO A;  1G15 A;  4OKK A;  4CK2 A;  4LSL A;  3V1R A;  4DTM A;  4C8O A;  3QNO A;  4DSJ A;  4KHQ A;  2IGI A;  3SQ1 A;  2XHB A;  2A1R A;  5SZT A;  2YNI A;  3IRX A;  1J54 A;  1JXB A;  5DK5 A;  3OYK A;  5C25 A;  4J2E A;  3L2V A;  3JYT A;  1SKS A;  1X9S A;  5KI6 A;  4M45 A;  1WN7 A;  1K6Y A;  4MFB A;  3SQ0 A;  4AH9 A;  1RDB A;  1NK6 A;  4K8Z A;  4QOZ B;  1WLJ A;  4CJW A;  4J2A A;  2ZD1 A;  4CF8 A;  4FM2 A;  1UAX A;  4CIE A;  4DTU A;  4EP5 A;  4PUO A;  1QQC A;  3AVA A;  3KLE A;  1T05 A;  3V6D A;  4DTN A;  1IH7 A;  3CFO A;  1RBV A;  2IS3 A;  4JS5 A;  4F3O A;  3NH0 A;  1J53 A;  3KKS A;  4L8R B;  1LWF A;  4CHZ A;  1JLC A;  4FJ9 A;  1ITG A;  5KGW A;  4FJM A;  1S1T A;  4CHO A;  4E3S A;  3MEC A;  2OZS A;  1JLF A;  4FM0 A;  1BCM A;  4B08 A;  2PY5 A;  1ZYQ A;  4AHS A;  4FJG A;  3K58 A;  2QXF A;  4ELT A;  2KTQ A;  4ZTJ A;  4E7J A;  5EU7 A;  3KLF A;  3QER A;  4DG1 A;  1ASV A;  3NF8 A;  4E19 A;  1J9A A;  4W5R A;  2Z1I A;  4KTZ A;  3I0S A;  3AVM A;  3KK3 A;  4BAC A;  1TV6 A;  3RR7 A;  3BGR A;  1NK9 A;  4LH4 A;  1B92 A;  2G8V A;  4OVL A;  3VQE A;  2XY5 A;  4M3U A;  4Z4E A;  1HYV A;  4C8N A;  4AHU A;  3AVN A;  1HMV A;  3ZT1 A;  3LDS A;  5CY4 A;  1NK5 A;  4KAZ A;  2QK9 A;  2RPI A;  4J2D A;  4B8C A;  1RT4 A;  1C1A A;  4IG0 A;  2D0B A;  1RT2 A;  1BI4 A;  5HP1 A;  3V1Q A;  1HYS A;  2EHG A;  3CM6 A;  5T7B A;  1LW0 A;  4GVM A;  4I9Q A;  2IOC A;  4M3Z A;  3AVJ A;  3ZSZ A;  3S3M A;  3QIP A;  3HK2 A;  2ZE2 A;  4OLB A;  1NJY A;  3HL8 A;  1TK5 A;  1DLO A;  1RNH A;  2VWK A;  3VQ5 A;  1DTT A;  5KRT A;  3ULD A;  3ALY A;  5JS1 A;  4CJL A;  3QES A;  4QCL A;  3ZT0 A;  1RBU A;  2FBT A;  4Q5V A;  4FXD A;  3QET A;  4CJV A;  4Q0B A;  2BE2 A;  1C0M A;  1FKO A;  1YVU A;  1DTQ A;  3P5J A;  4CEZ A;  4M3X A;  1YTU A;  3V9U A;  4KHN A;  1LWE A;  4Z4I A;  1HNV A;  3HYF A;  3NAE A;  1TK0 A;  4F3T A;  3A2F A;  2RKI A;  3LAL A;  4TSX A;  3DLE A;  3WNH A;  3ZSR A;  3ZT4 A;  3OS1 A;  3QEP A;  3F9K A;  1NK0 A;  4DU4 A;  4B9L A;  4F2S A;  3HP6 A;  4B3O A;  4FK4 A;  3M8S A;  1U47 A;  3S3O A;  3LP0 A;  3D0P A;  3U3Y A;  1LV5 A;  3PX0 A;  2ITG A;  5HRP A;  3AVF A;  3KLG A;  2Y1I A;  2OYQ A;  3H08 A;  1FXX A;  3C94 A;  4CJK A;  3SV3 A;  3MXI A;  4B9T A;  2X6N A;  1JLQ A;  3L2R A;  4O5B A;  4J2B A;  1LW2 A;  1WAF A;  1KCF A;  4KV8 A;  3VQA A;  4N76 A;  1TAU A;  3DYA A;  2VG5 A;  5J2Q A;  5I3U A;  4DMN A;  3HVT A;  1U48 A;  3VQ4 A;  4KFB A;  3MXM A;  4H8K A;  2DFH A;  3VQD A;  1EKE A;  4CEA A;  3CYM A;  1VSE A;  4FYD A;  4E0D A;  4DTX A;  3RMB A;  3NDK A;  2QKK A;  3OYD A;  3QO9 A;  3LP1 A;  3AA3 A;  1KTQ A;  4CJ3 A;  3RMA A;  1XC9 A;  1VSM A;  3SI6 A;  3KJV A;  3V9Z A;  1D5A A;  1JLB A;  2OPQ A;  1JXE A;  1RBT A;  4W5O A;  3DOK A;  2P5G A;  2HHX A;  2JLE A;  3HST B;  4LY7 A;  3ZSV A;  1RIL A;  4DTJ A;  1KVC A;  1S6Q A;  3AV9 A;  3P83 D;  4YNQ A;  3DRR A;  4NYF A;  3V9X A;  3AO5 A;  3SUP A;  4LSN A;  3TAP A;  1UOC A;  2FBY A;  4DQR A;  1F21 A;  1CXQ A;  4OKE A;  1XHZ A;  4BWM A;  4FZY A;  4NCA A;  1FKP A;  4EZ9 A;  1FK9 A;  2G8H A;  4B9S A;  3KD1 E;  3SV4 A;  4DFM A;  2Q3S A;  1TKX A;  3HPO A;  3AO3 A;  4HUF A;  1JLG A;  3P1G A;  4IBN A;  2R7Y A;  3V4I A;  1W9H A;  3ISN C;  3CQ8 A;  4KHY A;  1HQE A;  3VA0 A;  4M41 A;  2HHV A;  3F73 A;  1IKX A;  4M3T A;  1KLM A;  3VA3 A;  3VQ8 A;  3PX6 A;  3DMJ A;  4IDK A;  5JS2 A;  4DFP A;  2IAJ A;  3RWU A;  4IKF A;  4JRQ A;  4DSF A;  3K5O A;  3PUF A;  3NBP A;  2O4G A;  3ZT2 A;  1RTH A;  4FJH A;  2JGU A;  3VQP A;  2HHT A;  2Z1G A;  1QHT A;  3QEW A;  3NH2 A;  1A5V A;  1EXQ A;  3DRS A;  4AIL C;  3SQ2 A;  3OYN A;  2PZS A;  1VSD A;  3MEE A;  3WNE A;  4KHS A;  3DM2 A;  1I39 A;  4OGC A;  1NOZ A;  1RDD A;  1S9G A;  1KSP A;  4ELV A;  4FK2 A;  4KRE A;  3NGZ A;  4N47 A;  4CF0 A;  3ITH A;  1S9E A;  1X1P A;  4BDY A;  1SL1 A;  2FBX A;  2KZM A;  4MQ3 A;  3SCX A;  1C6V A;  3D45 A;  1L3T A;  1U04 A;  4DTO A;  1JKH A;  4FJJ A;  5FRM A;  3SUO A;  3I0R A;  1IKY A;  4Z0U A; 
#chains in the Genus database with same CATH topology
 3KK1 A;  1P8Z A;  4A2A A;  2E2O A;  2O8D B;  5J1E A;  4E7I A;  5C24 A;  3M1F A;  4DV0 K;  3E9O A;  4LFC K;  3O5B A;  3HRG A;  4PA1 A;  4BVP A;  5LMU K;  2QWR A;  4AHT A;  5JVG L;  4CGF A;  1QSY A;  3G4S N;  4NXM K;  1NGH A;  4E1J A;  2OPR A;  4KB0 A;  3LDO A;  3NF7 A;  3WQU A;  4DFJ A;  1U4B A;  2P9S B;  1GOA A;  3OYC A;  3SYZ A;  1Q81 O;  3H3N O;  1GOB A;  3OYF A;  1BA1 A;  3N4P A;  4IOX A;  2IDO A;  4K43 A;  2P51 A;  3B6P A;  4KH6 A;  3KTQ A;  3O3H A;  3L3V A;  5AQN A;  3ZT3 A;  1KLN A;  2IVN A;  1R0A A;  3UIQ A;  4MDA A;  2QWQ A;  2ZF5 O;  2WUS A;  4BRA A;  4KH5 A;  1LAW A;  4G1Q A;  3U9Z A;  1T44 A;  2BDP A;  5F0X A;  2UUC K;  3OYJ A;  1C1B A;  3TTC A;  3WNG A;  1J6Z A;  1GLJ O;  3K5M A;  4FJ7 A;  1ZBI A;  5DM6 L;  3EE9 A;  4M42 A;  4WQ5 C;  4LD0 A;  2BH1 A;  3QLH A;  3SBG A;  1NKE A;  3H1Q A;  1XHX A;  1NM1 A;  2F9W A;  1H1V A;  4W5Q A;  1QZ5 A;  3W3D A;  2EX3 A;  4I2Q A;  1HRH A;  5AQK A;  5J2P A;  3S9H A;  3RRH A;  3FZH A;  3L2U A;  4DFK A;  4CGJ A;  2AA4 A;  4FVU A;  3SPY A;  2P9L A;  1NBW A;  5TKY A;  2D0A A;  2G8K A;  3FGU A;  1SAZ A;  3LAN A;  1BIU A;  2KHO A;  4B1W B;  4I2P A;  1NK4 A;  3CJA A;  3BDP A;  1IKW A;  3K2P A;  4HTL A;  1IJJ A;  3L2Q A;  1QQM A;  3I33 A;  5C42 A;  2NRV A;  2VGN A;  4O0J A;  4A59 A;  1N8R O;  3LWM A;  3VTI A;  4JKF A;  4KI6 A;  2VG7 A;  4OKJ A;  2FXU A;  4HCC A;  2BGG A;  5E41 A;  3VGL A;  3OS2 A;  1RT7 A;  3HZ6 A;  4B1U B;  1XMO K;  2Q1N A;  2JWL A;  1KVA A;  3KLH A;  1TKD A;  2HMP A;  2YHA A;  1O13 A;  1N6Q A;  3CC4 N;  5HLF A;  3MK6 A;  4CEC A;  2W41 A;  3ZSY A;  3M3Z A;  3ZSO A;  3TAG A;  2O8E B;  3BY5 A;  3HPG A;  4FK0 A;  4BRK A;  3DXK B;  1LAV A;  4KTQ A;  3QIO A;  2YHB A;  4CJ4 A;  1SKW A;  1ZBH A;  3NVM A;  3ULE B;  4O4G A;  4QS8 A;  2VWJ A;  3VQ7 A;  2XY8 A;  3ZX2 A;  2WC9 A;  3NF9 A;  3DLH A;  1XQS C;  4FZX C;  3LZI A;  4G9Z A;  3BF3 A;  4MO5 A;  3TAB A;  4JI7 K;  1HR0 K;  1ZBF A;  3JSM A;  3O4Q A;  1LOT B;  3H3O B;  1JL2 A;  1WAJ A;  3UKU A;  4DV1 K;  3B6O A;  1K8A O;  4FLW A;  4BRQ A;  3C6H A;  4RTF D;  1MA9 B;  3TWH A;  1GLD G;  1T8E A;  1HNZ K;  3DLG A;  4F2R A;  3NFA A;  3C6T A;  3C6U A;  5GAD P;  2FSJ A;  3VQ9 A;  4A5B A;  4FJK A;  1NGG A;  4LFA K;  1TGO A;  3NHG A;  3V9W A;  5AZJ A;  1VQ5 N;  3TAN A;  2HHS A;  1C0F A;  1YVN A;  4L3Q A;  4AM7 A;  2XRI A;  1NOY A;  3QFP A;  4DCH A;  1B9F A;  4E1M A;  3SMS A;  3VQ6 A;  2QKB A;  1JLE A;  4DV4 K;  4B1X B;  3VQC A;  3CC2 N;  4BR7 A;  4MO4 A;  2QWP A;  4CCH A;  4O8U A;  2XY6 A;  1KAX A;  1HLU A;  3V9S A;  1KVB A;  4KKO A;  3OYL A;  4BY9 C;  3VEZ A;  4M3Y A;  3THY A;  2WTU A;  4JKA A;  3OS0 A;  5LJW A;  4DQS A;  1VSH A;  4V19 S;  4KPY A;  2G8F A;  4H4M A;  1U2V A;  1IBM K;  2OPS A;  1HNI A;  1TVR A;  4CGI A;  5J2M A;  3DWL A;  2OZM A;  5IT9 O;  4B3S K;  4BR4 A;  1QQO A;  3CCJ N;  2HBK A;  1RTI A;  2IVP A;  3IG1 A;  1WBB A;  4N41 A;  4QAG A;  1BGX T;  5AQI A;  1WSH A;  3V1O A;  3NGI A;  3TTD A;  3ULE A;  4BRH A;  4A61 A;  3QEV A;  1X9M A;  4R79 A;  1EP4 A;  1QVF M;  1EWQ A;  1XWL A;  4LH5 A;  4HUG A;  4X64 K;  4DLE A;  1VSL A;  1NGI A;  1VK0 A;  5FRN A;  1RT1 A;  2P9I A;  1NKB A;  3A5N C;  4CJR A;  3CI5 A;  1SQK A;  4FPB A;  5HRS A;  4JK7 A;  4C8K A;  4CK2 A;  3QNO A;  2IGI A;  2A1R A;  2BUP A;  4H5N A;  4A5A A;  2A40 A;  3IRX A;  4JEP A;  4JKC A;  5C25 A;  4J2E A;  3A0I X;  4M45 A;  1WN7 A;  4K8Z A;  1BU6 O;  4CJW A;  4CF8 A;  4DTU A;  4ISF A;  2P9U A;  3CCS N;  2ASP A;  3O9S A;  1IH7 A;  3CFO A;  5IWA K;  1JLC A;  4BRE A;  3ATV A;  3DLL L;  2PY5 A;  1BCM A;  4B08 A;  1ZYQ A;  4ZTJ A;  1DGK N;  3U8X A;  4KTZ A;  5GAH P;  3I0S A;  3KK3 A;  4H0Y B;  4OPA A;  1B92 A;  4OVL A;  2NZT A;  3VQE A;  4M3U A;  1HYV A;  4C8N A;  4AHU A;  5LMN K;  1HMV A;  3ZT1 A;  3L4Q A;  3WT0 A;  4BQL A;  1BI4 A;  3V1Q A;  5T7B A;  3MWP A;  3CCR N;  5AQV A;  4I9Q A;  3S3M A;  1RNH A;  4WCE L;  1DTT A;  5KRT A;  3ULD A;  3ALY A;  5BN8 A;  1N34 K;  3AAR A;  3QES A;  5M1F A;  4QCL A;  2FSK A;  1RBU A;  2D1K A;  4CEZ A;  1GLL O;  3J7A P;  3HBT A;  3CC7 N;  3MX5 A;  4JI3 K;  1TK0 A;  4TSX A;  1NK0 A;  2ZGZ A;  4H5W A;  2YHY A;  4EHT A;  3M8S A;  1NGC A;  2ITG A;  3AVF A;  3KLG A;  3H08 A;  2P9K B;  5EX5 A;  1JLQ A;  3L2R A;  1LW2 A;  4N76 A;  1TAU A;  4LF6 K;  5I3U A;  5J2Q A;  1Q7Y O;  3CPE A;  4KFB A;  2DFH A;  4FWM A;  5AFU H;  4CEA A;  1NG9 A;  4FYD A;  4WQ4 C;  4DTX A;  1OKJ A;  3QO9 A;  1JJ2 M;  4KHP K;  1VSM A;  1GLF O;  1D5A A;  2OPQ A;  1RBT A;  3DOK A;  3ZSV A;  3EL2 A;  4YNQ A;  3P83 D;  3AO5 A;  3MCP A;  3TAP A;  3C7N A;  5FLX O;  2W6K A;  1CZA N;  1XHZ A;  4EZ9 A;  4FWL A;  4WF9 L;  4FWP A;  2G8H A;  1TKX A;  4LF8 K;  3AO3 A;  2V52 B;  3V4I A;  3LDP A;  1HQE A;  4M41 A;  3K0S A;  5JS2 A;  4JKD A;  3K5O A;  4DUZ K;  1V4T A;  3NBP A;  2O4G A;  2Z1G A;  1YJ9 N;  3D6R A;  1EXQ A;  3ATU A;  1W2B M;  5C2D A;  3WNE A;  4ELV A;  4FK2 A;  4OGC A;  1NJI O;  4B1V A;  1KSP A;  3NGZ A;  1KD1 O;  2P9P B;  3RVC A;  4AF1 A;  3ZLJ A;  4JK9 A;  3CIP A;  3VOV A;  4JHD B;  1C6V A;  5I9E B;  4FJJ A;  3SUO A;  3GOI A;  1IKY A;  4FPA A;  4C1N K;  4ZTF A;  2O8C A;  4BRD A;  4W5T A;  1Z05 A;  2V7Y A;  3QEX A;  1XNQ K;  3H1V X;  5CYQ A;  3PIO L;  4IFY A;  1NGF A;  4RW4 A;  4CFC A;  4RW9 A;  4RG8 A;  5AR0 A;  5A2Q O;  1RDA A;  1VSI A;  1MU2 A;  5CZ2 A;  5GIO A;  5AQM A;  3MED A;  1Q9X A;  4B9N A;  3LDN A;  1WSE A;  2DFF A;  4XH1 A;  3I8D A;  2Y1J A;  3LP3 A;  1U49 A;  4M3W A;  3RMC A;  3N4Q A;  4YOY A;  4DR4 K;  4DQP A;  4O44 A;  1YUW A;  4K8X A;  1QE1 A;  4QS9 A;  4DSE A;  4N5S A;  1YI2 N;  2QTD A;  4JKE A;  2WOM A;  2P9N A;  4F4K A;  5LJV A;  2RF2 A;  1YIT N;  3CJ7 A;  2ASM A;  3WXL A;  3OBY A;  4Y1D A;  4OLA A;  5F2R A;  1HQU A;  4B3T K;  1BHL A;  3LAM A;  2LSN A;  1L3S A;  4M3R A;  4DR6 K;  4E89 A;  1WNS A;  2E1Z A;  4PL8 A;  1VQK N;  2KW4 A;  4FM1 A;  2QM1 A;  2GBZ A;  2Q2R A;  2YKN A;  1VSJ A;  3KLI A;  2F8S A;  4FLY A;  1D9F A;  4KHU A;  1M1K O;  4CGG A;  4JI0 K;  4B3R K;  4BWJ A;  1KQS M;  1RDW X;  4BRN A;  4B9M A;  1S5J A;  2A42 A;  2X78 A;  4OGE A;  3NH1 A;  3VQQ A;  5TKW A;  4BDP A;  4IFV A;  1CZB A;  2B4J A;  4DHY A;  3F9M A;  5KGX A;  1KFS A;  1N5Y A;  1KAZ A;  2IC3 A;  3LZJ A;  2P9P A;  3M8Q A;  1E4G T;  3IUC A;  3AAP A;  4B8A B;  2OPP A;  2VQF K;  4O5F A;  4DB3 A;  4HCB A;  4BG8 A;  4LF5 K;  3KK7 A;  4C8L A;  4NLB A;  2HBL A;  1RBR A;  2UXD K;  4YOW A;  1SZ2 A;  1TL3 A;  1C0G A;  3D7E O;  3CF5 L;  3NVK A;  2B6A A;  1C0T A;  3THX A;  3A8Y A;  4CGH A;  3BF1 A;  1QSL A;  4DU3 A;  2ATQ A;  2X6S A;  1YJN N;  3QIN A;  4FWR A;  2FSN A;  5SWM A;  5M1N A;  5AQQ A;  4EIA A;  2VCP A;  5GAE P;  4U67 L;  5AQR A;  1REV A;  4ILJ A;  3PO5 A;  3THV A;  2VQE K;  4CF1 A;  2KFN A;  1WSF A;  2Q36 A;  3QNN A;  4K41 A;  1HKG A;  3GL1 A;  4FWO A;  3ZEU A;  4UQG A;  1JLA A;  3NGY A;  3MCA B;  2PFU A;  5ADX A;  3LM9 A;  5M1P A;  5HRR A;  4ID1 A;  3HXM A;  3EKS A;  5M1K A;  4M63 C;  4N56 A;  2G8W A;  3L2W A;  3O3F A;  4IZ9 A;  3MX2 A;  4DR3 K;  1QZ6 A;  3NMU A;  3DLK A;  2YNH A;  2O8F B;  2YJE A;  1SKR A;  3DOL A;  1TUY A;  2XO7 A;  4NYN A;  5KPT A;  3PO4 A;  1ILY A;  3O9R A;  2H3G X;  3AVC A;  1BIS A;  5LY3 A;  2FC0 A;  1Y97 A;  1N33 K;  4UY8 O;  4CIF A;  4JV5 K;  3IKM A;  2QEX N;  1X3M A;  3AO2 A;  4CJT A;  1IG9 A;  1Q9Y A;  4RW7 A;  5FPM A;  4BRP A;  3ASM A;  3VN5 A;  1YJW N;  1D8Y A;  4CHY A;  3EYZ A;  3EZW A;  4IFE A;  4DF4 A;  2HW3 A;  3MN6 A;  1HYZ A;  4JK8 A;  2HB5 A;  2F4V K;  2PAV A;  4PHT X;  4BC4 A;  2HMI A;  4BC2 A;  3SBT A;  4KTW A;  3G0Z A;  4YOV A;  5HL7 L;  3LPT A;  4CHP A;  1TKT A;  2D0P A;  4CZJ A;  4CJF A;  1NK8 A;  2E6M A;  4FJN A;  4NLC A;  3BZC A;  4YDU C;  3T1A A;  1C1C A;  4HHT A;  3SNN A;  2HVI A;  4QS7 A;  2DPN A;  2KQ2 A;  1TKZ A;  4BRM A;  2NLX A;  4J8F A;  3MAQ A;  5CYM A;  5CE3 A;  4CF2 A;  3FZM A;  3WQT A;  4H0P A;  4C8M A;  4FJI A;  3AA2 A;  2NRX A;  5HBM A;  3RR8 A;  3M8P A;  4DWI A;  5AZI A;  3QEI A;  1SUQ A;  4LFB K;  4CEO A;  3LAK A;  4CJP A;  3T1H K;  5FRO A;  5AJ3 K;  4YOR A;  4HVJ A;  3KHY A;  4Y1C A;  3D2F A;  2DTU A;  4DLG A;  2E1Y A;  3NE6 A;  4HWI A;  2J4R A;  5DMR A;  4ELU A;  4PWD A;  2O8D A;  2YNF A;  4AHR A;  1E3M A;  3UE5 A;  1TL1 A;  3ID6 A;  1WSJ A;  4CFA A;  4XH5 A;  3WEE B;  2FLO A;  1RDU A;  3OYA A;  4PKH A;  1ASU A;  4H0O A;  3ZSQ A;  2O8F A;  3SUQ A;  1VSK A;  4CEF A;  4OPJ A;  4DSK A;  3AVG A;  1VSF A;  2YHW A;  4K42 A;  1DKG D;  3T7Z A;  1NNE A;  5ELZ A;  4CE9 A;  4RCH A;  2W42 A;  2P9S A;  3ZET B;  3VES A;  1T7P A;  4DF8 A;  1VQP N;  4KHW A;  2PBD A;  4B1Z A;  1B9D A;  1EET A;  4YOU A;  1G15 A;  4KRF A;  3V1R A;  4DSJ A;  1X3N A;  5SZT A;  2FF3 B;  1J54 A;  1JXB A;  3JYT A;  1SKS A;  1K6Y A;  4MFB A;  3SQ0 A;  4CW7 B;  1NK6 A;  4QOZ B;  4OO1 J;  1NGJ A;  4H5T A;  4FM2 A;  2WFB A;  3WUH A;  1T05 A;  3AVA A;  3MN9 A;  1RBV A;  4JS5 A;  3NH0 A;  1LWF A;  3GE1 A;  4FJM A;  3J7Y P;  4E3S A;  1VQN N;  2GEM A;  5F1X A;  1JLF A;  4B9Q A;  4FJG A;  3EEQ A;  2QXF A;  4ELT A;  2KTQ A;  4IO9 L;  2RHK A;  3LDL A;  3KLF A;  3CJC A;  3QDK A;  4DG1 A;  3NF8 A;  3IFR A;  3AVM A;  2ZJR L;  4BAC A;  2BTF A;  4BC3 A;  4H0X B;  5CY4 A;  4KAZ A;  1D4X A;  5FPD A;  4B8C A;  4IG0 A;  5HP1 A;  1RT2 A;  5KPR A;  1JCE A;  3CM6 A;  3DXM B;  1XMQ K;  1LW0 A;  4M3Z A;  4DV6 K;  3QIP A;  3HK2 A;  1VAZ A;  1DLO A;  3O8M A;  4CJL A;  3O80 A;  3CD6 N;  3CJ9 A;  3VPZ A;  1S3X A;  4NB4 A;  4CJV A;  2NRW A;  4Q0B A;  4M3X A;  4KHN A;  1LWE A;  4RWT A;  4BVO A;  3NAE A;  1Y64 A;  2DY4 A;  3ZT4 A;  3OS1 A;  1VHX A;  2O8B B;  3O1B A;  1U47 A;  3U3Y A;  1LV5 A;  4JN4 A;  3T69 A;  4LF4 K;  5HRP A;  4FWN A;  2Y1I A;  1WOQ A;  1I94 K;  3MXI A;  4FSV A;  1KCF A;  4KV8 A;  4JYA K;  3ZX3 A;  2VG5 A;  4DMN A;  4CJ7 A;  3G71 N;  3HVT A;  2D4W A;  3MXM A;  4H8K A;  5EOY A;  2ASO A;  1EKE A;  3LM2 A;  2O8E A;  3WXJ A;  1YIJ N;  3CYM A;  1VSE A;  3PSF A;  4CVN E;  1RFQ A;  2QWL A;  3DXK A;  2GWJ A;  2QKK A;  4LF7 K;  3LP1 A;  3AA3 A;  3RMA A;  1XC9 A;  3SI6 A;  3V9Z A;  4W5O A;  1JLB A;  1K73 O;  1HX1 A;  2HHX A;  1KVC A;  3V9X A;  4NYF A;  4NXN K;  4NO7 A;  5DM7 L;  1UOC A;  4DQR A;  1F21 A;  4NCA A;  2ZM6 K;  3KD1 E;  3SV4 A;  2Q3S A;  3AGR A;  1JLG A;  3VA0 A;  4ILH A;  1ZBS A;  3DMJ A;  3GG4 A;  1GLC G;  4IDK A;  1R59 O;  3EN9 A;  4A57 A;  1VQL N;  3RWU A;  1IV0 A;  1TYQ B;  3ZT2 A;  4FJH A;  3VQP A;  2HHT A;  1QHT A;  3QEW A;  3NH2 A;  3OYN A;  4DV3 K;  1GLB G;  1S9G A;  4BR2 A;  4CF0 A;  3ITH A;  1X1P A;  4BDY A;  4YY3 K;  2FBX A;  2GTD A;  3BP8 A;  4FWS A;  4MQ3 A;  3SCX A;  1L3T A;  1V4S A;  1YHQ N;  3VEW A;  3H46 O;  4DV7 K;  4O8K A;  2E20 A;  2I7N A;  2QWO A;  2V51 B;  4CIG A;  2UYT A;  4CEE A;  3TAE A;  4Z4G A;  3O9T A;  1QTM A;  1ATN A;  4CES A;  3LPU A;  4AHV A;  2VYP A;  2A6A A;  3IDH A;  2YKM A;  4DTS A;  1ZBL A;  1RGI A;  4JLH A;  3OYH A;  1UA0 A;  5C2F A;  4IJN A;  4Z4H A;  4EZ6 A;  1RTD A;  4E7K A;  2GWK A;  3BZK A;  2PYJ A;  1IKV A;  4E1N A;  4GV9 A;  2YNG A;  1EWR A;  1T6C A;  1NLV A;  4HUE A;  3O3G A;  2P1J A;  3A5L C;  3U9D A;  3C0B A;  3TR8 A;  4AM6 A;  3S3N A;  4DR1 K;  2O4I A;  3FZL A;  4CZH A;  4CHN A;  3O6W A;  4CF9 A;  4WFB L;  4YOX A;  4LF9 K;  4CED A;  2QW9 A;  1VQ7 N;  1Q18 A;  1WSG A;  2ETJ A;  3OYM A;  2QWN A;  1SL0 A;  5AQO A;  5BR8 K;  4FVM A;  4F8R A;  4C23 A;  1WBD A;  1T6D A;  4YOT A;  3MWT A;  4C1N I;  1S1X A;  4BE1 A;  1ZBU A;  1JCG A;  1TK8 A;  4FJL A;  1UA1 A;  1W0H A;  1QSS A;  1XNR K;  4IOC L;  5BPN A;  2YV0 X;  3J81 O;  4DS4 A;  3EZ5 A;  3TPQ A;  4ZHR A;  1NJW A;  4BRL A;  3RRG A;  4F9O A;  5BN9 A;  1M90 O;  2RN2 A;  1KC8 O;  1GOC A;  3KKR A;  3K5L A;  1N36 K;  3H45 C;  3K9J A;  4E7H A;  1ZXO A;  4IO8 A;  2ZWH A;  3L4I A;  3G25 A;  2X74 A;  5AQZ A;  5EVZ A;  4CK3 A;  2FF6 A;  2ITM A;  1K8K B;  1NKC A;  2A1S A;  3F2K A;  2HHH K;  4ICL A;  3EO3 A;  4KH4 A;  2I5J A;  1WSI A;  4FOE A;  3OY9 A;  2A41 A;  2HND A;  1Z25 A;  4JD2 B;  4FJ8 A;  1LWC A;  3MMV A;  3C65 A;  3HM9 A;  1WB9 A;  1NMN A;  3AVI A;  3TAQ A;  4IG3 A;  3RTV A;  3O4N A;  3OJU A;  3FZF A;  1P90 A;  5D3G A;  1XI1 A;  2WON A;  2F7T A;  3ENO A;  4BRI A;  4PY5 A;  2HBM A;  3QIC A;  5C12 A;  4W5N A;  2DFE A;  3FLC O;  3P39 A;  4XH4 A;  3ENB A;  3OTO K;  2PYL A;  3BUZ B;  3WXI A;  1S1U A;  2KFZ A;  4DSL A;  1T03 A;  4CJS A;  4CZL A;  4ISG A;  1RT3 A;  3I8B A;  3VGM A;  4HTU A;  3CJB A;  3HM8 A;  4DQQ A;  4CZF A;  5GIN A;  5AQW A;  4IEI A;  1NJX A;  5AQU A;  4GNI A;  1S1W A;  2P9K A;  5JVH L;  3RSE B;  3EE8 A;  4YFU A;  4FW2 A;  3ENH A;  4EP4 A;  3TAM A;  4JRP A;  3RMD A;  4ILG B;  2I7P A;  4DR7 K;  4AHC A;  4BE0 A;  2HHW A;  3EKU A;  4IEE A;  4BRG A;  4CBU A;  1MWK A;  2Q0R A;  3TSP A;  3OYI A;  4CZG A;  2NUB A;  3TI0 A;  3OW2 M;  1EO1 A;  3TAF A;  4JKG B;  3SAG A;  2A3Z A;  5HRO A;  4BR5 A;  1BA0 A;  3QBX A;  5BRF A;  3UKR B;  3SQ4 A;  4DQI A;  4B9V A;  1RT6 A;  2D0C A;  4EFH A;  3OYE A;  4CBW A;  2HNY A;  3HT3 A;  1K8K A;  1BOT O;  4I6M B;  3AVB A;  3QB0 A;  5JLF A;  5K14 A;  3OYB A;  5ADX H;  4FCY A;  1ESV A;  3PY8 A;  4CJU A;  3CMA N;  1BDG A;  1QQN A;  2HF3 A;  3PX4 A;  4FZZ A;  3IAY A;  3G6E N;  1X9W A;  1DEJ A;  4DV2 K;  3THW B;  4BE2 A;  4JHD A;  1BUP A;  3CQX A;  2HVH A;  1KRP A;  3SLC A;  3K59 A;  4KI4 A;  3L3U A;  1RT5 A;  4CJE A;  4DKW A;  3OJS A;  3PV8 A;  3VMF B;  1A5W A;  3EY1 A;  4DTP A;  3K9K A;  3CM5 A;  4DR2 K;  5GIP A;  4EAH D;  3VER A;  4BDZ A;  2HF4 A;  1Z26 A;  1HKB A;  4H5V A;  3ZSW A;  4JS4 A;  5KTQ A;  1J5O A;  1YT3 A;  3MEG A;  5KPZ A;  3SK3 A;  4LC9 B;  3MN7 A;  1CXU A;  2OTJ N;  2B5J A;  4KBO A;  4CFD A;  1SS6 A;  3P4I A;  3P31 A;  1S6P A;  3CCL N;  1S1V A;  4NCB A;  4LSL A;  3AGK A;  2ZJP L;  2XHB A;  2OAN A;  3M6G A;  2QXL A;  4BR0 A;  1X9S A;  4MLH A;  5JMV A;  1HKC A;  1RDB A;  5BR9 A;  4PL7 A;  4K0K K;  2ZD1 A;  1UAX A;  4CIE A;  4EP5 A;  1QQC A;  3KLE A;  4GKJ K;  3V6D A;  3SJH A;  4JKB A;  4JI1 K;  3R1X A;  2IS3 A;  4BC5 A;  1IBL K;  3FZK A;  1J53 A;  4I6M A;  1QHA A;  1ITG A;  5KGW A;  3MEC A;  2OZS A;  2E88 A;  4Z94 A;  3O4W A;  4AHS A;  3K58 A;  4BGA A;  3VEO A;  5EU7 A;  3QER A;  4E19 A;  4WYB A;  4GVE A;  4EHU A;  2IVO A;  3RR7 A;  1TV6 A;  3BGR A;  4FO0 A;  2VGM A;  2G8V A;  2XY5 A;  3THW A;  1VQ4 N;  4Z4E A;  3HI0 A;  2QK9 A;  3LDS A;  1OH8 A;  4J2D A;  1C1A A;  2UUA K;  4DV5 K;  5EXW A;  1HYS A;  1NMD A;  4U7B A;  3ZSZ A;  1N32 K;  1NJY A;  3LDQ A;  4CZE A;  4CI6 A;  4XEI A;  3ZT0 A;  4JI8 K;  2FBT A;  3QET A;  2BE2 A;  1FKO A;  3P5J A;  4IWV A;  3V9U A;  4Z4I A;  3O1W A;  3VEN A;  4FL9 A;  2W6L A;  1HNX K;  3B8A X;  1NGB A;  3A2F A;  2RKI A;  3WNH A;  3QEP A;  3ZSR A;  3ZX0 A;  4A2B A;  4DU4 A;  4F2S A;  3WXM B;  1Z6R A;  2A5X A;  1BWF O;  3LP0 A;  1ATR A;  5H1S Q;  5AQP A;  2OYQ A;  2E2N A;  1X9J A;  1FXX A;  3C94 A;  4CJK A;  3SV3 A;  2X6N A;  2UXB K;  3R8E A;  1WAF A;  3VQA A;  4FWK A;  3GBT A;  3R3L A;  3JXU A;  3WXK A;  3VQ4 A;  1GLA G;  4MDB A;  3UKU B;  3L6Q A;  3KZB A;  4E0D A;  3RMB A;  4BR9 A;  3OYD A;  3SAF A;  4CJ3 A;  4OX9 K;  1WUA A;  1W97 L;  3MDQ A;  3KJV A;  1JXE A;  2Q31 A;  3HST B;  2E2P A;  1RIL A;  4DTJ A;  4BQZ A;  3AV9 A;  5FPE A;  3DRR A;  4LSN A;  2AP1 A;  4X66 K;  1CXQ A;  4FZY A;  5AZJ B;  1NGE A;  1FK9 A;  4B9S A;  4CD3 A;  3HPO A;  4HUF A;  3P1G A;  4IBN A;  1W9H A;  4KHY A;  3ZYY X;  3F73 A;  4M3T A;  3VA3 A;  3VQ8 A;  2IAJ A;  3Q7B A;  4BRC A;  4JRQ A;  3L0Q A;  4DSF A;  3PUF A;  3SQ2 A;  1A5V A;  4AIL C;  2PZS A;  1VSD A;  3MEE A;  4KHS A;  3DM2 A;  1RDD A;  4KRE A;  4X65 K;  1W7A A;  1KAY A;  2YX6 A;  1SL1 A;  1E4F T;  3THY B;  5AQJ A;  2KZM A;  3Q7C A;  1U04 A;  4DTO A;  1JKH A;  4BRF A;  4H03 B;  3I0R A;  1U2V B;  4Z0U A;  5BPM A;  4WFN L;  1D9D A;  2Q97 A;  2CH6 A;  3TU5 A;  3FE1 A;  3KWI A;  4KB1 A;  4H5R A;  5BRH A;  3K5N A;  4JNE A;  3GDQ A;  3C6A A;  3P38 A;  4I9L A;  3VGK A;  3J7Z O;  1U45 A;  3SPZ A;  4BGB A;  2GV9 A;  5GAG P;  5MLC Q;  2CGK A;  3DAW A;  2EWS A;  2NRH A;  3AA5 X;  3SMP A;  3UB5 A;  2P9I B;  5CHI A;  4CZM A;  4FLU A;  4O0I A;  3WNF A;  1DT9 A;  4DS5 A;  4YDU A;  3CFR A;  4WQ5 A;  1BL3 A;  4B9U A;  3TSU A;  1S72 N;  3U3G A;  1G99 A;  3J8A A;  1OVY A;  3U4L A;  2F8T A;  3M8R A;  3WEE A;  3HO1 A;  5AQG A;  3M5R A;  5AQS A;  2ZGY A;  5CZ1 A;  4PKI A;  3PLA A;  1IO2 A;  2W40 A;  4GW6 A;  5AQH A;  2UXC K;  4CK1 A;  4FLV A;  1L5U A;  3C95 A;  3PSI A;  5AQT A;  3E9L A;  2P9U B;  2YCH A;  1VRU A;  5HRN A;  5KRS A;  4R5P A;  3CME N;  1HJR A;  4FWQ A;  3ZET A;  2D5R A;  2KZZ A;  1RDC A;  2WBN A;  1BQN A;  4A62 A;  1HPZ A;  3CQY A;  2UUB K;  1OH6 A;  3H6E A;  1JL1 A;  3ZCM A;  1OH5 A;  3CHW A;  3DJC A;  3CG7 A;  2BAN A;  3L8B A;  3S41 A;  1FW6 A;  4BRO A;  3AA4 A;  2CGJ A;  1MDU B;  3LWL A;  3OA9 A;  3E1Y A;  1IG8 A;  1NGD A;  1OH7 A;  2QI2 A;  1BI4 B;  3AVK A;  1RTJ A;  4FLX A;  2E6L A;  4IXC A;  3VET A;  5BRE A;  4FLT A;  3T19 A;  1EX4 A;  3IS9 A;  4DTR A;  1BQM A;  3DRP A;  4RW8 A;  3W0L A;  3V81 A;  4JI2 K;  2ZJQ L;  3HJF A;  4Y0W A;  2G8U A;  1NK7 A;  2Q0U A;  5FPN A;  5I42 A;  2CH5 A;  3VF4 A;  2F96 A;  2YHX A;  3MN5 A;  3AO4 A;  3K57 A;  3AO1 A;  3SJJ A;  2AJQ A;  1VQM N;  4FW1 A;  1ASW A;  2VG6 A;  3ZSX A;  4FJX A;  2ZQB A;  4X62 K;  1KXP A;  3DXM A;  1JCF A;  3TTF A;  3SZ2 A;  3D2E B;  4GKK K;  2QA4 N;  3HVR A;  1EQY A;  1QVG M;  1A5X A;  4CER A;  2E4L A;  2E2Q A;  3O08 A;  1BIZ A;  5JIC A;  2Z1H A;  3KWG A;  1T3V A;  3NF6 A;  3IMX A;  3OYG A;  2O8B A;  2VWB A;  4CHQ A;  4RW6 A;  1L3U A;  3F5T A;  4CEQ A;  5BPL A;  4PKG A;  3DLR A;  4FJ5 A;  1RBS A;  3SAH A;  4KO0 A;  3C7N B;  4ISE A;  3NCI A;  3VEX A;  3I55 N;  3KK2 A;  5AQY A;  3A5O C;  4IOA L;  2YJF A;  5EY4 A;  1OVQ A;  2G8I A;  3CFP A;  1ZC6 A;  5E26 A;  3MXJ A;  1MWM A;  4CFB A;  5C10 A;  2FBV A;  1NWK A;  2P5O A;  2HHU A;  2HNZ A;  2Z1J A;  4DR5 K;  4PQU A;  3HTV A;  2GEL A;  4NCG A;  4JKH A;  3VEV A;  4DSI A;  1SV5 A;  4M7Y A;  4H4O A;  1RCH A;  3KIO A;  3LP2 A;  3OHR A;  4XIU A;  4GMJ B;  1O1W A;  2GX9 A;  3SUN A;  3A5M C;  2OCE A;  3CPW M;  1VRT A;  4OJR A;  3FFI A;  1NJZ A;  4FLZ A;  3E66 A;  3TAR A;  1Q86 O;  5KQD A;  2O8C B;  1YTA A;  4CJQ A;  1SL2 A;  4WE1 A;  1Q8I A;  2RE2 A;  4O55 A;  3QML A;  1TYQ A;  1YXQ A;  3T1Y K;  1VQ6 N;  4H0V B;  3DLB A;  3FFK B;  3FR0 A;  1C0U A;  1TAQ A;  3CCQ N;  4E7L A;  3T3F A;  3TSQ A;  3KD5 E;  2D0O A;  1CZ9 A;  3E01 A;  4B3M K;  3AY9 A;  5J2N A;  3CET A;  2NRT A;  2QWM A;  2V7Z A;  3D2E A;  3U6F A;  5E84 A;  2YI1 A;  1KFD A;  4JAX A;  3HPH A;  4GY2 B;  4Z4F A;  3AVL A;  1CLQ A;  3HP9 A;  1YF5 L;  4OPK A;  4CEB A;  5KQ8 A;  2HHQ A;  3AVH A;  3DI6 A;  2P9N B;  3CJ1 A;  4I7F A;  2OA8 A;  2OTL N;  4Z4C A;  4CJ5 A;  2GUI A;  5BRD A;  2XY7 A;  1VQO N;  4ID5 A;  4CZK A;  1I3A A;  4GV6 A;  2KLA A;  5FDL A;  4CGD A;  3G10 A;  4DU1 A;  5M1Q A;  4CD1 A;  1QS4 A;  1L3V A;  1UWB A;  3OVN A;  3VQB A;  1K9M O;  2JWK A;  2NRZ A;  1BCO A;  4KHQ A;  4OKK A;  4DTM A;  4C8O A;  1FJG K;  3SQ1 A;  2YNI A;  5DK5 A;  3OYK A;  3AAQ A;  3E9P A;  3L2V A;  3O9Q A;  5AQL A;  5KI6 A;  4IJA A;  4AH9 A;  3VF6 A;  1WLJ A;  4B1Y B;  4J2A A;  3KVG A;  4PUO A;  4DTN A;  3O9U A;  4F3O A;  1HNW K;  3KKS A;  4L8R B;  3I56 N;  4CHZ A;  4FJ9 A;  2F9T A;  1S1T A;  4CHO A;  1VQ9 N;  5AFU A;  2HOE A;  4FM0 A;  1BO5 O;  4JI4 K;  4CBX A;  3PIP L;  3VEY A;  2CGL A;  4E7J A;  1ASV A;  3THX B;  1J9A A;  4W5R A;  1NU0 A;  2IIR A;  2Z1I A;  2E8A A;  4K25 A;  1NK9 A;  4LH4 A;  3J80 O;  1S22 A;  1LCU A;  3AVN A;  1NK5 A;  2RPI A;  4OPH A;  1RT4 A;  2D0B A;  2EHG A;  4GVM A;  2IOC A;  3AVJ A;  3HSC A;  2ZE2 A;  4OLB A;  3HL8 A;  1TK5 A;  2GUP A;  2VWK A;  1HUX A;  3VQ5 A;  3ZEU B;  3CER A;  5JS1 A;  3CCU N;  1J5E K;  1HPM A;  4Q5V A;  4FXD A;  3LL3 A;  4FOI A;  1C0M A;  1XC3 A;  1YVU A;  1DTQ A;  1YTU A;  1U6Z A;  4WQ4 A;  1NGA A;  4JD2 A;  1HNV A;  3HYF A;  4DUY K;  4F3T A;  3LAL A;  3DLE A;  1Q82 O;  3F9K A;  3JS6 A;  5LL6 Z;  4B9L A;  2NNW A;  3HP6 A;  4B3O A;  4JI6 K;  4FK4 A;  3S3O A;  3D0P A;  1XUP O;  3PX0 A;  5CR4 A;  5M1O A;  1HJO A;  4B9T A;  3CCV N;  3BEX A;  4O5B A;  4J2B A;  4M7X A;  4IDH A;  4JI5 K;  3DYA A;  4CZI A;  5AQX A;  5B8H A;  1U48 A;  3CXC M;  1GLE G;  5C15 A;  3VQD A;  3HOT A;  2NRR A;  3NDK A;  1YAG A;  2HST A;  1KTQ A;  3OBW A;  1VQ8 N;  5C0Y A;  2P5G A;  5AQF A;  2JLE A;  4LY7 A;  2KKZ A;  3QFU A;  3CCM N;  3R9P A;  1S6Q A;  3SUP A;  2FBY A;  1IBK K;  3HOS A;  4OKE A;  3RSE A;  3VF2 A;  4BWM A;  1FKP A;  5HOO A;  3R6M A;  1BG3 A;  4DFM A;  4GV3 A;  2R7Y A;  3ISN C;  3CQ8 A;  3CCE N;  2HHV A;  1IKX A;  1KLM A;  3PX6 A;  5JLH A;  4IKF A;  4DFP A;  4MLE A;  2UU9 K;  3VTH A;  1RTH A;  2JGU A;  4BG9 A;  3DRS A;  4DQ8 A;  1TUU A;  4JKG A;  3JAM O;  1I39 A;  1NOZ A;  4N47 A;  5AZI B;  1S9E A;  2P9L B;  3QBW A;  4AQY K;  3UKR A;  1ATS A;  2HBJ A;  3D45 A;  4H0T B;  3ID8 A;  5FRM A;  2E5L K;  4YHH K;  4WFA L;  3D2F B; 
#chains in the Genus database with same CATH homology
 4ZTF A;  1D9D A;  3KK1 A;  4W5T A;  5J1E A;  4E7I A;  3QEX A;  4KB1 A;  5C24 A;  4CIG A;  5CYQ A;  3K5N A;  4IFY A;  4RW4 A;  4CEE A;  4RW9 A;  4CFC A;  4RG8 A;  4I9L A;  3TAE A;  1QTM A;  4Z4G A;  1RDA A;  1U45 A;  1VSI A;  1MU2 A;  5CZ2 A;  4CES A;  3LPU A;  3SPZ A;  4KRF A;  4PA1 A;  2GV9 A;  4AHV A;  3MED A;  1Q9X A;  4B9N A;  4AHT A;  1WSE A;  2DFF A;  3I8D A;  4CGF A;  1QSY A;  2Y1J A;  3LP3 A;  2YKM A;  4DTS A;  2OPR A;  4KB0 A;  1ZBL A;  4JLH A;  1U49 A;  4M3W A;  3AA5 X;  3NF7 A;  3RMC A;  3OYH A;  1UA0 A;  4DFJ A;  4FLU A;  1U4B A;  1GOA A;  4Z4H A;  4O0I A;  3OYC A;  3WNF A;  4EZ6 A;  3SYZ A;  4O44 A;  4DQP A;  4K8X A;  1RTD A;  1QE1 A;  4E7K A;  4DS5 A;  2PYJ A;  1GOB A;  1IKV A;  4DSE A;  3OYF A;  3CFR A;  4N5S A;  1BL3 A;  4E1N A;  4B9U A;  2IDO A;  2YNG A;  3U3G A;  4HUE A;  2P51 A;  3B6P A;  2WOM A;  2F8T A;  3M8R A;  4F4K A;  3KTQ A;  4DWI A;  3HO1 A;  2RF2 A;  3L3V A;  3O3G A;  3O3H A;  2DY4 A;  3ZT3 A;  1KLN A;  2P1J A;  5CZ1 A;  1R0A A;  3UIQ A;  1IO2 A;  4Y1D A;  4GW6 A;  3TR8 A;  4OLA A;  1HQU A;  1LAW A;  4G1Q A;  4CK1 A;  4FLV A;  2BDP A;  1BHL A;  3S3N A;  1L5U A;  3LAM A;  2O4I A;  3OYJ A;  3C95 A;  1C1B A;  2LSN A;  4CHN A;  1L3S A;  4M3R A;  4E89 A;  1WNS A;  1VRU A;  3WNG A;  5HRN A;  5KRS A;  4CF9 A;  4R5P A;  4CED A;  2KW4 A;  4FM1 A;  3K5M A;  2GBZ A;  4FJ7 A;  2YKN A;  1WSG A;  1VSJ A;  2ETJ A;  3OYM A;  1SL0 A;  1HJR A;  1ZBI A;  4FVM A;  2D5R A;  3KLI A;  4F8R A;  2F8S A;  2KZZ A;  4FLY A;  1RDC A;  4M42 A;  1D9F A;  4KHU A;  1BQN A;  4CGG A;  4LD0 A;  1HPZ A;  4BWJ A;  3QLH A;  1NKE A;  1XHX A;  4B9M A;  4W5Q A;  1S5J A;  1S1X A;  2X78 A;  1ZBU A;  2EX3 A;  4OGE A;  3VQQ A;  3NH1 A;  4BE1 A;  4BDP A;  1TK8 A;  4IFV A;  1CZB A;  1W0H A;  1UA1 A;  4I2Q A;  1QSS A;  2B4J A;  4FJL A;  1HRH A;  1JL1 A;  3ZCM A;  2YV0 X;  5J2P A;  4DS4 A;  3S9H A;  3EZ5 A;  3RRH A;  4ZHR A;  5KGX A;  1NJW A;  1KFS A;  3CG7 A;  2BAN A;  2IC3 A;  3L2U A;  3LZJ A;  3L8B A;  4CGJ A;  4DFK A;  1N5Y A;  3RRG A;  3M8Q A;  2RN2 A;  3SPY A;  3AA4 A;  1GOC A;  3LWL A;  4B8A B;  2OPP A;  3KKR A;  2D0A A;  3K5L A;  2G8K A;  4E7H A;  4HCB A;  1BI4 B;  3AVK A;  1BIU A;  3LAN A;  1RTJ A;  4I2P A;  4FLX A;  2E6L A;  1NK4 A;  2X74 A;  3BDP A;  4C8L A;  4CK3 A;  4FLT A;  3T19 A;  1RBR A;  1IKW A;  1EX4 A;  3K2P A;  3IS9 A;  4DTR A;  1NKC A;  1TL3 A;  3L2Q A;  2A1S A;  1BQM A;  3DRP A;  4RW8 A;  3V81 A;  4ICL A;  2B6A A;  5C42 A;  1C0T A;  2I5J A;  3HJF A;  1WSI A;  4O0J A;  3OY9 A;  1NK7 A;  2G8U A;  2HND A;  1Z25 A;  5I42 A;  4FJ8 A;  1LWC A;  4CGH A;  3LWM A;  1QSL A;  2F96 A;  3HM9 A;  4DU3 A;  2ATQ A;  4KI6 A;  2VG7 A;  2X6S A;  4OKJ A;  3AO4 A;  3QIN A;  4HCC A;  3AVI A;  3K57 A;  3TAQ A;  2BGG A;  3AO1 A;  4IG3 A;  5E41 A;  5SWM A;  3SJJ A;  3OS2 A;  2AJQ A;  1RT7 A;  4FW1 A;  1ASW A;  2VG6 A;  1REV A;  3ZSX A;  3RTV A;  3PO5 A;  2ZQB A;  3O4N A;  3OJU A;  4FJX A;  3THV A;  5D3G A;  4CF1 A;  3SZ2 A;  1XI1 A;  1KVA A;  2WON A;  3KLH A;  1WSF A;  1TKD A;  2KFN A;  3QNN A;  2YHA A;  3HVR A;  1N6Q A;  4PY5 A;  4UQG A;  5HLF A;  1JLA A;  3NGY A;  1A5X A;  4CEC A;  4W5N A;  2DFE A;  3ZSY A;  3ZSO A;  5HRR A;  4ID1 A;  3TAG A;  3HXM A;  2PYL A;  4CER A;  2E4L A;  1S1U A;  4N56 A;  2KFZ A;  3HPG A;  1T03 A;  4DSL A;  4CJS A;  4FK0 A;  1BIZ A;  2G8W A;  3L2W A;  1LAV A;  2Z1H A;  3O3F A;  4KTQ A;  3QIO A;  3NF6 A;  2YHB A;  1RT3 A;  3DLK A;  4CJ4 A;  3OYG A;  2YNH A;  4CHQ A;  4RW6 A;  1SKW A;  4CEQ A;  4HTU A;  1L3U A;  1ZBH A;  4DQQ A;  1SKR A;  3DLR A;  3DOL A;  4O4G A;  2VWJ A;  4FJ5 A;  1RBS A;  3VQ7 A;  2XO7 A;  2XY8 A;  4NYN A;  1NJX A;  3PO4 A;  3NF9 A;  4KO0 A;  1S1W A;  3NCI A;  3DLH A;  4YFU A;  3AVC A;  1BIS A;  3KK2 A;  4FW2 A;  2FC0 A;  4FZX C;  1Y97 A;  3LZI A;  4EP4 A;  3TAM A;  4JRP A;  3TAB A;  3RMD A;  2G8I A;  3CFP A;  4CIF A;  3MXJ A;  1ZBF A;  4CFB A;  3JSM A;  3O4Q A;  4AHC A;  1JL2 A;  1WAJ A;  2FBV A;  4BE0 A;  3AO2 A;  3B6O A;  4CJT A;  2P5O A;  2HHW A;  1IG9 A;  2HNZ A;  2Z1J A;  1Q9Y A;  4RW7 A;  2HHU A;  4PQU A;  3ASM A;  3VN5 A;  3OYI A;  4NCG A;  1D8Y A;  2NUB A;  4CHY A;  3EYZ A;  1SV5 A;  4FLW A;  3TI0 A;  3TWH A;  4H4O A;  4DSI A;  4DF4 A;  3TAF A;  1T8E A;  1RCH A;  2HW3 A;  3DLG A;  5HRO A;  1HYZ A;  2HB5 A;  4F2R A;  3NFA A;  3KIO A;  3LP2 A;  2HMI A;  4DQI A;  3SQ4 A;  4XIU A;  3C6T A;  3C6U A;  4GMJ B;  4KTW A;  4B9V A;  3G0Z A;  3VQ9 A;  1O1W A;  4FJK A;  1RT6 A;  2D0C A;  3SUN A;  1TGO A;  3NHG A;  3OYE A;  3LPT A;  1VRT A;  4OJR A;  2HNY A;  3FFI A;  4CHP A;  3HT3 A;  4FLZ A;  1TKT A;  3V9W A;  1NJZ A;  3TAR A;  4CJF A;  3AVB A;  2E6M A;  1YTA A;  4CJQ A;  1NK8 A;  3TAN A;  3T1A A;  4FJN A;  4HHT A;  1C1C A;  3SNN A;  1SL2 A;  4WE1 A;  2HVI A;  2HHS A;  5K14 A;  2XRI A;  1Q8I A;  3OYB A;  1NOY A;  2KQ2 A;  4O55 A;  1TKZ A;  4FCY A;  1B9F A;  4E1M A;  3PY8 A;  3DLB A;  4CJU A;  3VQ6 A;  2QKB A;  1JLE A;  5CYM A;  4CF2 A;  3MAQ A;  2DTU A;  3VQC A;  3PX4 A;  1C0U A;  1TAQ A;  4C8M A;  3IAY A;  3AA2 A;  4FJI A;  4FZZ A;  4E7L A;  5HBM A;  3T3F A;  2XY6 A;  1X9W A;  4CCH A;  3KD5 E;  3V9S A;  3M8P A;  1KVB A;  4KKO A;  3OYL A;  1CZ9 A;  3E01 A;  3QEI A;  1SUQ A;  3RR8 A;  4M3Y A;  4CEO A;  3LAK A;  3OS0 A;  4BE2 A;  4DQS A;  1VSH A;  4CJP A;  5J2N A;  5FRO A;  4KPY A;  2G8F A;  4H4M A;  3U6F A;  1KFD A;  4HVJ A;  2OPS A;  1HNI A;  3HPH A;  4Y1C A;  1TVR A;  4CGI A;  5J2M A;  4Z4F A;  2HVH A;  4DLG A;  4ELU A;  3NE6 A;  4PWD A;  3AVL A;  5DMR A;  1KRP A;  2OZM A;  1CLQ A;  2YNF A;  3HP9 A;  4AHR A;  3K59 A;  4KI4 A;  1TL1 A;  3L3U A;  4OPK A;  1RT5 A;  4CEB A;  1WSJ A;  1RTI A;  4CFA A;  4CJE A;  3OJS A;  2HHQ A;  3IG1 A;  3AVH A;  3DI6 A;  4I7F A;  3PV8 A;  4QAG A;  2OA8 A;  4N41 A;  1A5W A;  3EY1 A;  3OYA A;  1BGX T;  4DTP A;  1ASU A;  3CM5 A;  4Z4C A;  3ZSQ A;  4CJ5 A;  2GUI A;  1WSH A;  3V1O A;  3NGI A;  2XY7 A;  4BDZ A;  3QEV A;  1Z26 A;  1VSK A;  3SUQ A;  4CEF A;  4ID5 A;  1X9M A;  1EP4 A;  4OPJ A;  4DSK A;  3AVG A;  1VSF A;  1XWL A;  4LH5 A;  4HUG A;  3ZSW A;  1I3A A;  4JS4 A;  5KTQ A;  4DLE A;  1VSL A;  1YT3 A;  3MEG A;  1VK0 A;  1J5O A;  5FRN A;  1RT1 A;  5FDL A;  1NKB A;  4CGD A;  4CE9 A;  2W42 A;  3G10 A;  4CJR A;  4DU1 A;  1CXU A;  2B5J A;  1T7P A;  4CFD A;  4DF8 A;  4KHW A;  1QS4 A;  1L3V A;  1UWB A;  1B9D A;  1EET A;  1S6P A;  3OVN A;  5HRS A;  3VQB A;  4C8K A;  4NCB A;  1S1V A;  1BCO A;  1G15 A;  4OKK A;  4CK2 A;  4LSL A;  3V1R A;  4DTM A;  4C8O A;  3QNO A;  4DSJ A;  4KHQ A;  2IGI A;  3SQ1 A;  2XHB A;  2A1R A;  5SZT A;  2YNI A;  3IRX A;  1J54 A;  1JXB A;  5DK5 A;  3OYK A;  5C25 A;  4J2E A;  3L2V A;  3JYT A;  1SKS A;  1X9S A;  5KI6 A;  4M45 A;  1WN7 A;  1K6Y A;  4MFB A;  3SQ0 A;  4AH9 A;  1RDB A;  1NK6 A;  4K8Z A;  4QOZ B;  1WLJ A;  4CJW A;  4J2A A;  2ZD1 A;  4CF8 A;  4FM2 A;  1UAX A;  4CIE A;  4DTU A;  4EP5 A;  4PUO A;  1QQC A;  3AVA A;  3KLE A;  1T05 A;  3V6D A;  4DTN A;  1IH7 A;  3CFO A;  1RBV A;  2IS3 A;  4JS5 A;  4F3O A;  3NH0 A;  1J53 A;  3KKS A;  4L8R B;  1LWF A;  4CHZ A;  1JLC A;  4FJ9 A;  1ITG A;  5KGW A;  4FJM A;  1S1T A;  4CHO A;  4E3S A;  3MEC A;  2OZS A;  1JLF A;  4FM0 A;  1BCM A;  4B08 A;  2PY5 A;  1ZYQ A;  4AHS A;  4FJG A;  3K58 A;  2QXF A;  4ELT A;  2KTQ A;  4ZTJ A;  4E7J A;  5EU7 A;  3KLF A;  3QER A;  4DG1 A;  1ASV A;  3NF8 A;  4E19 A;  1J9A A;  4W5R A;  2Z1I A;  4KTZ A;  3I0S A;  3AVM A;  3KK3 A;  4BAC A;  1TV6 A;  3RR7 A;  3BGR A;  1NK9 A;  4LH4 A;  1B92 A;  2G8V A;  4OVL A;  3VQE A;  2XY5 A;  4M3U A;  4Z4E A;  1HYV A;  4C8N A;  4AHU A;  3AVN A;  1HMV A;  3ZT1 A;  3LDS A;  5CY4 A;  1NK5 A;  4KAZ A;  2QK9 A;  2RPI A;  4J2D A;  4B8C A;  1RT4 A;  1C1A A;  4IG0 A;  2D0B A;  1RT2 A;  1BI4 A;  5HP1 A;  3V1Q A;  1HYS A;  2EHG A;  3CM6 A;  5T7B A;  1LW0 A;  4GVM A;  4I9Q A;  2IOC A;  4M3Z A;  3AVJ A;  3ZSZ A;  3S3M A;  3QIP A;  3HK2 A;  2ZE2 A;  4OLB A;  1NJY A;  3HL8 A;  1TK5 A;  1DLO A;  1RNH A;  2VWK A;  3VQ5 A;  1DTT A;  5KRT A;  3ULD A;  3ALY A;  5JS1 A;  4CJL A;  3QES A;  4QCL A;  3ZT0 A;  1RBU A;  2FBT A;  4Q5V A;  4FXD A;  3QET A;  4CJV A;  4Q0B A;  2BE2 A;  1C0M A;  1FKO A;  1YVU A;  1DTQ A;  3P5J A;  4CEZ A;  4M3X A;  1YTU A;  3V9U A;  4KHN A;  1LWE A;  4Z4I A;  1HNV A;  3HYF A;  3NAE A;  1TK0 A;  4F3T A;  3A2F A;  2RKI A;  3LAL A;  4TSX A;  3DLE A;  3WNH A;  3ZSR A;  3ZT4 A;  3OS1 A;  3QEP A;  3F9K A;  1NK0 A;  4DU4 A;  4B9L A;  4F2S A;  3HP6 A;  4B3O A;  4FK4 A;  3M8S A;  1U47 A;  3S3O A;  3LP0 A;  3D0P A;  3U3Y A;  1LV5 A;  3PX0 A;  2ITG A;  5HRP A;  3AVF A;  3KLG A;  2Y1I A;  2OYQ A;  3H08 A;  1FXX A;  3C94 A;  4CJK A;  3SV3 A;  3MXI A;  4B9T A;  2X6N A;  1JLQ A;  3L2R A;  4O5B A;  4J2B A;  1LW2 A;  1WAF A;  1KCF A;  4KV8 A;  3VQA A;  4N76 A;  1TAU A;  3DYA A;  2VG5 A;  5J2Q A;  5I3U A;  4DMN A;  3HVT A;  1U48 A;  3VQ4 A;  4KFB A;  3MXM A;  4H8K A;  2DFH A;  3VQD A;  1EKE A;  4CEA A;  3CYM A;  1VSE A;  4FYD A;  4E0D A;  4DTX A;  3RMB A;  3NDK A;  2QKK A;  3OYD A;  3QO9 A;  3LP1 A;  3AA3 A;  1KTQ A;  4CJ3 A;  3RMA A;  1XC9 A;  1VSM A;  3SI6 A;  3KJV A;  3V9Z A;  1D5A A;  1JLB A;  2OPQ A;  1JXE A;  1RBT A;  4W5O A;  3DOK A;  2P5G A;  2HHX A;  2JLE A;  3HST B;  4LY7 A;  3ZSV A;  1RIL A;  4DTJ A;  1KVC A;  1S6Q A;  3AV9 A;  3P83 D;  4YNQ A;  3DRR A;  4NYF A;  3V9X A;  3AO5 A;  3SUP A;  4LSN A;  3TAP A;  1UOC A;  2FBY A;  4DQR A;  1F21 A;  1CXQ A;  4OKE A;  1XHZ A;  4BWM A;  4FZY A;  4NCA A;  1FKP A;  4EZ9 A;  1FK9 A;  2G8H A;  4B9S A;  3KD1 E;  3SV4 A;  4DFM A;  2Q3S A;  1TKX A;  3HPO A;  3AO3 A;  4HUF A;  1JLG A;  3P1G A;  4IBN A;  2R7Y A;  3V4I A;  1W9H A;  3ISN C;  3CQ8 A;  4KHY A;  1HQE A;  3VA0 A;  4M41 A;  2HHV A;  3F73 A;  1IKX A;  4M3T A;  1KLM A;  3VA3 A;  3VQ8 A;  3PX6 A;  3DMJ A;  4IDK A;  5JS2 A;  4DFP A;  2IAJ A;  3RWU A;  4IKF A;  4JRQ A;  4DSF A;  3K5O A;  3PUF A;  3NBP A;  2O4G A;  3ZT2 A;  1RTH A;  4FJH A;  2JGU A;  3VQP A;  2HHT A;  2Z1G A;  1QHT A;  3QEW A;  3NH2 A;  1A5V A;  1EXQ A;  3DRS A;  4AIL C;  3SQ2 A;  3OYN A;  2PZS A;  1VSD A;  3MEE A;  3WNE A;  4KHS A;  3DM2 A;  1I39 A;  4OGC A;  1NOZ A;  1RDD A;  1S9G A;  1KSP A;  4ELV A;  4FK2 A;  4KRE A;  3NGZ A;  4N47 A;  4CF0 A;  3ITH A;  1S9E A;  1X1P A;  4BDY A;  1SL1 A;  2FBX A;  2KZM A;  4MQ3 A;  3SCX A;  1C6V A;  3D45 A;  1L3T A;  1U04 A;  4DTO A;  1JKH A;  4FJJ A;  5FRM A;  3SUO A;  3I0R A;  1IKY A;  4Z0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...