3ZSWA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zswA00
3LAMA 3ZSYA 3LP1A 4R5PA 1NOZA 4GMJB 4CEOA 3CQ8A 1QS4A 3TABA 1KTQA 4DTOA 2HHQA 3KTQA 2XY8A 4O0JA 4C8KA 3V9UA 4CHZA 1BCOA 4J2EA 3OYKA 3HT3A 1RBRA 3IS9A 2XY5A 3MXMA 4M3TA 3KKSA 1RT2A 4HTUA 1WSIA 3MEGA 3RMAA 2PZSA 2JLEA 5HBMA 1TVRA 4PWDA 3TAMA 4DTPA 3HL8A 4M3WA 4O44A 4DTRA 1J54A 3NF9A 2X6NA 2GV9A 4DG1A 3DRSA 4CJQA 1C1AA 2BE2A 2HHVA 3V1RA 3S3MA 1B9DA 4BDPA 4CJPA 5T7BA 5FRMA 4CF9A 2G8IA 1BIUA 3DYAA 3TI0A 4JLHA 4CEBA 2P5GA 4N47A 2NUBA 3BGRA 1C0UA 1RT4A 1WLJA 4EP5A 4DQQA 1NKBA 3CG7A 4DTUA 2IDOA 3VQ5A 3O3FA 3OYEA 3V9ZA 3KLGA 4N76A 4NCAA 3NH0A 4FK2A 2OZMA 1BL3A 4KTZA 3HYFA 1JXBA 3AVLA 4M42A 2QKBA 3DLHA 2OZSA 1SL0A 2XO7A 4PUOA 1YVUA 1EX4A 2B5JA 3F9KA 4CF0A 3K59A 1XHXA 1TV6A 1C0TA 2EHGA 3K5NA 1IG9A 3OYMA 4K8ZA 3VQPA 3SNNA 3H08A 3T19A 2A1RA 3SUQA 2E6LA 4M3YA 3CM5A 4AILC 1C1BA 1BHLA 4M3RA 4LY7A 3K58A 3F73A 4J2DA 1NK8A 1S9GA 1ZBIA 2ZE2A 1XWLA 3T3FA 4CFCA 1TK5A 3VQEA 4DU1A 3PX0A 4I9LA 1BISA 3LWMA 4OPKA 4F3OA 1J5OA 4DS4A 3SPYA 4CK3A 3AVJA 3QEPA 4E19A 4FK0A 1RDCA 4NYNA 4W5QA 2OPRA 4FZZA 3L3VA 4CGDA 4RW7A 3KK2A 3D0PA 3HPGA 3VQ8A 1HRHA 4Q5VA 4DS5A 2LSNA 4DTNA 4DSFA 1MU2A 1CLQA 4FM2A 4ZTFA 2DY4A 3OS1A 2RKIA 3K5LA 4QOZB 3WNHA 1TAQA 4CERA 5I3UA 4QCLA 2YNIA 3MXJA 3D45A 4CJKA 4DFJA 1W9HA 2FBTA 1WSHA 4CGIA 1I39A 1SL1A 4E3SA 2FBYA 5KI6A 3LP3A 3SI6A 2YNGA 4I9QA 4RW9A 2OPSA 3K5MA 3KJVA 3RMBA 1HNVA 5CYQA 3HM9A 2Z1HA 1DTQA 3SQ0A 4CK1A 4FCYA 1NK5A 4B08A 4AHSA 4DWIA 2X6SA 2ZQBA 1RT1A 1ZBUA 1QTMA 4LSNA 4CJTA 2R7YA 2F96A 3AO1A 4LH4A 4CGGA 4B9NA 1BI4B 1S6PA 1RCHA 4DMNA 3ZSOA 3PV8A 4CEZA 4CGHA 3DLEA 5C42A 3LWLA 4FLTA 3VQAA 4KAZA 4FZYA 3TAFA 4G1QA 4LH5A 2HNDA 3AO3A 3TAQA 4E7HA 4DTJA 3CFRA 2Z1GA 2B4JA 1TKTA 2FC0A 4LSLA 5EU7A 3VQDA 3ZSXA 3ZT4A 4E7IA 4XIUA 3VQCA 2YNFA 4UQGA 4FJHA 5HRPA 2D0AA 1U45A 4B9SA 3MXIA 1NOYA 3HVTA 3O3HA 2QKKA 3C6TA 2HHUA 4HUFA 2IS3A 2F8SA 3HP9A 1WSJA 4KFBA 3AVMA 1R0AA 2A1SA 1J53A 2Y1JA 4FJJA 4M45A 5FROA 3VQ9A 3MECA 3LZIA 3OYHA 4B9VA 3G10A 1HQUA 1GOCA 2IC3A 3A2FA 4FLZA 3VA3A 1JLQA 4ID5A 1XI1A 4OLBA 1WN7A 1X1PA 4B8AB 4M3XA 3SV4A 2HVHA 4IBNA 4CGJA 3WNGA 1RTIA 4KRFA 3ZT1A 1KSPA 4NCBA 2KFNA 4AH9A 4RG8A 1BIZA 1WNSA 3AA5X 1RBVA 2VG7A 1U4BA 2OPPA 1KVAA 4HCBA 3ZT3A 2XY6A 4FZXC 4Z4CA 4RW4A 3ASMA 4MFBA 4KPYA 1FXXA 5I42A 5J1EA 4KTQA 1S1VA 4CHPA 4DF8A 4CJFA 4FK4A 5CYMA 2PY5A 3RR8A 3AO5A 4FJIA 3NGYA 4O4GA 3SUNA 1IKVA 4E1MA 2PYJA 1SV5A 4IDKA 1LV5A 1TKZA 1ZBFA 5C24A 3OY9A 3T1AA 3PX6A 3BDPA 2IAJA 4E1NA 4EZ9A 4J2AA 1L3UA 1LWCA 3MEEA 4Q0BA 5JS1A 3RRGA 1QQCA 2D0CA 4OLAA 3OYGA 3OJSA 3JYTA 4DF4A 1NJYA 1WSFA 2BDPA 4DFKA 3LALA 3VQ4A 2HHTA 4KV8A 1WSEA 1A5VA 4KI4A 1CXQA 3AA4A 1JKHA 1UWBA 4FLYA 4ID1A 2KQ2A 3AA3A 3LZJA 1BGXT 2Q3SA 1JLGA 3VQ6A 1K6YA 3O3GA 4NCGA 3AVBA 4CJSA 3P83D 3G0ZA 2X74A 2YNHA 5HROA 1SKWA 1VRTA 1CZ9A 3AVAA 3IAYA 3QESA 2XY7A 1JLCA 1UOCA 3IRXA 1LWEA 1LW2A 3KK3A 3M8SA 3NE6A 1HYSA 3L2UA 3JSMA 5D3GA 4W5RA 3NDKA 4KTWA 1BCMA 1VSLA 2VG5A 3QNOA 1ASVA 4BDZA 1Q8IA 1DTTA 1U47A 1FK9A 3ZSQA 5C25A 1TL3A 3CM6A 4QAGA 1U48A 3EY1A 1LW0A 3B6PA 3AVCA 4O55A 3AVGA 1RBTA 4CEAA 3NGZA 1NJXA 1X9WA 1XC9A 1TK8A 1YTAA 3K2PA 3SQ2A 1L3TA 3K5OA 2HNYA 1F21A 4CFDA 4MQ3A 1KFDA 3UIQA 4CEDA 1ASWA 3DRPA 4AHCA 1IKYA 3ZSZA 1Q9XA 5HRSA 2DFFA 1RT3A 1O1WA 1ASUA 3VA0A 3HPHA 2GBZA 3OVNA 5J2NA 3QINA 4DQIA 4HCCA 1Z26A 2VWKA 2ZD1A 2HHXA 4CFAA 3L2QA 5HP1A 4FW1A 3MAQA 1SKSA 3RWUA 3OYAA 2VWJA 3QNNA 1BQNA 1QE1A 1S1XA 3AVIA 1T05A 1NK6A 4FJ7A 2HW3A 1TGOA 3LPTA 3HP6A 1D9DA 3O4QA 4CHYA 4CJLA 3CFOA 3OYIA 5CZ2A 3OYCA 1N6QA 2YHBA 4AHVA 4EZ6A 4KI6A 3DLGA 3LP0A 4CEFA 4BE2A 2D5RA 3V4IA 3ZT0A 1VK0A 4F2RA 4WE1A 2DTUA 5JS2A 3SJJA 5K14A 1L5UA 2EX3A 4FM0A 1RBSA 1ZBHA 4KHYA 4OKKA 1JLFA 4B9UA 1X9SA 4CEQA 1RTHA 2Z1JA 3RRHA 4BACA 3NF8A 1D8YA 2G8VA 1VSMA 3QLHA 5HRNA 3FFIA 1KFSA 2PYLA 4E0DA 3U3GA 4B3OA 4FJXA 2O4IA 2WONA 2E4LA 1ZBLA 4AHRA 4CIGA 3TARA 3DRRA 3C95A 1NK0A 1SKRA 4KB1A 4W5NA 2RPIA 3DM2A 1S5JA 4CESA 2DFEA 3M8RA 3SUPA 2E6MA 1CXUA 4DQPA 4IG0A 3OS2A 4FLUA 4Z4IA 4DTSA 1NJZA 1VSJA 2B6AA 4IKFA 2KZZA 1HNIA 3E01A 3KKRA 3ZSRA 4DU4A 3V81A 1FKOA 3M8PA 4Z0UA 4IG3A 4HHTA 3V1OA 1IKWA 3KD1E 1REVA 2HB5A 1J9AA 2WOMA 3DOKA 3ALYA 3KIOA 1RILA 4CIEA 3OJUA 4FJ5A 2BGGA 1KLMA 3AVNA 4C8MA 1WAFA 3AVHA 3LAKA 4CJWA 4E7JA 3PX4A 2X78A 4ICLA 4JRPA 3V6DA 1FKPA 2O4GA 4CJ5A 3OYNA 3NBPA 4OPJA 1TKXA 1ZYQA 1JL2A 4YFUA 4J2BA 3PUFA 4KREA 3VN5A 4AHTA 3OYBA 3U3YA 3QIOA 3NHGA 1NK9A 1KVBA 3NGIA 5E41A 1L3VA 5J2QA 2HHSA 4CJEA 3HPOA 1RDBA 3EZ5A 5KRSA 3EYZA 3RTVA 3QO9A 4CF1A 4H8KA 1QSLA 2I5JA 5KTQA 3SZ2A 4DSLA 2G8UA 1T03A 2FBXA 3KLFA 1JL1A 3ZSWA 3ULDA 3L2RA 1I3AA 4I2QA 2KFZA 2HHWA 1VSHA 2HNZA 1C1CA 3QERA 4I2PA 3DOLA 2KTQA 4OGCA 2OA8A 2OPQA 4E89A 3LP2A 1C0MA 4FJMA 4KHWA 2Y1IA 1VRUA 3QEWA 3VQQA 4ELVA 1KCFA 1RDAA 4LD0A 4FW2A 4FYDA 2F8TA 4YNQA 3QETA 4BWMA 4RW6A 1SL2A 4Z4GA 3THVA 4HUGA 2ITGA 1GOAA 3O4NA 1SUQA 3I0SA 2BANA 4B9TA 3V9WA 4KHQA 3PO4A 1VSEA 1LAVA 4EP4A 3L2WA 1IH7A 3PY8A 1RTDA 5HRRA 3OYDA 4CK2A 1WAJA 3TWHA 5HLFA 4CJRA 4DQSA 4BWJA 3SCXA 3L2VA 4O0IA 1UA0A 1RT6A 3SUOA 1U49A 1B9FA 1NK7A 1YTUA 4B9LA 3CFPA 1A5XA 4IFYA 2P5OA 3LANA 3HJFA 1JLEA 3SV3A 4GW6A 2OYQA 4W5TA 3ZCMA 1B92A 3TAGA 5DK5A 4FJ9A 1HQEA 1KVCA 2Z1IA 3TR8A 4BE0A 4H4OA 1VSIA 2JGUA 3KD5E 1TKDA 4KHNA 4Z4FA 2IOCA 1VSDA 1HJRA 2HMIA 3MEDA 1TAUA 3DLRA 1HYZA 4C8LA 4HUEA 3AO4A 4ZTJA 4CFBA 3NH1A 1Q9YA 3IG1A 4FJLA 3NF7A 4I7FA 4FLWA 4C8OA 1YT3A 1S6QA 1VSKA 3QIPA 2DFHA 4FJGA 1D9FA 2YHAA 4JS4A 3TAPA 4DLEA 2G8WA 1UAXA 3C94A 1JLBA 4CHNA 4JRQA 5SZTA 4CHQA 4DQRA 1IKXA 3NFAA 4Z4HA 2KW4A 4OJRA 4OGEA 3SYZA 4E7LA 3K57A 4H4MA 1L3SA 4CIFA 3M8QA 4O5BA 3V1QA 5SWMA 3LDSA 4W5OA 3ZSVA 2YKNA 4M41A 3AA2A 1CZBA 4TSXA 4CCHA 5CZ1A 5FRNA 1EETA 2IGIA 4DTXA 3VQ7A 4NYFA 4BE1A 1T7PA 1HYVA 1S1UA 3I8DA 3RMCA 3SQ1A 4PQUA 3LPUA 4JS5A 4FM1A 4M3UA 4KKOA 1Y97A 3OS0A 4GVMA 2FBVA 1D5AA 4KHSA 3CYMA 3NCIA 3S9HA 4F8RA 2G8FA 2RN2A 3NF6A 3L8BA 4DSKA 3L3UA 4L8RB 1QSSA 3VQBA 4ZHRA 2XHBA 1RT5A 4CGFA 3HSTB 4DU3A 4HVJA 1XHZA 3AVFA 4F3TA 1A5WA 4N5SA 5CY4A 3P5JA 3KK1A 3HVRA 4OKJA 3AO2A 1NK4A 3QEVA 4FVMA 3QEIA 3TAEA 1N5YA 3QEXA 4ELUA 3WNFA 1ITGA 4DSJA 3PO5A 3OYJA 4DFPA 4CECA 4F2SA 1QSYA 4B9MA 4FJKA 3C6UA 4FXDA 4PA1A 4CF2A 4KHUA 5J2MA 1LAWA 1JXEA 1S1WA 1RDDA 3I0RA 4CJ4A 2QXFA 1S9EA 4C8NA 3NAEA 5KRTA 4K8XA 4FJ8A 1UA1A 4M3ZA 4Z4EA 3HXMA 2YKMA 4FJNA 3DI6A 1RTJA 1BQMA 4N41A 1T8EA 3HO1A 4DFMA 4FLVA 2ETJA 1BI4A 2D0BA 3SQ4A 1TL1A 4KB0A 2RF2A 2XRIA 4Y1DA 4CJ3A 4CHOA 1KRPA 4CF8A 5KGWA 3OYLA 4N56A 1TK0A 4IFVA 3RMDA 2HVIA 2YV0X 3WNEA 1DLOA 1S1TA 1HMVA 4OVLA 3V9XA 3ZT2A 4RW8A 4CE9A 4DSEA 1EKEA 2GUIA 1GOBA 4F4KA 2P1JA 2KZMA 4FLXA 3V9SA 3AV9A 4E7KA 1KLNA 3B6OA 1JLAA 3KLHA 3KLIA 2ATQA 1G15A 5DMRA 4KO0A 1EXQA 1QHTA 1Z25A 4BDYA 2AJQA 1X9MA 1HPZA 1IO2A 4Y1CA 3S3OA 4CEEA 5J2PA 3DLBA 1RNHA 3AVKA 1EP4A 3KLEA 4CJVA 1VSFA 3ISNC 1LWFA 2P51A 3ITHA 3SPZA 3NH2A 1NKEA 3S3NA 4PY5A 1NKCA 1U04A 3DMJA 3TANA 1W0HA 2QK9A 2G8HA 4OKEA 4DSIA 1NJWA 1C6VA 1WSGA 3OYFA 3HK2A 4B8CA 5KGXA 3RR7A 3P1GA 5FDLA 4AHUA 4DTMA 4CJUA 2VG6A 3U6FA 4ELTA 2G8KA 3DLKA 1RT7A 1RBUA 2W42A 4DLGA
chains in the Genus database with same CATH superfamily
2A6AA 3HTVA 5ADXH 4GMJB 4WCEL 4R5PA 3CQ8A 2F4VK 4A57A 4O5FA 4DB3A 5IWAK 1RT2A 3R9PA 3RMAA 2JLEA 1T3VA 3TAMA 3HL8A 4M3WA 2BE2A 2HHVA 1B9DA 4CZHA 1JCGA 4CF9A 4Z94A 3OW2M 4CEBA 3TTCA 4EHUA 5EVZA 5HOOA 3OYEA 1GLLO 4N76A 3PSFA 3VPZA 4BRGA 4HTLA 5AQOA 3QFPA 2QKBA 2OZSA 4PUOA 3GOIA 1EX4A 3F9KA 4CF0A 1XHXA 2NRXA 3Q7BA 1KAZA 3VQPA 3H08A 3FR0A 3H3NO 2UUBK 1X9JA 1C1BA 1BHLA 3T1HK 3F73A 4J2DA 4NLCA 4BRAA 1ZBIA 3T3FA 1QVFM 3RSEB 1BISA 4F3OA 4DS4A 3LDLA 3AVJA 2VQFK 5BN8A 3MDQA 1KXPA 4RW7A 3GL1A 3VOVA 2VQEK 1QQNA 1W2BM 4RTFD 4LC9B 1MU2A 3NVMA 4CERA 1VQON 2FBTA 1WSHA 3PIPL 1I39A 2FBYA 5KI6A 3SI6A 3KJVA 3RMBA 4PKIA 4CK1A 2ZQBA 1ZBUA 1QTMA 4LSNA 2UXBK 3EKSA 3W0LA 3AO1A 4IOCL 1S6PA 1RCHA 3WEEA 2QWPA 1ZC6A 3D6RA 5BRDA 4K41A 4WFAL 4CGHA 5C42A 4FL9A 4FLTA 4JI4K 1T6DA 3VQAA 4KAZA 1VQLN 4E1JA 4FZYA 2ZM6K 3ENHA 4LH5A 3AO3A 4BR4A 4GV6A 1NGIA 4DV5K 2B4JA 1TKTA 2P9SA 4E7IA 4XIUA 3VQCA 2YNFA 4FJHA 4H5TA 4B9SA 3O3HA 2HHUA 5DM6L 4KFBA 1WSJA 3AVMA 4WQ4A 5AJ3K 3LZIA 4ISEA 5LMNK 3A2FA 4EIAA 5KQDA 2ZJRL 4BRMA 4OLBA 2ZGYA 1WN7A 1X1PA 4B8AB 4H03B 4JI5K 4M3XA 3ZT1A 1KSPA 1P90A 2WFBA 4RG8A 4QS8A 5EXWA 1U4BA 3C7NA 4Z4CA 5I42A 1RFQA 4A5BA 1S1VA 4CHPA 4FK4A 3AO5A 3NGYA 4O4GA 4E1MA 4OPHA 4MO4A 4QS9A 3RRGA 1QQCA 2Q2RA 3OYGA 3OJSA 1NJYA 2P9PA 4JYAK 1WSEA 3HM8A 1H1VA 3AA4A 2KQ2A 3AA3A 4FWQA 5AQHA 1BGXT 3LZJA 4DR2K 2Q3SA 4CD3A 4IOAL 4GNIA 3AVBA 4CJSA 3G0ZA 3U4LA 4WF9L 1LWEA 1LW2A 1O13A 4BRLA 3KK3A 4IJNA 3L2UA 1FW6A 4KTWA 5FPNA 2E1YA 5C25A 1OH5A 3LDNA 3R1XA 4O55A 3NGZA 1NJXA 3N4PA 3K2PA 5GAGP 4CFDA 3H46O 3UE5A 1Q7YO 3O08A 3F2KA 3VA0A 2GBZA 5J2NA 5EOYA 3QINA 4B1XB 4JI7K 1S3XA 2ZD1A 2QEXN 4H5RA 4CFAA 1N34K 4ILGB 4MLHA 4CHYA 3CFOA 5CZ2A 1N32K 4AHVA 4EZ6A 4KI6A 4CEFA 4BRDA 5C10A 3SJJA 1L5UA 2EX3A 4KHYA 1JLFA 4FWNA 4H0YB 3NF8A 3MN6A 1D8YA 1VSMA 3TU5A 1VQKN 1KFSA 3U3GA 4B3OA 4BC5A 3C6HA 4CIGA 3LL3A 1NK0A 1V4SA 1S5JA 3SUPA 1J6ZA 4ISGA 3VMFB 4DQPA 4IG0A 3OS2A 4FLUA 4U67L 1VSJA 4ILHA 3QDKA 4DV1K 1Q82O 1K73O 3V1OA 1REVA 2HB5A 1J9AA 3WXMB 1BOTO 3ALYA 4FJ5A 4BGAA 3AVNA 4C8MA 1WAFA 3PX4A 2X78A 1NGJA 1FKPA 1J5EK 5MLCQ 3OYBA 4PL7A 1V4TA 4FWLA 1NK9A 3NGIA 4IFEA 4IZ9A 1XMQK 2IVNA 4CJEA 1NGFA 1QSLA 2I5JA 2G8UA 1T03A 3KLFA 2E2PA 3CJBA 3WUHA 4BQZA 2HNZA 4PL8A 3P38A 4I2PA 2KTQA 3ULEB 3J81O 4FWOA 2Y1IA 4ELVA 1RDAA 5JVGL 4FW2A 4MDBA 4FYDA 1SL2A 5AQWA 2NRWA 4Z4GA 3O4NA 1SUQA 3V9WA 4CZGA 3L2WA 1RTDA 3A5LC 3WXLA 5HLFA 4KHPK 3SCXA 1UA0A 1B9FA 1YTUA 2O8FA 3LANA 1HNXK 3SV3A 1S22A 4GW6A 5TKWA 4W5TA 3ZCMA 3P4IA 4FJ9A 1HQEA 2W41A 3CIPA 3TR8A 5KPRA 4H4OA 5AQGA 1VSIA 2JGUA 3KD5E 4Z4FA 4DUZK 1TAUA 2HMIA 1YF5L 4AQYK 3NH1A 1T44A 4DUYK 3NF7A 4O8KA 1NMNA 2DFHA 5AQRA 1D9FA 3TTDA 4JS4A 3TAPA 4WFNL 5AQYA 4CHQA 3NFAA 5JICA 3ID6A 4E7LA 3SYZA 4B9LA 4A62A 1BA1A 1MA9B 3ZSVA 3LDSA 4X64K 4C23A 2H3GX 2IGIA 3VQ7A 1HKBA 1GLJO 4NYFA 3I8DA 2CGLA 1T6CA 1D5AA 3CYMA 4F8RA 3L3UA 5FPEA 2P9KA 3VF6A 1EWQA 1QSSA 3VQBA 1XNQK 4F3TA 1A5WA 3P5JA 3KK1A 2UYTA 3O4WA 2F8TA 1ITGA 3PO5A 4XH1A 4F2SA 4EHTA 4B9MA 4BRIA 1E3MA 4FXDA 4CF2A 2YX6A 1JXEA 2QXFA 5AZIB 3WXIA 3T69A 2YKMA 4FJNA 3DI6A 1RTJA 1BQMA 4N41A 1ATNA 1T8EA 3AARA 3ATVA 4FLVA 4BR9A 4IFVA 2YV0X 1S1TA 4OVLA 4PHTX 4X66K 4RW8A 4DSEA 1GOBA 3ZEUB 3V9SA 2F9TA 1KLNA 3KLHA 5LMUK 1G15A 1EXQA 2AJQA 1DT9A 4Y1CA 1OH6A 3S3OA 3FZLA 1GLAG 2QWOA 3AVKA 1SZ2A 3KLEA 2QWMA 3DAWA 4CJVA 3ISNC 4FVUA 3NH2A 1NKEA 4X65K 1ZXOA 5AR0A 1D4XA 2QK9A 2E8AA 1WSGA 3HK2A 1QQMA 4BRHA 3CJ7A 5FDLA 4AHUA 4DTMA 5BPNA 2G8KA 1M1KO 3VGKA 4JKHA 2W42A 1HNZK 3ZSYA 3LP1A 1DGKN 1QS4A 3KTQA 4O0JA 1JJ2M 3V9UA 1RBRA 2ZGZA 2ASOA 3KKSA 1HUXA 3RVCA 3MEGA 2PZSA 3M3ZA 1Z6RA 1K8AO 4DTPA 3NMUA 1NNEA 2X6NA 1ATRA 2RE2A 3IDHA 3D2FB 3VEYA 4BDPA 2WC9A 3HI0A 3L6QA 4CBUA 1RT4A 4EP5A 1NKBA 2GWKA 3CG7A 4NCAA 3NH0A 3FZFA 4IWVA 4FOIA 2P9LA 3OHRA 1YVUA 2P9PB 2B5JA 1IG9A 1TUYA 1C0TA 1TV6A 1Q81O 3OYMA 1YITN 3T19A 3VEZA 1VQ6N 4XEIA 4M3YA 3ULEA 3CM5A 1NLVA 1NGAA 4M3RA 3K58A 1NGEA 3KHYA 2QM1A 2ZE2A 5LJWA 4CFCA 1TK5A 4DU1A 3PX0A 4B9QA 3LWMA 4MO5A 3SPYA 2D0OA 4X62K 4E19A 1RDCA 4H5VA 2OPRA 4JI2K 4FZZA 3L3VA 3KK2A 3HPGA 3C7NB 3VQ8A 3CXCM 4DTNA 3ZX2A 4DSFA 4IO8A 1CLQA 4LF8K 2KLAA 4QOZB 3VERA 3WNHA 2Q1NA 4RW9A 3K5MA 1HNVA 3ENBA 3HM9A 3NVKA 1DTQA 1XNRK 3SQ0A 4YHHK 4DWIA 3H3OB 4CJTA 4CD1A 2F96A 4B9NA 1BI4B 1SS6A 5M1FA 4B3SK 3DLEA 3F5TA 3VESA 1QZ5A 4DCHA 3K0SA 2HNDA 3TAQA 4LSLA 3VEXA 3ZSXA 2FC0A 1NBWA 3CCEN 4UQGA 2D0AA 1U45A 1NOYA 2QKKA 4OX9K 3C6TA 3EN9A 3D7EO 4BR0A 1R0AA 4EAHD 4FJJA 5FROA 1YJWN 3GDQA 4JI1K 3MECA 2HBLA 2IC3A 1GOCA 3I56N 2GELA 1BO5O 5IT9O 4ID5A 1G99A 3ZETA 3SV4A 4IBNA 4CGJA 1Q86O 3CJ9A 3VGLA 4BY9C 2YHWA 1WNSA 3AA5X 3S41A 1K8KB 3I55N 1KVAA 2XY6A 4BRNA 3VEWA 2CGKA 4DF8A 4CJFA 2PY5A 3M6GA 5JLHA 3O5BA 1N33K 4KH5A 2P9SB 2VYPA 3BDPA 4E1NA 4OLAA 3JYTA 3CCRN 3LALA 4DV2K 4KV8A 4KI4A 3LDOA 1CXQA 4FLYA 4JI6K 4CJ7A 2O8EB 3BP8A 1VHXA 4GVEA 3L4QA 3I8BA 3P83D 3ZLJA 2X74A 1CZ9A 3AVAA 3CETA 2XY7A 1HYSA 1UOCA 3IRXA 3M8SA 4H0XB 3JSMA 4W5RA 1LOTB 3CCSN 1Q8IA 1U47A 4Y0WA 4WQ4C 3B6PA 5JS1A 4CEAA 1X9WA 1YTAA 3SQ2A 4LF5K 3K5OA 1F21A 1KFDA 4CEDA 1OH7A 3CMEN 1Q9XA 3MMVA 3DJCA 1ASUA 2F9WA 3A5NC 5BRHA 4DQIA 2VWKA 2EWSA 4YOTA 3IMXA 3OYAA 3MX2A 3MN5A 2JWKA 3J8AA 3QNNA 1BQNA 1QE1A 1T05A 4QS7A 3LPTA 3HP6A 1OVYA 1NMDA 3LP0A 4BE2A 3V4IA 2UXDK 5JS2A 5K14A 3MCPA 1ZBHA 2E88A 4B9UA 4HWIA 3CCMN 3QLHA 1S72N 2PYLA 1XC3A 5KQ8A 2WONA 4JHDA 1RDWX 1Z05A 3DRRA 3VETA 3TARA 4KB1A 4K42A 4LF6K 4FWMA 5A2QO 4MDAA 4CESA 3M8RA 2E6MA 1CXUA 3EKUA 4DTSA 5FLXO 3CPWM 1N36K 2KZZA 2QWLA 3KKRA 2HSTA 3GG4A 4IG3A 1IKWA 3KD1E 4DV0K 2WOMA 3KIOA 3HRGA 3OJUA 1KLMA 1E4FT 4I6MB 3ENOA 3V6DA 2O8CA 5AZIA 4WQ5A 4OPJA 5AQQA 4IO9L 4WQ5C 4J2BA 3PUFA 3Q7CA 4C1NI 5GINA 4H0TB 4IEIA 3NHGA 4YDUC 4JKDA 3QO9A 3OBYA 3I33A 4H8KA 5LJVA 4DSLA 2FBXA 3ULDA 4ISFA 2HHWA 1C1CA 2UUCK 4IOXA 3LP2A 3H1VX 4FWRA 4FJMA 1VRUA 3VQQA 3AY9A 4LD0A 2FLOA 2GUPA 4YNQA 4BWMA 3E9PA 5AQNA 4RW6A 2NRTA 3G6EN 3THVA 4HUGA 2GWJA 3FFKB 4KHQA 1R59O 3PY8A 3OYDA 4CJRA 1BUPA 5BR9A 4O0IA 3O9SA 1GLCG 3SUOA 1NK7A 3CCUN 4CZJA 1K8KA 3HJFA 1U2VA 1JLEA 3PLAA 3TAGA 5DK5A 1X3NA 1WBBA 5BN9A 4CZMA 2P9UB 4CBWA 4KHNA 2HMPA 1VQPN 3VEVA 4HUEA 4FJLA 1YT3A 1VSKA 4CZIA 3CJ1A 1M90O 2G8WA 1JLBA 5SZTA 2O8EA 4OGEA 3W3DA 3C0BA 2YKNA 4A2BA 3BZKA 4M41A 4RWTA 1U6ZA 3AA2A 1CZBA 3MWPA 4CCHA 4B3TK 1HYVA 3VGMA 3RMCA 3QMLA 2AA4A 2OANA 4FM1A 4M3UA 4KKOA 1Y97A 3OS0A 4GVMA 5H1SQ 3E9LA 3SLCA 2G8FA 4DSKA 1IV0A 5BRFA 2A3ZA 2XHBA 4CGFA 3VF4A 2QI2A 4HVJA 3AVFA 3E66A 3CF5L 5CY4A 3SK3A 3HVRA 3QBWA 3AO2A 4FVMA 3QEIA 3DXKA 4K43A 3OYJA 4CECA 2D1KA 3ID8A 3THXA 5J2MA 4DR7K 4CJ4A 1RDDA 4FJ8A 4H0VB 4YOWA 1W7AA 5AQPA 4FWKA 3VENA 3THYA 1GLEG 4FWPA 3TSUA 1XQSC 2O8DB 4DR6K 2F7TA 3SQ4A 2D0BA 1TL1A 1QVGM 4CF8A 4N56A 4WFBL 3RMDA 2HVIA 3WNEA 2KKZA 1NWKA 4GY2B 2HF4A 2PAVA 3TTFA 4CE9A 3O1BA 1EKEA 2GUIA 4DR5K 4FLXA 4JAXA 3AV9A 3FZMA 3G4SN 1N8RO 2P9KB 2VGMA 4JKGA 5DMRA 1QHTA 4NLBA 4BC3A 5AQKA 1IO2A 3K9JA 4CEEA 3O6WA 1EP4A 2P51A 3SPZA 4A2AA 3WQUA 4KH4A 1U04A 5C2DA 2G8HA 4BR7A 3RR7A 3P1GA 2YI1A 2D4WA 2VG6A 3O8MA 4QCLA 2FF6A 3LAMA 4BREA 3U8XA 4O8UA 4YDUA 4CEOA 4DTOA 2XY8A 4CHZA 3OYKA 3LDQA 3EO3A 1W97L 3R6MA 4NB4A 3NF9A 2GV9A 4DG1A 3DRSA 4CJQA 1C1AA 3V1RA 4IJAA 3S3MA 4B1YB 4CJPA 5T7BA 5FRMA 5AQXA 2G8IA 1BIUA 3DYAA 4JLHA 2O8BA 3BGRA 4DTUA 1SAZA 3VQ5A 3VTHA 3O3FA 3V9ZA 3KLGA 4FK2A 2D0PA 1BU6O 4CVNE 1BL3A 1ESVA 4KTZA 3HYFA 4M42A 2FXUA 3DLHA 2BUPA 3K59A 2EHGA 3SNNA 2A1RA 3SUQA 3SAGA 4AILC 1NK8A 4LF4K 3R3LA 4I9LA 3SJHA 4OPKA 4V19S 1YIJN 3O9TA 4FK0A 2HBMA 1EWRA 2P9UA 4IXCA 4CGDA 3D0PA 2FSJA 4BG8A 3CJAA 3CCQN 2NZTA 3UKRB 4FM2A 3PIOL 4ZTFA 2DY4A 3OTOK 3K5LA 1ZBSA 1TAQA 1C0FA 3D45A 4CGIA 3LP3A 4I9QA 5TKYA 2I7NA 5M1OA 2P9IA 2Z1HA 4FCYA 1RT1A 2R7YA 5CHIA 4LH4A 3QB0A 3ZSOA 3LWLA 2V51B 4CW7B 4NXNK 1P8ZA 3WQTA 2UUAK 3TAFA 3PSIA 4E7HA 4DTJA 4CZLA 5GADP 3CFRA 2Z1GA 3ZT4A 3CERA 1HKCA 3J80O 3THWA 4FOEA 3MXIA 4U7BA 2QA4N 4HUFA 3GBTA 5KPZA 2F8SA 3HP9A 3T1YK 2A1SA 2Y1JA 2E5LK 3L0QA 1HQUA 4YOUA 3UB5A 5LY3A 1JLQA 3KZBA 2HVHA 4JI8K 1HLUA 3WNGA 1RTIA 3O80A 3DXKB 4B1ZA 4KRFA 3DWLA 2UU9K 2KFNA 3J7AP 1BIZA 4A5AA 2E2OA 5GIPA 1RBVA 4JHDB 4HCBA 3ZT3A 4GKKK 5AFUA 2DPNA 3ASMA 4DR3K 4LFCK 4KPYA 5AZJA 3THYB 5CR4A 5F1XA 3F9MA 3RR8A 4FJIA 3SUNA 1IKVA 1SV5A 3UKUB 1TKZA 2ITMA 1ZBFA 5C24A 3OY9A 2IAJA 3A5OC 1L3UA 1LWCA 2D0CA 3MN9A 1WSFA 2BDPA 4DFKA 3VQ4A 2PBDA 1A5VA 2QXLA 2O8CB 4DV4K 1KD1O 4JKGB 1K6YA 2QW9A 3M5RA 1YAGA 5HROA 1SKWA 2A42A 3IAYA 3QESA 3EEQA 4B1WB 1TUUA 3SMSA 5D3GA 2YHXA 1BCMA 1VSLA 2VG5A 3M1FA 3QNOA 1NM1A 3ZSQA 1TL3A 1BA0A 4QAGA 1U48A 3EY1A 1HX1A 1LW0A 3AVCA 2WBNA 3AVGA 1TK8A 1L3TA 2W40A 2HNYA 4MQ3A 1ASWA 3MX5A 3G71N 4AHCA 2A5XA 1WOQA 1RT3A 2DFFA 5EX5A 3KWGA 2ZJQL 1O1WA 1VQ5N 2QTDA 3AGRA 3HPHA 4JEPA 3OVNA 2NRZA 1SKSA 3L2QA 4FW1A 5KPTA 3MAQA 3O9RA 2VWJA 1NK6A 3AVIA 4FJ7A 2HW3A 1D9DA 3OYCA 1U2VB 1N6QA 2YHBA 1VK0A 4WE1A 1YXQA 2V7YA 4FM0A 1X9SA 1RTHA 1OVQA 4B1UB 4BACA 3WXKA 3U9DA 5HRNA 4C1NK 4E0DA 1RGIA 4FJXA 2O4IA 4B3RK 1SKRA 3C95A 2OCEA 2RPIA 2OTLN 2CGJA 5AQFA 1NGCA 4EFHA 4Z4IA 3L4IA 4IEEA 3H1QA 3MCAB 1HNIA 3E01A 3ZSRA 4DU4A 2YJEA 1FKOA 3M8PA 2ZF5O 3OA9A 4Z0UA 4HHTA 3DOKA 1RILA 3HBTA 4CJWA 2HOEA 2CH6A 1MDUB 4ICLA 2O4GA 2YJFA 3MWTA 3NBPA 4CJ5A 1TKXA 1ZYQA 4YFUA 4KREA 3UKRA 3VN5A 4AHTA 2IVOA 1IBLK 1KVBA 3C65A 5J2QA 2HHSA 3EZ5A 4GV3A 3EYZA 4CF1A 5KTQA 5JLFA 3ZSWA 3L2RA 1I3AA 4I2QA 3THXB 2KFZA 3CCVN 3FE1A 2OPQA 3THWB 1C0MA 4KHWA 3QEWA 1KCFA 3HOSA 3LDPA 4FPBA 3QETA 1LCUA 4CZFA 2ITGA 3FLCO 4H0OA 4I6MA 4PKHA 2NNWA 1VSEA 1LAVA 4EP4A 4K25A 5M1PA 1WAJA 3TWHA 1C0GA 4DQSA 2QWRA 4BWJA 3L2VA 1RT6A 1U49A 3CFPA 1A5XA 4IFYA 2P5OA 4DQ8A 1YI2N 3D2EB 4BE0A 2Z1IA 2V52B 4M63C 1VSDA 1HJRA 4RCHA 3MEDA 4JKFA 3CPEA 3AO4A 3JS6A 4CFBA 3O9QA 1Q9YA 4C8OA 2IVPA 1S6QA 3QIPA 3TPQA 2YHAA 4DLEA 3CQXA 3H45C 4CHNA 1VQ4N 3OBWA 5GAHP 1IKXA 1QQOA 4OJRA 4KB0A 3K57A 4H4MA 4O5BA 3V1QA 5SWMA 4JK9A 4TSXA 5CZ1A 4JV5K 1EETA 1T7PA 4DTXA 4BE1A 1S1UA 3HZ6A 3LM2A 3SQ1A 4JS5A 1OKJA 4KHSA 3NCIA 3S9HA 3NF6A 1SQKA 2VWBA 4L8RB 3CD6N 4AM7A 4BRKA 3HSTB 1YJ9N 1HPMA 4PKGA 1XHZA 3SBGA 1VQ7N 5ELZA 4BRPA 3TAEA 3QEXA 4ELUA 3WNFA 4DSJA 1E4GT 4BROA 1QSYA 1HR0K 3C6UA 4PA1A 1LAWA 3FGUA 1EQYA 5KRTA 1UA1A 4Z4EA 3HXMA 1IJJA 1GLFO 4DFMA 2ETJA 1BI4A 4GKJK 2XRIA 4Y1DA 4CJ3A 5LL6Z 4FWSA 5KGWA 1TK0A 1DLOA 3ZT2A 2P9IB 2KZMA 2Q31A 4IDHA 3B6OA 1JLAA 3KLIA 4GV9A 2ATQA 2Q97A 5AQSA 1HPZA 3DLBA 3CC7N 5AQVA 2CH5A 4CZEA 1RDUA 4JD2B 1W0HA 4DSIA 2A41A 1C6VA 1NJWA 5KGXA 2QWNA 4WYBA 2ASPA 3E1YA 4CJUA 2O8DA 3D2FA 1YVNA 1BDGA 3IKMA 1NOZA 3TABA 5CE3A 4JK7A 2HF3A 1KTQA 2HHQA 4C8KA 4J2EA 4BR2A 1BCOA 3MXMA 3HT3A 3IS9A 2XY5A 1NGGA 4M3TA 4HTUA 1WSIA 1TYQA 5HBMA 1MWKA 1TVRA 4PWDA 3ZX0A 4O44A 4DTRA 1J54A 1VQ8N 1YJNN 2GEMA 4BG9A 4LFAK 1WUAA 2E2NA 3TI0A 2P5GA 4N47A 2NUBA 1C0UA 1WLJA 3KVGA 4DQQA 4F4KA 2IDOA 3UKUA 2OZMA 1JXBA 3AVLA 5AQZA 1SL0A 4LF9K 2XO7A 4A61A 4AF1A 3K5NA 4K8ZA 3SAHA 2OTJN 3SBTA 2E6LA 2BTFA 3EZWA 4LY7A 2Q0UA 2VGNA 4CI6A 1S9GA 1XWLA 3VQEA 1BG3A 3N4QA 1NG9A 1J5OA 5E26A 1YUWA 4CK3A 3QEPA 4NYNA 4W5QA 4NXMK 1OH8A 1HRHA 4Q5VA 4DS5A 2LSNA 2O8BB 5GAEP 1NGHA 4BRFA 3OS1A 2RKIA 2BH1A 4JKBA 2W6KA 5I3UA 2AP1A 2Q0RA 2YNIA 3MXJA 3A5MC 4CJKA 4DFJA 1W9HA 1SL1A 4E3SA 2YNGA 1BWFO 2OPSA 4OPAA 1EO1A 5CYQA 4H5WA 4FO0A 2HHHK 2KHOA 1NK5A 4B08A 4AHSA 4LFBK 2X6SA 1DKGD 4CGGA 3B8AX 2A40A 3K9KA 4DMNA 3PV8A 4NO7A 4CEZA 3CCLN 3HOTA 3ATUA 3P39A 4G1QA 3ZEUA 3ZETB 5EU7A 3VQDA 1IBKK 2I7PA 5HRPA 3BZCA 3HVTA 4XH5A 3HSCA 2IS3A 3MN7A 1J53A 3CI5A 4M45A 3VQ9A 1JCEA 3GE1A 3OYHA 3G10A 4B9VA 2P9NB 3CHWA 4FLZA 2QWQA 3VA3A 1XI1A 4NCBA 4AH9A 3BF1A 2VG7A 1VAZA 2OPPA 4FZXC 3U9ZA 4RW4A 3EL2A 4MFBA 3AAQA 1FXXA 2GX9A 5J1EA 4KTQA 2UXCK 2E2QA 2FF3B 5CYMA 4BVOA 4JKEA 5AQJA 5HL7L 2PYJA 4JI0K 3RSEA 3CC4N 1ILYA 4H5NA 4IDKA 5F0XA 5GIOA 1LV5A 3PX6A 3T1AA 4MLEA 4J2AA 4DV7K 4EZ9A 4KHUA 4YOXA 3MEEA 4Q0BA 4YY3K 5C15A 4DV3K 4DF4A 1IBMK 2HHTA 1JKHA 1UWBA 3O9UA 4ID1A 1JLGA 5AQMA 3CQYA 1DEJA 3VQ6A 3O3GA 4NCGA 2ZJPL 3J7ZO 4DR1K 2YNHA 1VRTA 1HJOA 1JLCA 4ILJA 4BC4A 2W6LA 3NE6A 2P9LB 2WUSA 4DV6K 4JD2A 4CZKA 4DR4K 1MWMA 3NDKA 4XH4A 1YHQN 1ASVA 4BR5A 5I9EB 1DTTA 3DXMB 4BDZA 5AZJB 1FK9A 3O1WA 3CM6A 5C12A 1RBTA 3MK6A 1XC9A 2HBKA 3WEEB 3UIQA 5AQIA 3DRPA 1IKYA 3ZSZA 4DHYA 5HRSA 3E9OA 3BEXA 4JKAA 4M7YA 4BRCA 4HCCA 1Z26A 1KQSM 2HHXA 3IUCA 5HP1A 1WB9A 3RWUA 1S1XA 1TGOA 1KAXA 3O4QA 4CJLA 3OYIA 1JCFA 1GLDG 4UY8O 1XUPO 3DLGA 2D5RA 3ZT0A 4F2RA 2DTUA 2FSNA 3KWIA 3ZX3A 1RBSA 4OKKA 4K0KK 4CEQA 2Z1JA 3RRHA 2G8VA 1QZ6A 3FFIA 3ZYYX 4H0PA 5JMVA 2E4LA 1ZBLA 4AHRA 5EY4A 4W5NA 3DM2A 2GTDA 4JNEA 2DFEA 1WBDA 5AQUA 1NJZA 2B6AA 4IKFA 3V81A 3FZKA 3P31A 4CIEA 2Q36A 2BGGA 4L3QA 3AVHA 3LAKA 4J8FA 3H6EA 4E7JA 4JRPA 3OYNA 1JL2A 2J4RA 4B1VA 4AM6A 3U3YA 3QIOA 1VQNN 5E41A 3BF3A 1L3VA 4JKCA 4KBOA 3TSPA 5F2RA 4BRQA 2FSKA 1RDBA 3HPOA 5KRSA 3RTVA 1NJIO 1Q18A 3SZ2A 1JL1A 1NGDA 5AQLA 3A8YA 1VSHA 4LF7K 3QERA 3KK7A 3DOLA 4M7XA 4OGCA 2OA8A 4E89A 3AAPA 2JWLA 2NRVA 5BPMA 3EE9A 1KC8O 3JXUA 5DM7L 5M1KA 1Y64A 3FZHA 4BGBA 4YOYA 3JAMO 3J7YP 2WTUA 5BREA 2YHYA 1IG8A 3TSQA 1GOAA 4BQLA 3I0SA 2BANA 4B9TA 2PFUA 3PO4A 1XMOK 1IH7A 1FJGK 5HRRA 4CK2A 2IIRA 2V7ZA 2HBJA 1KAYA 1ATSA 2ASMA 2E20A 5M1NA 4FPAA 2OYQA 1B92A 2P9NA 1KVCA 2NRHA 4B3MK 1TKDA 2IOCA 1HYZA 3DLRA 3DLLL 4C8LA 1VQMN 4ZTJA 3WT0A 3QBXA 3AGKA 3IG1A 4I7FA 4FLWA 3IFRA 5C0YA 3G25A 4FJGA 3R8EA 3CMAN 2E1ZA 4YOVA 1UAXA 3C94A 4BC2A 1GLBG 4JRQA 3A0IX 3VTIA 4DQRA 5BPLA 4CBXA 4Z4HA 4OO1J 2KW4A 1L3SA 4CIFA 3M8QA 1NU0A 4W5OA 4KH6A 3QFUA 4BVPA 5FRNA 5B8HA 5C2FA 1CZAN 4PQUA 3QICA 3LPUA 2FBVA 3D2EA 3SMPA 2RN2A 2NLXA 3L8BA 5BR8K 5FPDA 3SAFA 4ZHRA 3BY5A 1RT5A 4JN4A 4DU3A 2RHKA 4N5SA 1X3MA 3EE8A 1TYQB 4OKJA 4F9OA 1NK4A 3QEVA 1N5YA 3VEOA 4R79A 4YORA 1I94K 4DFPA 1NGBA 1QHAA 4FJKA 1S1WA 3I0RA 5E84A 4C8NA 1S9EA 3DXMA 3NAEA 4K8XA 4M3ZA 1K9MO 4JI3K 2O8FB 3HO1A 1HNWK 2RF2A 4CHOA 3CC2N 5AQTA 1HKGA 2NRRA 1KRPA 3CCJN 4DKWA 3OYLA 1VQ9N 2YCHA 5AFUH 5FPMA 5JVHL 1HMVA 3V9XA 3C6AA 2P1JA 2VCPA 5ADXA 4E7KA 4KO0A 3WXJA 1Z25A 4BDYA 1X9MA 2ZWHA 3VF2A 3BUZB 5J2PA 1RNHA 4JK8A 3LM9A 1VSFA 1LWFA 3ITHA 3S3NA 4PY5A 1NKCA 3DMJA 3TANA 4A59A 4G9ZA 4OKEA 3OYFA 4FSVA 3T7ZA 4B8CA 3CJCA 3U6FA 4ELTA 3DLKA 1RT7A 1RBUA 5M1QA 4DLGA
chains in the Genus database with same CATH topology
3LAMA 3ZSYA 3LP1A 4R5PA 1NOZA 4GMJB 4CEOA 3CQ8A 1QS4A 3TABA 1KTQA 4DTOA 2HHQA 3KTQA 2XY8A 4O0JA 4C8KA 3V9UA 4CHZA 1BCOA 4J2EA 3OYKA 3HT3A 1RBRA 3IS9A 2XY5A 3MXMA 4M3TA 3KKSA 1RT2A 4HTUA 1WSIA 3MEGA 3RMAA 2PZSA 2JLEA 5HBMA 1TVRA 4PWDA 3TAMA 4DTPA 3HL8A 4M3WA 4O44A 4DTRA 1J54A 3NF9A 2X6NA 2GV9A 4DG1A 3DRSA 4CJQA 1C1AA 2BE2A 2HHVA 3V1RA 3S3MA 1B9DA 4BDPA 4CJPA 5T7BA 5FRMA 4CF9A 2G8IA 1BIUA 3DYAA 3TI0A 4JLHA 4CEBA 2P5GA 4N47A 2NUBA 3BGRA 1C0UA 1RT4A 1WLJA 4EP5A 4DQQA 1NKBA 3CG7A 4DTUA 2IDOA 3VQ5A 3O3FA 3OYEA 3V9ZA 3KLGA 4N76A 4NCAA 3NH0A 4FK2A 2OZMA 1BL3A 4KTZA 3HYFA 1JXBA 3AVLA 4M42A 2QKBA 3DLHA 2OZSA 1SL0A 2XO7A 4PUOA 1YVUA 1EX4A 2B5JA 3F9KA 4CF0A 3K59A 1XHXA 1TV6A 1C0TA 2EHGA 3K5NA 1IG9A 3OYMA 4K8ZA 3VQPA 3SNNA 3H08A 3T19A 2A1RA 3SUQA 2E6LA 4M3YA 3CM5A 4AILC 1C1BA 1BHLA 4M3RA 4LY7A 3K58A 3F73A 4J2DA 1NK8A 1S9GA 1ZBIA 2ZE2A 1XWLA 3T3FA 4CFCA 1TK5A 3VQEA 4DU1A 3PX0A 4I9LA 1BISA 3LWMA 4OPKA 4F3OA 1J5OA 4DS4A 3SPYA 4CK3A 3AVJA 3QEPA 4E19A 4FK0A 1RDCA 4NYNA 4W5QA 2OPRA 4FZZA 3L3VA 4CGDA 4RW7A 3KK2A 3D0PA 3HPGA 3VQ8A 1HRHA 4Q5VA 4DS5A 2LSNA 4DTNA 4DSFA 1MU2A 1CLQA 4FM2A 4ZTFA 2DY4A 3OS1A 2RKIA 3K5LA 4QOZB 3WNHA 1TAQA 4CERA 5I3UA 4QCLA 2YNIA 3MXJA 3D45A 4CJKA 4DFJA 1W9HA 2FBTA 1WSHA 4CGIA 1I39A 1SL1A 4E3SA 2FBYA 5KI6A 3LP3A 3SI6A 2YNGA 4I9QA 4RW9A 2OPSA 3K5MA 3KJVA 3RMBA 1HNVA 5CYQA 3HM9A 2Z1HA 1DTQA 3SQ0A 4CK1A 4FCYA 1NK5A 4B08A 4AHSA 4DWIA 2X6SA 2ZQBA 1RT1A 1ZBUA 1QTMA 4LSNA 4CJTA 2R7YA 2F96A 3AO1A 4LH4A 4CGGA 4B9NA 1BI4B 1S6PA 1RCHA 4DMNA 3ZSOA 3PV8A 4CEZA 4CGHA 3DLEA 5C42A 3LWLA 4FLTA 3VQAA 4KAZA 4FZYA 3TAFA 4G1QA 4LH5A 2HNDA 3AO3A 3TAQA 4E7HA 4DTJA 3CFRA 2Z1GA 2B4JA 1TKTA 2FC0A 4LSLA 5EU7A 3VQDA 3ZSXA 3ZT4A 4E7IA 4XIUA 3VQCA 2YNFA 4UQGA 4FJHA 5HRPA 2D0AA 1U45A 4B9SA 3MXIA 1NOYA 3HVTA 3O3HA 2QKKA 3C6TA 2HHUA 4HUFA 2IS3A 2F8SA 3HP9A 1WSJA 4KFBA 3AVMA 1R0AA 2A1SA 1J53A 2Y1JA 4FJJA 4M45A 5FROA 3VQ9A 3MECA 3LZIA 3OYHA 4B9VA 3G10A 1HQUA 1GOCA 2IC3A 3A2FA 4FLZA 3VA3A 1JLQA 4ID5A 1XI1A 4OLBA 1WN7A 1X1PA 4B8AB 4M3XA 3SV4A 2HVHA 4IBNA 4CGJA 3WNGA 1RTIA 4KRFA 3ZT1A 1KSPA 4NCBA 2KFNA 4AH9A 4RG8A 1BIZA 1WNSA 3AA5X 1RBVA 2VG7A 1U4BA 2OPPA 1KVAA 4HCBA 3ZT3A 2XY6A 4FZXC 4Z4CA 4RW4A 3ASMA 4MFBA 4KPYA 1FXXA 5I42A 5J1EA 4KTQA 1S1VA 4CHPA 4DF8A 4CJFA 4FK4A 5CYMA 2PY5A 3RR8A 3AO5A 4FJIA 3NGYA 4O4GA 3SUNA 1IKVA 4E1MA 2PYJA 1SV5A 4IDKA 1LV5A 1TKZA 1ZBFA 5C24A 3OY9A 3T1AA 3PX6A 3BDPA 2IAJA 4E1NA 4EZ9A 4J2AA 1L3UA 1LWCA 3MEEA 4Q0BA 5JS1A 3RRGA 1QQCA 2D0CA 4OLAA 3OYGA 3OJSA 3JYTA 4DF4A 1NJYA 1WSFA 2BDPA 4DFKA 3LALA 3VQ4A 2HHTA 4KV8A 1WSEA 1A5VA 4KI4A 1CXQA 3AA4A 1JKHA 1UWBA 4FLYA 4ID1A 2KQ2A 3AA3A 3LZJA 1BGXT 2Q3SA 1JLGA 3VQ6A 1K6YA 3O3GA 4NCGA 3AVBA 4CJSA 3P83D 3G0ZA 2X74A 2YNHA 5HROA 1SKWA 1VRTA 1CZ9A 3AVAA 3IAYA 3QESA 2XY7A 1JLCA 1UOCA 3IRXA 1LWEA 1LW2A 3KK3A 3M8SA 3NE6A 1HYSA 3L2UA 3JSMA 5D3GA 4W5RA 3NDKA 4KTWA 1BCMA 1VSLA 2VG5A 3QNOA 1ASVA 4BDZA 1Q8IA 1DTTA 1U47A 1FK9A 3ZSQA 5C25A 1TL3A 3CM6A 4QAGA 1U48A 3EY1A 1LW0A 3B6PA 3AVCA 4O55A 3AVGA 1RBTA 4CEAA 3NGZA 1NJXA 1X9WA 1XC9A 1TK8A 1YTAA 3K2PA 3SQ2A 1L3TA 3K5OA 2HNYA 1F21A 4CFDA 4MQ3A 1KFDA 3UIQA 4CEDA 1ASWA 3DRPA 4AHCA 1IKYA 3ZSZA 1Q9XA 5HRSA 2DFFA 1RT3A 1O1WA 1ASUA 3VA0A 3HPHA 2GBZA 3OVNA 5J2NA 3QINA 4DQIA 4HCCA 1Z26A 2VWKA 2ZD1A 2HHXA 4CFAA 3L2QA 5HP1A 4FW1A 3MAQA 1SKSA 3RWUA 3OYAA 2VWJA 3QNNA 1BQNA 1QE1A 1S1XA 3AVIA 1T05A 1NK6A 4FJ7A 2HW3A 1TGOA 3LPTA 3HP6A 1D9DA 3O4QA 4CHYA 4CJLA 3CFOA 3OYIA 5CZ2A 3OYCA 1N6QA 2YHBA 4AHVA 4EZ6A 4KI6A 3DLGA 3LP0A 4CEFA 4BE2A 2D5RA 3V4IA 3ZT0A 1VK0A 4F2RA 4WE1A 2DTUA 5JS2A 3SJJA 5K14A 1L5UA 2EX3A 4FM0A 1RBSA 1ZBHA 4KHYA 4OKKA 1JLFA 4B9UA 1X9SA 4CEQA 1RTHA 2Z1JA 3RRHA 4BACA 3NF8A 1D8YA 2G8VA 1VSMA 3QLHA 5HRNA 3FFIA 1KFSA 2PYLA 4E0DA 3U3GA 4B3OA 4FJXA 2O4IA 2WONA 2E4LA 1ZBLA 4AHRA 4CIGA 3TARA 3DRRA 3C95A 1NK0A 1SKRA 4KB1A 4W5NA 2RPIA 3DM2A 1S5JA 4CESA 2DFEA 3M8RA 3SUPA 2E6MA 1CXUA 4DQPA 4IG0A 3OS2A 4FLUA 4Z4IA 4DTSA 1NJZA 1VSJA 2B6AA 4IKFA 2KZZA 1HNIA 3E01A 3KKRA 3ZSRA 4DU4A 3V81A 1FKOA 3M8PA 4Z0UA 4IG3A 4HHTA 3V1OA 1IKWA 3KD1E 1REVA 2HB5A 1J9AA 2WOMA 3DOKA 3ALYA 3KIOA 1RILA 4CIEA 3OJUA 4FJ5A 2BGGA 1KLMA 3AVNA 4C8MA 1WAFA 3AVHA 3LAKA 4CJWA 4E7JA 3PX4A 2X78A 4ICLA 4JRPA 3V6DA 1FKPA 2O4GA 4CJ5A 3OYNA 3NBPA 4OPJA 1TKXA 1ZYQA 1JL2A 4YFUA 4J2BA 3PUFA 4KREA 3VN5A 4AHTA 3OYBA 3U3YA 3QIOA 3NHGA 1NK9A 1KVBA 3NGIA 5E41A 1L3VA 5J2QA 2HHSA 4CJEA 3HPOA 1RDBA 3EZ5A 5KRSA 3EYZA 3RTVA 3QO9A 4CF1A 4H8KA 1QSLA 2I5JA 5KTQA 3SZ2A 4DSLA 2G8UA 1T03A 2FBXA 3KLFA 1JL1A 3ZSWA 3ULDA 3L2RA 1I3AA 4I2QA 2KFZA 2HHWA 1VSHA 2HNZA 1C1CA 3QERA 4I2PA 3DOLA 2KTQA 4OGCA 2OA8A 2OPQA 4E89A 3LP2A 1C0MA 4FJMA 4KHWA 2Y1IA 1VRUA 3QEWA 3VQQA 4ELVA 1KCFA 1RDAA 4LD0A 4FW2A 4FYDA 2F8TA 4YNQA 3QETA 4BWMA 4RW6A 1SL2A 4Z4GA 3THVA 4HUGA 2ITGA 1GOAA 3O4NA 1SUQA 3I0SA 2BANA 4B9TA 3V9WA 4KHQA 3PO4A 1VSEA 1LAVA 4EP4A 3L2WA 1IH7A 3PY8A 1RTDA 5HRRA 3OYDA 4CK2A 1WAJA 3TWHA 5HLFA 4CJRA 4DQSA 4BWJA 3SCXA 3L2VA 4O0IA 1UA0A 1RT6A 3SUOA 1U49A 1B9FA 1NK7A 1YTUA 4B9LA 3CFPA 1A5XA 4IFYA 2P5OA 3LANA 3HJFA 1JLEA 3SV3A 4GW6A 2OYQA 4W5TA 3ZCMA 1B92A 3TAGA 5DK5A 4FJ9A 1HQEA 1KVCA 2Z1IA 3TR8A 4BE0A 4H4OA 1VSIA 2JGUA 3KD5E 1TKDA 4KHNA 4Z4FA 2IOCA 1VSDA 1HJRA 2HMIA 3MEDA 1TAUA 3DLRA 1HYZA 4C8LA 4HUEA 3AO4A 4ZTJA 4CFBA 3NH1A 1Q9YA 3IG1A 4FJLA 3NF7A 4I7FA 4FLWA 4C8OA 1YT3A 1S6QA 1VSKA 3QIPA 2DFHA 4FJGA 1D9FA 2YHAA 4JS4A 3TAPA 4DLEA 2G8WA 1UAXA 3C94A 1JLBA 4CHNA 4JRQA 5SZTA 4CHQA 4DQRA 1IKXA 3NFAA 4Z4HA 2KW4A 4OJRA 4OGEA 3SYZA 4E7LA 3K57A 4H4MA 1L3SA 4CIFA 3M8QA 4O5BA 3V1QA 5SWMA 3LDSA 4W5OA 3ZSVA 2YKNA 4M41A 3AA2A 1CZBA 4TSXA 4CCHA 5CZ1A 5FRNA 1EETA 2IGIA 4DTXA 3VQ7A 4NYFA 4BE1A 1T7PA 1HYVA 1S1UA 3I8DA 3RMCA 3SQ1A 4PQUA 3LPUA 4JS5A 4FM1A 4M3UA 4KKOA 1Y97A 3OS0A 4GVMA 2FBVA 1D5AA 4KHSA 3CYMA 3NCIA 3S9HA 4F8RA 2G8FA 2RN2A 3NF6A 3L8BA 4DSKA 3L3UA 4L8RB 1QSSA 3VQBA 4ZHRA 2XHBA 1RT5A 4CGFA 3HSTB 4DU3A 4HVJA 1XHZA 3AVFA 4F3TA 1A5WA 4N5SA 5CY4A 3P5JA 3KK1A 3HVRA 4OKJA 3AO2A 1NK4A 3QEVA 4FVMA 3QEIA 3TAEA 1N5YA 3QEXA 4ELUA 3WNFA 1ITGA 4DSJA 3PO5A 3OYJA 4DFPA 4CECA 4F2SA 1QSYA 4B9MA 4FJKA 3C6UA 4FXDA 4PA1A 4CF2A 4KHUA 5J2MA 1LAWA 1JXEA 1S1WA 1RDDA 3I0RA 4CJ4A 2QXFA 1S9EA 4C8NA 3NAEA 5KRTA 4K8XA 4FJ8A 1UA1A 4M3ZA 4Z4EA 3HXMA 2YKMA 4FJNA 3DI6A 1RTJA 1BQMA 4N41A 1T8EA 3HO1A 4DFMA 4FLVA 2ETJA 1BI4A 2D0BA 3SQ4A 1TL1A 4KB0A 2RF2A 2XRIA 4Y1DA 4CJ3A 4CHOA 1KRPA 4CF8A 5KGWA 3OYLA 4N56A 1TK0A 4IFVA 3RMDA 2HVIA 2YV0X 3WNEA 1DLOA 1S1TA 1HMVA 4OVLA 3V9XA 3ZT2A 4RW8A 4CE9A 4DSEA 1EKEA 2GUIA 1GOBA 4F4KA 2P1JA 2KZMA 4FLXA 3V9SA 3AV9A 4E7KA 1KLNA 3B6OA 1JLAA 3KLHA 3KLIA 2ATQA 1G15A 5DMRA 4KO0A 1EXQA 1QHTA 1Z25A 4BDYA 2AJQA 1X9MA 1HPZA 1IO2A 4Y1CA 3S3OA 4CEEA 5J2PA 3DLBA 1RNHA 3AVKA 1EP4A 3KLEA 4CJVA 1VSFA 3ISNC 1LWFA 2P51A 3ITHA 3SPZA 3NH2A 1NKEA 3S3NA 4PY5A 1NKCA 1U04A 3DMJA 3TANA 1W0HA 2QK9A 2G8HA 4OKEA 4DSIA 1NJWA 1C6VA 1WSGA 3OYFA 3HK2A 4B8CA 5KGXA 3RR7A 3P1GA 5FDLA 4AHUA 4DTMA 4CJUA 2VG6A 3U6FA 4ELTA 2G8KA 3DLKA 1RT7A 1RBUA 2W42A 4DLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAM A;  3ZSY A;  3LP1 A;  4R5P A;  1NOZ A;  4GMJ B;  4CEO A;  3CQ8 A;  1QS4 A;  3TAB A;  1KTQ A;  4DTO A;  2HHQ A;  3KTQ A;  2XY8 A;  4O0J A;  4C8K A;  3V9U A;  4CHZ A;  1BCO A;  4J2E A;  3OYK A;  3HT3 A;  1RBR A;  3IS9 A;  2XY5 A;  3MXM A;  4M3T A;  3KKS A;  1RT2 A;  4HTU A;  1WSI A;  3MEG A;  3RMA A;  2PZS A;  2JLE A;  5HBM A;  1TVR A;  4PWD A;  3TAM A;  4DTP A;  3HL8 A;  4M3W A;  4O44 A;  4DTR A;  1J54 A;  3NF9 A;  2X6N A;  2GV9 A;  4DG1 A;  3DRS A;  4CJQ A;  1C1A A;  2BE2 A;  2HHV A;  3V1R A;  3S3M A;  1B9D A;  4BDP A;  4CJP A;  5T7B A;  5FRM A;  4CF9 A;  2G8I A;  1BIU A;  3DYA A;  3TI0 A;  4JLH A;  4CEB A;  2P5G A;  4N47 A;  2NUB A;  3BGR A;  1C0U A;  1RT4 A;  1WLJ A;  4EP5 A;  4DQQ A;  1NKB A;  3CG7 A;  4DTU A;  2IDO A;  3VQ5 A;  3O3F A;  3OYE A;  3V9Z A;  3KLG A;  4N76 A;  4NCA A;  3NH0 A;  4FK2 A;  2OZM A;  1BL3 A;  4KTZ A;  3HYF A;  1JXB A;  3AVL A;  4M42 A;  2QKB A;  3DLH A;  2OZS A;  1SL0 A;  2XO7 A;  4PUO A;  1YVU A;  1EX4 A;  2B5J A;  3F9K A;  4CF0 A;  3K59 A;  1XHX A;  1TV6 A;  1C0T A;  2EHG A;  3K5N A;  1IG9 A;  3OYM A;  4K8Z A;  3VQP A;  3SNN A;  3H08 A;  3T19 A;  2A1R A;  3SUQ A;  2E6L A;  4M3Y A;  3CM5 A;  4AIL C;  1C1B A;  1BHL A;  4M3R A;  4LY7 A;  3K58 A;  3F73 A;  4J2D A;  1NK8 A;  1S9G A;  1ZBI A;  2ZE2 A;  1XWL A;  3T3F A;  4CFC A;  1TK5 A;  3VQE A;  4DU1 A;  3PX0 A;  4I9L A;  1BIS A;  3LWM A;  4OPK A;  4F3O A;  1J5O A;  4DS4 A;  3SPY A;  4CK3 A;  3AVJ A;  3QEP A;  4E19 A;  4FK0 A;  1RDC A;  4NYN A;  4W5Q A;  2OPR A;  4FZZ A;  3L3V A;  4CGD A;  4RW7 A;  3KK2 A;  3D0P A;  3HPG A;  3VQ8 A;  1HRH A;  4Q5V A;  4DS5 A;  2LSN A;  4DTN A;  4DSF A;  1MU2 A;  1CLQ A;  4FM2 A;  4ZTF A;  2DY4 A;  3OS1 A;  2RKI A;  3K5L A;  4QOZ B;  3WNH A;  1TAQ A;  4CER A;  5I3U A;  4QCL A;  2YNI A;  3MXJ A;  3D45 A;  4CJK A;  4DFJ A;  1W9H A;  2FBT A;  1WSH A;  4CGI A;  1I39 A;  1SL1 A;  4E3S A;  2FBY A;  5KI6 A;  3LP3 A;  3SI6 A;  2YNG A;  4I9Q A;  4RW9 A;  2OPS A;  3K5M A;  3KJV A;  3RMB A;  1HNV A;  5CYQ A;  3HM9 A;  2Z1H A;  1DTQ A;  3SQ0 A;  4CK1 A;  4FCY A;  1NK5 A;  4B08 A;  4AHS A;  4DWI A;  2X6S A;  2ZQB A;  1RT1 A;  1ZBU A;  1QTM A;  4LSN A;  4CJT A;  2R7Y A;  2F96 A;  3AO1 A;  4LH4 A;  4CGG A;  4B9N A;  1BI4 B;  1S6P A;  1RCH A;  4DMN A;  3ZSO A;  3PV8 A;  4CEZ A;  4CGH A;  3DLE A;  5C42 A;  3LWL A;  4FLT A;  3VQA A;  4KAZ A;  4FZY A;  3TAF A;  4G1Q A;  4LH5 A;  2HND A;  3AO3 A;  3TAQ A;  4E7H A;  4DTJ A;  3CFR A;  2Z1G A;  2B4J A;  1TKT A;  2FC0 A;  4LSL A;  5EU7 A;  3VQD A;  3ZSX A;  3ZT4 A;  4E7I A;  4XIU A;  3VQC A;  2YNF A;  4UQG A;  4FJH A;  5HRP A;  2D0A A;  1U45 A;  4B9S A;  3MXI A;  1NOY A;  3HVT A;  3O3H A;  2QKK A;  3C6T A;  2HHU A;  4HUF A;  2IS3 A;  2F8S A;  3HP9 A;  1WSJ A;  4KFB A;  3AVM A;  1R0A A;  2A1S A;  1J53 A;  2Y1J A;  4FJJ A;  4M45 A;  5FRO A;  3VQ9 A;  3MEC A;  3LZI A;  3OYH A;  4B9V A;  3G10 A;  1HQU A;  1GOC A;  2IC3 A;  3A2F A;  4FLZ A;  3VA3 A;  1JLQ A;  4ID5 A;  1XI1 A;  4OLB A;  1WN7 A;  1X1P A;  4B8A B;  4M3X A;  3SV4 A;  2HVH A;  4IBN A;  4CGJ A;  3WNG A;  1RTI A;  4KRF A;  3ZT1 A;  1KSP A;  4NCB A;  2KFN A;  4AH9 A;  4RG8 A;  1BIZ A;  1WNS A;  3AA5 X;  1RBV A;  2VG7 A;  1U4B A;  2OPP A;  1KVA A;  4HCB A;  3ZT3 A;  2XY6 A;  4FZX C;  4Z4C A;  4RW4 A;  3ASM A;  4MFB A;  4KPY A;  1FXX A;  5I42 A;  5J1E A;  4KTQ A;  1S1V A;  4CHP A;  4DF8 A;  4CJF A;  4FK4 A;  5CYM A;  2PY5 A;  3RR8 A;  3AO5 A;  4FJI A;  3NGY A;  4O4G A;  3SUN A;  1IKV A;  4E1M A;  2PYJ A;  1SV5 A;  4IDK A;  1LV5 A;  1TKZ A;  1ZBF A;  5C24 A;  3OY9 A;  3T1A A;  3PX6 A;  3BDP A;  2IAJ A;  4E1N A;  4EZ9 A;  4J2A A;  1L3U A;  1LWC A;  3MEE A;  4Q0B A;  5JS1 A;  3RRG A;  1QQC A;  2D0C A;  4OLA A;  3OYG A;  3OJS A;  3JYT A;  4DF4 A;  1NJY A;  1WSF A;  2BDP A;  4DFK A;  3LAL A;  3VQ4 A;  2HHT A;  4KV8 A;  1WSE A;  1A5V A;  4KI4 A;  1CXQ A;  3AA4 A;  1JKH A;  1UWB A;  4FLY A;  4ID1 A;  2KQ2 A;  3AA3 A;  3LZJ A;  1BGX T;  2Q3S A;  1JLG A;  3VQ6 A;  1K6Y A;  3O3G A;  4NCG A;  3AVB A;  4CJS A;  3P83 D;  3G0Z A;  2X74 A;  2YNH A;  5HRO A;  1SKW A;  1VRT A;  1CZ9 A;  3AVA A;  3IAY A;  3QES A;  2XY7 A;  1JLC A;  1UOC A;  3IRX A;  1LWE A;  1LW2 A;  3KK3 A;  3M8S A;  3NE6 A;  1HYS A;  3L2U A;  3JSM A;  5D3G A;  4W5R A;  3NDK A;  4KTW A;  1BCM A;  1VSL A;  2VG5 A;  3QNO A;  1ASV A;  4BDZ A;  1Q8I A;  1DTT A;  1U47 A;  1FK9 A;  3ZSQ A;  5C25 A;  1TL3 A;  3CM6 A;  4QAG A;  1U48 A;  3EY1 A;  1LW0 A;  3B6P A;  3AVC A;  4O55 A;  3AVG A;  1RBT A;  4CEA A;  3NGZ A;  1NJX A;  1X9W A;  1XC9 A;  1TK8 A;  1YTA A;  3K2P A;  3SQ2 A;  1L3T A;  3K5O A;  2HNY A;  1F21 A;  4CFD A;  4MQ3 A;  1KFD A;  3UIQ A;  4CED A;  1ASW A;  3DRP A;  4AHC A;  1IKY A;  3ZSZ A;  1Q9X A;  5HRS A;  2DFF A;  1RT3 A;  1O1W A;  1ASU A;  3VA0 A;  3HPH A;  2GBZ A;  3OVN A;  5J2N A;  3QIN A;  4DQI A;  4HCC A;  1Z26 A;  2VWK A;  2ZD1 A;  2HHX A;  4CFA A;  3L2Q A;  5HP1 A;  4FW1 A;  3MAQ A;  1SKS A;  3RWU A;  3OYA A;  2VWJ A;  3QNN A;  1BQN A;  1QE1 A;  1S1X A;  3AVI A;  1T05 A;  1NK6 A;  4FJ7 A;  2HW3 A;  1TGO A;  3LPT A;  3HP6 A;  1D9D A;  3O4Q A;  4CHY A;  4CJL A;  3CFO A;  3OYI A;  5CZ2 A;  3OYC A;  1N6Q A;  2YHB A;  4AHV A;  4EZ6 A;  4KI6 A;  3DLG A;  3LP0 A;  4CEF A;  4BE2 A;  2D5R A;  3V4I A;  3ZT0 A;  1VK0 A;  4F2R A;  4WE1 A;  2DTU A;  5JS2 A;  3SJJ A;  5K14 A;  1L5U A;  2EX3 A;  4FM0 A;  1RBS A;  1ZBH A;  4KHY A;  4OKK A;  1JLF A;  4B9U A;  1X9S A;  4CEQ A;  1RTH A;  2Z1J A;  3RRH A;  4BAC A;  3NF8 A;  1D8Y A;  2G8V A;  1VSM A;  3QLH A;  5HRN A;  3FFI A;  1KFS A;  2PYL A;  4E0D A;  3U3G A;  4B3O A;  4FJX A;  2O4I A;  2WON A;  2E4L A;  1ZBL A;  4AHR A;  4CIG A;  3TAR A;  3DRR A;  3C95 A;  1NK0 A;  1SKR A;  4KB1 A;  4W5N A;  2RPI A;  3DM2 A;  1S5J A;  4CES A;  2DFE A;  3M8R A;  3SUP A;  2E6M A;  1CXU A;  4DQP A;  4IG0 A;  3OS2 A;  4FLU A;  4Z4I A;  4DTS A;  1NJZ A;  1VSJ A;  2B6A A;  4IKF A;  2KZZ A;  1HNI A;  3E01 A;  3KKR A;  3ZSR A;  4DU4 A;  3V81 A;  1FKO A;  3M8P A;  4Z0U A;  4IG3 A;  4HHT A;  3V1O A;  1IKW A;  3KD1 E;  1REV A;  2HB5 A;  1J9A A;  2WOM A;  3DOK A;  3ALY A;  3KIO A;  1RIL A;  4CIE A;  3OJU A;  4FJ5 A;  2BGG A;  1KLM A;  3AVN A;  4C8M A;  1WAF A;  3AVH A;  3LAK A;  4CJW A;  4E7J A;  3PX4 A;  2X78 A;  4ICL A;  4JRP A;  3V6D A;  1FKP A;  2O4G A;  4CJ5 A;  3OYN A;  3NBP A;  4OPJ A;  1TKX A;  1ZYQ A;  1JL2 A;  4YFU A;  4J2B A;  3PUF A;  4KRE A;  3VN5 A;  4AHT A;  3OYB A;  3U3Y A;  3QIO A;  3NHG A;  1NK9 A;  1KVB A;  3NGI A;  5E41 A;  1L3V A;  5J2Q A;  2HHS A;  4CJE A;  3HPO A;  1RDB A;  3EZ5 A;  5KRS A;  3EYZ A;  3RTV A;  3QO9 A;  4CF1 A;  4H8K A;  1QSL A;  2I5J A;  5KTQ A;  3SZ2 A;  4DSL A;  2G8U A;  1T03 A;  2FBX A;  3KLF A;  1JL1 A;  3ZSW A;  3ULD A;  3L2R A;  1I3A A;  4I2Q A;  2KFZ A;  2HHW A;  1VSH A;  2HNZ A;  1C1C A;  3QER A;  4I2P A;  3DOL A;  2KTQ A;  4OGC A;  2OA8 A;  2OPQ A;  4E89 A;  3LP2 A;  1C0M A;  4FJM A;  4KHW A;  2Y1I A;  1VRU A;  3QEW A;  3VQQ A;  4ELV A;  1KCF A;  1RDA A;  4LD0 A;  4FW2 A;  4FYD A;  2F8T A;  4YNQ A;  3QET A;  4BWM A;  4RW6 A;  1SL2 A;  4Z4G A;  3THV A;  4HUG A;  2ITG A;  1GOA A;  3O4N A;  1SUQ A;  3I0S A;  2BAN A;  4B9T A;  3V9W A;  4KHQ A;  3PO4 A;  1VSE A;  1LAV A;  4EP4 A;  3L2W A;  1IH7 A;  3PY8 A;  1RTD A;  5HRR A;  3OYD A;  4CK2 A;  1WAJ A;  3TWH A;  5HLF A;  4CJR A;  4DQS A;  4BWJ A;  3SCX A;  3L2V A;  4O0I A;  1UA0 A;  1RT6 A;  3SUO A;  1U49 A;  1B9F A;  1NK7 A;  1YTU A;  4B9L A;  3CFP A;  1A5X A;  4IFY A;  2P5O A;  3LAN A;  3HJF A;  1JLE A;  3SV3 A;  4GW6 A;  2OYQ A;  4W5T A;  3ZCM A;  1B92 A;  3TAG A;  5DK5 A;  4FJ9 A;  1HQE A;  1KVC A;  2Z1I A;  3TR8 A;  4BE0 A;  4H4O A;  1VSI A;  2JGU A;  3KD5 E;  1TKD A;  4KHN A;  4Z4F A;  2IOC A;  1VSD A;  1HJR A;  2HMI A;  3MED A;  1TAU A;  3DLR A;  1HYZ A;  4C8L A;  4HUE A;  3AO4 A;  4ZTJ A;  4CFB A;  3NH1 A;  1Q9Y A;  3IG1 A;  4FJL A;  3NF7 A;  4I7F A;  4FLW A;  4C8O A;  1YT3 A;  1S6Q A;  1VSK A;  3QIP A;  2DFH A;  4FJG A;  1D9F A;  2YHA A;  4JS4 A;  3TAP A;  4DLE A;  2G8W A;  1UAX A;  3C94 A;  1JLB A;  4CHN A;  4JRQ A;  5SZT A;  4CHQ A;  4DQR A;  1IKX A;  3NFA A;  4Z4H A;  2KW4 A;  4OJR A;  4OGE A;  3SYZ A;  4E7L A;  3K57 A;  4H4M A;  1L3S A;  4CIF A;  3M8Q A;  4O5B A;  3V1Q A;  5SWM A;  3LDS A;  4W5O A;  3ZSV A;  2YKN A;  4M41 A;  3AA2 A;  1CZB A;  4TSX A;  4CCH A;  5CZ1 A;  5FRN A;  1EET A;  2IGI A;  4DTX A;  3VQ7 A;  4NYF A;  4BE1 A;  1T7P A;  1HYV A;  1S1U A;  3I8D A;  3RMC A;  3SQ1 A;  4PQU A;  3LPU A;  4JS5 A;  4FM1 A;  4M3U A;  4KKO A;  1Y97 A;  3OS0 A;  4GVM A;  2FBV A;  1D5A A;  4KHS A;  3CYM A;  3NCI A;  3S9H A;  4F8R A;  2G8F A;  2RN2 A;  3NF6 A;  3L8B A;  4DSK A;  3L3U A;  4L8R B;  1QSS A;  3VQB A;  4ZHR A;  2XHB A;  1RT5 A;  4CGF A;  3HST B;  4DU3 A;  4HVJ A;  1XHZ A;  3AVF A;  4F3T A;  1A5W A;  4N5S A;  5CY4 A;  3P5J A;  3KK1 A;  3HVR A;  4OKJ A;  3AO2 A;  1NK4 A;  3QEV A;  4FVM A;  3QEI A;  3TAE A;  1N5Y A;  3QEX A;  4ELU A;  3WNF A;  1ITG A;  4DSJ A;  3PO5 A;  3OYJ A;  4DFP A;  4CEC A;  4F2S A;  1QSY A;  4B9M A;  4FJK A;  3C6U A;  4FXD A;  4PA1 A;  4CF2 A;  4KHU A;  5J2M A;  1LAW A;  1JXE A;  1S1W A;  1RDD A;  3I0R A;  4CJ4 A;  2QXF A;  1S9E A;  4C8N A;  3NAE A;  5KRT A;  4K8X A;  4FJ8 A;  1UA1 A;  4M3Z A;  4Z4E A;  3HXM A;  2YKM A;  4FJN A;  3DI6 A;  1RTJ A;  1BQM A;  4N41 A;  1T8E A;  3HO1 A;  4DFM A;  4FLV A;  2ETJ A;  1BI4 A;  2D0B A;  3SQ4 A;  1TL1 A;  4KB0 A;  2RF2 A;  2XRI A;  4Y1D A;  4CJ3 A;  4CHO A;  1KRP A;  4CF8 A;  5KGW A;  3OYL A;  4N56 A;  1TK0 A;  4IFV A;  3RMD A;  2HVI A;  2YV0 X;  3WNE A;  1DLO A;  1S1T A;  1HMV A;  4OVL A;  3V9X A;  3ZT2 A;  4RW8 A;  4CE9 A;  4DSE A;  1EKE A;  2GUI A;  1GOB A;  4F4K A;  2P1J A;  2KZM A;  4FLX A;  3V9S A;  3AV9 A;  4E7K A;  1KLN A;  3B6O A;  1JLA A;  3KLH A;  3KLI A;  2ATQ A;  1G15 A;  5DMR A;  4KO0 A;  1EXQ A;  1QHT A;  1Z25 A;  4BDY A;  2AJQ A;  1X9M A;  1HPZ A;  1IO2 A;  4Y1C A;  3S3O A;  4CEE A;  5J2P A;  3DLB A;  1RNH A;  3AVK A;  1EP4 A;  3KLE A;  4CJV A;  1VSF A;  3ISN C;  1LWF A;  2P51 A;  3ITH A;  3SPZ A;  3NH2 A;  1NKE A;  3S3N A;  4PY5 A;  1NKC A;  1U04 A;  3DMJ A;  3TAN A;  1W0H A;  2QK9 A;  2G8H A;  4OKE A;  4DSI A;  1NJW A;  1C6V A;  1WSG A;  3OYF A;  3HK2 A;  4B8C A;  5KGX A;  3RR7 A;  3P1G A;  5FDL A;  4AHU A;  4DTM A;  4CJU A;  2VG6 A;  3U6F A;  4ELT A;  2G8K A;  3DLK A;  1RT7 A;  1RBU A;  2W42 A;  4DLG A; 
#chains in the Genus database with same CATH topology
 2A6A A;  3HTV A;  5ADX H;  4GMJ B;  4WCE L;  4R5P A;  3CQ8 A;  2F4V K;  4A57 A;  4O5F A;  4DB3 A;  5IWA K;  1RT2 A;  3R9P A;  3RMA A;  2JLE A;  1T3V A;  3TAM A;  3HL8 A;  4M3W A;  2BE2 A;  2HHV A;  1B9D A;  4CZH A;  1JCG A;  4CF9 A;  4Z94 A;  3OW2 M;  4CEB A;  3TTC A;  4EHU A;  5EVZ A;  5HOO A;  3OYE A;  1GLL O;  4N76 A;  3PSF A;  3VPZ A;  4BRG A;  4HTL A;  5AQO A;  3QFP A;  2QKB A;  2OZS A;  4PUO A;  3GOI A;  1EX4 A;  3F9K A;  4CF0 A;  1XHX A;  2NRX A;  3Q7B A;  1KAZ A;  3VQP A;  3H08 A;  3FR0 A;  3H3N O;  2UUB K;  1X9J A;  1C1B A;  1BHL A;  3T1H K;  3F73 A;  4J2D A;  4NLC A;  4BRA A;  1ZBI A;  3T3F A;  1QVF M;  3RSE B;  1BIS A;  4F3O A;  4DS4 A;  3LDL A;  3AVJ A;  2VQF K;  5BN8 A;  3MDQ A;  1KXP A;  4RW7 A;  3GL1 A;  3VOV A;  2VQE K;  1QQN A;  1W2B M;  4RTF D;  4LC9 B;  1MU2 A;  3NVM A;  4CER A;  1VQO N;  2FBT A;  1WSH A;  3PIP L;  1I39 A;  2FBY A;  5KI6 A;  3SI6 A;  3KJV A;  3RMB A;  4PKI A;  4CK1 A;  2ZQB A;  1ZBU A;  1QTM A;  4LSN A;  2UXB K;  3EKS A;  3W0L A;  3AO1 A;  4IOC L;  1S6P A;  1RCH A;  3WEE A;  2QWP A;  1ZC6 A;  3D6R A;  5BRD A;  4K41 A;  4WFA L;  4CGH A;  5C42 A;  4FL9 A;  4FLT A;  4JI4 K;  1T6D A;  3VQA A;  4KAZ A;  1VQL N;  4E1J A;  4FZY A;  2ZM6 K;  3ENH A;  4LH5 A;  3AO3 A;  4BR4 A;  4GV6 A;  1NGI A;  4DV5 K;  2B4J A;  1TKT A;  2P9S A;  4E7I A;  4XIU A;  3VQC A;  2YNF A;  4FJH A;  4H5T A;  4B9S A;  3O3H A;  2HHU A;  5DM6 L;  4KFB A;  1WSJ A;  3AVM A;  4WQ4 A;  5AJ3 K;  3LZI A;  4ISE A;  5LMN K;  3A2F A;  4EIA A;  5KQD A;  2ZJR L;  4BRM A;  4OLB A;  2ZGY A;  1WN7 A;  1X1P A;  4B8A B;  4H03 B;  4JI5 K;  4M3X A;  3ZT1 A;  1KSP A;  1P90 A;  2WFB A;  4RG8 A;  4QS8 A;  5EXW A;  1U4B A;  3C7N A;  4Z4C A;  5I42 A;  1RFQ A;  4A5B A;  1S1V A;  4CHP A;  4FK4 A;  3AO5 A;  3NGY A;  4O4G A;  4E1M A;  4OPH A;  4MO4 A;  4QS9 A;  3RRG A;  1QQC A;  2Q2R A;  3OYG A;  3OJS A;  1NJY A;  2P9P A;  4JYA K;  1WSE A;  3HM8 A;  1H1V A;  3AA4 A;  2KQ2 A;  3AA3 A;  4FWQ A;  5AQH A;  1BGX T;  3LZJ A;  4DR2 K;  2Q3S A;  4CD3 A;  4IOA L;  4GNI A;  3AVB A;  4CJS A;  3G0Z A;  3U4L A;  4WF9 L;  1LWE A;  1LW2 A;  1O13 A;  4BRL A;  3KK3 A;  4IJN A;  3L2U A;  1FW6 A;  4KTW A;  5FPN A;  2E1Y A;  5C25 A;  1OH5 A;  3LDN A;  3R1X A;  4O55 A;  3NGZ A;  1NJX A;  3N4P A;  3K2P A;  5GAG P;  4CFD A;  3H46 O;  3UE5 A;  1Q7Y O;  3O08 A;  3F2K A;  3VA0 A;  2GBZ A;  5J2N A;  5EOY A;  3QIN A;  4B1X B;  4JI7 K;  1S3X A;  2ZD1 A;  2QEX N;  4H5R A;  4CFA A;  1N34 K;  4ILG B;  4MLH A;  4CHY A;  3CFO A;  5CZ2 A;  1N32 K;  4AHV A;  4EZ6 A;  4KI6 A;  4CEF A;  4BRD A;  5C10 A;  3SJJ A;  1L5U A;  2EX3 A;  4KHY A;  1JLF A;  4FWN A;  4H0Y B;  3NF8 A;  3MN6 A;  1D8Y A;  1VSM A;  3TU5 A;  1VQK N;  1KFS A;  3U3G A;  4B3O A;  4BC5 A;  3C6H A;  4CIG A;  3LL3 A;  1NK0 A;  1V4S A;  1S5J A;  3SUP A;  1J6Z A;  4ISG A;  3VMF B;  4DQP A;  4IG0 A;  3OS2 A;  4FLU A;  4U67 L;  1VSJ A;  4ILH A;  3QDK A;  4DV1 K;  1Q82 O;  1K73 O;  3V1O A;  1REV A;  2HB5 A;  1J9A A;  3WXM B;  1BOT O;  3ALY A;  4FJ5 A;  4BGA A;  3AVN A;  4C8M A;  1WAF A;  3PX4 A;  2X78 A;  1NGJ A;  1FKP A;  1J5E K;  5MLC Q;  3OYB A;  4PL7 A;  1V4T A;  4FWL A;  1NK9 A;  3NGI A;  4IFE A;  4IZ9 A;  1XMQ K;  2IVN A;  4CJE A;  1NGF A;  1QSL A;  2I5J A;  2G8U A;  1T03 A;  3KLF A;  2E2P A;  3CJB A;  3WUH A;  4BQZ A;  2HNZ A;  4PL8 A;  3P38 A;  4I2P A;  2KTQ A;  3ULE B;  3J81 O;  4FWO A;  2Y1I A;  4ELV A;  1RDA A;  5JVG L;  4FW2 A;  4MDB A;  4FYD A;  1SL2 A;  5AQW A;  2NRW A;  4Z4G A;  3O4N A;  1SUQ A;  3V9W A;  4CZG A;  3L2W A;  1RTD A;  3A5L C;  3WXL A;  5HLF A;  4KHP K;  3SCX A;  1UA0 A;  1B9F A;  1YTU A;  2O8F A;  3LAN A;  1HNX K;  3SV3 A;  1S22 A;  4GW6 A;  5TKW A;  4W5T A;  3ZCM A;  3P4I A;  4FJ9 A;  1HQE A;  2W41 A;  3CIP A;  3TR8 A;  5KPR A;  4H4O A;  5AQG A;  1VSI A;  2JGU A;  3KD5 E;  4Z4F A;  4DUZ K;  1TAU A;  2HMI A;  1YF5 L;  4AQY K;  3NH1 A;  1T44 A;  4DUY K;  3NF7 A;  4O8K A;  1NMN A;  2DFH A;  5AQR A;  1D9F A;  3TTD A;  4JS4 A;  3TAP A;  4WFN L;  5AQY A;  4CHQ A;  3NFA A;  5JIC A;  3ID6 A;  4E7L A;  3SYZ A;  4B9L A;  4A62 A;  1BA1 A;  1MA9 B;  3ZSV A;  3LDS A;  4X64 K;  4C23 A;  2H3G X;  2IGI A;  3VQ7 A;  1HKB A;  1GLJ O;  4NYF A;  3I8D A;  2CGL A;  1T6C A;  1D5A A;  3CYM A;  4F8R A;  3L3U A;  5FPE A;  2P9K A;  3VF6 A;  1EWQ A;  1QSS A;  3VQB A;  1XNQ K;  4F3T A;  1A5W A;  3P5J A;  3KK1 A;  2UYT A;  3O4W A;  2F8T A;  1ITG A;  3PO5 A;  4XH1 A;  4F2S A;  4EHT A;  4B9M A;  4BRI A;  1E3M A;  4FXD A;  4CF2 A;  2YX6 A;  1JXE A;  2QXF A;  5AZI B;  3WXI A;  3T69 A;  2YKM A;  4FJN A;  3DI6 A;  1RTJ A;  1BQM A;  4N41 A;  1ATN A;  1T8E A;  3AAR A;  3ATV A;  4FLV A;  4BR9 A;  4IFV A;  2YV0 X;  1S1T A;  4OVL A;  4PHT X;  4X66 K;  4RW8 A;  4DSE A;  1GOB A;  3ZEU B;  3V9S A;  2F9T A;  1KLN A;  3KLH A;  5LMU K;  1G15 A;  1EXQ A;  2AJQ A;  1DT9 A;  4Y1C A;  1OH6 A;  3S3O A;  3FZL A;  1GLA G;  2QWO A;  3AVK A;  1SZ2 A;  3KLE A;  2QWM A;  3DAW A;  4CJV A;  3ISN C;  4FVU A;  3NH2 A;  1NKE A;  4X65 K;  1ZXO A;  5AR0 A;  1D4X A;  2QK9 A;  2E8A A;  1WSG A;  3HK2 A;  1QQM A;  4BRH A;  3CJ7 A;  5FDL A;  4AHU A;  4DTM A;  5BPN A;  2G8K A;  1M1K O;  3VGK A;  4JKH A;  2W42 A;  1HNZ K;  3ZSY A;  3LP1 A;  1DGK N;  1QS4 A;  3KTQ A;  4O0J A;  1JJ2 M;  3V9U A;  1RBR A;  2ZGZ A;  2ASO A;  3KKS A;  1HUX A;  3RVC A;  3MEG A;  2PZS A;  3M3Z A;  1Z6R A;  1K8A O;  4DTP A;  3NMU A;  1NNE A;  2X6N A;  1ATR A;  2RE2 A;  3IDH A;  3D2F B;  3VEY A;  4BDP A;  2WC9 A;  3HI0 A;  3L6Q A;  4CBU A;  1RT4 A;  4EP5 A;  1NKB A;  2GWK A;  3CG7 A;  4NCA A;  3NH0 A;  3FZF A;  4IWV A;  4FOI A;  2P9L A;  3OHR A;  1YVU A;  2P9P B;  2B5J A;  1IG9 A;  1TUY A;  1C0T A;  1TV6 A;  1Q81 O;  3OYM A;  1YIT N;  3T19 A;  3VEZ A;  1VQ6 N;  4XEI A;  4M3Y A;  3ULE A;  3CM5 A;  1NLV A;  1NGA A;  4M3R A;  3K58 A;  1NGE A;  3KHY A;  2QM1 A;  2ZE2 A;  5LJW A;  4CFC A;  1TK5 A;  4DU1 A;  3PX0 A;  4B9Q A;  3LWM A;  4MO5 A;  3SPY A;  2D0O A;  4X62 K;  4E19 A;  1RDC A;  4H5V A;  2OPR A;  4JI2 K;  4FZZ A;  3L3V A;  3KK2 A;  3HPG A;  3C7N B;  3VQ8 A;  3CXC M;  4DTN A;  3ZX2 A;  4DSF A;  4IO8 A;  1CLQ A;  4LF8 K;  2KLA A;  4QOZ B;  3VER A;  3WNH A;  2Q1N A;  4RW9 A;  3K5M A;  1HNV A;  3ENB A;  3HM9 A;  3NVK A;  1DTQ A;  1XNR K;  3SQ0 A;  4YHH K;  4DWI A;  3H3O B;  4CJT A;  4CD1 A;  2F96 A;  4B9N A;  1BI4 B;  1SS6 A;  5M1F A;  4B3S K;  3DLE A;  3F5T A;  3VES A;  1QZ5 A;  4DCH A;  3K0S A;  2HND A;  3TAQ A;  4LSL A;  3VEX A;  3ZSX A;  2FC0 A;  1NBW A;  3CCE N;  4UQG A;  2D0A A;  1U45 A;  1NOY A;  2QKK A;  4OX9 K;  3C6T A;  3EN9 A;  3D7E O;  4BR0 A;  1R0A A;  4EAH D;  4FJJ A;  5FRO A;  1YJW N;  3GDQ A;  4JI1 K;  3MEC A;  2HBL A;  2IC3 A;  1GOC A;  3I56 N;  2GEL A;  1BO5 O;  5IT9 O;  4ID5 A;  1G99 A;  3ZET A;  3SV4 A;  4IBN A;  4CGJ A;  1Q86 O;  3CJ9 A;  3VGL A;  4BY9 C;  2YHW A;  1WNS A;  3AA5 X;  3S41 A;  1K8K B;  3I55 N;  1KVA A;  2XY6 A;  4BRN A;  3VEW A;  2CGK A;  4DF8 A;  4CJF A;  2PY5 A;  3M6G A;  5JLH A;  3O5B A;  1N33 K;  4KH5 A;  2P9S B;  2VYP A;  3BDP A;  4E1N A;  4OLA A;  3JYT A;  3CCR N;  3LAL A;  4DV2 K;  4KV8 A;  4KI4 A;  3LDO A;  1CXQ A;  4FLY A;  4JI6 K;  4CJ7 A;  2O8E B;  3BP8 A;  1VHX A;  4GVE A;  3L4Q A;  3I8B A;  3P83 D;  3ZLJ A;  2X74 A;  1CZ9 A;  3AVA A;  3CET A;  2XY7 A;  1HYS A;  1UOC A;  3IRX A;  3M8S A;  4H0X B;  3JSM A;  4W5R A;  1LOT B;  3CCS N;  1Q8I A;  1U47 A;  4Y0W A;  4WQ4 C;  3B6P A;  5JS1 A;  4CEA A;  1X9W A;  1YTA A;  3SQ2 A;  4LF5 K;  3K5O A;  1F21 A;  1KFD A;  4CED A;  1OH7 A;  3CME N;  1Q9X A;  3MMV A;  3DJC A;  1ASU A;  2F9W A;  3A5N C;  5BRH A;  4DQI A;  2VWK A;  2EWS A;  4YOT A;  3IMX A;  3OYA A;  3MX2 A;  3MN5 A;  2JWK A;  3J8A A;  3QNN A;  1BQN A;  1QE1 A;  1T05 A;  4QS7 A;  3LPT A;  3HP6 A;  1OVY A;  1NMD A;  3LP0 A;  4BE2 A;  3V4I A;  2UXD K;  5JS2 A;  5K14 A;  3MCP A;  1ZBH A;  2E88 A;  4B9U A;  4HWI A;  3CCM N;  3QLH A;  1S72 N;  2PYL A;  1XC3 A;  5KQ8 A;  2WON A;  4JHD A;  1RDW X;  1Z05 A;  3DRR A;  3VET A;  3TAR A;  4KB1 A;  4K42 A;  4LF6 K;  4FWM A;  5A2Q O;  4MDA A;  4CES A;  3M8R A;  2E6M A;  1CXU A;  3EKU A;  4DTS A;  5FLX O;  3CPW M;  1N36 K;  2KZZ A;  2QWL A;  3KKR A;  2HST A;  3GG4 A;  4IG3 A;  1IKW A;  3KD1 E;  4DV0 K;  2WOM A;  3KIO A;  3HRG A;  3OJU A;  1KLM A;  1E4F T;  4I6M B;  3ENO A;  3V6D A;  2O8C A;  5AZI A;  4WQ5 A;  4OPJ A;  5AQQ A;  4IO9 L;  4WQ5 C;  4J2B A;  3PUF A;  3Q7C A;  4C1N I;  5GIN A;  4H0T B;  4IEI A;  3NHG A;  4YDU C;  4JKD A;  3QO9 A;  3OBY A;  3I33 A;  4H8K A;  5LJV A;  4DSL A;  2FBX A;  3ULD A;  4ISF A;  2HHW A;  1C1C A;  2UUC K;  4IOX A;  3LP2 A;  3H1V X;  4FWR A;  4FJM A;  1VRU A;  3VQQ A;  3AY9 A;  4LD0 A;  2FLO A;  2GUP A;  4YNQ A;  4BWM A;  3E9P A;  5AQN A;  4RW6 A;  2NRT A;  3G6E N;  3THV A;  4HUG A;  2GWJ A;  3FFK B;  4KHQ A;  1R59 O;  3PY8 A;  3OYD A;  4CJR A;  1BUP A;  5BR9 A;  4O0I A;  3O9S A;  1GLC G;  3SUO A;  1NK7 A;  3CCU N;  4CZJ A;  1K8K A;  3HJF A;  1U2V A;  1JLE A;  3PLA A;  3TAG A;  5DK5 A;  1X3N A;  1WBB A;  5BN9 A;  4CZM A;  2P9U B;  4CBW A;  4KHN A;  2HMP A;  1VQP N;  3VEV A;  4HUE A;  4FJL A;  1YT3 A;  1VSK A;  4CZI A;  3CJ1 A;  1M90 O;  2G8W A;  1JLB A;  5SZT A;  2O8E A;  4OGE A;  3W3D A;  3C0B A;  2YKN A;  4A2B A;  3BZK A;  4M41 A;  4RWT A;  1U6Z A;  3AA2 A;  1CZB A;  3MWP A;  4CCH A;  4B3T K;  1HYV A;  3VGM A;  3RMC A;  3QML A;  2AA4 A;  2OAN A;  4FM1 A;  4M3U A;  4KKO A;  1Y97 A;  3OS0 A;  4GVM A;  5H1S Q;  3E9L A;  3SLC A;  2G8F A;  4DSK A;  1IV0 A;  5BRF A;  2A3Z A;  2XHB A;  4CGF A;  3VF4 A;  2QI2 A;  4HVJ A;  3AVF A;  3E66 A;  3CF5 L;  5CY4 A;  3SK3 A;  3HVR A;  3QBW A;  3AO2 A;  4FVM A;  3QEI A;  3DXK A;  4K43 A;  3OYJ A;  4CEC A;  2D1K A;  3ID8 A;  3THX A;  5J2M A;  4DR7 K;  4CJ4 A;  1RDD A;  4FJ8 A;  4H0V B;  4YOW A;  1W7A A;  5AQP A;  4FWK A;  3VEN A;  3THY A;  1GLE G;  4FWP A;  3TSU A;  1XQS C;  2O8D B;  4DR6 K;  2F7T A;  3SQ4 A;  2D0B A;  1TL1 A;  1QVG M;  4CF8 A;  4N56 A;  4WFB L;  3RMD A;  2HVI A;  3WNE A;  2KKZ A;  1NWK A;  4GY2 B;  2HF4 A;  2PAV A;  3TTF A;  4CE9 A;  3O1B A;  1EKE A;  2GUI A;  4DR5 K;  4FLX A;  4JAX A;  3AV9 A;  3FZM A;  3G4S N;  1N8R O;  2P9K B;  2VGM A;  4JKG A;  5DMR A;  1QHT A;  4NLB A;  4BC3 A;  5AQK A;  1IO2 A;  3K9J A;  4CEE A;  3O6W A;  1EP4 A;  2P51 A;  3SPZ A;  4A2A A;  3WQU A;  4KH4 A;  1U04 A;  5C2D A;  2G8H A;  4BR7 A;  3RR7 A;  3P1G A;  2YI1 A;  2D4W A;  2VG6 A;  3O8M A;  4QCL A;  2FF6 A;  3LAM A;  4BRE A;  3U8X A;  4O8U A;  4YDU A;  4CEO A;  4DTO A;  2XY8 A;  4CHZ A;  3OYK A;  3LDQ A;  3EO3 A;  1W97 L;  3R6M A;  4NB4 A;  3NF9 A;  2GV9 A;  4DG1 A;  3DRS A;  4CJQ A;  1C1A A;  3V1R A;  4IJA A;  3S3M A;  4B1Y B;  4CJP A;  5T7B A;  5FRM A;  5AQX A;  2G8I A;  1BIU A;  3DYA A;  4JLH A;  2O8B A;  3BGR A;  4DTU A;  1SAZ A;  3VQ5 A;  3VTH A;  3O3F A;  3V9Z A;  3KLG A;  4FK2 A;  2D0P A;  1BU6 O;  4CVN E;  1BL3 A;  1ESV A;  4KTZ A;  3HYF A;  4M42 A;  2FXU A;  3DLH A;  2BUP A;  3K59 A;  2EHG A;  3SNN A;  2A1R A;  3SUQ A;  3SAG A;  4AIL C;  1NK8 A;  4LF4 K;  3R3L A;  4I9L A;  3SJH A;  4OPK A;  4V19 S;  1YIJ N;  3O9T A;  4FK0 A;  2HBM A;  1EWR A;  2P9U A;  4IXC A;  4CGD A;  3D0P A;  2FSJ A;  4BG8 A;  3CJA A;  3CCQ N;  2NZT A;  3UKR B;  4FM2 A;  3PIO L;  4ZTF A;  2DY4 A;  3OTO K;  3K5L A;  1ZBS A;  1TAQ A;  1C0F A;  3D45 A;  4CGI A;  3LP3 A;  4I9Q A;  5TKY A;  2I7N A;  5M1O A;  2P9I A;  2Z1H A;  4FCY A;  1RT1 A;  2R7Y A;  5CHI A;  4LH4 A;  3QB0 A;  3ZSO A;  3LWL A;  2V51 B;  4CW7 B;  4NXN K;  1P8Z A;  3WQT A;  2UUA K;  3TAF A;  3PSI A;  4E7H A;  4DTJ A;  4CZL A;  5GAD P;  3CFR A;  2Z1G A;  3ZT4 A;  3CER A;  1HKC A;  3J80 O;  3THW A;  4FOE A;  3MXI A;  4U7B A;  2QA4 N;  4HUF A;  3GBT A;  5KPZ A;  2F8S A;  3HP9 A;  3T1Y K;  2A1S A;  2Y1J A;  2E5L K;  3L0Q A;  1HQU A;  4YOU A;  3UB5 A;  5LY3 A;  1JLQ A;  3KZB A;  2HVH A;  4JI8 K;  1HLU A;  3WNG A;  1RTI A;  3O80 A;  3DXK B;  4B1Z A;  4KRF A;  3DWL A;  2UU9 K;  2KFN A;  3J7A P;  1BIZ A;  4A5A A;  2E2O A;  5GIP A;  1RBV A;  4JHD B;  4HCB A;  3ZT3 A;  4GKK K;  5AFU A;  2DPN A;  3ASM A;  4DR3 K;  4LFC K;  4KPY A;  5AZJ A;  3THY B;  5CR4 A;  5F1X A;  3F9M A;  3RR8 A;  4FJI A;  3SUN A;  1IKV A;  1SV5 A;  3UKU B;  1TKZ A;  2ITM A;  1ZBF A;  5C24 A;  3OY9 A;  2IAJ A;  3A5O C;  1L3U A;  1LWC A;  2D0C A;  3MN9 A;  1WSF A;  2BDP A;  4DFK A;  3VQ4 A;  2PBD A;  1A5V A;  2QXL A;  2O8C B;  4DV4 K;  1KD1 O;  4JKG B;  1K6Y A;  2QW9 A;  3M5R A;  1YAG A;  5HRO A;  1SKW A;  2A42 A;  3IAY A;  3QES A;  3EEQ A;  4B1W B;  1TUU A;  3SMS A;  5D3G A;  2YHX A;  1BCM A;  1VSL A;  2VG5 A;  3M1F A;  3QNO A;  1NM1 A;  3ZSQ A;  1TL3 A;  1BA0 A;  4QAG A;  1U48 A;  3EY1 A;  1HX1 A;  1LW0 A;  3AVC A;  2WBN A;  3AVG A;  1TK8 A;  1L3T A;  2W40 A;  2HNY A;  4MQ3 A;  1ASW A;  3MX5 A;  3G71 N;  4AHC A;  2A5X A;  1WOQ A;  1RT3 A;  2DFF A;  5EX5 A;  3KWG A;  2ZJQ L;  1O1W A;  1VQ5 N;  2QTD A;  3AGR A;  3HPH A;  4JEP A;  3OVN A;  2NRZ A;  1SKS A;  3L2Q A;  4FW1 A;  5KPT A;  3MAQ A;  3O9R A;  2VWJ A;  1NK6 A;  3AVI A;  4FJ7 A;  2HW3 A;  1D9D A;  3OYC A;  1U2V B;  1N6Q A;  2YHB A;  1VK0 A;  4WE1 A;  1YXQ A;  2V7Y A;  4FM0 A;  1X9S A;  1RTH A;  1OVQ A;  4B1U B;  4BAC A;  3WXK A;  3U9D A;  5HRN A;  4C1N K;  4E0D A;  1RGI A;  4FJX A;  2O4I A;  4B3R K;  1SKR A;  3C95 A;  2OCE A;  2RPI A;  2OTL N;  2CGJ A;  5AQF A;  1NGC A;  4EFH A;  4Z4I A;  3L4I A;  4IEE A;  3H1Q A;  3MCA B;  1HNI A;  3E01 A;  3ZSR A;  4DU4 A;  2YJE A;  1FKO A;  3M8P A;  2ZF5 O;  3OA9 A;  4Z0U A;  4HHT A;  3DOK A;  1RIL A;  3HBT A;  4CJW A;  2HOE A;  2CH6 A;  1MDU B;  4ICL A;  2O4G A;  2YJF A;  3MWT A;  3NBP A;  4CJ5 A;  1TKX A;  1ZYQ A;  4YFU A;  4KRE A;  3UKR A;  3VN5 A;  4AHT A;  2IVO A;  1IBL K;  1KVB A;  3C65 A;  5J2Q A;  2HHS A;  3EZ5 A;  4GV3 A;  3EYZ A;  4CF1 A;  5KTQ A;  5JLF A;  3ZSW A;  3L2R A;  1I3A A;  4I2Q A;  3THX B;  2KFZ A;  3CCV N;  3FE1 A;  2OPQ A;  3THW B;  1C0M A;  4KHW A;  3QEW A;  1KCF A;  3HOS A;  3LDP A;  4FPB A;  3QET A;  1LCU A;  4CZF A;  2ITG A;  3FLC O;  4H0O A;  4I6M A;  4PKH A;  2NNW A;  1VSE A;  1LAV A;  4EP4 A;  4K25 A;  5M1P A;  1WAJ A;  3TWH A;  1C0G A;  4DQS A;  2QWR A;  4BWJ A;  3L2V A;  1RT6 A;  1U49 A;  3CFP A;  1A5X A;  4IFY A;  2P5O A;  4DQ8 A;  1YI2 N;  3D2E B;  4BE0 A;  2Z1I A;  2V52 B;  4M63 C;  1VSD A;  1HJR A;  4RCH A;  3MED A;  4JKF A;  3CPE A;  3AO4 A;  3JS6 A;  4CFB A;  3O9Q A;  1Q9Y A;  4C8O A;  2IVP A;  1S6Q A;  3QIP A;  3TPQ A;  2YHA A;  4DLE A;  3CQX A;  3H45 C;  4CHN A;  1VQ4 N;  3OBW A;  5GAH P;  1IKX A;  1QQO A;  4OJR A;  4KB0 A;  3K57 A;  4H4M A;  4O5B A;  3V1Q A;  5SWM A;  4JK9 A;  4TSX A;  5CZ1 A;  4JV5 K;  1EET A;  1T7P A;  4DTX A;  4BE1 A;  1S1U A;  3HZ6 A;  3LM2 A;  3SQ1 A;  4JS5 A;  1OKJ A;  4KHS A;  3NCI A;  3S9H A;  3NF6 A;  1SQK A;  2VWB A;  4L8R B;  3CD6 N;  4AM7 A;  4BRK A;  3HST B;  1YJ9 N;  1HPM A;  4PKG A;  1XHZ A;  3SBG A;  1VQ7 N;  5ELZ A;  4BRP A;  3TAE A;  3QEX A;  4ELU A;  3WNF A;  4DSJ A;  1E4G T;  4BRO A;  1QSY A;  1HR0 K;  3C6U A;  4PA1 A;  1LAW A;  3FGU A;  1EQY A;  5KRT A;  1UA1 A;  4Z4E A;  3HXM A;  1IJJ A;  1GLF O;  4DFM A;  2ETJ A;  1BI4 A;  4GKJ K;  2XRI A;  4Y1D A;  4CJ3 A;  5LL6 Z;  4FWS A;  5KGW A;  1TK0 A;  1DLO A;  3ZT2 A;  2P9I B;  2KZM A;  2Q31 A;  4IDH A;  3B6O A;  1JLA A;  3KLI A;  4GV9 A;  2ATQ A;  2Q97 A;  5AQS A;  1HPZ A;  3DLB A;  3CC7 N;  5AQV A;  2CH5 A;  4CZE A;  1RDU A;  4JD2 B;  1W0H A;  4DSI A;  2A41 A;  1C6V A;  1NJW A;  5KGX A;  2QWN A;  4WYB A;  2ASP A;  3E1Y A;  4CJU A;  2O8D A;  3D2F A;  1YVN A;  1BDG A;  3IKM A;  1NOZ A;  3TAB A;  5CE3 A;  4JK7 A;  2HF3 A;  1KTQ A;  2HHQ A;  4C8K A;  4J2E A;  4BR2 A;  1BCO A;  3MXM A;  3HT3 A;  3IS9 A;  2XY5 A;  1NGG A;  4M3T A;  4HTU A;  1WSI A;  1TYQ A;  5HBM A;  1MWK A;  1TVR A;  4PWD A;  3ZX0 A;  4O44 A;  4DTR A;  1J54 A;  1VQ8 N;  1YJN N;  2GEM A;  4BG9 A;  4LFA K;  1WUA A;  2E2N A;  3TI0 A;  2P5G A;  4N47 A;  2NUB A;  1C0U A;  1WLJ A;  3KVG A;  4DQQ A;  4F4K A;  2IDO A;  3UKU A;  2OZM A;  1JXB A;  3AVL A;  5AQZ A;  1SL0 A;  4LF9 K;  2XO7 A;  4A61 A;  4AF1 A;  3K5N A;  4K8Z A;  3SAH A;  2OTJ N;  3SBT A;  2E6L A;  2BTF A;  3EZW A;  4LY7 A;  2Q0U A;  2VGN A;  4CI6 A;  1S9G A;  1XWL A;  3VQE A;  1BG3 A;  3N4Q A;  1NG9 A;  1J5O A;  5E26 A;  1YUW A;  4CK3 A;  3QEP A;  4NYN A;  4W5Q A;  4NXM K;  1OH8 A;  1HRH A;  4Q5V A;  4DS5 A;  2LSN A;  2O8B B;  5GAE P;  1NGH A;  4BRF A;  3OS1 A;  2RKI A;  2BH1 A;  4JKB A;  2W6K A;  5I3U A;  2AP1 A;  2Q0R A;  2YNI A;  3MXJ A;  3A5M C;  4CJK A;  4DFJ A;  1W9H A;  1SL1 A;  4E3S A;  2YNG A;  1BWF O;  2OPS A;  4OPA A;  1EO1 A;  5CYQ A;  4H5W A;  4FO0 A;  2HHH K;  2KHO A;  1NK5 A;  4B08 A;  4AHS A;  4LFB K;  2X6S A;  1DKG D;  4CGG A;  3B8A X;  2A40 A;  3K9K A;  4DMN A;  3PV8 A;  4NO7 A;  4CEZ A;  3CCL N;  3HOT A;  3ATU A;  3P39 A;  4G1Q A;  3ZEU A;  3ZET B;  5EU7 A;  3VQD A;  1IBK K;  2I7P A;  5HRP A;  3BZC A;  3HVT A;  4XH5 A;  3HSC A;  2IS3 A;  3MN7 A;  1J53 A;  3CI5 A;  4M45 A;  3VQ9 A;  1JCE A;  3GE1 A;  3OYH A;  3G10 A;  4B9V A;  2P9N B;  3CHW A;  4FLZ A;  2QWQ A;  3VA3 A;  1XI1 A;  4NCB A;  4AH9 A;  3BF1 A;  2VG7 A;  1VAZ A;  2OPP A;  4FZX C;  3U9Z A;  4RW4 A;  3EL2 A;  4MFB A;  3AAQ A;  1FXX A;  2GX9 A;  5J1E A;  4KTQ A;  2UXC K;  2E2Q A;  2FF3 B;  5CYM A;  4BVO A;  4JKE A;  5AQJ A;  5HL7 L;  2PYJ A;  4JI0 K;  3RSE A;  3CC4 N;  1ILY A;  4H5N A;  4IDK A;  5F0X A;  5GIO A;  1LV5 A;  3PX6 A;  3T1A A;  4MLE A;  4J2A A;  4DV7 K;  4EZ9 A;  4KHU A;  4YOX A;  3MEE A;  4Q0B A;  4YY3 K;  5C15 A;  4DV3 K;  4DF4 A;  1IBM K;  2HHT A;  1JKH A;  1UWB A;  3O9U A;  4ID1 A;  1JLG A;  5AQM A;  3CQY A;  1DEJ A;  3VQ6 A;  3O3G A;  4NCG A;  2ZJP L;  3J7Z O;  4DR1 K;  2YNH A;  1VRT A;  1HJO A;  1JLC A;  4ILJ A;  4BC4 A;  2W6L A;  3NE6 A;  2P9L B;  2WUS A;  4DV6 K;  4JD2 A;  4CZK A;  4DR4 K;  1MWM A;  3NDK A;  4XH4 A;  1YHQ N;  1ASV A;  4BR5 A;  5I9E B;  1DTT A;  3DXM B;  4BDZ A;  5AZJ B;  1FK9 A;  3O1W A;  3CM6 A;  5C12 A;  1RBT A;  3MK6 A;  1XC9 A;  2HBK A;  3WEE B;  3UIQ A;  5AQI A;  3DRP A;  1IKY A;  3ZSZ A;  4DHY A;  5HRS A;  3E9O A;  3BEX A;  4JKA A;  4M7Y A;  4BRC A;  4HCC A;  1Z26 A;  1KQS M;  2HHX A;  3IUC A;  5HP1 A;  1WB9 A;  3RWU A;  1S1X A;  1TGO A;  1KAX A;  3O4Q A;  4CJL A;  3OYI A;  1JCF A;  1GLD G;  4UY8 O;  1XUP O;  3DLG A;  2D5R A;  3ZT0 A;  4F2R A;  2DTU A;  2FSN A;  3KWI A;  3ZX3 A;  1RBS A;  4OKK A;  4K0K K;  4CEQ A;  2Z1J A;  3RRH A;  2G8V A;  1QZ6 A;  3FFI A;  3ZYY X;  4H0P A;  5JMV A;  2E4L A;  1ZBL A;  4AHR A;  5EY4 A;  4W5N A;  3DM2 A;  2GTD A;  4JNE A;  2DFE A;  1WBD A;  5AQU A;  1NJZ A;  2B6A A;  4IKF A;  3V81 A;  3FZK A;  3P31 A;  4CIE A;  2Q36 A;  2BGG A;  4L3Q A;  3AVH A;  3LAK A;  4J8F A;  3H6E A;  4E7J A;  4JRP A;  3OYN A;  1JL2 A;  2J4R A;  4B1V A;  4AM6 A;  3U3Y A;  3QIO A;  1VQN N;  5E41 A;  3BF3 A;  1L3V A;  4JKC A;  4KBO A;  3TSP A;  5F2R A;  4BRQ A;  2FSK A;  1RDB A;  3HPO A;  5KRS A;  3RTV A;  1NJI O;  1Q18 A;  3SZ2 A;  1JL1 A;  1NGD A;  5AQL A;  3A8Y A;  1VSH A;  4LF7 K;  3QER A;  3KK7 A;  3DOL A;  4M7X A;  4OGC A;  2OA8 A;  4E89 A;  3AAP A;  2JWL A;  2NRV A;  5BPM A;  3EE9 A;  1KC8 O;  3JXU A;  5DM7 L;  5M1K A;  1Y64 A;  3FZH A;  4BGB A;  4YOY A;  3JAM O;  3J7Y P;  2WTU A;  5BRE A;  2YHY A;  1IG8 A;  3TSQ A;  1GOA A;  4BQL A;  3I0S A;  2BAN A;  4B9T A;  2PFU A;  3PO4 A;  1XMO K;  1IH7 A;  1FJG K;  5HRR A;  4CK2 A;  2IIR A;  2V7Z A;  2HBJ A;  1KAY A;  1ATS A;  2ASM A;  2E20 A;  5M1N A;  4FPA A;  2OYQ A;  1B92 A;  2P9N A;  1KVC A;  2NRH A;  4B3M K;  1TKD A;  2IOC A;  1HYZ A;  3DLR A;  3DLL L;  4C8L A;  1VQM N;  4ZTJ A;  3WT0 A;  3QBX A;  3AGK A;  3IG1 A;  4I7F A;  4FLW A;  3IFR A;  5C0Y A;  3G25 A;  4FJG A;  3R8E A;  3CMA N;  2E1Z A;  4YOV A;  1UAX A;  3C94 A;  4BC2 A;  1GLB G;  4JRQ A;  3A0I X;  3VTI A;  4DQR A;  5BPL A;  4CBX A;  4Z4H A;  4OO1 J;  2KW4 A;  1L3S A;  4CIF A;  3M8Q A;  1NU0 A;  4W5O A;  4KH6 A;  3QFU A;  4BVP A;  5FRN A;  5B8H A;  5C2F A;  1CZA N;  4PQU A;  3QIC A;  3LPU A;  2FBV A;  3D2E A;  3SMP A;  2RN2 A;  2NLX A;  3L8B A;  5BR8 K;  5FPD A;  3SAF A;  4ZHR A;  3BY5 A;  1RT5 A;  4JN4 A;  4DU3 A;  2RHK A;  4N5S A;  1X3M A;  3EE8 A;  1TYQ B;  4OKJ A;  4F9O A;  1NK4 A;  3QEV A;  1N5Y A;  3VEO A;  4R79 A;  4YOR A;  1I94 K;  4DFP A;  1NGB A;  1QHA A;  4FJK A;  1S1W A;  3I0R A;  5E84 A;  4C8N A;  1S9E A;  3DXM A;  3NAE A;  4K8X A;  4M3Z A;  1K9M O;  4JI3 K;  2O8F B;  3HO1 A;  1HNW K;  2RF2 A;  4CHO A;  3CC2 N;  5AQT A;  1HKG A;  2NRR A;  1KRP A;  3CCJ N;  4DKW A;  3OYL A;  1VQ9 N;  2YCH A;  5AFU H;  5FPM A;  5JVH L;  1HMV A;  3V9X A;  3C6A A;  2P1J A;  2VCP A;  5ADX A;  4E7K A;  4KO0 A;  3WXJ A;  1Z25 A;  4BDY A;  1X9M A;  2ZWH A;  3VF2 A;  3BUZ B;  5J2P A;  1RNH A;  4JK8 A;  3LM9 A;  1VSF A;  1LWF A;  3ITH A;  3S3N A;  4PY5 A;  1NKC A;  3DMJ A;  3TAN A;  4A59 A;  4G9Z A;  4OKE A;  3OYF A;  4FSV A;  3T7Z A;  4B8C A;  3CJC A;  3U6F A;  4ELT A;  3DLK A;  1RT7 A;  1RBU A;  5M1Q A;  4DLG A; 
#chains in the Genus database with same CATH homology
 3LAM A;  3ZSY A;  3LP1 A;  4R5P A;  1NOZ A;  4GMJ B;  4CEO A;  3CQ8 A;  1QS4 A;  3TAB A;  1KTQ A;  4DTO A;  2HHQ A;  3KTQ A;  2XY8 A;  4O0J A;  4C8K A;  3V9U A;  4CHZ A;  1BCO A;  4J2E A;  3OYK A;  3HT3 A;  1RBR A;  3IS9 A;  2XY5 A;  3MXM A;  4M3T A;  3KKS A;  1RT2 A;  4HTU A;  1WSI A;  3MEG A;  3RMA A;  2PZS A;  2JLE A;  5HBM A;  1TVR A;  4PWD A;  3TAM A;  4DTP A;  3HL8 A;  4M3W A;  4O44 A;  4DTR A;  1J54 A;  3NF9 A;  2X6N A;  2GV9 A;  4DG1 A;  3DRS A;  4CJQ A;  1C1A A;  2BE2 A;  2HHV A;  3V1R A;  3S3M A;  1B9D A;  4BDP A;  4CJP A;  5T7B A;  5FRM A;  4CF9 A;  2G8I A;  1BIU A;  3DYA A;  3TI0 A;  4JLH A;  4CEB A;  2P5G A;  4N47 A;  2NUB A;  3BGR A;  1C0U A;  1RT4 A;  1WLJ A;  4EP5 A;  4DQQ A;  1NKB A;  3CG7 A;  4DTU A;  2IDO A;  3VQ5 A;  3O3F A;  3OYE A;  3V9Z A;  3KLG A;  4N76 A;  4NCA A;  3NH0 A;  4FK2 A;  2OZM A;  1BL3 A;  4KTZ A;  3HYF A;  1JXB A;  3AVL A;  4M42 A;  2QKB A;  3DLH A;  2OZS A;  1SL0 A;  2XO7 A;  4PUO A;  1YVU A;  1EX4 A;  2B5J A;  3F9K A;  4CF0 A;  3K59 A;  1XHX A;  1TV6 A;  1C0T A;  2EHG A;  3K5N A;  1IG9 A;  3OYM A;  4K8Z A;  3VQP A;  3SNN A;  3H08 A;  3T19 A;  2A1R A;  3SUQ A;  2E6L A;  4M3Y A;  3CM5 A;  4AIL C;  1C1B A;  1BHL A;  4M3R A;  4LY7 A;  3K58 A;  3F73 A;  4J2D A;  1NK8 A;  1S9G A;  1ZBI A;  2ZE2 A;  1XWL A;  3T3F A;  4CFC A;  1TK5 A;  3VQE A;  4DU1 A;  3PX0 A;  4I9L A;  1BIS A;  3LWM A;  4OPK A;  4F3O A;  1J5O A;  4DS4 A;  3SPY A;  4CK3 A;  3AVJ A;  3QEP A;  4E19 A;  4FK0 A;  1RDC A;  4NYN A;  4W5Q A;  2OPR A;  4FZZ A;  3L3V A;  4CGD A;  4RW7 A;  3KK2 A;  3D0P A;  3HPG A;  3VQ8 A;  1HRH A;  4Q5V A;  4DS5 A;  2LSN A;  4DTN A;  4DSF A;  1MU2 A;  1CLQ A;  4FM2 A;  4ZTF A;  2DY4 A;  3OS1 A;  2RKI A;  3K5L A;  4QOZ B;  3WNH A;  1TAQ A;  4CER A;  5I3U A;  4QCL A;  2YNI A;  3MXJ A;  3D45 A;  4CJK A;  4DFJ A;  1W9H A;  2FBT A;  1WSH A;  4CGI A;  1I39 A;  1SL1 A;  4E3S A;  2FBY A;  5KI6 A;  3LP3 A;  3SI6 A;  2YNG A;  4I9Q A;  4RW9 A;  2OPS A;  3K5M A;  3KJV A;  3RMB A;  1HNV A;  5CYQ A;  3HM9 A;  2Z1H A;  1DTQ A;  3SQ0 A;  4CK1 A;  4FCY A;  1NK5 A;  4B08 A;  4AHS A;  4DWI A;  2X6S A;  2ZQB A;  1RT1 A;  1ZBU A;  1QTM A;  4LSN A;  4CJT A;  2R7Y A;  2F96 A;  3AO1 A;  4LH4 A;  4CGG A;  4B9N A;  1BI4 B;  1S6P A;  1RCH A;  4DMN A;  3ZSO A;  3PV8 A;  4CEZ A;  4CGH A;  3DLE A;  5C42 A;  3LWL A;  4FLT A;  3VQA A;  4KAZ A;  4FZY A;  3TAF A;  4G1Q A;  4LH5 A;  2HND A;  3AO3 A;  3TAQ A;  4E7H A;  4DTJ A;  3CFR A;  2Z1G A;  2B4J A;  1TKT A;  2FC0 A;  4LSL A;  5EU7 A;  3VQD A;  3ZSX A;  3ZT4 A;  4E7I A;  4XIU A;  3VQC A;  2YNF A;  4UQG A;  4FJH A;  5HRP A;  2D0A A;  1U45 A;  4B9S A;  3MXI A;  1NOY A;  3HVT A;  3O3H A;  2QKK A;  3C6T A;  2HHU A;  4HUF A;  2IS3 A;  2F8S A;  3HP9 A;  1WSJ A;  4KFB A;  3AVM A;  1R0A A;  2A1S A;  1J53 A;  2Y1J A;  4FJJ A;  4M45 A;  5FRO A;  3VQ9 A;  3MEC A;  3LZI A;  3OYH A;  4B9V A;  3G10 A;  1HQU A;  1GOC A;  2IC3 A;  3A2F A;  4FLZ A;  3VA3 A;  1JLQ A;  4ID5 A;  1XI1 A;  4OLB A;  1WN7 A;  1X1P A;  4B8A B;  4M3X A;  3SV4 A;  2HVH A;  4IBN A;  4CGJ A;  3WNG A;  1RTI A;  4KRF A;  3ZT1 A;  1KSP A;  4NCB A;  2KFN A;  4AH9 A;  4RG8 A;  1BIZ A;  1WNS A;  3AA5 X;  1RBV A;  2VG7 A;  1U4B A;  2OPP A;  1KVA A;  4HCB A;  3ZT3 A;  2XY6 A;  4FZX C;  4Z4C A;  4RW4 A;  3ASM A;  4MFB A;  4KPY A;  1FXX A;  5I42 A;  5J1E A;  4KTQ A;  1S1V A;  4CHP A;  4DF8 A;  4CJF A;  4FK4 A;  5CYM A;  2PY5 A;  3RR8 A;  3AO5 A;  4FJI A;  3NGY A;  4O4G A;  3SUN A;  1IKV A;  4E1M A;  2PYJ A;  1SV5 A;  4IDK A;  1LV5 A;  1TKZ A;  1ZBF A;  5C24 A;  3OY9 A;  3T1A A;  3PX6 A;  3BDP A;  2IAJ A;  4E1N A;  4EZ9 A;  4J2A A;  1L3U A;  1LWC A;  3MEE A;  4Q0B A;  5JS1 A;  3RRG A;  1QQC A;  2D0C A;  4OLA A;  3OYG A;  3OJS A;  3JYT A;  4DF4 A;  1NJY A;  1WSF A;  2BDP A;  4DFK A;  3LAL A;  3VQ4 A;  2HHT A;  4KV8 A;  1WSE A;  1A5V A;  4KI4 A;  1CXQ A;  3AA4 A;  1JKH A;  1UWB A;  4FLY A;  4ID1 A;  2KQ2 A;  3AA3 A;  3LZJ A;  1BGX T;  2Q3S A;  1JLG A;  3VQ6 A;  1K6Y A;  3O3G A;  4NCG A;  3AVB A;  4CJS A;  3P83 D;  3G0Z A;  2X74 A;  2YNH A;  5HRO A;  1SKW A;  1VRT A;  1CZ9 A;  3AVA A;  3IAY A;  3QES A;  2XY7 A;  1JLC A;  1UOC A;  3IRX A;  1LWE A;  1LW2 A;  3KK3 A;  3M8S A;  3NE6 A;  1HYS A;  3L2U A;  3JSM A;  5D3G A;  4W5R A;  3NDK A;  4KTW A;  1BCM A;  1VSL A;  2VG5 A;  3QNO A;  1ASV A;  4BDZ A;  1Q8I A;  1DTT A;  1U47 A;  1FK9 A;  3ZSQ A;  5C25 A;  1TL3 A;  3CM6 A;  4QAG A;  1U48 A;  3EY1 A;  1LW0 A;  3B6P A;  3AVC A;  4O55 A;  3AVG A;  1RBT A;  4CEA A;  3NGZ A;  1NJX A;  1X9W A;  1XC9 A;  1TK8 A;  1YTA A;  3K2P A;  3SQ2 A;  1L3T A;  3K5O A;  2HNY A;  1F21 A;  4CFD A;  4MQ3 A;  1KFD A;  3UIQ A;  4CED A;  1ASW A;  3DRP A;  4AHC A;  1IKY A;  3ZSZ A;  1Q9X A;  5HRS A;  2DFF A;  1RT3 A;  1O1W A;  1ASU A;  3VA0 A;  3HPH A;  2GBZ A;  3OVN A;  5J2N A;  3QIN A;  4DQI A;  4HCC A;  1Z26 A;  2VWK A;  2ZD1 A;  2HHX A;  4CFA A;  3L2Q A;  5HP1 A;  4FW1 A;  3MAQ A;  1SKS A;  3RWU A;  3OYA A;  2VWJ A;  3QNN A;  1BQN A;  1QE1 A;  1S1X A;  3AVI A;  1T05 A;  1NK6 A;  4FJ7 A;  2HW3 A;  1TGO A;  3LPT A;  3HP6 A;  1D9D A;  3O4Q A;  4CHY A;  4CJL A;  3CFO A;  3OYI A;  5CZ2 A;  3OYC A;  1N6Q A;  2YHB A;  4AHV A;  4EZ6 A;  4KI6 A;  3DLG A;  3LP0 A;  4CEF A;  4BE2 A;  2D5R A;  3V4I A;  3ZT0 A;  1VK0 A;  4F2R A;  4WE1 A;  2DTU A;  5JS2 A;  3SJJ A;  5K14 A;  1L5U A;  2EX3 A;  4FM0 A;  1RBS A;  1ZBH A;  4KHY A;  4OKK A;  1JLF A;  4B9U A;  1X9S A;  4CEQ A;  1RTH A;  2Z1J A;  3RRH A;  4BAC A;  3NF8 A;  1D8Y A;  2G8V A;  1VSM A;  3QLH A;  5HRN A;  3FFI A;  1KFS A;  2PYL A;  4E0D A;  3U3G A;  4B3O A;  4FJX A;  2O4I A;  2WON A;  2E4L A;  1ZBL A;  4AHR A;  4CIG A;  3TAR A;  3DRR A;  3C95 A;  1NK0 A;  1SKR A;  4KB1 A;  4W5N A;  2RPI A;  3DM2 A;  1S5J A;  4CES A;  2DFE A;  3M8R A;  3SUP A;  2E6M A;  1CXU A;  4DQP A;  4IG0 A;  3OS2 A;  4FLU A;  4Z4I A;  4DTS A;  1NJZ A;  1VSJ A;  2B6A A;  4IKF A;  2KZZ A;  1HNI A;  3E01 A;  3KKR A;  3ZSR A;  4DU4 A;  3V81 A;  1FKO A;  3M8P A;  4Z0U A;  4IG3 A;  4HHT A;  3V1O A;  1IKW A;  3KD1 E;  1REV A;  2HB5 A;  1J9A A;  2WOM A;  3DOK A;  3ALY A;  3KIO A;  1RIL A;  4CIE A;  3OJU A;  4FJ5 A;  2BGG A;  1KLM A;  3AVN A;  4C8M A;  1WAF A;  3AVH A;  3LAK A;  4CJW A;  4E7J A;  3PX4 A;  2X78 A;  4ICL A;  4JRP A;  3V6D A;  1FKP A;  2O4G A;  4CJ5 A;  3OYN A;  3NBP A;  4OPJ A;  1TKX A;  1ZYQ A;  1JL2 A;  4YFU A;  4J2B A;  3PUF A;  4KRE A;  3VN5 A;  4AHT A;  3OYB A;  3U3Y A;  3QIO A;  3NHG A;  1NK9 A;  1KVB A;  3NGI A;  5E41 A;  1L3V A;  5J2Q A;  2HHS A;  4CJE A;  3HPO A;  1RDB A;  3EZ5 A;  5KRS A;  3EYZ A;  3RTV A;  3QO9 A;  4CF1 A;  4H8K A;  1QSL A;  2I5J A;  5KTQ A;  3SZ2 A;  4DSL A;  2G8U A;  1T03 A;  2FBX A;  3KLF A;  1JL1 A;  3ZSW A;  3ULD A;  3L2R A;  1I3A A;  4I2Q A;  2KFZ A;  2HHW A;  1VSH A;  2HNZ A;  1C1C A;  3QER A;  4I2P A;  3DOL A;  2KTQ A;  4OGC A;  2OA8 A;  2OPQ A;  4E89 A;  3LP2 A;  1C0M A;  4FJM A;  4KHW A;  2Y1I A;  1VRU A;  3QEW A;  3VQQ A;  4ELV A;  1KCF A;  1RDA A;  4LD0 A;  4FW2 A;  4FYD A;  2F8T A;  4YNQ A;  3QET A;  4BWM A;  4RW6 A;  1SL2 A;  4Z4G A;  3THV A;  4HUG A;  2ITG A;  1GOA A;  3O4N A;  1SUQ A;  3I0S A;  2BAN A;  4B9T A;  3V9W A;  4KHQ A;  3PO4 A;  1VSE A;  1LAV A;  4EP4 A;  3L2W A;  1IH7 A;  3PY8 A;  1RTD A;  5HRR A;  3OYD A;  4CK2 A;  1WAJ A;  3TWH A;  5HLF A;  4CJR A;  4DQS A;  4BWJ A;  3SCX A;  3L2V A;  4O0I A;  1UA0 A;  1RT6 A;  3SUO A;  1U49 A;  1B9F A;  1NK7 A;  1YTU A;  4B9L A;  3CFP A;  1A5X A;  4IFY A;  2P5O A;  3LAN A;  3HJF A;  1JLE A;  3SV3 A;  4GW6 A;  2OYQ A;  4W5T A;  3ZCM A;  1B92 A;  3TAG A;  5DK5 A;  4FJ9 A;  1HQE A;  1KVC A;  2Z1I A;  3TR8 A;  4BE0 A;  4H4O A;  1VSI A;  2JGU A;  3KD5 E;  1TKD A;  4KHN A;  4Z4F A;  2IOC A;  1VSD A;  1HJR A;  2HMI A;  3MED A;  1TAU A;  3DLR A;  1HYZ A;  4C8L A;  4HUE A;  3AO4 A;  4ZTJ A;  4CFB A;  3NH1 A;  1Q9Y A;  3IG1 A;  4FJL A;  3NF7 A;  4I7F A;  4FLW A;  4C8O A;  1YT3 A;  1S6Q A;  1VSK A;  3QIP A;  2DFH A;  4FJG A;  1D9F A;  2YHA A;  4JS4 A;  3TAP A;  4DLE A;  2G8W A;  1UAX A;  3C94 A;  1JLB A;  4CHN A;  4JRQ A;  5SZT A;  4CHQ A;  4DQR A;  1IKX A;  3NFA A;  4Z4H A;  2KW4 A;  4OJR A;  4OGE A;  3SYZ A;  4E7L A;  3K57 A;  4H4M A;  1L3S A;  4CIF A;  3M8Q A;  4O5B A;  3V1Q A;  5SWM A;  3LDS A;  4W5O A;  3ZSV A;  2YKN A;  4M41 A;  3AA2 A;  1CZB A;  4TSX A;  4CCH A;  5CZ1 A;  5FRN A;  1EET A;  2IGI A;  4DTX A;  3VQ7 A;  4NYF A;  4BE1 A;  1T7P A;  1HYV A;  1S1U A;  3I8D A;  3RMC A;  3SQ1 A;  4PQU A;  3LPU A;  4JS5 A;  4FM1 A;  4M3U A;  4KKO A;  1Y97 A;  3OS0 A;  4GVM A;  2FBV A;  1D5A A;  4KHS A;  3CYM A;  3NCI A;  3S9H A;  4F8R A;  2G8F A;  2RN2 A;  3NF6 A;  3L8B A;  4DSK A;  3L3U A;  4L8R B;  1QSS A;  3VQB A;  4ZHR A;  2XHB A;  1RT5 A;  4CGF A;  3HST B;  4DU3 A;  4HVJ A;  1XHZ A;  3AVF A;  4F3T A;  1A5W A;  4N5S A;  5CY4 A;  3P5J A;  3KK1 A;  3HVR A;  4OKJ A;  3AO2 A;  1NK4 A;  3QEV A;  4FVM A;  3QEI A;  3TAE A;  1N5Y A;  3QEX A;  4ELU A;  3WNF A;  1ITG A;  4DSJ A;  3PO5 A;  3OYJ A;  4DFP A;  4CEC A;  4F2S A;  1QSY A;  4B9M A;  4FJK A;  3C6U A;  4FXD A;  4PA1 A;  4CF2 A;  4KHU A;  5J2M A;  1LAW A;  1JXE A;  1S1W A;  1RDD A;  3I0R A;  4CJ4 A;  2QXF A;  1S9E A;  4C8N A;  3NAE A;  5KRT A;  4K8X A;  4FJ8 A;  1UA1 A;  4M3Z A;  4Z4E A;  3HXM A;  2YKM A;  4FJN A;  3DI6 A;  1RTJ A;  1BQM A;  4N41 A;  1T8E A;  3HO1 A;  4DFM A;  4FLV A;  2ETJ A;  1BI4 A;  2D0B A;  3SQ4 A;  1TL1 A;  4KB0 A;  2RF2 A;  2XRI A;  4Y1D A;  4CJ3 A;  4CHO A;  1KRP A;  4CF8 A;  5KGW A;  3OYL A;  4N56 A;  1TK0 A;  4IFV A;  3RMD A;  2HVI A;  2YV0 X;  3WNE A;  1DLO A;  1S1T A;  1HMV A;  4OVL A;  3V9X A;  3ZT2 A;  4RW8 A;  4CE9 A;  4DSE A;  1EKE A;  2GUI A;  1GOB A;  4F4K A;  2P1J A;  2KZM A;  4FLX A;  3V9S A;  3AV9 A;  4E7K A;  1KLN A;  3B6O A;  1JLA A;  3KLH A;  3KLI A;  2ATQ A;  1G15 A;  5DMR A;  4KO0 A;  1EXQ A;  1QHT A;  1Z25 A;  4BDY A;  2AJQ A;  1X9M A;  1HPZ A;  1IO2 A;  4Y1C A;  3S3O A;  4CEE A;  5J2P A;  3DLB A;  1RNH A;  3AVK A;  1EP4 A;  3KLE A;  4CJV A;  1VSF A;  3ISN C;  1LWF A;  2P51 A;  3ITH A;  3SPZ A;  3NH2 A;  1NKE A;  3S3N A;  4PY5 A;  1NKC A;  1U04 A;  3DMJ A;  3TAN A;  1W0H A;  2QK9 A;  2G8H A;  4OKE A;  4DSI A;  1NJW A;  1C6V A;  1WSG A;  3OYF A;  3HK2 A;  4B8C A;  5KGX A;  3RR7 A;  3P1G A;  5FDL A;  4AHU A;  4DTM A;  4CJU A;  2VG6 A;  3U6F A;  4ELT A;  2G8K A;  3DLK A;  1RT7 A;  1RBU A;  2W42 A;  4DLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...