3ZSZA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zszA00
3LWLA 3MXMA 3RRHA 3VQ4A 5CY4A 3ZT0A 2HNZA 4AILC 3L8BA 3SPZA 3VA3A 3SZ2A 3SYZA 2P5GA 4FJKA 1KSPA 4DSLA 3LZJA 4M3TA 5EU7A 4CEEA 1IO2A 1SUQA 2FBTA 3NHGA 1F21A 3RR7A 1G15A 3K2PA 4H8KA 4EP4A 3AVGA 1KVCA 2FBXA 1NJXA 4CGJA 3L2RA 1BISA 1ZBFA 4FLTA 2QKBA 3D0PA 4OGEA 4DSEA 1U45A 2NUBA 3QESA 3CFOA 1C0UA 2B4JA 1N5YA 4K8XA 1X9SA 1A5VA 3V1QA 5JS1A 4CHOA 1Q8IA 3OYHA 4CEBA 4CJ4A 2O4IA 3KLFA 3LPTA 3PY8A 1U4BA 4NYFA 1REVA 3L2UA 2KFNA 4OPJA 3WNGA 1JL1A 1QS4A 3QEXA 1BQMA 3NBPA 3VQ8A 3NCIA 3T19A 3BGRA 4O5BA 3UIQA 2VG7A 4KHYA 4F2SA 4GMJB 4FZZA 3L2QA 3SUQA 3HL8A 1RDDA 3LP0A 3NF8A 3TAMA 4CEOA 1XHZA 3MECA 1NJZA 4CJTA 1I39A 1JKHA 2G8VA 3HO1A 1U04A 4CIFA 4I9QA 1VSMA 1CXQA 4RW4A 4DU3A 1XI1A 1C1AA 4DU4A 1QHTA 2GBZA 2FBVA 2YNGA 3A2FA 2PYLA 3AVMA 1ZBIA 4CJKA 1ITGA 1TAQA 2YKMA 3DMJA 1RTJA 4OVLA 5J2QA 3SQ2A 1UA1A 1B92A 4B9SA 4Z4FA 1RTIA 3NAEA 4ZHRA 4BDYA 2YKNA 1IKVA 3HYFA 1WSIA 3CFRA 1QSSA 3V1RA 1Z25A 2YHAA 4CJSA 1TV6A 3K5LA 4FW2A 5J2MA 2HHSA 3IAYA 2ZE2A 1Q9XA 3AVJA 1FKOA 2HHXA 2HVHA 1FXXA 2YNHA 2KFZA 2G8WA 3RMDA 3QIPA 4RW6A 3AVFA 3AVBA 2A1RA 1ZBLA 3ZT4A 1JXEA 1S1VA 1RT1A 3U3GA 5SWMA 3D45A 3KK1A 2KTQA 3I8DA 3I0RA 4M3YA 3L3UA 4CJFA 4KREA 1JLQA 2PZSA 3AVIA 2XHBA 4KI6A 1NK0A 1VSHA 3M8PA 2YV0X 1KLNA 2G8IA 4DF8A 4FJ7A 3G0ZA 1BCMA 4DTJA 1JLFA 4DTUA 3CQ8A 3DYAA 4M45A 4CEDA 2ZD1A 3DM2A 4Z4HA 4FLXA 1ASVA 1JLAA 1BHLA 5J1EA 2HVIA 4Z4IA 4DFKA 3HP9A 4B8AB 4NCBA 3LZIA 2HHVA 3G10A 3LDSA 2HNDA 3KKRA 1CZBA 4PA1A 4BWMA 3DI6A 4CIGA 4LH5A 3HM9A 4FYDA 3O3FA 4DF4A 4I7FA 2DTUA 4ELTA 3CM6A 3LWMA 3QEIA 4FJNA 3C6UA 4W5TA 2GV9A 1T8EA 1NK5A 2P5OA 4QOZB 4KKOA 4BDZA 4OKEA 3B6OA 4FLWA 3SPYA 1Q9YA 3VQ9A 3SUOA 2YHBA 4B08A 4F3OA 4Z0UA 3OYIA 2E6MA 4TSXA 4DS4A 3AA3A 3P1GA 4CE9A 1WSEA 4J2DA 1CZ9A 2D0AA 4CHQA 3F73A 1RTHA 1UAXA 4CJVA 1LWFA 4IFVA 4Q0BA 4CEZA 3ZT3A 4ZTJA 4KI4A 4WE1A 3S9HA 3BDPA 1J53A 3OJUA 2Y1JA 1RTDA 3LAMA 2OPRA 4KO0A 4JS4A 1NOYA 3VQPA 4IKFA 1WAFA 1S1TA 1YT3A 2F8TA 3NF6A 2HHTA 1X9MA 3SQ4A 3RMBA 5DMRA 4HHTA 4GW6A 3SJJA 3DRSA 1TAUA 2O4GA 1C6VA 4Y1DA 4DQPA 1D5AA 3IRXA 1NKEA 3ITHA 4FW1A 4M3RA 4CF1A 4O0IA 4B9MA 1KLMA 1FK9A 1TL1A 2ATQA 1LAWA 3LPUA 3K5OA 4OGCA 3T1AA 4OPKA 3SI6A 4KTWA 4N76A 4DSFA 1QQCA 4BACA 4CF8A 3ZT2A 2D0CA 1X9WA 4BE2A 5DK5A 1RBTA 1HYVA 1S6PA 3TAFA 2D0BA 1S1XA 3O3HA 3OY9A 2ETJA 3MEGA 1C1BA 1UWBA 1L5UA 4N47A 2OYQA 3LP1A 1CXUA 2P51A 3NF9A 2JGUA 2EHGA 5D3GA 5C24A 1T05A 2HNYA 2I5JA 4AHUA 2BE2A 2HHUA 4N41A 2X6NA 1NKBA 1JXBA 1BCOA 3C94A 4B3OA 4FLUA 5HRNA 3P5JA 2OPPA 3QIOA 3TAQA 5FRNA 1S5JA 4M3ZA 3NFAA 2XY8A 4ID1A 2Z1GA 1VK0A 1HNVA 4I9LA 3VQDA 1JLEA 3QLHA 4CJQA 3QERA 1ZYQA 4KTZA 3HPGA 4B9TA 3V81A 4F3TA 4E7KA 1SKRA 1RCHA 3AVLA 3VQ6A 1JLBA 2VG6A 4W5OA 5C42A 4RW7A 1VSDA 1S9EA 1BIUA 4DLGA 3KKSA 4ICLA 1I3AA 4FM2A 3SCXA 3I0SA 4E0DA 5FDLA 3VN5A 2Z1IA 4HUGA 3V1OA 2R7YA 3DLGA 2FC0A 1VSEA 4O4GA 3EYZA 3V4IA 3AA5X 2OZSA 1J9AA 1HNIA 1VRTA 4R5PA 3RMAA 5I42A 1NK7A 1ZBHA 3NDKA 3OS1A 3TWHA 5E41A 1KFSA 2RPIA 4CK1A 3ALYA 3MAQA 4HTUA 2QKKA 2B6AA 3ZSZA 1UA0A 3LP2A 4HUEA 2DFHA 3V9UA 5HROA 2OZMA 2XRIA 4FJIA 1JLCA 3S3MA 2X78A 4KFBA 4DQRA 1HRHA 1X1PA 4CJ3A 1D9DA 4ELUA 4FXDA 3SV4A 1WSGA 3DOLA 4CFCA 3MEDA 4KHUA 1C1CA 3OJSA 1T03A 1TGOA 3WNEA 1IKWA 4FVMA 3ZCMA 4CGDA 2B5JA 2W42A 2WONA 4W5NA 1YVUA 3K59A 2AJQA 1EX4A 3AVNA 5T7BA 4E7HA 3SQ1A 4FJJA 3PO4A 3DLKA 3MEEA 1J5OA 1S9GA 1EKEA 1L3UA 1SV5A 4J2EA 4W5RA 2XY6A 3ZSYA 4HCBA 1LAVA 3JYTA 1IH7A 4DTOA 4L8RB 3OYDA 3NF7A 4CERA 1A5WA 3AO2A 2DFEA 1IG9A 4KB1A 1HYZA 1NJYA 3AVAA 5KRSA 2X74A 5HBMA 4CIEA 5HRPA 3SUNA 1KTQA 4CEAA 1DTTA 1DTQA 4QAGA 4PUOA 4O0JA 3HXMA 3KK3A 3TANA 3PUFA 1HJRA 1ASUA 4CHYA 3ZSWA 4DQSA 1N6QA 5I3UA 1WLJA 4G1QA 4DSKA 4PQUA 1RBUA 4NYNA 1XHXA 3OYLA 1KFDA 3KLIA 2RN2A 4JLHA 1B9FA 2HMIA 1RBSA 1YTAA 3L2VA 1W9HA 3VQ5A 3OYNA 4KB0A 1RT6A 4FLZA 2YNIA 1BI4B 4Z4CA 2IDOA 1GOAA 4CECA 4BE0A 1L3VA 4OLBA 1WSFA 4HUFA 3V9WA 2BGGA 2D5RA 3AO5A 4CHZA 1DLOA 2XO7A 3QO9A 1WAJA 4JRQA 3T3FA 1L3SA 4GVMA 4KV8A 3OS0A 3OYKA 1SKSA 4M3WA 3DRRA 3HVTA 3MXJA 1LW2A 3PO5A 4PY5A 4CJLA 3PX6A 3NGYA 3P83D 4C8NA 2G8UA 1EETA 3ULDA 4C8OA 4M3UA 4FJ9A 3K57A 2G8KA 3JSMA 3HK2A 5JS2A 5CYQA 1TK0A 3B6PA 1B9DA 1ZBUA 3OYGA 3K5MA 1TK5A 1LV5A 4F4KA 4K8ZA 1S1UA 4AHVA 2DY4A 4DQQA 1SL1A 1TKXA 1RT3A 3IS9A 1RT7A 4EP5A 2E4LA 4BE1A 3TR8A 2QXFA 1KVAA 2A1SA 3SNNA 1CLQA 2KZZA 3IG1A 3ZSQA 2FBYA 4DTPA 4O44A 3O4QA 3RTVA 3OYAA 3HPHA 1L3TA 3CM5A 1BQNA 3ZSXA 2IAJA 4KPYA 4QCLA 4DTRA 4M41A 1VSLA 3VA0A 5CYMA 4DLEA 3LANA 3AA2A 2IS3A 2YNFA 2G8HA 4CJWA 3HT3A 3O3GA 5KI6A 4FZYA 5FRMA 4FJ8A 1GOCA 2X6SA 5HRRA 4FM1A 4FLVA 1RDAA 3OVNA 2PY5A 4DU1A 3KD5E 3L2WA 3AO3A 3OYMA 3VQQA 4E89A 3AV9A 3ASMA 5FROA 4E7IA 3RMCA 4IDKA 3C95A 1Z26A 3TAGA 2ZQBA 1TK8A 4E7LA 1WN7A 4N56A 2XY5A 1Y97A 2VWJA 4E19A 4O55A 3AO1A 1NK9A 1RBRA 3C6TA 3S3OA 3THVA 4RG8A 4I2QA 4RW9A 1A5XA 1C0TA 4B9NA 4FLYA 4YNQA 3ZSRA 4KRFA 5SZTA 3KJVA 3KLGA 3FFIA 4CFAA 3DLEA 3KLHA 4EZ9A 4M3XA 4I2PA 5KGXA 2RKIA 3NE6A 3TI0A 3ZT1A 3M8SA 3SV3A 2WOMA 3VQCA 4CGHA 5HRSA 4DFMA 4KTQA 1W0HA 4JS5A 4CGFA 1U49A 3VQAA 4Z4EA 3V9XA 1RT4A 2IGIA 3ZSOA 4RW8A 3K58A 4UQGA 1RDBA 1NK8A 1U48A 4HVJA 1IKYA 1YTUA 3OS2A 3RR8A 4DTXA 4DFJA 4DS5A 1S1WA 2HHWA 2GUIA 1WNSA 1EP4A 4FK0A 3M8RA 3H08A 4CFDA 4CEFA 3QNNA 2KZMA 1RNHA 4CF2A 1WSHA 2P1JA 1QSYA 1BI4A 3DLHA 1T7PA 1KCFA 1SL2A 4CHNA 4JRPA 3K5NA 3OYJA 4OKJA 2Z1JA 3E01A 4IBNA 4LY7A 3QEWA 1TKDA 3RRGA 4FZXC 1NJWA 3V9ZA 4DFPA 5HLFA 4DTMA 3VQBA 1JLGA 3DLRA 4MQ3A 4CF9A 4C8KA 4CEQA 2JLEA 2OPSA 2KW4A 4FJLA 4FK2A 2RF2A 2EX3A 2DFFA 4CESA 4Z4GA 4E7JA 2HHQA 1QTMA 1KRPA 4Q5VA 3CYMA 2OPQA 3SQ0A 3TAPA 1WSJA 3S3NA 3DOKA 1HMVA 3LAKA 1HPZA 4DG1A 3PV8A 5J2NA 5J2PA 4DTSA 4ZTFA 3NH0A 4B9UA 4ID5A 3HJFA 4B9LA 1O1WA 5C25A 3MXIA 4CK2A 3EZ5A 1R0AA 4KHNA 5KGWA 4OLAA 1J54A 3QETA 2HW3A 3M8QA 1VRUA 4Y1CA 1TL3A 3AO4A 3OYFA 3OYEA 1RILA 4KHQA 1SKWA 4F8RA 3DRPA 3OYBA 4FJXA 1JL2A 4LSLA 4B8CA 1XC9A 1D8YA 2PYJA 2VG5A 3EY1A 3O4NA 1GOBA 4MFBA 3WNFA 2Y1IA 4E1NA 1D9FA 3AVHA 1VSIA 3V6DA 4CK3A 3QEVA 4E3SA 3AVCA 4DQIA 4J2BA 4DTNA 3VQEA 1BGXT 3CFPA 3AVKA 3KK2A 1BL3A 3L3VA 4AH9A 4CJPA 3TAEA 3QINA 4BDPA 4W5QA 3VQ7A 4PWDA 1LWCA 1C0MA 1NOZA 1KVBA 4LH4A 1QE1A 4OJRA 4CJ5A 4E1MA 4YFUA 3NH1A 2OA8A 4IFYA 4KAZA 4DSIA 4FJGA 3RWUA 1VSFA 4CCHA 4KHSA 4FK4A 5KRTA 3TARA 3DLBA 4IG3A 4EZ6A 1VSKA 1FKPA 1S6QA 3ISNC 2F8SA 1XWLA 4FM0A 1HYSA 3AA4A 3HSTB 3HVRA 2IOCA 2LSNA 3HPOA 4LSNA 5K14A 2BDPA 1ASWA 4NCGA 2BANA 3WNHA 2IC3A 5KTQA 3KLEA 3QNOA 4CJRA 4OKKA 4AHSA 4C8LA 1NK6A 4KHWA 1RT5A 5CZ2A 1HQEA 4BWJA 1TKTA 1RBVA 2Z1HA 4CJUA 1QSLA 4CF0A 1NK4A 5CZ1A 1VSJA 4CGIA 1EXQA 3U3YA 3QEPA 4CFBA 1NKCA 4FJHA 4IG0A 4XIUA 3PX4A 2XY7A 4AHRA 1TVRA 1LWEA 4C8MA 3SUPA 2G8FA 4FJ5A 4ELVA 3HP6A 1RT2A 4AHCA 1U47A 3KTQA 1BIZA 4HCCA 4H4OA 3NGZA 4LD0A 3ZSVA 3OYCA 1MU2A 3KD1E 3CG7A 4N5SA 4DSJA 4NCAA 2HB5A 3LP3A 4AHTA 1SL0A 1TKZA 4F2RA 2E6LA 1UOCA 4H4MA 3LALA 4CJEA 4DMNA 1IKXA 1HQUA 1RDCA 2Q3SA 3F9KA 3V9SA 4CGGA 1K6YA 2ITGA 4FJMA 4CHPA 4M42A 3TABA 2QK9A 3NH2A 3NGIA 4B9VA 3PX0A 4DWIA 4J2AA 3KIOA 2VWKA 4FCYA 5HP1A 2F96A 2KQ2A 1LW0A 3U6FA
chains in the Genus database with same CATH superfamily
3MXMA 1HKGA 2AP1A 3L8BA 3VF2A 1KAXA 4A2AA 3KVGA 3LZJA 4KH4A 5I9EB 1F21A 3RR7A 3AVGA 1NJXA 4CGJA 3WXMB 4JK8A 3ZEUA 1U45A 3QESA 3CFOA 1C0UA 1N5YA 1A5VA 4O8UA 2UU9K 3CCJN 5JS1A 4YDUC 1C0GA 1Q8IA 3DJCA 4CHOA 2UXCK 4IO9L 1EO1A 1XMQK 3L2UA 3KHYA 3NMUA 3T19A 3MDQA 1Z6RA 4CZLA 3L2QA 3SUQA 1RDDA 3LP0A 1RDWX 3TAMA 1NJZA 3HO1A 3E9OA 1U04A 4I9QA 2EWSA 1GLDG 4IZ9A 4RW4A 5FPEA 4DU3A 2FBVA 3AAQA 4CJKA 1ITGA 1TAQA 5ELZA 1RTIA 4JKHA 2YKNA 1IKVA 3HYFA 1WSIA 4A59A 1Z25A 4GV3A 3IAYA 1FXXA 1GLFO 3IMXA 5M1FA 1IG8A 4RW6A 1ZBLA 3ZT4A 1S1VA 5LJVA 4FO0A 3KK1A 3I8DA 2IVPA 1NGHA 3I0RA 4CJFA 3SMSA 3KWIA 2XHBA 5FPMA 2A42A 5AZJB 2Q1NA 1OH8A 1TUUA 4Z4HA 4RWTA 5J1EA 1JLAA 2HVIA 3M1FA 4OO1J 1O13A 3G10A 1WBBA 2HNDA 1BG3A 2VGMA 4PA1A 3DI6A 3FZMA 2DTUA 3CM6A 3C6UA 4QOZB 2W41A 3O9TA 4OKEA 3TSPA 2VQEK 4CBUA 3B6OA 3SPYA 4JI0K 2YHWA 3VQ9A 2YHBA 4FWLA 4JKCA 4KH6A 4CD1A 4TSXA 1ZXOA 4CE9A 2D0AA 3DXKA 4CHQA 1RTHA 4H0XB 4AM7A 4M7XA 3OJUA 1TYQA 4F9OA 1NOYA 4ILGB 1W97L 1S1TA 2F8TA 3J80O 4BC5A 2UUBK 4U7BA 2O4GA 1C6VA 4FPBA 4JI4K 4CZKA 4Y1DA 3WQTA 5C15A 3ITHA 4H5NA 4O0IA 4B9MA 3FZFA 1KLMA 3SI6A 1HUXA 2D0CA 3DWLA 4U67L 2D0BA 1S1XA 1NM1A 2ETJA 2NRXA 1L5UA 1HR0K 4N47A 2JGUA 5C24A 2Q97A 2BE2A 2A6AA 3IFRA 1BCOA 1Y64A 4B3OA 5FPNA 4LF7K 1UA0A 2Z1GA 3CJAA 4KTZA 3CF5L 3V81A 4E7KA 4JKGB 1JLBA 4H5VA 1WBDA 4M7YA 1VSDA 2ZGYA 3K9JA 3FGUA 2FSJA 3DXMA 3SCXA 3O4WA 5HL7L 1ZBSA 4HUGA 3DLGA 2FC0A 1HNXK 1HNIA 1VRTA 3IKMA 5EVZA 4BR5A 1XNRK 1ZBHA 5BREA 3OS1A 3FZKA 4CK1A 1FJGK 3LP2A 4MLEA 1DT9A 3QMLA 5HROA 2XRIA 4FJIA 2P9UB 2UUAK 3S3MA 4JEPA 4CJ3A 1NMNA 1WSGA 4CFCA 4A5BA 3MEDA 1E4FT 1TGOA 3WNEA 2OANA 2P9NB 2B5JA 3ZLJA 1YVUA 3L4IA 3SQ1A 3Q7CA 3DLKA 1S9GA 4J2EA 4W5RA 4LFAK 3JYTA 1HNWK 1OKJA 1E3MA 3OYDA 2HBLA 4CERA 4NB4A 4KB1A 3AVAA 2X74A 1KTQA 2D4WA 1DTTA 3RVCA 4O0JA 3PUFA 1HJRA 3MN9A 4CHYA 3ZSWA 2ASOA 5I3UA 1WLJA 3E1YA 4G1QA 1KFDA 3KLIA 1B9FA 2A40A 1W9HA 3SK3A 5AJ3K 2I7NA 1BI4B 4Z4CA 1VQNN 2KHOA 1RGIA 1WSFA 3EZWA 3V9WA 2BGGA 1NGDA 4CHZA 5C10A 4JRQA 1L3SA 3T3FA 3OS0A 4PY5A 3DRRA 3PO5A 3PX6A 3NGYA 4C8NA 3CCMN 4BRNA 4FJ9A 5CYQA 2O8FB 3N4PA 4MO4A 3MX5A 4DQQA 1RT7A 2A1SA 3SNNA 2KZZA 4CZJA 3GBTA 2FBYA 1X9JA 2CGJA 3C6HA 3CM5A 4CVNE 2IAJA 4M41A 1VSLA 4LF5K 2YNFA 1WOQA 4CJWA 3HT3A 1SZ2A 5KI6A 5DM6L 1JJ2M 2UUCK 4FM1A 4DV1K 3L2WA 3OYMA 3VQQA 3AV9A 3FZHA 5FROA 3RMCA 4LF9K 4K41A 3BEXA 4BR0A 3CPEA 3TAGA 1TK8A 1IJJA 1WN7A 4N56A 2VWJA 1NK9A 3CJ9A 4I2QA 4YORA 4FLYA 5EXWA 2P9SB 1KC8O 5KGXA 4WYBA 2RKIA 3NE6A 3TI0A 3I33A 4CGHA 4BY9C 5AR0A 3C7NB 3ZSOA 1KQSM 4BVOA 3MWPA 3JAMO 3RR8A 1OVQA 2BTFA 4DS5A 2GUIA 1BWFO 5M1PA 3WXIA 3M8RA 4BRHA 3H08A 4CFDA 2O8DA 4NLBA 1BI4A 3DLHA 2NRHA 4A61A 2KLAA 1ZC6A 4JRPA 4DR3K 4OKJA 2Z1JA 3TU5A 3QEWA 1ATNA 1NJWA 5BPMA 4DTMA 1JLGA 4CF9A 4C8KA 4CEQA 2OPSA 4FJLA 4Z4GA 1NLVA 4B3SK 3CYMA 3P4IA 5CHIA 3SQ0A 3TAPA 3LAKA 3WEEB 3PV8A 4ZTFA 5J2NA 3NH0A 3CQYA 4DR7K 1QVGM 4OLAA 3QETA 5AZIB 3AO4A 5AZJA 3DRPA 3UKUB 3OYBA 3CCUN 5F2RA 3KZBA 1XC9A 1Q7YO 2PYJA 2VG5A 4CZHA 2I7PA 5EOYA 3O4NA 1GOBA 3WNFA 1VSIA 3QEVA 1YIJN 3KK2A 3L3VA 3OBWA 3QINA 4PHTX 2E8AA 3VQ7A 4W5QA 1NOZA 1QE1A 3VEZA 4KAZA 4Y0WA 4H0TB 3RWUA 4CCHA 5LMUK 3MN7A 1XWLA 1XNQK 2VCPA 3AA4A 1QQNA 3U9DA 3DXMB 4LSNA 3FLCO 3WNHA 2IC3A 5LMNK 4AM6A 4JV5K 3CETA 4BG8A 4CJUA 2QWQA 1V4SA 5CZ1A 4CGIA 3U3YA 3QEPA 5FLXO 4CFBA 4XIUA 3HTVA 2XY7A 4X62K 1NGFA 4C8MA 3VGMA 3HP6A 1RT2A 4LD0A 3ZSVA 3CG7A 4N5SA 1TKZA 1BUPA 1UOCA 3VMFB 4FJMA 1HQUA 3F9KA 1K6YA 4BC4A 3D7EO 2V7YA 4BRFA 3B8AX 4FCYA 5HP1A 4B1UB 3NFAA 3U6FA 4WQ4C 3VTHA 5CY4A 2HNZA 2E2NA 4JK7A 3SZ2A 3SYZA 1KSPA 4M3TA 4RCHA 5M1QA 4CEEA 3NHGA 4WQ5C 2QM1A 4H8KA 3H1VX 1KVCA 3CERA 2WFBA 5BRDA 2FXUA 1BISA 1ZBFA 2QKBA 3D0PA 5GINA 4X66K 2NUBA 4FWRA 3V1QA 1GLEG 2HBJA 1YJNN 2YHXA 4JYAK 3KLFA 3RSEA 5ADXH 4KHPK 3QEXA 1JL1A 4H03B 4BGAA 3K9KA 1TUYA 4I6MB 4ISEA 2ASMA 4FZZA 1XHZA 2P9PA 3MECA 4NO7A 1JKHA 4BR4A 1CXQA 3MK6A 1XC3A 1XI1A 1C1AA 3H45C 4DU4A 2GBZA 4ILJA 1YXQA 4KB0A 1GLLO 3SQ2A 1UA1A 1B92A 2P9KB 3DAWA 4ZHRA 5BPNA 5H1SQ 5F1XA 4J8FA 5J2MA 1Q9XA 4A2BA 2HVHA 2YNHA 4JKBA 3MN6A 3AARA 3O80A 3RMDA 5JICA 3QIPA 5KPTA 3AVFA 3EE8A 3R6MA 5AQGA 1RT1A 3D45A 4M3YA 5AQKA 4KI6A 1KXPA 2CGLA 3UKUA 3EE9A 2P9KA 1KLNA 3F9MA 4BRLA 5AQXA 4DF8A 4B1XB 3G0ZA 3AGRA 3M3ZA 3VGLA 4DTJA 1JLFA 4DTUA 1VQ8N 3I56N 3H46O 3DM2A 3O08A 1ASVA 2HHVA 4DFKA 3HP9A 4I7FA 1QZ5A 4FWPA 2HBMA 4W5TA 2P5OA 3A5NC 4KKOA 3WXJA 4C1NI 4BDZA 1Q9YA 2E88A 2IVNA 4B08A 5CR4A 4Z0UA 1DGKN 4DS4A 3AA3A 4J2DA 1CZ9A 4FOIA 4B1VA 2YX6A 1VAZA 4Q0BA 3ZEUB 3ZT3A 3CJCA 3S9HA 3BDPA 1J53A 3CI5A 4CZGA 4KO0A 3LDNA 2E2QA 4A5AA 4IKFA 2E2OA 1X9MA 1BOTO 3L4QA 4GW6A 3DRSA 1D5AA 4FW1A 4M3RA 2ATQA 5BN9A 3HBTA 1OVYA 3LPUA 4OGCA 4OPKA 3CMEN 2UXBK 4DSFA 5DK5A 1HYVA 3TAFA 5AQMA 3MEGA 1C1BA 1YVNA 1UWBA 5AQUA 4IEEA 3LP1A 4CZFA 3NF9A 1T05A 1GLBG 3FZLA 1NKBA 3W0LA 4EFHA 3P5JA 5FRNA 4FL9A 1S5JA 5AQVA 4M3ZA 5FPDA 2XY8A 4I9LA 4K25A 1HNVA 1NGIA 3H3NO 5AQZA 4B9TA 2IIRA 4JI1K 1SKRA 5JLHA 3F2KA 3WXKA 1BIUA 4DLGA 4ICLA 4Z94A 3VN5A 5BRFA 3S41A 2R7YA 1NGJA 4OX9K 4BR7A 4BG9A 3ALYA 4HTUA 1BO5O 3THWB 3A5MC 4HUEA 3PIOL 4ILHA 1X1PA 3O9QA 4LC9B 1Q86O 1D9DA 2QTDA 4ELUA 3VESA 4UY8O 3DOLA 2OTJN 3F5TA 4KHUA 5LL6Z 3PIPL 3IUCA 3ZCMA 4CGDA 1VQLN 1EX4A 3CMAN 3PO4A 1SV5A 3D2FA 2HF4A 4O5FA 3ZSYA 4HCBA 4L8RB 3NF7A 1NG9A 1A5WA 4BRKA 2DFEA 3CCVN 1NJYA 5HBMA 5HRPA 3SUNA 3TTDA 1DTQA 4PUOA 3KK3A 1YJWN 4NCAA 1ASUA 3THXA 1XHXA 2F9WA 3OYLA 2RN2A 2HMIA 4BC3A 3L2VA 1JCEA 3MWTA 1RT6A 1J6ZA 1GOAA 4OLBA 1L3VA 4L3QA 3T7ZA 4BRGA 3HOTA 2HHXA 1SKSA 3MXJA 1LW2A 2G8UA 4C8OA 3ULDA 3JSMA 3FR0A 4NXMK 1TK0A 1B9DA 1LV5A 4K8ZA 1S1UA 3CC7N 2DY4A 2OTLN 1Q82O 1RT3A 1HKBA 2E4LA 4BE1A 3TR8A 3H1QA 4JKGA 4MDBA 1ESVA 2O8BB 2P9SA 4DTPA 2RE2A 2QWOA 1GLJO 3MN5A 1Q81O 3VA0A 4DLEA 2G8HA 3AA2A 2HOEA 3R9PA 3MX2A 4BRCA 3KD5E 3MMVA 1P8ZA 4E89A 4IDHA 3ASMA 2O8EB 1Z26A 3G71N 2NLXA 4O55A 3AO1A 1I94K 3S3OA 1YJ9N 4RG8A 4CW7B 2UXDK 4B9NA 4YNQA 3ZSRA 3KLGA 4CFAA 4EZ9A 4M3XA 4I2PA 1U2VA 2ZJPL 3SV3A 3VQCA 5HRSA 4ISFA 5TKYA 4H5TA 2IGIA 3K58A 1HX1A 4YY3K 3TPQA 1IKYA 4FWQA 3OS2A 1YTUA 4LFBK 4DTXA 3SAHA 5EX5A 4DFJA 3A0IX 3DXKB 1S1WA 1WNSA 1EP4A 4FK0A 2E20A 4CEFA 3QNNA 1HPMA 4K42A 4CF2A 2GWKA 2Q36A 3A8YA 2GX9A 1E4GT 3SBGA 4CHNA 3E01A 4IBNA 4DCHA 1IBKK 3VQBA 3J8AA 1U6ZA 4DV0K 4E7JA 2PAVA 1V4TA 1KRPA 1WSJA 1HMVA 1HPZA 2WC9A 5J2PA 4DTSA 4FPAA 5C2DA 4B9LA 1O1WA 3LDPA 5C25A 3MXIA 4YHHK 1Q18A 1R0AA 2HW3A 1TL3A 3GE1A 3OYEA 4KHQA 4F8RA 2O8CA 3ATVA 1JL2A 4B8CA 4DR4K 4JKEA 2HHHK 1D9FA 2Y1IA 2E5LK 4CK3A 4J2BA 4E3SA 3AVCA 4DQIA 3VQEA 3AVKA 4BRDA 4BDPA 2V51B 2P9UA 3NH1A 4IFYA 4FK4A 4BQZA 5KRTA 4CJ7A 3TARA 4IXCA 3DLBA 1LCUA 4EZ6A 4IO8A 3CCRN 1S6QA 3VF4A 4A57A 3U8XA 2QXLA 3ZETB 2YI1A 3O1WA 1HYSA 2LSNA 3EN9A 3HPOA 3TSUA 3J81O 4LF6K 5KTQA 3QNOA 4CJRA 2Z1HA 3CCQN 3I8BA 1J5EK 3CJBA 1EXQA 5HOOA 2CH6A 1T3VA 2Q2RA 1K8KA 3RSEB 4G9ZA 4ELVA 4AHCA 4H4OA 1MU2A 4AHTA 4PKIA 4FSVA 3VOVA 1IKXA 4CHPA 5ADXA 2QA4N 4PL7A 4B9VA 4J2AA 3KIOA 2F96A 1LW0A 5C12A 5JLFA 3LWLA 3SMPA 3VQ4A 4GV9A 3ZT0A 4AILC 3SPZA 4WCEL 1M1KO 4DSLA 5EU7A 1IO2A 2FBTA 3D2EB 3SJHA 2RHKA 4GY2B 1S72N 3O9SA 4BQLA 2W40A 3L2RA 2YJEA 4DV7K 4K8XA 4IOAL 4YOVA 1NGGA 1XUPO 3OYHA 2GWJA 3HOSA 3VEYA 3LPTA 3PY8A 4EHTA 4OPJA 1QS4A 1BQMA 3VENA 3NBPA 4DUYK 5MLCQ 3QDKA 3NCIA 3UIQA 2VG7A 4KHYA 4GMJB 5LY3A 3NF8A 2ZJRL 4CEOA 4CJTA 1I39A 2BUPA 4CIFA 4X64K 5F0XA 1SQKA 2Q0UA 2ZGZA 2V7ZA 1QHTA 3M6GA 3A2FA 2PYLA 3BZCA 3TSQA 2YKMA 4OVLA 3DMJA 1RTJA 4CD3A 4Z4FA 4YOTA 4IWVA 3NAEA 1QSSA 3H3OB 3V1RA 2YCHA 2YHAA 4CJSA 3K5LA 2ZE2A 3AVJA 1FKOA 4GV6A 2DPNA 2G8WA 1VHXA 2E1ZA 2D0OA 1VQ6N 3AVBA 2A1RA 4CI6A 1JXEA 5SWMA 2FSNA 4JNEA 1W2BM 3L3UA 1JLQA 3P38A 1NK0A 1VSHA 5AZIA 4DR1K 1NBWA 5AFUA 4FJ7A 1BCMA 3GL1A 2PBDA 3MCPA 4M45A 4ISGA 4FLXA 1BHLA 4B8AB 4NCBA 3D6RA 2QWNA 4BWMA 3CPWM 3HM9A 3LDLA 4LH5A 3O3FA 4DF4A 3R8EA 4ELTA 3LWMA 2GV9A 1NK5A 4JKAA 5M1OA 1H1VA 3ZX3A 4DV6K 4DR6K 4FWSA 2JWKA 2KKZA 3GDQA 2ZWHA 4F3OA 2VYPA 2JWLA 3OYIA 2E6MA 3VPZA 2VWBA 4B1YB 1MA9B 3F73A 5BR9A 3J7AP 1UAXA 5AQTA 4CJVA 4ZTJA 3LAMA 2OPRA 4JS4A 3VQPA 3C7NA 4BREA 1QVFM 4PKGA 1YT3A 4AF1A 3NF6A 4WFAL 3RMBA 3FFKB 4HHTA 3CXCM 4DV3K 3QBXA 4DQPA 1NKEA 2PFUA 4CF1A 1FK9A 1TL1A 3T1AA 1LAWA 3K5OA 3U9ZA 1W7AA 5TKWA 3ENOA 4KTWA 4XEIA 4BACA 3OBYA 2Q0RA 2O8EA 3HZ6A 1X9WA 4BE2A 1RBTA 1S6PA 4DQ8A 3O3HA 3OY9A 5KPZA 5GADP 1NGBA 1CXUA 5AQJA 5KQ8A 4DKWA 1FW6A 2I5JA 4AHUA 4JHDB 2E1YA 3C94A 1YUWA 4FLUA 3SAGA 2FLOA 3VQDA 5FRMA 1JLEA 3QLHA 3QERA 1ZYQA 1IBLK 3HSCA 3T1YK 1RCHA 3VQ6A 2QWMA 5C42A 4JKDA 5BR8K 5E84A 4RTFD 3I0SA 1NMDA 4C1NK 3V1OA 3ZETA 4O4GA 3LL3A 3V4IA 1NK7A 4R5PA 1KFSA 3TWHA 5E41A 3CD6N 3MAQA 4B3TK 3ZSZA 5GIOA 2DFHA 4XH1A 4KFBA 1HRHA 4FXDA 3SV4A 4FWMA 1XMOK 1C1CA 3OJSA 1T03A 1ILYA 2W42A 2WONA 4W5NA 3W3DA 2XY6A 1LAVA 1IH7A 3AO2A 1IG9A 1HYZA 5KRSA 2P9LB 1D4XA 3CQXA 2QW9A 1DEJA 4QAGA 3HXMA 3R3LA 4BC2A 4GKKK 2P9NA 1N6QA 2UYTA 1ATRA 5JMVA 1NWKA 4X65K 1HNZK 1RBUA 4WQ4A 4NYNA 4QS9A 4JLHA 1RBSA 1YTAA 2J4RA 1N32K 1G99A 5C2FA 3OYNA 4LF4K 2YNIA 2IDOA 4CECA 4DUZK 1OH5A 4HUFA 3THWA 2O8DB 1QZ6A 3AO5A 4C8LA 1WAJA 4M3WA 3OYKA 4H5RA 1M90O 3CCLN 3K57A 3OYGA 3PSIA 2NRWA 4OPHA 1U2VB 1CLQA 4O44A 3O4QA 1YAGA 2ASPA 1L3TA 4IFEA 4HWIA 4QCLA 2H3GX 1LOTB 4H0PA 5CYMA 3EL2A 2IS3A 1BDGA 3CJ7A 1N34K 4FLVA 4DU1A 3AO3A 4DHYA 3K0SA 4IDKA 3C95A 4E7LA 1Y97A 2W6LA 4E19A 1RBRA 3THVA 1NGAA 1RDUA 5M1KA 1A5XA 1KAZA 4KRFA 3KWGA 4BRPA 5SZTA 3KJVA 4FWNA 3DLEA 4KH5A 5LJWA 2O8BA 3ATUA 3ZT1A 3M8SA 4YOYA 2ITMA 4DFMA 3J7YP 1W0HA 4JS5A 1VQON 4CGFA 3VQAA 1VQKN 3V9XA 3OA9A 3VETA 4UQGA 1NK8A 1OH6A 3JXUA 2D1KA 2E2PA 3CCEN 3QFUA 2HHWA 3HM8A 4FOEA 4BRMA 1WSHA 1QSYA 1SL2A 3G6EN 3ZX0A 3OYJA 3RRGA 4WF9L 4FZXC 3V9ZA 3THXB 3C65A 3DLRA 1NGEA 1SAZA 2KW4A 2RF2A 2EX3A 2DFFA 4H5WA 2HHQA 5BN8A 3BP8A 4Q5VA 2OPQA 4IEIA 4A62A 1XQSC 3DOKA 4DG1A 1X3NA 4B9UA 1JCFA 4ID5A 3HJFA 3ZYYX 3G25A 3HI0A 3WUHA 1J54A 3D2FB 1S3XA 3M8QA 1VRUA 3OYFA 5IT9O 1RILA 1SKWA 4LSLA 5C0YA 3AVHA 1N8RO 5GAHP 4DTNA 3KK7A 4B9QA 2ZF5O 4JD2B 3CFPA 1BL3A 4AH9A 4DV5K 1VQ7N 1LWCA 4LH4A 1KVBA 4BVPA 4YFUA 3VF6A 2OA8A 4CBWA 4DSIA 4FJGA 1VSFA 4KHSA 3UKRA 4JN4A 3SAFA 2NNWA 5JVGL 4IG3A 4B3RK 1VSKA 4HTLA 3ISNC 3MCAB 1K8AO 2F8SA 3R1XA 3M5RA 3PLAA 3HVRA 2IOCA 2CGKA 1NJIO 5K14A 4CZMA 1ASWA 3SLCA 3KLEA 3O9UA 3AY9A 1C0FA 3OHRA 1RT5A 4BWJA 4I6MA 4CF0A 4R79A 1NKCA 3HRGA 4FJHA 1N36K 4IG0A 2GEMA 5E26A 4AQYK 3CIPA 1T44A 4IJAA 1TVRA 4FJ5A 2W6KA 2YHYA 4B1WB 3DLLL 4LF8K 3NGZA 4B3MK 3OYCA 1NNEA 2F9TA 2QWPA 4MLHA 4BRQA 2HB5A 3LP3A 4F2RA 3UB5A 2QEXN 1KAYA 3LALA 4H4MA 4DMNA 2Q3SA 1HJOA 1IBMK 2ITGA 4M42A 4XH4A 3NVMA 3NVKA 1MWMA 2NRZA 3NH2A 4XH5A 4JAXA 2VWKA 1C0TA 2KQ2A 4IOCL 3RRHA 2FSKA 2GTDA 4DR5K 3VA3A 3TTCA 2P5GA 3G4SN 4FJKA 3O8MA 1SUQA 1G15A 3K2PA 4EP4A 4FVUA 2HBKA 2FBXA 4FWOA 3OW2M 1TYQB 4M63C 3J7ZO 4H0VB 5AQNA 4FLTA 4DSEA 4OGEA 3IDHA 2B4JA 1WB9A 1X9SA 2GUPA 2P9IB 4MDAA 2O4IA 4CEBA 4CJ4A 1X3MA 1U4BA 1K8KB 1HKCA 4NYFA 1REVA 2KFNA 3LM2A 3WNGA 1YI2N 3T69A 3VQ8A 3BGRA 4O5BA 4F2SA 4JI2K 3HL8A 5AFUH 4BROA 3VEVA 2G8VA 1VSMA 2IVOA 2A3ZA 3LDOA 2YNGA 4O8KA 3AVMA 1ZBIA 3C6AA 5J2QA 5BRHA 4B9SA 3UKRB 4BDYA 3CFRA 2HHSA 1TV6A 4FW2A 3T1HK 1YF5L 2KFZA 3O9RA 4JD2A 3U3GA 2KTQA 1SS6A 5KPRA 2PZSA 3AVIA 4DV4K 3EKSA 1QQOA 3M8PA 2YV0X 1VQ5N 2G8IA 3CHWA 4EAHD 5AQHA 4JI8K 3CQ8A 4DV2K 3DYAA 4CEDA 2ZD1A 3WEEA 2YJFA 1VQMN 5CE3A 4Z4IA 4NXNK 3LZIA 3AAPA 3LDSA 3KKRA 1CZBA 4FYDA 4CIGA 2P9PB 5AQLA 3QEIA 4FJNA 1T8EA 2FF3B 4CBXA 5A2QO 5JVHL 2WBNA 4KBOA 4FLWA 1KD1O 2D0PA 3JS6A 3SUOA 3EKUA 3L0QA 1NU0A 3P1GA 4H0YB 1WSEA 4WQ5A 1EQYA 1LWFA 4IFVA 4CEZA 4KI4A 4WE1A 2Y1JA 1RTDA 1WAFA 2HHTA 4YOUA 3D2EA 3SQ4A 3FE1A 5DMRA 2NRTA 5AQOA 1MWKA 3SJJA 3ZX2A 5M1NA 3ENBA 5GAEP 2QI2A 3IRXA 1OH7A 4DR2K 3VEOA 5AQRA 4N76A 1QQCA 4CF8A 3ZT2A 4GKJK 1K9MO 2OYQA 1EWRA 2P51A 3U4LA 2EHGA 4BRIA 5D3GA 2HNYA 2HHUA 4N41A 2X6NA 1JXBA 1YHQN 1GLAG 5AQIA 4MO5A 5HRNA 2OPPA 3QIOA 3TAQA 4C23A 4ID1A 1VK0A 3E9LA 4CJQA 3HPGA 4IOXA 4F3TA 5AQFA 3AVLA 3SBTA 2VG6A 4W5OA 4RW7A 1S9EA 4E1JA 4JK9A 1NGCA 1BA1A 1DKGD 3KKSA 1I3AA 4BRAA 4FM2A 4E0DA 5FDLA 2O8FA 5IWAK 2Z1IA 5AQYA 5AQSA 1VSEA 3EYZA 4BR9A 2WTUA 3AA5X 4JKFA 2OZSA 1J9AA 3RMAA 4YDUA 5I42A 3NDKA 2RPIA 3THYA 2QKKA 2B6AA 2OCEA 3V9UA 2OZMA 4LFCK 1JLCA 2X78A 2BH1A 4DQRA 1VQPN 2CH5A 1S22A 1JCGA 4K0KK 1IKWA 4FVMA 4IJNA 4JI6K 2AJQA 3K59A 5EY4A 3AVNA 3EEQA 5T7BA 4E7HA 4FJJA 2O8CB 3MEEA 1J5OA 1L3UA 1EKEA 4DTOA 3VERA 1YITN 3P31A 3VEWA 4DB3A 4WFBL 4YOWA 1CZAN 4CIEA 1VQ4N 2QWLA 4WFNL 4CEAA 3TANA 3VEXA 3LM9A 3H6EA 3ID8A 4DQSA 3GOIA 4PQUA 4DSKA 3VTIA 2ZM6K 3CC2N 1TAUA 4PKHA 3P39A 4GVEA 3UE5A 3VQ5A 3N4QA 4EIAA 4FLZA 4BE0A 1QHAA 1BA0A 2D5RA 3EO3A 1DLOA 2XO7A 3QO9A 1QQMA 3KTQA 3HK2A 4GVMA 4KV8A 3HVTA 3THYB 4CJLA 3P83D 3BF1A 1EETA 3O6WA 4M3UA 5BPLA 2G8KA 5JS2A 3ULEB 3B6PA 1ZBUA 3K5MA 1T6CA 4NLCA 1TK5A 3WT0A 4F4KA 1P90A 4AHVA 3QICA 1SL1A 3Q7BA 1TKXA 4PL8A 3IS9A 4EP5A 2AA4A 2QXFA 1KVAA 3O5BA 3IG1A 2HSTA 3ZSQA 2NRRA 3RTVA 3OYAA 3HPHA 1BQNA 3ZSXA 3A5OC 4KPYA 4DTRA 2FF6A 3LANA 3PSFA 3O3GA 1R59O 4FZYA 3OTOK 3CC4N 4FJ8A 1GOCA 2X6SA 5HRRA 4OPAA 1RDAA 3OVNA 4EHUA 2PY5A 3I55N 5AQWA 4E7IA 2ZJQL 4FWKA 2ZQBA 1HLUA 2A5XA 3BY5A 2XY5A 4JI5K 2HF3A 1ATSA 3C6TA 4K43A 4RW9A 4QS8A 1K73O 4H0OA 3E66A 2HMPA 3FFIA 2GELA 3KLHA 1RFQA 4KREA 4JI7K 2WOMA 4KTQA 1U49A 3QFPA 4Z4EA 1RT4A 1GLCG 4RW8A 2VQFK 3ULEA 1RDBA 1U48A 4HVJA 4BGBA 1N33K 1T6DA 4QS7A 5DM7L 3CCSN 2NZTA 3QB0A 4B1ZA 2NRVA 3L6QA 2KZMA 2V52B 1RNHA 4CZIA 2P1JA 1T7PA 1KCFA 3K5NA 4LY7A 1TKDA 5HLFA 4DFPA 4MQ3A 4FK2A 2JLEA 4CESA 3O1BA 1QTMA 3A5LC 2P9LA 3S3NA 5GAGP 5GIPA 2F7TA 3AGKA 4CK2A 3QBWA 3EZ5A 4KHNA 5KGWA 3E9PA 4Y1CA 3GG4A 3LDQA 4FJXA 4GNIA 1D8YA 3EY1A 4MFBA 1BU6O 4E1NA 4YOXA 4BR2A 3ENHA 3V6DA 1BGXT 3TAEA 3C0BA 4CJPA 4PWDA 5KQDA 4E1MA 1C0MA 4CJ5A 4OJRA 1Z05A 3CJ1A 4JI3K 1FKPA 3BZKA 1MDUB 4FM0A 4CZEA 3HSTB 3WQUA 5AQQA 2BDPA 4NCGA 2BANA 5B8HA 3BF3A 3BUZB 4OKKA 4AHSA 2QWRA 1NK6A 4KHWA 2F4VK 2VGNA 2A41A 5CZ2A 1HQEA 1QSLA 1TKTA 1RBVA 3VGKA 1NK4A 2Q31A 1VSJA 4V19S 3PX4A 4AHRA 3SUPA 1LWEA 5AQPA 2G8FA 4JHDA 1U47A 1EWQA 1BIZA 4HCCA 1WUAA 3KD1E 4DSJA 2P9IA 1SL0A 2E6LA 4CJEA 3V9SA 1IV0A 1RDCA 2WUSA 3ID6A 4CGGA 1VQ9N 3TABA 2QK9A 3WXLA 3NGIA 3PX0A 4DWIA 3TTFA
chains in the Genus database with same CATH topology
3LWLA 3MXMA 3RRHA 3VQ4A 5CY4A 3ZT0A 2HNZA 4AILC 3L8BA 3SPZA 3VA3A 3SZ2A 3SYZA 2P5GA 4FJKA 1KSPA 4DSLA 3LZJA 4M3TA 5EU7A 4CEEA 1IO2A 1SUQA 2FBTA 3NHGA 1F21A 3RR7A 1G15A 3K2PA 4H8KA 4EP4A 3AVGA 1KVCA 2FBXA 1NJXA 4CGJA 3L2RA 1BISA 1ZBFA 4FLTA 2QKBA 3D0PA 4OGEA 4DSEA 1U45A 2NUBA 3QESA 3CFOA 1C0UA 2B4JA 1N5YA 4K8XA 1X9SA 1A5VA 3V1QA 5JS1A 4CHOA 1Q8IA 3OYHA 4CEBA 4CJ4A 2O4IA 3KLFA 3LPTA 3PY8A 1U4BA 4NYFA 1REVA 3L2UA 2KFNA 4OPJA 3WNGA 1JL1A 1QS4A 3QEXA 1BQMA 3NBPA 3VQ8A 3NCIA 3T19A 3BGRA 4O5BA 3UIQA 2VG7A 4KHYA 4F2SA 4GMJB 4FZZA 3L2QA 3SUQA 3HL8A 1RDDA 3LP0A 3NF8A 3TAMA 4CEOA 1XHZA 3MECA 1NJZA 4CJTA 1I39A 1JKHA 2G8VA 3HO1A 1U04A 4CIFA 4I9QA 1VSMA 1CXQA 4RW4A 4DU3A 1XI1A 1C1AA 4DU4A 1QHTA 2GBZA 2FBVA 2YNGA 3A2FA 2PYLA 3AVMA 1ZBIA 4CJKA 1ITGA 1TAQA 2YKMA 3DMJA 1RTJA 4OVLA 5J2QA 3SQ2A 1UA1A 1B92A 4B9SA 4Z4FA 1RTIA 3NAEA 4ZHRA 4BDYA 2YKNA 1IKVA 3HYFA 1WSIA 3CFRA 1QSSA 3V1RA 1Z25A 2YHAA 4CJSA 1TV6A 3K5LA 4FW2A 5J2MA 2HHSA 3IAYA 2ZE2A 1Q9XA 3AVJA 1FKOA 2HHXA 2HVHA 1FXXA 2YNHA 2KFZA 2G8WA 3RMDA 3QIPA 4RW6A 3AVFA 3AVBA 2A1RA 1ZBLA 3ZT4A 1JXEA 1S1VA 1RT1A 3U3GA 5SWMA 3D45A 3KK1A 2KTQA 3I8DA 3I0RA 4M3YA 3L3UA 4CJFA 4KREA 1JLQA 2PZSA 3AVIA 2XHBA 4KI6A 1NK0A 1VSHA 3M8PA 2YV0X 1KLNA 2G8IA 4DF8A 4FJ7A 3G0ZA 1BCMA 4DTJA 1JLFA 4DTUA 3CQ8A 3DYAA 4M45A 4CEDA 2ZD1A 3DM2A 4Z4HA 4FLXA 1ASVA 1JLAA 1BHLA 5J1EA 2HVIA 4Z4IA 4DFKA 3HP9A 4B8AB 4NCBA 3LZIA 2HHVA 3G10A 3LDSA 2HNDA 3KKRA 1CZBA 4PA1A 4BWMA 3DI6A 4CIGA 4LH5A 3HM9A 4FYDA 3O3FA 4DF4A 4I7FA 2DTUA 4ELTA 3CM6A 3LWMA 3QEIA 4FJNA 3C6UA 4W5TA 2GV9A 1T8EA 1NK5A 2P5OA 4QOZB 4KKOA 4BDZA 4OKEA 3B6OA 4FLWA 3SPYA 1Q9YA 3VQ9A 3SUOA 2YHBA 4B08A 4F3OA 4Z0UA 3OYIA 2E6MA 4TSXA 4DS4A 3AA3A 3P1GA 4CE9A 1WSEA 4J2DA 1CZ9A 2D0AA 4CHQA 3F73A 1RTHA 1UAXA 4CJVA 1LWFA 4IFVA 4Q0BA 4CEZA 3ZT3A 4ZTJA 4KI4A 4WE1A 3S9HA 3BDPA 1J53A 3OJUA 2Y1JA 1RTDA 3LAMA 2OPRA 4KO0A 4JS4A 1NOYA 3VQPA 4IKFA 1WAFA 1S1TA 1YT3A 2F8TA 3NF6A 2HHTA 1X9MA 3SQ4A 3RMBA 5DMRA 4HHTA 4GW6A 3SJJA 3DRSA 1TAUA 2O4GA 1C6VA 4Y1DA 4DQPA 1D5AA 3IRXA 1NKEA 3ITHA 4FW1A 4M3RA 4CF1A 4O0IA 4B9MA 1KLMA 1FK9A 1TL1A 2ATQA 1LAWA 3LPUA 3K5OA 4OGCA 3T1AA 4OPKA 3SI6A 4KTWA 4N76A 4DSFA 1QQCA 4BACA 4CF8A 3ZT2A 2D0CA 1X9WA 4BE2A 5DK5A 1RBTA 1HYVA 1S6PA 3TAFA 2D0BA 1S1XA 3O3HA 3OY9A 2ETJA 3MEGA 1C1BA 1UWBA 1L5UA 4N47A 2OYQA 3LP1A 1CXUA 2P51A 3NF9A 2JGUA 2EHGA 5D3GA 5C24A 1T05A 2HNYA 2I5JA 4AHUA 2BE2A 2HHUA 4N41A 2X6NA 1NKBA 1JXBA 1BCOA 3C94A 4B3OA 4FLUA 5HRNA 3P5JA 2OPPA 3QIOA 3TAQA 5FRNA 1S5JA 4M3ZA 3NFAA 2XY8A 4ID1A 2Z1GA 1VK0A 1HNVA 4I9LA 3VQDA 1JLEA 3QLHA 4CJQA 3QERA 1ZYQA 4KTZA 3HPGA 4B9TA 3V81A 4F3TA 4E7KA 1SKRA 1RCHA 3AVLA 3VQ6A 1JLBA 2VG6A 4W5OA 5C42A 4RW7A 1VSDA 1S9EA 1BIUA 4DLGA 3KKSA 4ICLA 1I3AA 4FM2A 3SCXA 3I0SA 4E0DA 5FDLA 3VN5A 2Z1IA 4HUGA 3V1OA 2R7YA 3DLGA 2FC0A 1VSEA 4O4GA 3EYZA 3V4IA 3AA5X 2OZSA 1J9AA 1HNIA 1VRTA 4R5PA 3RMAA 5I42A 1NK7A 1ZBHA 3NDKA 3OS1A 3TWHA 5E41A 1KFSA 2RPIA 4CK1A 3ALYA 3MAQA 4HTUA 2QKKA 2B6AA 3ZSZA 1UA0A 3LP2A 4HUEA 2DFHA 3V9UA 5HROA 2OZMA 2XRIA 4FJIA 1JLCA 3S3MA 2X78A 4KFBA 4DQRA 1HRHA 1X1PA 4CJ3A 1D9DA 4ELUA 4FXDA 3SV4A 1WSGA 3DOLA 4CFCA 3MEDA 4KHUA 1C1CA 3OJSA 1T03A 1TGOA 3WNEA 1IKWA 4FVMA 3ZCMA 4CGDA 2B5JA 2W42A 2WONA 4W5NA 1YVUA 3K59A 2AJQA 1EX4A 3AVNA 5T7BA 4E7HA 3SQ1A 4FJJA 3PO4A 3DLKA 3MEEA 1J5OA 1S9GA 1EKEA 1L3UA 1SV5A 4J2EA 4W5RA 2XY6A 3ZSYA 4HCBA 1LAVA 3JYTA 1IH7A 4DTOA 4L8RB 3OYDA 3NF7A 4CERA 1A5WA 3AO2A 2DFEA 1IG9A 4KB1A 1HYZA 1NJYA 3AVAA 5KRSA 2X74A 5HBMA 4CIEA 5HRPA 3SUNA 1KTQA 4CEAA 1DTTA 1DTQA 4QAGA 4PUOA 4O0JA 3HXMA 3KK3A 3TANA 3PUFA 1HJRA 1ASUA 4CHYA 3ZSWA 4DQSA 1N6QA 5I3UA 1WLJA 4G1QA 4DSKA 4PQUA 1RBUA 4NYNA 1XHXA 3OYLA 1KFDA 3KLIA 2RN2A 4JLHA 1B9FA 2HMIA 1RBSA 1YTAA 3L2VA 1W9HA 3VQ5A 3OYNA 4KB0A 1RT6A 4FLZA 2YNIA 1BI4B 4Z4CA 2IDOA 1GOAA 4CECA 4BE0A 1L3VA 4OLBA 1WSFA 4HUFA 3V9WA 2BGGA 2D5RA 3AO5A 4CHZA 1DLOA 2XO7A 3QO9A 1WAJA 4JRQA 3T3FA 1L3SA 4GVMA 4KV8A 3OS0A 3OYKA 1SKSA 4M3WA 3DRRA 3HVTA 3MXJA 1LW2A 3PO5A 4PY5A 4CJLA 3PX6A 3NGYA 3P83D 4C8NA 2G8UA 1EETA 3ULDA 4C8OA 4M3UA 4FJ9A 3K57A 2G8KA 3JSMA 3HK2A 5JS2A 5CYQA 1TK0A 3B6PA 1B9DA 1ZBUA 3OYGA 3K5MA 1TK5A 1LV5A 4F4KA 4K8ZA 1S1UA 4AHVA 2DY4A 4DQQA 1SL1A 1TKXA 1RT3A 3IS9A 1RT7A 4EP5A 2E4LA 4BE1A 3TR8A 2QXFA 1KVAA 2A1SA 3SNNA 1CLQA 2KZZA 3IG1A 3ZSQA 2FBYA 4DTPA 4O44A 3O4QA 3RTVA 3OYAA 3HPHA 1L3TA 3CM5A 1BQNA 3ZSXA 2IAJA 4KPYA 4QCLA 4DTRA 4M41A 1VSLA 3VA0A 5CYMA 4DLEA 3LANA 3AA2A 2IS3A 2YNFA 2G8HA 4CJWA 3HT3A 3O3GA 5KI6A 4FZYA 5FRMA 4FJ8A 1GOCA 2X6SA 5HRRA 4FM1A 4FLVA 1RDAA 3OVNA 2PY5A 4DU1A 3KD5E 3L2WA 3AO3A 3OYMA 3VQQA 4E89A 3AV9A 3ASMA 5FROA 4E7IA 3RMCA 4IDKA 3C95A 1Z26A 3TAGA 2ZQBA 1TK8A 4E7LA 1WN7A 4N56A 2XY5A 1Y97A 2VWJA 4E19A 4O55A 3AO1A 1NK9A 1RBRA 3C6TA 3S3OA 3THVA 4RG8A 4I2QA 4RW9A 1A5XA 1C0TA 4B9NA 4FLYA 4YNQA 3ZSRA 4KRFA 5SZTA 3KJVA 3KLGA 3FFIA 4CFAA 3DLEA 3KLHA 4EZ9A 4M3XA 4I2PA 5KGXA 2RKIA 3NE6A 3TI0A 3ZT1A 3M8SA 3SV3A 2WOMA 3VQCA 4CGHA 5HRSA 4DFMA 4KTQA 1W0HA 4JS5A 4CGFA 1U49A 3VQAA 4Z4EA 3V9XA 1RT4A 2IGIA 3ZSOA 4RW8A 3K58A 4UQGA 1RDBA 1NK8A 1U48A 4HVJA 1IKYA 1YTUA 3OS2A 3RR8A 4DTXA 4DFJA 4DS5A 1S1WA 2HHWA 2GUIA 1WNSA 1EP4A 4FK0A 3M8RA 3H08A 4CFDA 4CEFA 3QNNA 2KZMA 1RNHA 4CF2A 1WSHA 2P1JA 1QSYA 1BI4A 3DLHA 1T7PA 1KCFA 1SL2A 4CHNA 4JRPA 3K5NA 3OYJA 4OKJA 2Z1JA 3E01A 4IBNA 4LY7A 3QEWA 1TKDA 3RRGA 4FZXC 1NJWA 3V9ZA 4DFPA 5HLFA 4DTMA 3VQBA 1JLGA 3DLRA 4MQ3A 4CF9A 4C8KA 4CEQA 2JLEA 2OPSA 2KW4A 4FJLA 4FK2A 2RF2A 2EX3A 2DFFA 4CESA 4Z4GA 4E7JA 2HHQA 1QTMA 1KRPA 4Q5VA 3CYMA 2OPQA 3SQ0A 3TAPA 1WSJA 3S3NA 3DOKA 1HMVA 3LAKA 1HPZA 4DG1A 3PV8A 5J2NA 5J2PA 4DTSA 4ZTFA 3NH0A 4B9UA 4ID5A 3HJFA 4B9LA 1O1WA 5C25A 3MXIA 4CK2A 3EZ5A 1R0AA 4KHNA 5KGWA 4OLAA 1J54A 3QETA 2HW3A 3M8QA 1VRUA 4Y1CA 1TL3A 3AO4A 3OYFA 3OYEA 1RILA 4KHQA 1SKWA 4F8RA 3DRPA 3OYBA 4FJXA 1JL2A 4LSLA 4B8CA 1XC9A 1D8YA 2PYJA 2VG5A 3EY1A 3O4NA 1GOBA 4MFBA 3WNFA 2Y1IA 4E1NA 1D9FA 3AVHA 1VSIA 3V6DA 4CK3A 3QEVA 4E3SA 3AVCA 4DQIA 4J2BA 4DTNA 3VQEA 1BGXT 3CFPA 3AVKA 3KK2A 1BL3A 3L3VA 4AH9A 4CJPA 3TAEA 3QINA 4BDPA 4W5QA 3VQ7A 4PWDA 1LWCA 1C0MA 1NOZA 1KVBA 4LH4A 1QE1A 4OJRA 4CJ5A 4E1MA 4YFUA 3NH1A 2OA8A 4IFYA 4KAZA 4DSIA 4FJGA 3RWUA 1VSFA 4CCHA 4KHSA 4FK4A 5KRTA 3TARA 3DLBA 4IG3A 4EZ6A 1VSKA 1FKPA 1S6QA 3ISNC 2F8SA 1XWLA 4FM0A 1HYSA 3AA4A 3HSTB 3HVRA 2IOCA 2LSNA 3HPOA 4LSNA 5K14A 2BDPA 1ASWA 4NCGA 2BANA 3WNHA 2IC3A 5KTQA 3KLEA 3QNOA 4CJRA 4OKKA 4AHSA 4C8LA 1NK6A 4KHWA 1RT5A 5CZ2A 1HQEA 4BWJA 1TKTA 1RBVA 2Z1HA 4CJUA 1QSLA 4CF0A 1NK4A 5CZ1A 1VSJA 4CGIA 1EXQA 3U3YA 3QEPA 4CFBA 1NKCA 4FJHA 4IG0A 4XIUA 3PX4A 2XY7A 4AHRA 1TVRA 1LWEA 4C8MA 3SUPA 2G8FA 4FJ5A 4ELVA 3HP6A 1RT2A 4AHCA 1U47A 3KTQA 1BIZA 4HCCA 4H4OA 3NGZA 4LD0A 3ZSVA 3OYCA 1MU2A 3KD1E 3CG7A 4N5SA 4DSJA 4NCAA 2HB5A 3LP3A 4AHTA 1SL0A 1TKZA 4F2RA 2E6LA 1UOCA 4H4MA 3LALA 4CJEA 4DMNA 1IKXA 1HQUA 1RDCA 2Q3SA 3F9KA 3V9SA 4CGGA 1K6YA 2ITGA 4FJMA 4CHPA 4M42A 3TABA 2QK9A 3NH2A 3NGIA 4B9VA 3PX0A 4DWIA 4J2AA 3KIOA 2VWKA 4FCYA 5HP1A 2F96A 2KQ2A 1LW0A 3U6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWL A;  3MXM A;  3RRH A;  3VQ4 A;  5CY4 A;  3ZT0 A;  2HNZ A;  4AIL C;  3L8B A;  3SPZ A;  3VA3 A;  3SZ2 A;  3SYZ A;  2P5G A;  4FJK A;  1KSP A;  4DSL A;  3LZJ A;  4M3T A;  5EU7 A;  4CEE A;  1IO2 A;  1SUQ A;  2FBT A;  3NHG A;  1F21 A;  3RR7 A;  1G15 A;  3K2P A;  4H8K A;  4EP4 A;  3AVG A;  1KVC A;  2FBX A;  1NJX A;  4CGJ A;  3L2R A;  1BIS A;  1ZBF A;  4FLT A;  2QKB A;  3D0P A;  4OGE A;  4DSE A;  1U45 A;  2NUB A;  3QES A;  3CFO A;  1C0U A;  2B4J A;  1N5Y A;  4K8X A;  1X9S A;  1A5V A;  3V1Q A;  5JS1 A;  4CHO A;  1Q8I A;  3OYH A;  4CEB A;  4CJ4 A;  2O4I A;  3KLF A;  3LPT A;  3PY8 A;  1U4B A;  4NYF A;  1REV A;  3L2U A;  2KFN A;  4OPJ A;  3WNG A;  1JL1 A;  1QS4 A;  3QEX A;  1BQM A;  3NBP A;  3VQ8 A;  3NCI A;  3T19 A;  3BGR A;  4O5B A;  3UIQ A;  2VG7 A;  4KHY A;  4F2S A;  4GMJ B;  4FZZ A;  3L2Q A;  3SUQ A;  3HL8 A;  1RDD A;  3LP0 A;  3NF8 A;  3TAM A;  4CEO A;  1XHZ A;  3MEC A;  1NJZ A;  4CJT A;  1I39 A;  1JKH A;  2G8V A;  3HO1 A;  1U04 A;  4CIF A;  4I9Q A;  1VSM A;  1CXQ A;  4RW4 A;  4DU3 A;  1XI1 A;  1C1A A;  4DU4 A;  1QHT A;  2GBZ A;  2FBV A;  2YNG A;  3A2F A;  2PYL A;  3AVM A;  1ZBI A;  4CJK A;  1ITG A;  1TAQ A;  2YKM A;  3DMJ A;  1RTJ A;  4OVL A;  5J2Q A;  3SQ2 A;  1UA1 A;  1B92 A;  4B9S A;  4Z4F A;  1RTI A;  3NAE A;  4ZHR A;  4BDY A;  2YKN A;  1IKV A;  3HYF A;  1WSI A;  3CFR A;  1QSS A;  3V1R A;  1Z25 A;  2YHA A;  4CJS A;  1TV6 A;  3K5L A;  4FW2 A;  5J2M A;  2HHS A;  3IAY A;  2ZE2 A;  1Q9X A;  3AVJ A;  1FKO A;  2HHX A;  2HVH A;  1FXX A;  2YNH A;  2KFZ A;  2G8W A;  3RMD A;  3QIP A;  4RW6 A;  3AVF A;  3AVB A;  2A1R A;  1ZBL A;  3ZT4 A;  1JXE A;  1S1V A;  1RT1 A;  3U3G A;  5SWM A;  3D45 A;  3KK1 A;  2KTQ A;  3I8D A;  3I0R A;  4M3Y A;  3L3U A;  4CJF A;  4KRE A;  1JLQ A;  2PZS A;  3AVI A;  2XHB A;  4KI6 A;  1NK0 A;  1VSH A;  3M8P A;  2YV0 X;  1KLN A;  2G8I A;  4DF8 A;  4FJ7 A;  3G0Z A;  1BCM A;  4DTJ A;  1JLF A;  4DTU A;  3CQ8 A;  3DYA A;  4M45 A;  4CED A;  2ZD1 A;  3DM2 A;  4Z4H A;  4FLX A;  1ASV A;  1JLA A;  1BHL A;  5J1E A;  2HVI A;  4Z4I A;  4DFK A;  3HP9 A;  4B8A B;  4NCB A;  3LZI A;  2HHV A;  3G10 A;  3LDS A;  2HND A;  3KKR A;  1CZB A;  4PA1 A;  4BWM A;  3DI6 A;  4CIG A;  4LH5 A;  3HM9 A;  4FYD A;  3O3F A;  4DF4 A;  4I7F A;  2DTU A;  4ELT A;  3CM6 A;  3LWM A;  3QEI A;  4FJN A;  3C6U A;  4W5T A;  2GV9 A;  1T8E A;  1NK5 A;  2P5O A;  4QOZ B;  4KKO A;  4BDZ A;  4OKE A;  3B6O A;  4FLW A;  3SPY A;  1Q9Y A;  3VQ9 A;  3SUO A;  2YHB A;  4B08 A;  4F3O A;  4Z0U A;  3OYI A;  2E6M A;  4TSX A;  4DS4 A;  3AA3 A;  3P1G A;  4CE9 A;  1WSE A;  4J2D A;  1CZ9 A;  2D0A A;  4CHQ A;  3F73 A;  1RTH A;  1UAX A;  4CJV A;  1LWF A;  4IFV A;  4Q0B A;  4CEZ A;  3ZT3 A;  4ZTJ A;  4KI4 A;  4WE1 A;  3S9H A;  3BDP A;  1J53 A;  3OJU A;  2Y1J A;  1RTD A;  3LAM A;  2OPR A;  4KO0 A;  4JS4 A;  1NOY A;  3VQP A;  4IKF A;  1WAF A;  1S1T A;  1YT3 A;  2F8T A;  3NF6 A;  2HHT A;  1X9M A;  3SQ4 A;  3RMB A;  5DMR A;  4HHT A;  4GW6 A;  3SJJ A;  3DRS A;  1TAU A;  2O4G A;  1C6V A;  4Y1D A;  4DQP A;  1D5A A;  3IRX A;  1NKE A;  3ITH A;  4FW1 A;  4M3R A;  4CF1 A;  4O0I A;  4B9M A;  1KLM A;  1FK9 A;  1TL1 A;  2ATQ A;  1LAW A;  3LPU A;  3K5O A;  4OGC A;  3T1A A;  4OPK A;  3SI6 A;  4KTW A;  4N76 A;  4DSF A;  1QQC A;  4BAC A;  4CF8 A;  3ZT2 A;  2D0C A;  1X9W A;  4BE2 A;  5DK5 A;  1RBT A;  1HYV A;  1S6P A;  3TAF A;  2D0B A;  1S1X A;  3O3H A;  3OY9 A;  2ETJ A;  3MEG A;  1C1B A;  1UWB A;  1L5U A;  4N47 A;  2OYQ A;  3LP1 A;  1CXU A;  2P51 A;  3NF9 A;  2JGU A;  2EHG A;  5D3G A;  5C24 A;  1T05 A;  2HNY A;  2I5J A;  4AHU A;  2BE2 A;  2HHU A;  4N41 A;  2X6N A;  1NKB A;  1JXB A;  1BCO A;  3C94 A;  4B3O A;  4FLU A;  5HRN A;  3P5J A;  2OPP A;  3QIO A;  3TAQ A;  5FRN A;  1S5J A;  4M3Z A;  3NFA A;  2XY8 A;  4ID1 A;  2Z1G A;  1VK0 A;  1HNV A;  4I9L A;  3VQD A;  1JLE A;  3QLH A;  4CJQ A;  3QER A;  1ZYQ A;  4KTZ A;  3HPG A;  4B9T A;  3V81 A;  4F3T A;  4E7K A;  1SKR A;  1RCH A;  3AVL A;  3VQ6 A;  1JLB A;  2VG6 A;  4W5O A;  5C42 A;  4RW7 A;  1VSD A;  1S9E A;  1BIU A;  4DLG A;  3KKS A;  4ICL A;  1I3A A;  4FM2 A;  3SCX A;  3I0S A;  4E0D A;  5FDL A;  3VN5 A;  2Z1I A;  4HUG A;  3V1O A;  2R7Y A;  3DLG A;  2FC0 A;  1VSE A;  4O4G A;  3EYZ A;  3V4I A;  3AA5 X;  2OZS A;  1J9A A;  1HNI A;  1VRT A;  4R5P A;  3RMA A;  5I42 A;  1NK7 A;  1ZBH A;  3NDK A;  3OS1 A;  3TWH A;  5E41 A;  1KFS A;  2RPI A;  4CK1 A;  3ALY A;  3MAQ A;  4HTU A;  2QKK A;  2B6A A;  3ZSZ A;  1UA0 A;  3LP2 A;  4HUE A;  2DFH A;  3V9U A;  5HRO A;  2OZM A;  2XRI A;  4FJI A;  1JLC A;  3S3M A;  2X78 A;  4KFB A;  4DQR A;  1HRH A;  1X1P A;  4CJ3 A;  1D9D A;  4ELU A;  4FXD A;  3SV4 A;  1WSG A;  3DOL A;  4CFC A;  3MED A;  4KHU A;  1C1C A;  3OJS A;  1T03 A;  1TGO A;  3WNE A;  1IKW A;  4FVM A;  3ZCM A;  4CGD A;  2B5J A;  2W42 A;  2WON A;  4W5N A;  1YVU A;  3K59 A;  2AJQ A;  1EX4 A;  3AVN A;  5T7B A;  4E7H A;  3SQ1 A;  4FJJ A;  3PO4 A;  3DLK A;  3MEE A;  1J5O A;  1S9G A;  1EKE A;  1L3U A;  1SV5 A;  4J2E A;  4W5R A;  2XY6 A;  3ZSY A;  4HCB A;  1LAV A;  3JYT A;  1IH7 A;  4DTO A;  4L8R B;  3OYD A;  3NF7 A;  4CER A;  1A5W A;  3AO2 A;  2DFE A;  1IG9 A;  4KB1 A;  1HYZ A;  1NJY A;  3AVA A;  5KRS A;  2X74 A;  5HBM A;  4CIE A;  5HRP A;  3SUN A;  1KTQ A;  4CEA A;  1DTT A;  1DTQ A;  4QAG A;  4PUO A;  4O0J A;  3HXM A;  3KK3 A;  3TAN A;  3PUF A;  1HJR A;  1ASU A;  4CHY A;  3ZSW A;  4DQS A;  1N6Q A;  5I3U A;  1WLJ A;  4G1Q A;  4DSK A;  4PQU A;  1RBU A;  4NYN A;  1XHX A;  3OYL A;  1KFD A;  3KLI A;  2RN2 A;  4JLH A;  1B9F A;  2HMI A;  1RBS A;  1YTA A;  3L2V A;  1W9H A;  3VQ5 A;  3OYN A;  4KB0 A;  1RT6 A;  4FLZ A;  2YNI A;  1BI4 B;  4Z4C A;  2IDO A;  1GOA A;  4CEC A;  4BE0 A;  1L3V A;  4OLB A;  1WSF A;  4HUF A;  3V9W A;  2BGG A;  2D5R A;  3AO5 A;  4CHZ A;  1DLO A;  2XO7 A;  3QO9 A;  1WAJ A;  4JRQ A;  3T3F A;  1L3S A;  4GVM A;  4KV8 A;  3OS0 A;  3OYK A;  1SKS A;  4M3W A;  3DRR A;  3HVT A;  3MXJ A;  1LW2 A;  3PO5 A;  4PY5 A;  4CJL A;  3PX6 A;  3NGY A;  3P83 D;  4C8N A;  2G8U A;  1EET A;  3ULD A;  4C8O A;  4M3U A;  4FJ9 A;  3K57 A;  2G8K A;  3JSM A;  3HK2 A;  5JS2 A;  5CYQ A;  1TK0 A;  3B6P A;  1B9D A;  1ZBU A;  3OYG A;  3K5M A;  1TK5 A;  1LV5 A;  4F4K A;  4K8Z A;  1S1U A;  4AHV A;  2DY4 A;  4DQQ A;  1SL1 A;  1TKX A;  1RT3 A;  3IS9 A;  1RT7 A;  4EP5 A;  2E4L A;  4BE1 A;  3TR8 A;  2QXF A;  1KVA A;  2A1S A;  3SNN A;  1CLQ A;  2KZZ A;  3IG1 A;  3ZSQ A;  2FBY A;  4DTP A;  4O44 A;  3O4Q A;  3RTV A;  3OYA A;  3HPH A;  1L3T A;  3CM5 A;  1BQN A;  3ZSX A;  2IAJ A;  4KPY A;  4QCL A;  4DTR A;  4M41 A;  1VSL A;  3VA0 A;  5CYM A;  4DLE A;  3LAN A;  3AA2 A;  2IS3 A;  2YNF A;  2G8H A;  4CJW A;  3HT3 A;  3O3G A;  5KI6 A;  4FZY A;  5FRM A;  4FJ8 A;  1GOC A;  2X6S A;  5HRR A;  4FM1 A;  4FLV A;  1RDA A;  3OVN A;  2PY5 A;  4DU1 A;  3KD5 E;  3L2W A;  3AO3 A;  3OYM A;  3VQQ A;  4E89 A;  3AV9 A;  3ASM A;  5FRO A;  4E7I A;  3RMC A;  4IDK A;  3C95 A;  1Z26 A;  3TAG A;  2ZQB A;  1TK8 A;  4E7L A;  1WN7 A;  4N56 A;  2XY5 A;  1Y97 A;  2VWJ A;  4E19 A;  4O55 A;  3AO1 A;  1NK9 A;  1RBR A;  3C6T A;  3S3O A;  3THV A;  4RG8 A;  4I2Q A;  4RW9 A;  1A5X A;  1C0T A;  4B9N A;  4FLY A;  4YNQ A;  3ZSR A;  4KRF A;  5SZT A;  3KJV A;  3KLG A;  3FFI A;  4CFA A;  3DLE A;  3KLH A;  4EZ9 A;  4M3X A;  4I2P A;  5KGX A;  2RKI A;  3NE6 A;  3TI0 A;  3ZT1 A;  3M8S A;  3SV3 A;  2WOM A;  3VQC A;  4CGH A;  5HRS A;  4DFM A;  4KTQ A;  1W0H A;  4JS5 A;  4CGF A;  1U49 A;  3VQA A;  4Z4E A;  3V9X A;  1RT4 A;  2IGI A;  3ZSO A;  4RW8 A;  3K58 A;  4UQG A;  1RDB A;  1NK8 A;  1U48 A;  4HVJ A;  1IKY A;  1YTU A;  3OS2 A;  3RR8 A;  4DTX A;  4DFJ A;  4DS5 A;  1S1W A;  2HHW A;  2GUI A;  1WNS A;  1EP4 A;  4FK0 A;  3M8R A;  3H08 A;  4CFD A;  4CEF A;  3QNN A;  2KZM A;  1RNH A;  4CF2 A;  1WSH A;  2P1J A;  1QSY A;  1BI4 A;  3DLH A;  1T7P A;  1KCF A;  1SL2 A;  4CHN A;  4JRP A;  3K5N A;  3OYJ A;  4OKJ A;  2Z1J A;  3E01 A;  4IBN A;  4LY7 A;  3QEW A;  1TKD A;  3RRG A;  4FZX C;  1NJW A;  3V9Z A;  4DFP A;  5HLF A;  4DTM A;  3VQB A;  1JLG A;  3DLR A;  4MQ3 A;  4CF9 A;  4C8K A;  4CEQ A;  2JLE A;  2OPS A;  2KW4 A;  4FJL A;  4FK2 A;  2RF2 A;  2EX3 A;  2DFF A;  4CES A;  4Z4G A;  4E7J A;  2HHQ A;  1QTM A;  1KRP A;  4Q5V A;  3CYM A;  2OPQ A;  3SQ0 A;  3TAP A;  1WSJ A;  3S3N A;  3DOK A;  1HMV A;  3LAK A;  1HPZ A;  4DG1 A;  3PV8 A;  5J2N A;  5J2P A;  4DTS A;  4ZTF A;  3NH0 A;  4B9U A;  4ID5 A;  3HJF A;  4B9L A;  1O1W A;  5C25 A;  3MXI A;  4CK2 A;  3EZ5 A;  1R0A A;  4KHN A;  5KGW A;  4OLA A;  1J54 A;  3QET A;  2HW3 A;  3M8Q A;  1VRU A;  4Y1C A;  1TL3 A;  3AO4 A;  3OYF A;  3OYE A;  1RIL A;  4KHQ A;  1SKW A;  4F8R A;  3DRP A;  3OYB A;  4FJX A;  1JL2 A;  4LSL A;  4B8C A;  1XC9 A;  1D8Y A;  2PYJ A;  2VG5 A;  3EY1 A;  3O4N A;  1GOB A;  4MFB A;  3WNF A;  2Y1I A;  4E1N A;  1D9F A;  3AVH A;  1VSI A;  3V6D A;  4CK3 A;  3QEV A;  4E3S A;  3AVC A;  4DQI A;  4J2B A;  4DTN A;  3VQE A;  1BGX T;  3CFP A;  3AVK A;  3KK2 A;  1BL3 A;  3L3V A;  4AH9 A;  4CJP A;  3TAE A;  3QIN A;  4BDP A;  4W5Q A;  3VQ7 A;  4PWD A;  1LWC A;  1C0M A;  1NOZ A;  1KVB A;  4LH4 A;  1QE1 A;  4OJR A;  4CJ5 A;  4E1M A;  4YFU A;  3NH1 A;  2OA8 A;  4IFY A;  4KAZ A;  4DSI A;  4FJG A;  3RWU A;  1VSF A;  4CCH A;  4KHS A;  4FK4 A;  5KRT A;  3TAR A;  3DLB A;  4IG3 A;  4EZ6 A;  1VSK A;  1FKP A;  1S6Q A;  3ISN C;  2F8S A;  1XWL A;  4FM0 A;  1HYS A;  3AA4 A;  3HST B;  3HVR A;  2IOC A;  2LSN A;  3HPO A;  4LSN A;  5K14 A;  2BDP A;  1ASW A;  4NCG A;  2BAN A;  3WNH A;  2IC3 A;  5KTQ A;  3KLE A;  3QNO A;  4CJR A;  4OKK A;  4AHS A;  4C8L A;  1NK6 A;  4KHW A;  1RT5 A;  5CZ2 A;  1HQE A;  4BWJ A;  1TKT A;  1RBV A;  2Z1H A;  4CJU A;  1QSL A;  4CF0 A;  1NK4 A;  5CZ1 A;  1VSJ A;  4CGI A;  1EXQ A;  3U3Y A;  3QEP A;  4CFB A;  1NKC A;  4FJH A;  4IG0 A;  4XIU A;  3PX4 A;  2XY7 A;  4AHR A;  1TVR A;  1LWE A;  4C8M A;  3SUP A;  2G8F A;  4FJ5 A;  4ELV A;  3HP6 A;  1RT2 A;  4AHC A;  1U47 A;  3KTQ A;  1BIZ A;  4HCC A;  4H4O A;  3NGZ A;  4LD0 A;  3ZSV A;  3OYC A;  1MU2 A;  3KD1 E;  3CG7 A;  4N5S A;  4DSJ A;  4NCA A;  2HB5 A;  3LP3 A;  4AHT A;  1SL0 A;  1TKZ A;  4F2R A;  2E6L A;  1UOC A;  4H4M A;  3LAL A;  4CJE A;  4DMN A;  1IKX A;  1HQU A;  1RDC A;  2Q3S A;  3F9K A;  3V9S A;  4CGG A;  1K6Y A;  2ITG A;  4FJM A;  4CHP A;  4M42 A;  3TAB A;  2QK9 A;  3NH2 A;  3NGI A;  4B9V A;  3PX0 A;  4DWI A;  4J2A A;  3KIO A;  2VWK A;  4FCY A;  5HP1 A;  2F96 A;  2KQ2 A;  1LW0 A;  3U6F A; 
#chains in the Genus database with same CATH topology
 3MXM A;  1HKG A;  2AP1 A;  3L8B A;  3VF2 A;  1KAX A;  4A2A A;  3KVG A;  3LZJ A;  4KH4 A;  5I9E B;  1F21 A;  3RR7 A;  3AVG A;  1NJX A;  4CGJ A;  3WXM B;  4JK8 A;  3ZEU A;  1U45 A;  3QES A;  3CFO A;  1C0U A;  1N5Y A;  1A5V A;  4O8U A;  2UU9 K;  3CCJ N;  5JS1 A;  4YDU C;  1C0G A;  1Q8I A;  3DJC A;  4CHO A;  2UXC K;  4IO9 L;  1EO1 A;  1XMQ K;  3L2U A;  3KHY A;  3NMU A;  3T19 A;  3MDQ A;  1Z6R A;  4CZL A;  3L2Q A;  3SUQ A;  1RDD A;  3LP0 A;  1RDW X;  3TAM A;  1NJZ A;  3HO1 A;  3E9O A;  1U04 A;  4I9Q A;  2EWS A;  1GLD G;  4IZ9 A;  4RW4 A;  5FPE A;  4DU3 A;  2FBV A;  3AAQ A;  4CJK A;  1ITG A;  1TAQ A;  5ELZ A;  1RTI A;  4JKH A;  2YKN A;  1IKV A;  3HYF A;  1WSI A;  4A59 A;  1Z25 A;  4GV3 A;  3IAY A;  1FXX A;  1GLF O;  3IMX A;  5M1F A;  1IG8 A;  4RW6 A;  1ZBL A;  3ZT4 A;  1S1V A;  5LJV A;  4FO0 A;  3KK1 A;  3I8D A;  2IVP A;  1NGH A;  3I0R A;  4CJF A;  3SMS A;  3KWI A;  2XHB A;  5FPM A;  2A42 A;  5AZJ B;  2Q1N A;  1OH8 A;  1TUU A;  4Z4H A;  4RWT A;  5J1E A;  1JLA A;  2HVI A;  3M1F A;  4OO1 J;  1O13 A;  3G10 A;  1WBB A;  2HND A;  1BG3 A;  2VGM A;  4PA1 A;  3DI6 A;  3FZM A;  2DTU A;  3CM6 A;  3C6U A;  4QOZ B;  2W41 A;  3O9T A;  4OKE A;  3TSP A;  2VQE K;  4CBU A;  3B6O A;  3SPY A;  4JI0 K;  2YHW A;  3VQ9 A;  2YHB A;  4FWL A;  4JKC A;  4KH6 A;  4CD1 A;  4TSX A;  1ZXO A;  4CE9 A;  2D0A A;  3DXK A;  4CHQ A;  1RTH A;  4H0X B;  4AM7 A;  4M7X A;  3OJU A;  1TYQ A;  4F9O A;  1NOY A;  4ILG B;  1W97 L;  1S1T A;  2F8T A;  3J80 O;  4BC5 A;  2UUB K;  4U7B A;  2O4G A;  1C6V A;  4FPB A;  4JI4 K;  4CZK A;  4Y1D A;  3WQT A;  5C15 A;  3ITH A;  4H5N A;  4O0I A;  4B9M A;  3FZF A;  1KLM A;  3SI6 A;  1HUX A;  2D0C A;  3DWL A;  4U67 L;  2D0B A;  1S1X A;  1NM1 A;  2ETJ A;  2NRX A;  1L5U A;  1HR0 K;  4N47 A;  2JGU A;  5C24 A;  2Q97 A;  2BE2 A;  2A6A A;  3IFR A;  1BCO A;  1Y64 A;  4B3O A;  5FPN A;  4LF7 K;  1UA0 A;  2Z1G A;  3CJA A;  4KTZ A;  3CF5 L;  3V81 A;  4E7K A;  4JKG B;  1JLB A;  4H5V A;  1WBD A;  4M7Y A;  1VSD A;  2ZGY A;  3K9J A;  3FGU A;  2FSJ A;  3DXM A;  3SCX A;  3O4W A;  5HL7 L;  1ZBS A;  4HUG A;  3DLG A;  2FC0 A;  1HNX K;  1HNI A;  1VRT A;  3IKM A;  5EVZ A;  4BR5 A;  1XNR K;  1ZBH A;  5BRE A;  3OS1 A;  3FZK A;  4CK1 A;  1FJG K;  3LP2 A;  4MLE A;  1DT9 A;  3QML A;  5HRO A;  2XRI A;  4FJI A;  2P9U B;  2UUA K;  3S3M A;  4JEP A;  4CJ3 A;  1NMN A;  1WSG A;  4CFC A;  4A5B A;  3MED A;  1E4F T;  1TGO A;  3WNE A;  2OAN A;  2P9N B;  2B5J A;  3ZLJ A;  1YVU A;  3L4I A;  3SQ1 A;  3Q7C A;  3DLK A;  1S9G A;  4J2E A;  4W5R A;  4LFA K;  3JYT A;  1HNW K;  1OKJ A;  1E3M A;  3OYD A;  2HBL A;  4CER A;  4NB4 A;  4KB1 A;  3AVA A;  2X74 A;  1KTQ A;  2D4W A;  1DTT A;  3RVC A;  4O0J A;  3PUF A;  1HJR A;  3MN9 A;  4CHY A;  3ZSW A;  2ASO A;  5I3U A;  1WLJ A;  3E1Y A;  4G1Q A;  1KFD A;  3KLI A;  1B9F A;  2A40 A;  1W9H A;  3SK3 A;  5AJ3 K;  2I7N A;  1BI4 B;  4Z4C A;  1VQN N;  2KHO A;  1RGI A;  1WSF A;  3EZW A;  3V9W A;  2BGG A;  1NGD A;  4CHZ A;  5C10 A;  4JRQ A;  1L3S A;  3T3F A;  3OS0 A;  4PY5 A;  3DRR A;  3PO5 A;  3PX6 A;  3NGY A;  4C8N A;  3CCM N;  4BRN A;  4FJ9 A;  5CYQ A;  2O8F B;  3N4P A;  4MO4 A;  3MX5 A;  4DQQ A;  1RT7 A;  2A1S A;  3SNN A;  2KZZ A;  4CZJ A;  3GBT A;  2FBY A;  1X9J A;  2CGJ A;  3C6H A;  3CM5 A;  4CVN E;  2IAJ A;  4M41 A;  1VSL A;  4LF5 K;  2YNF A;  1WOQ A;  4CJW A;  3HT3 A;  1SZ2 A;  5KI6 A;  5DM6 L;  1JJ2 M;  2UUC K;  4FM1 A;  4DV1 K;  3L2W A;  3OYM A;  3VQQ A;  3AV9 A;  3FZH A;  5FRO A;  3RMC A;  4LF9 K;  4K41 A;  3BEX A;  4BR0 A;  3CPE A;  3TAG A;  1TK8 A;  1IJJ A;  1WN7 A;  4N56 A;  2VWJ A;  1NK9 A;  3CJ9 A;  4I2Q A;  4YOR A;  4FLY A;  5EXW A;  2P9S B;  1KC8 O;  5KGX A;  4WYB A;  2RKI A;  3NE6 A;  3TI0 A;  3I33 A;  4CGH A;  4BY9 C;  5AR0 A;  3C7N B;  3ZSO A;  1KQS M;  4BVO A;  3MWP A;  3JAM O;  3RR8 A;  1OVQ A;  2BTF A;  4DS5 A;  2GUI A;  1BWF O;  5M1P A;  3WXI A;  3M8R A;  4BRH A;  3H08 A;  4CFD A;  2O8D A;  4NLB A;  1BI4 A;  3DLH A;  2NRH A;  4A61 A;  2KLA A;  1ZC6 A;  4JRP A;  4DR3 K;  4OKJ A;  2Z1J A;  3TU5 A;  3QEW A;  1ATN A;  1NJW A;  5BPM A;  4DTM A;  1JLG A;  4CF9 A;  4C8K A;  4CEQ A;  2OPS A;  4FJL A;  4Z4G A;  1NLV A;  4B3S K;  3CYM A;  3P4I A;  5CHI A;  3SQ0 A;  3TAP A;  3LAK A;  3WEE B;  3PV8 A;  4ZTF A;  5J2N A;  3NH0 A;  3CQY A;  4DR7 K;  1QVG M;  4OLA A;  3QET A;  5AZI B;  3AO4 A;  5AZJ A;  3DRP A;  3UKU B;  3OYB A;  3CCU N;  5F2R A;  3KZB A;  1XC9 A;  1Q7Y O;  2PYJ A;  2VG5 A;  4CZH A;  2I7P A;  5EOY A;  3O4N A;  1GOB A;  3WNF A;  1VSI A;  3QEV A;  1YIJ N;  3KK2 A;  3L3V A;  3OBW A;  3QIN A;  4PHT X;  2E8A A;  3VQ7 A;  4W5Q A;  1NOZ A;  1QE1 A;  3VEZ A;  4KAZ A;  4Y0W A;  4H0T B;  3RWU A;  4CCH A;  5LMU K;  3MN7 A;  1XWL A;  1XNQ K;  2VCP A;  3AA4 A;  1QQN A;  3U9D A;  3DXM B;  4LSN A;  3FLC O;  3WNH A;  2IC3 A;  5LMN K;  4AM6 A;  4JV5 K;  3CET A;  4BG8 A;  4CJU A;  2QWQ A;  1V4S A;  5CZ1 A;  4CGI A;  3U3Y A;  3QEP A;  5FLX O;  4CFB A;  4XIU A;  3HTV A;  2XY7 A;  4X62 K;  1NGF A;  4C8M A;  3VGM A;  3HP6 A;  1RT2 A;  4LD0 A;  3ZSV A;  3CG7 A;  4N5S A;  1TKZ A;  1BUP A;  1UOC A;  3VMF B;  4FJM A;  1HQU A;  3F9K A;  1K6Y A;  4BC4 A;  3D7E O;  2V7Y A;  4BRF A;  3B8A X;  4FCY A;  5HP1 A;  4B1U B;  3NFA A;  3U6F A;  4WQ4 C;  3VTH A;  5CY4 A;  2HNZ A;  2E2N A;  4JK7 A;  3SZ2 A;  3SYZ A;  1KSP A;  4M3T A;  4RCH A;  5M1Q A;  4CEE A;  3NHG A;  4WQ5 C;  2QM1 A;  4H8K A;  3H1V X;  1KVC A;  3CER A;  2WFB A;  5BRD A;  2FXU A;  1BIS A;  1ZBF A;  2QKB A;  3D0P A;  5GIN A;  4X66 K;  2NUB A;  4FWR A;  3V1Q A;  1GLE G;  2HBJ A;  1YJN N;  2YHX A;  4JYA K;  3KLF A;  3RSE A;  5ADX H;  4KHP K;  3QEX A;  1JL1 A;  4H03 B;  4BGA A;  3K9K A;  1TUY A;  4I6M B;  4ISE A;  2ASM A;  4FZZ A;  1XHZ A;  2P9P A;  3MEC A;  4NO7 A;  1JKH A;  4BR4 A;  1CXQ A;  3MK6 A;  1XC3 A;  1XI1 A;  1C1A A;  3H45 C;  4DU4 A;  2GBZ A;  4ILJ A;  1YXQ A;  4KB0 A;  1GLL O;  3SQ2 A;  1UA1 A;  1B92 A;  2P9K B;  3DAW A;  4ZHR A;  5BPN A;  5H1S Q;  5F1X A;  4J8F A;  5J2M A;  1Q9X A;  4A2B A;  2HVH A;  2YNH A;  4JKB A;  3MN6 A;  3AAR A;  3O80 A;  3RMD A;  5JIC A;  3QIP A;  5KPT A;  3AVF A;  3EE8 A;  3R6M A;  5AQG A;  1RT1 A;  3D45 A;  4M3Y A;  5AQK A;  4KI6 A;  1KXP A;  2CGL A;  3UKU A;  3EE9 A;  2P9K A;  1KLN A;  3F9M A;  4BRL A;  5AQX A;  4DF8 A;  4B1X B;  3G0Z A;  3AGR A;  3M3Z A;  3VGL A;  4DTJ A;  1JLF A;  4DTU A;  1VQ8 N;  3I56 N;  3H46 O;  3DM2 A;  3O08 A;  1ASV A;  2HHV A;  4DFK A;  3HP9 A;  4I7F A;  1QZ5 A;  4FWP A;  2HBM A;  4W5T A;  2P5O A;  3A5N C;  4KKO A;  3WXJ A;  4C1N I;  4BDZ A;  1Q9Y A;  2E88 A;  2IVN A;  4B08 A;  5CR4 A;  4Z0U A;  1DGK N;  4DS4 A;  3AA3 A;  4J2D A;  1CZ9 A;  4FOI A;  4B1V A;  2YX6 A;  1VAZ A;  4Q0B A;  3ZEU B;  3ZT3 A;  3CJC A;  3S9H A;  3BDP A;  1J53 A;  3CI5 A;  4CZG A;  4KO0 A;  3LDN A;  2E2Q A;  4A5A A;  4IKF A;  2E2O A;  1X9M A;  1BOT O;  3L4Q A;  4GW6 A;  3DRS A;  1D5A A;  4FW1 A;  4M3R A;  2ATQ A;  5BN9 A;  3HBT A;  1OVY A;  3LPU A;  4OGC A;  4OPK A;  3CME N;  2UXB K;  4DSF A;  5DK5 A;  1HYV A;  3TAF A;  5AQM A;  3MEG A;  1C1B A;  1YVN A;  1UWB A;  5AQU A;  4IEE A;  3LP1 A;  4CZF A;  3NF9 A;  1T05 A;  1GLB G;  3FZL A;  1NKB A;  3W0L A;  4EFH A;  3P5J A;  5FRN A;  4FL9 A;  1S5J A;  5AQV A;  4M3Z A;  5FPD A;  2XY8 A;  4I9L A;  4K25 A;  1HNV A;  1NGI A;  3H3N O;  5AQZ A;  4B9T A;  2IIR A;  4JI1 K;  1SKR A;  5JLH A;  3F2K A;  3WXK A;  1BIU A;  4DLG A;  4ICL A;  4Z94 A;  3VN5 A;  5BRF A;  3S41 A;  2R7Y A;  1NGJ A;  4OX9 K;  4BR7 A;  4BG9 A;  3ALY A;  4HTU A;  1BO5 O;  3THW B;  3A5M C;  4HUE A;  3PIO L;  4ILH A;  1X1P A;  3O9Q A;  4LC9 B;  1Q86 O;  1D9D A;  2QTD A;  4ELU A;  3VES A;  4UY8 O;  3DOL A;  2OTJ N;  3F5T A;  4KHU A;  5LL6 Z;  3PIP L;  3IUC A;  3ZCM A;  4CGD A;  1VQL N;  1EX4 A;  3CMA N;  3PO4 A;  1SV5 A;  3D2F A;  2HF4 A;  4O5F A;  3ZSY A;  4HCB A;  4L8R B;  3NF7 A;  1NG9 A;  1A5W A;  4BRK A;  2DFE A;  3CCV N;  1NJY A;  5HBM A;  5HRP A;  3SUN A;  3TTD A;  1DTQ A;  4PUO A;  3KK3 A;  1YJW N;  4NCA A;  1ASU A;  3THX A;  1XHX A;  2F9W A;  3OYL A;  2RN2 A;  2HMI A;  4BC3 A;  3L2V A;  1JCE A;  3MWT A;  1RT6 A;  1J6Z A;  1GOA A;  4OLB A;  1L3V A;  4L3Q A;  3T7Z A;  4BRG A;  3HOT A;  2HHX A;  1SKS A;  3MXJ A;  1LW2 A;  2G8U A;  4C8O A;  3ULD A;  3JSM A;  3FR0 A;  4NXM K;  1TK0 A;  1B9D A;  1LV5 A;  4K8Z A;  1S1U A;  3CC7 N;  2DY4 A;  2OTL N;  1Q82 O;  1RT3 A;  1HKB A;  2E4L A;  4BE1 A;  3TR8 A;  3H1Q A;  4JKG A;  4MDB A;  1ESV A;  2O8B B;  2P9S A;  4DTP A;  2RE2 A;  2QWO A;  1GLJ O;  3MN5 A;  1Q81 O;  3VA0 A;  4DLE A;  2G8H A;  3AA2 A;  2HOE A;  3R9P A;  3MX2 A;  4BRC A;  3KD5 E;  3MMV A;  1P8Z A;  4E89 A;  4IDH A;  3ASM A;  2O8E B;  1Z26 A;  3G71 N;  2NLX A;  4O55 A;  3AO1 A;  1I94 K;  3S3O A;  1YJ9 N;  4RG8 A;  4CW7 B;  2UXD K;  4B9N A;  4YNQ A;  3ZSR A;  3KLG A;  4CFA A;  4EZ9 A;  4M3X A;  4I2P A;  1U2V A;  2ZJP L;  3SV3 A;  3VQC A;  5HRS A;  4ISF A;  5TKY A;  4H5T A;  2IGI A;  3K58 A;  1HX1 A;  4YY3 K;  3TPQ A;  1IKY A;  4FWQ A;  3OS2 A;  1YTU A;  4LFB K;  4DTX A;  3SAH A;  5EX5 A;  4DFJ A;  3A0I X;  3DXK B;  1S1W A;  1WNS A;  1EP4 A;  4FK0 A;  2E20 A;  4CEF A;  3QNN A;  1HPM A;  4K42 A;  4CF2 A;  2GWK A;  2Q36 A;  3A8Y A;  2GX9 A;  1E4G T;  3SBG A;  4CHN A;  3E01 A;  4IBN A;  4DCH A;  1IBK K;  3VQB A;  3J8A A;  1U6Z A;  4DV0 K;  4E7J A;  2PAV A;  1V4T A;  1KRP A;  1WSJ A;  1HMV A;  1HPZ A;  2WC9 A;  5J2P A;  4DTS A;  4FPA A;  5C2D A;  4B9L A;  1O1W A;  3LDP A;  5C25 A;  3MXI A;  4YHH K;  1Q18 A;  1R0A A;  2HW3 A;  1TL3 A;  3GE1 A;  3OYE A;  4KHQ A;  4F8R A;  2O8C A;  3ATV A;  1JL2 A;  4B8C A;  4DR4 K;  4JKE A;  2HHH K;  1D9F A;  2Y1I A;  2E5L K;  4CK3 A;  4J2B A;  4E3S A;  3AVC A;  4DQI A;  3VQE A;  3AVK A;  4BRD A;  4BDP A;  2V51 B;  2P9U A;  3NH1 A;  4IFY A;  4FK4 A;  4BQZ A;  5KRT A;  4CJ7 A;  3TAR A;  4IXC A;  3DLB A;  1LCU A;  4EZ6 A;  4IO8 A;  3CCR N;  1S6Q A;  3VF4 A;  4A57 A;  3U8X A;  2QXL A;  3ZET B;  2YI1 A;  3O1W A;  1HYS A;  2LSN A;  3EN9 A;  3HPO A;  3TSU A;  3J81 O;  4LF6 K;  5KTQ A;  3QNO A;  4CJR A;  2Z1H A;  3CCQ N;  3I8B A;  1J5E K;  3CJB A;  1EXQ A;  5HOO A;  2CH6 A;  1T3V A;  2Q2R A;  1K8K A;  3RSE B;  4G9Z A;  4ELV A;  4AHC A;  4H4O A;  1MU2 A;  4AHT A;  4PKI A;  4FSV A;  3VOV A;  1IKX A;  4CHP A;  5ADX A;  2QA4 N;  4PL7 A;  4B9V A;  4J2A A;  3KIO A;  2F96 A;  1LW0 A;  5C12 A;  5JLF A;  3LWL A;  3SMP A;  3VQ4 A;  4GV9 A;  3ZT0 A;  4AIL C;  3SPZ A;  4WCE L;  1M1K O;  4DSL A;  5EU7 A;  1IO2 A;  2FBT A;  3D2E B;  3SJH A;  2RHK A;  4GY2 B;  1S72 N;  3O9S A;  4BQL A;  2W40 A;  3L2R A;  2YJE A;  4DV7 K;  4K8X A;  4IOA L;  4YOV A;  1NGG A;  1XUP O;  3OYH A;  2GWJ A;  3HOS A;  3VEY A;  3LPT A;  3PY8 A;  4EHT A;  4OPJ A;  1QS4 A;  1BQM A;  3VEN A;  3NBP A;  4DUY K;  5MLC Q;  3QDK A;  3NCI A;  3UIQ A;  2VG7 A;  4KHY A;  4GMJ B;  5LY3 A;  3NF8 A;  2ZJR L;  4CEO A;  4CJT A;  1I39 A;  2BUP A;  4CIF A;  4X64 K;  5F0X A;  1SQK A;  2Q0U A;  2ZGZ A;  2V7Z A;  1QHT A;  3M6G A;  3A2F A;  2PYL A;  3BZC A;  3TSQ A;  2YKM A;  4OVL A;  3DMJ A;  1RTJ A;  4CD3 A;  4Z4F A;  4YOT A;  4IWV A;  3NAE A;  1QSS A;  3H3O B;  3V1R A;  2YCH A;  2YHA A;  4CJS A;  3K5L A;  2ZE2 A;  3AVJ A;  1FKO A;  4GV6 A;  2DPN A;  2G8W A;  1VHX A;  2E1Z A;  2D0O A;  1VQ6 N;  3AVB A;  2A1R A;  4CI6 A;  1JXE A;  5SWM A;  2FSN A;  4JNE A;  1W2B M;  3L3U A;  1JLQ A;  3P38 A;  1NK0 A;  1VSH A;  5AZI A;  4DR1 K;  1NBW A;  5AFU A;  4FJ7 A;  1BCM A;  3GL1 A;  2PBD A;  3MCP A;  4M45 A;  4ISG A;  4FLX A;  1BHL A;  4B8A B;  4NCB A;  3D6R A;  2QWN A;  4BWM A;  3CPW M;  3HM9 A;  3LDL A;  4LH5 A;  3O3F A;  4DF4 A;  3R8E A;  4ELT A;  3LWM A;  2GV9 A;  1NK5 A;  4JKA A;  5M1O A;  1H1V A;  3ZX3 A;  4DV6 K;  4DR6 K;  4FWS A;  2JWK A;  2KKZ A;  3GDQ A;  2ZWH A;  4F3O A;  2VYP A;  2JWL A;  3OYI A;  2E6M A;  3VPZ A;  2VWB A;  4B1Y B;  1MA9 B;  3F73 A;  5BR9 A;  3J7A P;  1UAX A;  5AQT A;  4CJV A;  4ZTJ A;  3LAM A;  2OPR A;  4JS4 A;  3VQP A;  3C7N A;  4BRE A;  1QVF M;  4PKG A;  1YT3 A;  4AF1 A;  3NF6 A;  4WFA L;  3RMB A;  3FFK B;  4HHT A;  3CXC M;  4DV3 K;  3QBX A;  4DQP A;  1NKE A;  2PFU A;  4CF1 A;  1FK9 A;  1TL1 A;  3T1A A;  1LAW A;  3K5O A;  3U9Z A;  1W7A A;  5TKW A;  3ENO A;  4KTW A;  4XEI A;  4BAC A;  3OBY A;  2Q0R A;  2O8E A;  3HZ6 A;  1X9W A;  4BE2 A;  1RBT A;  1S6P A;  4DQ8 A;  3O3H A;  3OY9 A;  5KPZ A;  5GAD P;  1NGB A;  1CXU A;  5AQJ A;  5KQ8 A;  4DKW A;  1FW6 A;  2I5J A;  4AHU A;  4JHD B;  2E1Y A;  3C94 A;  1YUW A;  4FLU A;  3SAG A;  2FLO A;  3VQD A;  5FRM A;  1JLE A;  3QLH A;  3QER A;  1ZYQ A;  1IBL K;  3HSC A;  3T1Y K;  1RCH A;  3VQ6 A;  2QWM A;  5C42 A;  4JKD A;  5BR8 K;  5E84 A;  4RTF D;  3I0S A;  1NMD A;  4C1N K;  3V1O A;  3ZET A;  4O4G A;  3LL3 A;  3V4I A;  1NK7 A;  4R5P A;  1KFS A;  3TWH A;  5E41 A;  3CD6 N;  3MAQ A;  4B3T K;  3ZSZ A;  5GIO A;  2DFH A;  4XH1 A;  4KFB A;  1HRH A;  4FXD A;  3SV4 A;  4FWM A;  1XMO K;  1C1C A;  3OJS A;  1T03 A;  1ILY A;  2W42 A;  2WON A;  4W5N A;  3W3D A;  2XY6 A;  1LAV A;  1IH7 A;  3AO2 A;  1IG9 A;  1HYZ A;  5KRS A;  2P9L B;  1D4X A;  3CQX A;  2QW9 A;  1DEJ A;  4QAG A;  3HXM A;  3R3L A;  4BC2 A;  4GKK K;  2P9N A;  1N6Q A;  2UYT A;  1ATR A;  5JMV A;  1NWK A;  4X65 K;  1HNZ K;  1RBU A;  4WQ4 A;  4NYN A;  4QS9 A;  4JLH A;  1RBS A;  1YTA A;  2J4R A;  1N32 K;  1G99 A;  5C2F A;  3OYN A;  4LF4 K;  2YNI A;  2IDO A;  4CEC A;  4DUZ K;  1OH5 A;  4HUF A;  3THW A;  2O8D B;  1QZ6 A;  3AO5 A;  4C8L A;  1WAJ A;  4M3W A;  3OYK A;  4H5R A;  1M90 O;  3CCL N;  3K57 A;  3OYG A;  3PSI A;  2NRW A;  4OPH A;  1U2V B;  1CLQ A;  4O44 A;  3O4Q A;  1YAG A;  2ASP A;  1L3T A;  4IFE A;  4HWI A;  4QCL A;  2H3G X;  1LOT B;  4H0P A;  5CYM A;  3EL2 A;  2IS3 A;  1BDG A;  3CJ7 A;  1N34 K;  4FLV A;  4DU1 A;  3AO3 A;  4DHY A;  3K0S A;  4IDK A;  3C95 A;  4E7L A;  1Y97 A;  2W6L A;  4E19 A;  1RBR A;  3THV A;  1NGA A;  1RDU A;  5M1K A;  1A5X A;  1KAZ A;  4KRF A;  3KWG A;  4BRP A;  5SZT A;  3KJV A;  4FWN A;  3DLE A;  4KH5 A;  5LJW A;  2O8B A;  3ATU A;  3ZT1 A;  3M8S A;  4YOY A;  2ITM A;  4DFM A;  3J7Y P;  1W0H A;  4JS5 A;  1VQO N;  4CGF A;  3VQA A;  1VQK N;  3V9X A;  3OA9 A;  3VET A;  4UQG A;  1NK8 A;  1OH6 A;  3JXU A;  2D1K A;  2E2P A;  3CCE N;  3QFU A;  2HHW A;  3HM8 A;  4FOE A;  4BRM A;  1WSH A;  1QSY A;  1SL2 A;  3G6E N;  3ZX0 A;  3OYJ A;  3RRG A;  4WF9 L;  4FZX C;  3V9Z A;  3THX B;  3C65 A;  3DLR A;  1NGE A;  1SAZ A;  2KW4 A;  2RF2 A;  2EX3 A;  2DFF A;  4H5W A;  2HHQ A;  5BN8 A;  3BP8 A;  4Q5V A;  2OPQ A;  4IEI A;  4A62 A;  1XQS C;  3DOK A;  4DG1 A;  1X3N A;  4B9U A;  1JCF A;  4ID5 A;  3HJF A;  3ZYY X;  3G25 A;  3HI0 A;  3WUH A;  1J54 A;  3D2F B;  1S3X A;  3M8Q A;  1VRU A;  3OYF A;  5IT9 O;  1RIL A;  1SKW A;  4LSL A;  5C0Y A;  3AVH A;  1N8R O;  5GAH P;  4DTN A;  3KK7 A;  4B9Q A;  2ZF5 O;  4JD2 B;  3CFP A;  1BL3 A;  4AH9 A;  4DV5 K;  1VQ7 N;  1LWC A;  4LH4 A;  1KVB A;  4BVP A;  4YFU A;  3VF6 A;  2OA8 A;  4CBW A;  4DSI A;  4FJG A;  1VSF A;  4KHS A;  3UKR A;  4JN4 A;  3SAF A;  2NNW A;  5JVG L;  4IG3 A;  4B3R K;  1VSK A;  4HTL A;  3ISN C;  3MCA B;  1K8A O;  2F8S A;  3R1X A;  3M5R A;  3PLA A;  3HVR A;  2IOC A;  2CGK A;  1NJI O;  5K14 A;  4CZM A;  1ASW A;  3SLC A;  3KLE A;  3O9U A;  3AY9 A;  1C0F A;  3OHR A;  1RT5 A;  4BWJ A;  4I6M A;  4CF0 A;  4R79 A;  1NKC A;  3HRG A;  4FJH A;  1N36 K;  4IG0 A;  2GEM A;  5E26 A;  4AQY K;  3CIP A;  1T44 A;  4IJA A;  1TVR A;  4FJ5 A;  2W6K A;  2YHY A;  4B1W B;  3DLL L;  4LF8 K;  3NGZ A;  4B3M K;  3OYC A;  1NNE A;  2F9T A;  2QWP A;  4MLH A;  4BRQ A;  2HB5 A;  3LP3 A;  4F2R A;  3UB5 A;  2QEX N;  1KAY A;  3LAL A;  4H4M A;  4DMN A;  2Q3S A;  1HJO A;  1IBM K;  2ITG A;  4M42 A;  4XH4 A;  3NVM A;  3NVK A;  1MWM A;  2NRZ A;  3NH2 A;  4XH5 A;  4JAX A;  2VWK A;  1C0T A;  2KQ2 A;  4IOC L;  3RRH A;  2FSK A;  2GTD A;  4DR5 K;  3VA3 A;  3TTC A;  2P5G A;  3G4S N;  4FJK A;  3O8M A;  1SUQ A;  1G15 A;  3K2P A;  4EP4 A;  4FVU A;  2HBK A;  2FBX A;  4FWO A;  3OW2 M;  1TYQ B;  4M63 C;  3J7Z O;  4H0V B;  5AQN A;  4FLT A;  4DSE A;  4OGE A;  3IDH A;  2B4J A;  1WB9 A;  1X9S A;  2GUP A;  2P9I B;  4MDA A;  2O4I A;  4CEB A;  4CJ4 A;  1X3M A;  1U4B A;  1K8K B;  1HKC A;  4NYF A;  1REV A;  2KFN A;  3LM2 A;  3WNG A;  1YI2 N;  3T69 A;  3VQ8 A;  3BGR A;  4O5B A;  4F2S A;  4JI2 K;  3HL8 A;  5AFU H;  4BRO A;  3VEV A;  2G8V A;  1VSM A;  2IVO A;  2A3Z A;  3LDO A;  2YNG A;  4O8K A;  3AVM A;  1ZBI A;  3C6A A;  5J2Q A;  5BRH A;  4B9S A;  3UKR B;  4BDY A;  3CFR A;  2HHS A;  1TV6 A;  4FW2 A;  3T1H K;  1YF5 L;  2KFZ A;  3O9R A;  4JD2 A;  3U3G A;  2KTQ A;  1SS6 A;  5KPR A;  2PZS A;  3AVI A;  4DV4 K;  3EKS A;  1QQO A;  3M8P A;  2YV0 X;  1VQ5 N;  2G8I A;  3CHW A;  4EAH D;  5AQH A;  4JI8 K;  3CQ8 A;  4DV2 K;  3DYA A;  4CED A;  2ZD1 A;  3WEE A;  2YJF A;  1VQM N;  5CE3 A;  4Z4I A;  4NXN K;  3LZI A;  3AAP A;  3LDS A;  3KKR A;  1CZB A;  4FYD A;  4CIG A;  2P9P B;  5AQL A;  3QEI A;  4FJN A;  1T8E A;  2FF3 B;  4CBX A;  5A2Q O;  5JVH L;  2WBN A;  4KBO A;  4FLW A;  1KD1 O;  2D0P A;  3JS6 A;  3SUO A;  3EKU A;  3L0Q A;  1NU0 A;  3P1G A;  4H0Y B;  1WSE A;  4WQ5 A;  1EQY A;  1LWF A;  4IFV A;  4CEZ A;  4KI4 A;  4WE1 A;  2Y1J A;  1RTD A;  1WAF A;  2HHT A;  4YOU A;  3D2E A;  3SQ4 A;  3FE1 A;  5DMR A;  2NRT A;  5AQO A;  1MWK A;  3SJJ A;  3ZX2 A;  5M1N A;  3ENB A;  5GAE P;  2QI2 A;  3IRX A;  1OH7 A;  4DR2 K;  3VEO A;  5AQR A;  4N76 A;  1QQC A;  4CF8 A;  3ZT2 A;  4GKJ K;  1K9M O;  2OYQ A;  1EWR A;  2P51 A;  3U4L A;  2EHG A;  4BRI A;  5D3G A;  2HNY A;  2HHU A;  4N41 A;  2X6N A;  1JXB A;  1YHQ N;  1GLA G;  5AQI A;  4MO5 A;  5HRN A;  2OPP A;  3QIO A;  3TAQ A;  4C23 A;  4ID1 A;  1VK0 A;  3E9L A;  4CJQ A;  3HPG A;  4IOX A;  4F3T A;  5AQF A;  3AVL A;  3SBT A;  2VG6 A;  4W5O A;  4RW7 A;  1S9E A;  4E1J A;  4JK9 A;  1NGC A;  1BA1 A;  1DKG D;  3KKS A;  1I3A A;  4BRA A;  4FM2 A;  4E0D A;  5FDL A;  2O8F A;  5IWA K;  2Z1I A;  5AQY A;  5AQS A;  1VSE A;  3EYZ A;  4BR9 A;  2WTU A;  3AA5 X;  4JKF A;  2OZS A;  1J9A A;  3RMA A;  4YDU A;  5I42 A;  3NDK A;  2RPI A;  3THY A;  2QKK A;  2B6A A;  2OCE A;  3V9U A;  2OZM A;  4LFC K;  1JLC A;  2X78 A;  2BH1 A;  4DQR A;  1VQP N;  2CH5 A;  1S22 A;  1JCG A;  4K0K K;  1IKW A;  4FVM A;  4IJN A;  4JI6 K;  2AJQ A;  3K59 A;  5EY4 A;  3AVN A;  3EEQ A;  5T7B A;  4E7H A;  4FJJ A;  2O8C B;  3MEE A;  1J5O A;  1L3U A;  1EKE A;  4DTO A;  3VER A;  1YIT N;  3P31 A;  3VEW A;  4DB3 A;  4WFB L;  4YOW A;  1CZA N;  4CIE A;  1VQ4 N;  2QWL A;  4WFN L;  4CEA A;  3TAN A;  3VEX A;  3LM9 A;  3H6E A;  3ID8 A;  4DQS A;  3GOI A;  4PQU A;  4DSK A;  3VTI A;  2ZM6 K;  3CC2 N;  1TAU A;  4PKH A;  3P39 A;  4GVE A;  3UE5 A;  3VQ5 A;  3N4Q A;  4EIA A;  4FLZ A;  4BE0 A;  1QHA A;  1BA0 A;  2D5R A;  3EO3 A;  1DLO A;  2XO7 A;  3QO9 A;  1QQM A;  3KTQ A;  3HK2 A;  4GVM A;  4KV8 A;  3HVT A;  3THY B;  4CJL A;  3P83 D;  3BF1 A;  1EET A;  3O6W A;  4M3U A;  5BPL A;  2G8K A;  5JS2 A;  3ULE B;  3B6P A;  1ZBU A;  3K5M A;  1T6C A;  4NLC A;  1TK5 A;  3WT0 A;  4F4K A;  1P90 A;  4AHV A;  3QIC A;  1SL1 A;  3Q7B A;  1TKX A;  4PL8 A;  3IS9 A;  4EP5 A;  2AA4 A;  2QXF A;  1KVA A;  3O5B A;  3IG1 A;  2HST A;  3ZSQ A;  2NRR A;  3RTV A;  3OYA A;  3HPH A;  1BQN A;  3ZSX A;  3A5O C;  4KPY A;  4DTR A;  2FF6 A;  3LAN A;  3PSF A;  3O3G A;  1R59 O;  4FZY A;  3OTO K;  3CC4 N;  4FJ8 A;  1GOC A;  2X6S A;  5HRR A;  4OPA A;  1RDA A;  3OVN A;  4EHU A;  2PY5 A;  3I55 N;  5AQW A;  4E7I A;  2ZJQ L;  4FWK A;  2ZQB A;  1HLU A;  2A5X A;  3BY5 A;  2XY5 A;  4JI5 K;  2HF3 A;  1ATS A;  3C6T A;  4K43 A;  4RW9 A;  4QS8 A;  1K73 O;  4H0O A;  3E66 A;  2HMP A;  3FFI A;  2GEL A;  3KLH A;  1RFQ A;  4KRE A;  4JI7 K;  2WOM A;  4KTQ A;  1U49 A;  3QFP A;  4Z4E A;  1RT4 A;  1GLC G;  4RW8 A;  2VQF K;  3ULE A;  1RDB A;  1U48 A;  4HVJ A;  4BGB A;  1N33 K;  1T6D A;  4QS7 A;  5DM7 L;  3CCS N;  2NZT A;  3QB0 A;  4B1Z A;  2NRV A;  3L6Q A;  2KZM A;  2V52 B;  1RNH A;  4CZI A;  2P1J A;  1T7P A;  1KCF A;  3K5N A;  4LY7 A;  1TKD A;  5HLF A;  4DFP A;  4MQ3 A;  4FK2 A;  2JLE A;  4CES A;  3O1B A;  1QTM A;  3A5L C;  2P9L A;  3S3N A;  5GAG P;  5GIP A;  2F7T A;  3AGK A;  4CK2 A;  3QBW A;  3EZ5 A;  4KHN A;  5KGW A;  3E9P A;  4Y1C A;  3GG4 A;  3LDQ A;  4FJX A;  4GNI A;  1D8Y A;  3EY1 A;  4MFB A;  1BU6 O;  4E1N A;  4YOX A;  4BR2 A;  3ENH A;  3V6D A;  1BGX T;  3TAE A;  3C0B A;  4CJP A;  4PWD A;  5KQD A;  4E1M A;  1C0M A;  4CJ5 A;  4OJR A;  1Z05 A;  3CJ1 A;  4JI3 K;  1FKP A;  3BZK A;  1MDU B;  4FM0 A;  4CZE A;  3HST B;  3WQU A;  5AQQ A;  2BDP A;  4NCG A;  2BAN A;  5B8H A;  3BF3 A;  3BUZ B;  4OKK A;  4AHS A;  2QWR A;  1NK6 A;  4KHW A;  2F4V K;  2VGN A;  2A41 A;  5CZ2 A;  1HQE A;  1QSL A;  1TKT A;  1RBV A;  3VGK A;  1NK4 A;  2Q31 A;  1VSJ A;  4V19 S;  3PX4 A;  4AHR A;  3SUP A;  1LWE A;  5AQP A;  2G8F A;  4JHD A;  1U47 A;  1EWQ A;  1BIZ A;  4HCC A;  1WUA A;  3KD1 E;  4DSJ A;  2P9I A;  1SL0 A;  2E6L A;  4CJE A;  3V9S A;  1IV0 A;  1RDC A;  2WUS A;  3ID6 A;  4CGG A;  1VQ9 N;  3TAB A;  2QK9 A;  3WXL A;  3NGI A;  3PX0 A;  4DWI A;  3TTF A; 
#chains in the Genus database with same CATH homology
 3LWL A;  3MXM A;  3RRH A;  3VQ4 A;  5CY4 A;  3ZT0 A;  2HNZ A;  4AIL C;  3L8B A;  3SPZ A;  3VA3 A;  3SZ2 A;  3SYZ A;  2P5G A;  4FJK A;  1KSP A;  4DSL A;  3LZJ A;  4M3T A;  5EU7 A;  4CEE A;  1IO2 A;  1SUQ A;  2FBT A;  3NHG A;  1F21 A;  3RR7 A;  1G15 A;  3K2P A;  4H8K A;  4EP4 A;  3AVG A;  1KVC A;  2FBX A;  1NJX A;  4CGJ A;  3L2R A;  1BIS A;  1ZBF A;  4FLT A;  2QKB A;  3D0P A;  4OGE A;  4DSE A;  1U45 A;  2NUB A;  3QES A;  3CFO A;  1C0U A;  2B4J A;  1N5Y A;  4K8X A;  1X9S A;  1A5V A;  3V1Q A;  5JS1 A;  4CHO A;  1Q8I A;  3OYH A;  4CEB A;  4CJ4 A;  2O4I A;  3KLF A;  3LPT A;  3PY8 A;  1U4B A;  4NYF A;  1REV A;  3L2U A;  2KFN A;  4OPJ A;  3WNG A;  1JL1 A;  1QS4 A;  3QEX A;  1BQM A;  3NBP A;  3VQ8 A;  3NCI A;  3T19 A;  3BGR A;  4O5B A;  3UIQ A;  2VG7 A;  4KHY A;  4F2S A;  4GMJ B;  4FZZ A;  3L2Q A;  3SUQ A;  3HL8 A;  1RDD A;  3LP0 A;  3NF8 A;  3TAM A;  4CEO A;  1XHZ A;  3MEC A;  1NJZ A;  4CJT A;  1I39 A;  1JKH A;  2G8V A;  3HO1 A;  1U04 A;  4CIF A;  4I9Q A;  1VSM A;  1CXQ A;  4RW4 A;  4DU3 A;  1XI1 A;  1C1A A;  4DU4 A;  1QHT A;  2GBZ A;  2FBV A;  2YNG A;  3A2F A;  2PYL A;  3AVM A;  1ZBI A;  4CJK A;  1ITG A;  1TAQ A;  2YKM A;  3DMJ A;  1RTJ A;  4OVL A;  5J2Q A;  3SQ2 A;  1UA1 A;  1B92 A;  4B9S A;  4Z4F A;  1RTI A;  3NAE A;  4ZHR A;  4BDY A;  2YKN A;  1IKV A;  3HYF A;  1WSI A;  3CFR A;  1QSS A;  3V1R A;  1Z25 A;  2YHA A;  4CJS A;  1TV6 A;  3K5L A;  4FW2 A;  5J2M A;  2HHS A;  3IAY A;  2ZE2 A;  1Q9X A;  3AVJ A;  1FKO A;  2HHX A;  2HVH A;  1FXX A;  2YNH A;  2KFZ A;  2G8W A;  3RMD A;  3QIP A;  4RW6 A;  3AVF A;  3AVB A;  2A1R A;  1ZBL A;  3ZT4 A;  1JXE A;  1S1V A;  1RT1 A;  3U3G A;  5SWM A;  3D45 A;  3KK1 A;  2KTQ A;  3I8D A;  3I0R A;  4M3Y A;  3L3U A;  4CJF A;  4KRE A;  1JLQ A;  2PZS A;  3AVI A;  2XHB A;  4KI6 A;  1NK0 A;  1VSH A;  3M8P A;  2YV0 X;  1KLN A;  2G8I A;  4DF8 A;  4FJ7 A;  3G0Z A;  1BCM A;  4DTJ A;  1JLF A;  4DTU A;  3CQ8 A;  3DYA A;  4M45 A;  4CED A;  2ZD1 A;  3DM2 A;  4Z4H A;  4FLX A;  1ASV A;  1JLA A;  1BHL A;  5J1E A;  2HVI A;  4Z4I A;  4DFK A;  3HP9 A;  4B8A B;  4NCB A;  3LZI A;  2HHV A;  3G10 A;  3LDS A;  2HND A;  3KKR A;  1CZB A;  4PA1 A;  4BWM A;  3DI6 A;  4CIG A;  4LH5 A;  3HM9 A;  4FYD A;  3O3F A;  4DF4 A;  4I7F A;  2DTU A;  4ELT A;  3CM6 A;  3LWM A;  3QEI A;  4FJN A;  3C6U A;  4W5T A;  2GV9 A;  1T8E A;  1NK5 A;  2P5O A;  4QOZ B;  4KKO A;  4BDZ A;  4OKE A;  3B6O A;  4FLW A;  3SPY A;  1Q9Y A;  3VQ9 A;  3SUO A;  2YHB A;  4B08 A;  4F3O A;  4Z0U A;  3OYI A;  2E6M A;  4TSX A;  4DS4 A;  3AA3 A;  3P1G A;  4CE9 A;  1WSE A;  4J2D A;  1CZ9 A;  2D0A A;  4CHQ A;  3F73 A;  1RTH A;  1UAX A;  4CJV A;  1LWF A;  4IFV A;  4Q0B A;  4CEZ A;  3ZT3 A;  4ZTJ A;  4KI4 A;  4WE1 A;  3S9H A;  3BDP A;  1J53 A;  3OJU A;  2Y1J A;  1RTD A;  3LAM A;  2OPR A;  4KO0 A;  4JS4 A;  1NOY A;  3VQP A;  4IKF A;  1WAF A;  1S1T A;  1YT3 A;  2F8T A;  3NF6 A;  2HHT A;  1X9M A;  3SQ4 A;  3RMB A;  5DMR A;  4HHT A;  4GW6 A;  3SJJ A;  3DRS A;  1TAU A;  2O4G A;  1C6V A;  4Y1D A;  4DQP A;  1D5A A;  3IRX A;  1NKE A;  3ITH A;  4FW1 A;  4M3R A;  4CF1 A;  4O0I A;  4B9M A;  1KLM A;  1FK9 A;  1TL1 A;  2ATQ A;  1LAW A;  3LPU A;  3K5O A;  4OGC A;  3T1A A;  4OPK A;  3SI6 A;  4KTW A;  4N76 A;  4DSF A;  1QQC A;  4BAC A;  4CF8 A;  3ZT2 A;  2D0C A;  1X9W A;  4BE2 A;  5DK5 A;  1RBT A;  1HYV A;  1S6P A;  3TAF A;  2D0B A;  1S1X A;  3O3H A;  3OY9 A;  2ETJ A;  3MEG A;  1C1B A;  1UWB A;  1L5U A;  4N47 A;  2OYQ A;  3LP1 A;  1CXU A;  2P51 A;  3NF9 A;  2JGU A;  2EHG A;  5D3G A;  5C24 A;  1T05 A;  2HNY A;  2I5J A;  4AHU A;  2BE2 A;  2HHU A;  4N41 A;  2X6N A;  1NKB A;  1JXB A;  1BCO A;  3C94 A;  4B3O A;  4FLU A;  5HRN A;  3P5J A;  2OPP A;  3QIO A;  3TAQ A;  5FRN A;  1S5J A;  4M3Z A;  3NFA A;  2XY8 A;  4ID1 A;  2Z1G A;  1VK0 A;  1HNV A;  4I9L A;  3VQD A;  1JLE A;  3QLH A;  4CJQ A;  3QER A;  1ZYQ A;  4KTZ A;  3HPG A;  4B9T A;  3V81 A;  4F3T A;  4E7K A;  1SKR A;  1RCH A;  3AVL A;  3VQ6 A;  1JLB A;  2VG6 A;  4W5O A;  5C42 A;  4RW7 A;  1VSD A;  1S9E A;  1BIU A;  4DLG A;  3KKS A;  4ICL A;  1I3A A;  4FM2 A;  3SCX A;  3I0S A;  4E0D A;  5FDL A;  3VN5 A;  2Z1I A;  4HUG A;  3V1O A;  2R7Y A;  3DLG A;  2FC0 A;  1VSE A;  4O4G A;  3EYZ A;  3V4I A;  3AA5 X;  2OZS A;  1J9A A;  1HNI A;  1VRT A;  4R5P A;  3RMA A;  5I42 A;  1NK7 A;  1ZBH A;  3NDK A;  3OS1 A;  3TWH A;  5E41 A;  1KFS A;  2RPI A;  4CK1 A;  3ALY A;  3MAQ A;  4HTU A;  2QKK A;  2B6A A;  3ZSZ A;  1UA0 A;  3LP2 A;  4HUE A;  2DFH A;  3V9U A;  5HRO A;  2OZM A;  2XRI A;  4FJI A;  1JLC A;  3S3M A;  2X78 A;  4KFB A;  4DQR A;  1HRH A;  1X1P A;  4CJ3 A;  1D9D A;  4ELU A;  4FXD A;  3SV4 A;  1WSG A;  3DOL A;  4CFC A;  3MED A;  4KHU A;  1C1C A;  3OJS A;  1T03 A;  1TGO A;  3WNE A;  1IKW A;  4FVM A;  3ZCM A;  4CGD A;  2B5J A;  2W42 A;  2WON A;  4W5N A;  1YVU A;  3K59 A;  2AJQ A;  1EX4 A;  3AVN A;  5T7B A;  4E7H A;  3SQ1 A;  4FJJ A;  3PO4 A;  3DLK A;  3MEE A;  1J5O A;  1S9G A;  1EKE A;  1L3U A;  1SV5 A;  4J2E A;  4W5R A;  2XY6 A;  3ZSY A;  4HCB A;  1LAV A;  3JYT A;  1IH7 A;  4DTO A;  4L8R B;  3OYD A;  3NF7 A;  4CER A;  1A5W A;  3AO2 A;  2DFE A;  1IG9 A;  4KB1 A;  1HYZ A;  1NJY A;  3AVA A;  5KRS A;  2X74 A;  5HBM A;  4CIE A;  5HRP A;  3SUN A;  1KTQ A;  4CEA A;  1DTT A;  1DTQ A;  4QAG A;  4PUO A;  4O0J A;  3HXM A;  3KK3 A;  3TAN A;  3PUF A;  1HJR A;  1ASU A;  4CHY A;  3ZSW A;  4DQS A;  1N6Q A;  5I3U A;  1WLJ A;  4G1Q A;  4DSK A;  4PQU A;  1RBU A;  4NYN A;  1XHX A;  3OYL A;  1KFD A;  3KLI A;  2RN2 A;  4JLH A;  1B9F A;  2HMI A;  1RBS A;  1YTA A;  3L2V A;  1W9H A;  3VQ5 A;  3OYN A;  4KB0 A;  1RT6 A;  4FLZ A;  2YNI A;  1BI4 B;  4Z4C A;  2IDO A;  1GOA A;  4CEC A;  4BE0 A;  1L3V A;  4OLB A;  1WSF A;  4HUF A;  3V9W A;  2BGG A;  2D5R A;  3AO5 A;  4CHZ A;  1DLO A;  2XO7 A;  3QO9 A;  1WAJ A;  4JRQ A;  3T3F A;  1L3S A;  4GVM A;  4KV8 A;  3OS0 A;  3OYK A;  1SKS A;  4M3W A;  3DRR A;  3HVT A;  3MXJ A;  1LW2 A;  3PO5 A;  4PY5 A;  4CJL A;  3PX6 A;  3NGY A;  3P83 D;  4C8N A;  2G8U A;  1EET A;  3ULD A;  4C8O A;  4M3U A;  4FJ9 A;  3K57 A;  2G8K A;  3JSM A;  3HK2 A;  5JS2 A;  5CYQ A;  1TK0 A;  3B6P A;  1B9D A;  1ZBU A;  3OYG A;  3K5M A;  1TK5 A;  1LV5 A;  4F4K A;  4K8Z A;  1S1U A;  4AHV A;  2DY4 A;  4DQQ A;  1SL1 A;  1TKX A;  1RT3 A;  3IS9 A;  1RT7 A;  4EP5 A;  2E4L A;  4BE1 A;  3TR8 A;  2QXF A;  1KVA A;  2A1S A;  3SNN A;  1CLQ A;  2KZZ A;  3IG1 A;  3ZSQ A;  2FBY A;  4DTP A;  4O44 A;  3O4Q A;  3RTV A;  3OYA A;  3HPH A;  1L3T A;  3CM5 A;  1BQN A;  3ZSX A;  2IAJ A;  4KPY A;  4QCL A;  4DTR A;  4M41 A;  1VSL A;  3VA0 A;  5CYM A;  4DLE A;  3LAN A;  3AA2 A;  2IS3 A;  2YNF A;  2G8H A;  4CJW A;  3HT3 A;  3O3G A;  5KI6 A;  4FZY A;  5FRM A;  4FJ8 A;  1GOC A;  2X6S A;  5HRR A;  4FM1 A;  4FLV A;  1RDA A;  3OVN A;  2PY5 A;  4DU1 A;  3KD5 E;  3L2W A;  3AO3 A;  3OYM A;  3VQQ A;  4E89 A;  3AV9 A;  3ASM A;  5FRO A;  4E7I A;  3RMC A;  4IDK A;  3C95 A;  1Z26 A;  3TAG A;  2ZQB A;  1TK8 A;  4E7L A;  1WN7 A;  4N56 A;  2XY5 A;  1Y97 A;  2VWJ A;  4E19 A;  4O55 A;  3AO1 A;  1NK9 A;  1RBR A;  3C6T A;  3S3O A;  3THV A;  4RG8 A;  4I2Q A;  4RW9 A;  1A5X A;  1C0T A;  4B9N A;  4FLY A;  4YNQ A;  3ZSR A;  4KRF A;  5SZT A;  3KJV A;  3KLG A;  3FFI A;  4CFA A;  3DLE A;  3KLH A;  4EZ9 A;  4M3X A;  4I2P A;  5KGX A;  2RKI A;  3NE6 A;  3TI0 A;  3ZT1 A;  3M8S A;  3SV3 A;  2WOM A;  3VQC A;  4CGH A;  5HRS A;  4DFM A;  4KTQ A;  1W0H A;  4JS5 A;  4CGF A;  1U49 A;  3VQA A;  4Z4E A;  3V9X A;  1RT4 A;  2IGI A;  3ZSO A;  4RW8 A;  3K58 A;  4UQG A;  1RDB A;  1NK8 A;  1U48 A;  4HVJ A;  1IKY A;  1YTU A;  3OS2 A;  3RR8 A;  4DTX A;  4DFJ A;  4DS5 A;  1S1W A;  2HHW A;  2GUI A;  1WNS A;  1EP4 A;  4FK0 A;  3M8R A;  3H08 A;  4CFD A;  4CEF A;  3QNN A;  2KZM A;  1RNH A;  4CF2 A;  1WSH A;  2P1J A;  1QSY A;  1BI4 A;  3DLH A;  1T7P A;  1KCF A;  1SL2 A;  4CHN A;  4JRP A;  3K5N A;  3OYJ A;  4OKJ A;  2Z1J A;  3E01 A;  4IBN A;  4LY7 A;  3QEW A;  1TKD A;  3RRG A;  4FZX C;  1NJW A;  3V9Z A;  4DFP A;  5HLF A;  4DTM A;  3VQB A;  1JLG A;  3DLR A;  4MQ3 A;  4CF9 A;  4C8K A;  4CEQ A;  2JLE A;  2OPS A;  2KW4 A;  4FJL A;  4FK2 A;  2RF2 A;  2EX3 A;  2DFF A;  4CES A;  4Z4G A;  4E7J A;  2HHQ A;  1QTM A;  1KRP A;  4Q5V A;  3CYM A;  2OPQ A;  3SQ0 A;  3TAP A;  1WSJ A;  3S3N A;  3DOK A;  1HMV A;  3LAK A;  1HPZ A;  4DG1 A;  3PV8 A;  5J2N A;  5J2P A;  4DTS A;  4ZTF A;  3NH0 A;  4B9U A;  4ID5 A;  3HJF A;  4B9L A;  1O1W A;  5C25 A;  3MXI A;  4CK2 A;  3EZ5 A;  1R0A A;  4KHN A;  5KGW A;  4OLA A;  1J54 A;  3QET A;  2HW3 A;  3M8Q A;  1VRU A;  4Y1C A;  1TL3 A;  3AO4 A;  3OYF A;  3OYE A;  1RIL A;  4KHQ A;  1SKW A;  4F8R A;  3DRP A;  3OYB A;  4FJX A;  1JL2 A;  4LSL A;  4B8C A;  1XC9 A;  1D8Y A;  2PYJ A;  2VG5 A;  3EY1 A;  3O4N A;  1GOB A;  4MFB A;  3WNF A;  2Y1I A;  4E1N A;  1D9F A;  3AVH A;  1VSI A;  3V6D A;  4CK3 A;  3QEV A;  4E3S A;  3AVC A;  4DQI A;  4J2B A;  4DTN A;  3VQE A;  1BGX T;  3CFP A;  3AVK A;  3KK2 A;  1BL3 A;  3L3V A;  4AH9 A;  4CJP A;  3TAE A;  3QIN A;  4BDP A;  4W5Q A;  3VQ7 A;  4PWD A;  1LWC A;  1C0M A;  1NOZ A;  1KVB A;  4LH4 A;  1QE1 A;  4OJR A;  4CJ5 A;  4E1M A;  4YFU A;  3NH1 A;  2OA8 A;  4IFY A;  4KAZ A;  4DSI A;  4FJG A;  3RWU A;  1VSF A;  4CCH A;  4KHS A;  4FK4 A;  5KRT A;  3TAR A;  3DLB A;  4IG3 A;  4EZ6 A;  1VSK A;  1FKP A;  1S6Q A;  3ISN C;  2F8S A;  1XWL A;  4FM0 A;  1HYS A;  3AA4 A;  3HST B;  3HVR A;  2IOC A;  2LSN A;  3HPO A;  4LSN A;  5K14 A;  2BDP A;  1ASW A;  4NCG A;  2BAN A;  3WNH A;  2IC3 A;  5KTQ A;  3KLE A;  3QNO A;  4CJR A;  4OKK A;  4AHS A;  4C8L A;  1NK6 A;  4KHW A;  1RT5 A;  5CZ2 A;  1HQE A;  4BWJ A;  1TKT A;  1RBV A;  2Z1H A;  4CJU A;  1QSL A;  4CF0 A;  1NK4 A;  5CZ1 A;  1VSJ A;  4CGI A;  1EXQ A;  3U3Y A;  3QEP A;  4CFB A;  1NKC A;  4FJH A;  4IG0 A;  4XIU A;  3PX4 A;  2XY7 A;  4AHR A;  1TVR A;  1LWE A;  4C8M A;  3SUP A;  2G8F A;  4FJ5 A;  4ELV A;  3HP6 A;  1RT2 A;  4AHC A;  1U47 A;  3KTQ A;  1BIZ A;  4HCC A;  4H4O A;  3NGZ A;  4LD0 A;  3ZSV A;  3OYC A;  1MU2 A;  3KD1 E;  3CG7 A;  4N5S A;  4DSJ A;  4NCA A;  2HB5 A;  3LP3 A;  4AHT A;  1SL0 A;  1TKZ A;  4F2R A;  2E6L A;  1UOC A;  4H4M A;  3LAL A;  4CJE A;  4DMN A;  1IKX A;  1HQU A;  1RDC A;  2Q3S A;  3F9K A;  3V9S A;  4CGG A;  1K6Y A;  2ITG A;  4FJM A;  4CHP A;  4M42 A;  3TAB A;  2QK9 A;  3NH2 A;  3NGI A;  4B9V A;  3PX0 A;  4DWI A;  4J2A A;  3KIO A;  2VWK A;  4FCY A;  5HP1 A;  2F96 A;  2KQ2 A;  1LW0 A;  3U6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...