3ZT1A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt1A00
1DLOA 4FM1A 4B9UA 1TKXA 4E7KA 1SV5A 3G0ZA 1KRPA 4LSLA 3PY8A 3V4IA 3VQCA 4WE1A 4FJJA 1T8EA 4W5RA 3DLRA 4CIEA 4BDYA 1TK8A 4HCCA 3KIOA 3P5JA 3TANA 1ZBHA 4B9NA 3ASMA 1HPZA 4DU1A 4CEEA 3ZSOA 3S3NA 3CFRA 4JS4A 1VSHA 3SV3A 3THVA 1N5YA 4C8MA 4PWDA 2E6MA 3DM2A 1VK0A 4OKJA 1VRUA 4KB0A 1HRHA 4B9LA 3LP3A 4FJNA 2OPPA 3LPTA 3OYAA 1GOBA 4HTUA 2ZE2A 2G8IA 3ALYA 1W0HA 2PY5A 4KTWA 2Z1JA 3AVIA 1N6QA 2P1JA 3QNOA 1C1AA 2RPIA 4M45A 3VQQA 1KVCA 3TAQA 1KFSA 3HVRA 4E7LA 1A5VA 1U4BA 1U47A 1L3TA 1X9WA 4HHTA 1YT3A 1EX4A 5I3UA 3V6DA 2OPQA 4CFDA 3TAEA 4ZHRA 4CK3A 1NK7A 1HNIA 1RILA 3AV9A 3DYAA 3CFOA 3VN5A 4RW6A 4DSKA 4KFBA 4DFMA 3VQ7A 2OPRA 3ZT3A 4CK1A 4KREA 4DTSA 2D5RA 4O0IA 3SV4A 2JLEA 2LSNA 4DQQA 3MEDA 3IS9A 1B9DA 1TAQA 2QXFA 3ZT2A 1UWBA 4I7FA 3NGZA 3OYNA 2XY7A 1BI4B 3HT3A 4DLGA 4C8LA 4CHNA 3K59A 2HHUA 3KKRA 2X78A 3QEIA 4O4GA 3HPGA 1GOCA 3RMDA 1XHXA 4FM0A 4NCBA 2Z1GA 4Z0UA 3AA4A 1BQMA 2FBXA 2IOCA 3B6PA 4ZTJA 2HNYA 4FZZA 4W5NA 1UA1A 1D5AA 2E4LA 3QEWA 1HYSA 1L3SA 1TKTA 3SPZA 3D0PA 2HHQA 1U45A 3PO5A 1TAUA 2GV9A 1ZYQA 2XY5A 1EP4A 3NF6A 3ZSXA 4KAZA 3SZ2A 2XY6A 3NAEA 1KVBA 4B9VA 4E0DA 1RDBA 4GMJB 4R5PA 1D9DA 3AVLA 1RDAA 1WSFA 3DMJA 2DFFA 3QEVA 1WLJA 3PX4A 1NKBA 3P83D 4CJKA 3QEXA 4CJLA 4J2BA 1WSJA 3I0SA 3O3FA 3KTQA 4J2AA 4W5TA 4M3WA 5FRMA 2IGIA 4CGGA 4KHWA 4H4OA 1VSFA 1NK9A 4AH9A 3OJUA 3KLHA 1Q9XA 4OLBA 4DLEA 3NCIA 4E1NA 4UQGA 4CJ3A 3O4NA 4CFBA 1YTUA 1SL0A 3EY1A 3VQAA 3S9HA 4PQUA 2F96A 2YNIA 3AVCA 1YVUA 4CF2A 4CJWA 1DTQA 1KLMA 5KGXA 4DTPA 1S9GA 1ZBFA 1C0MA 3SI6A 1BQNA 3V1QA 3L8BA 4RW4A 5HRSA 1RDDA 4FLWA 4CF0A 5CYMA 2FC0A 4O44A 4ICLA 4PA1A 1XWLA 3TI0A 3C6UA 2YKNA 1JLFA 3DRRA 4CJTA 3ZSYA 1HYVA 3LZIA 3CM5A 4DQSA 4F4KA 3ZSQA 3AO2A 3KK2A 3NDKA 4K8ZA 5KRTA 3LP0A 3LPUA 3OYEA 2KFZA 4Z4IA 1CXQA 4Q5VA 1FKOA 2QK9A 4LY7A 3AA3A 3OYGA 4DU4A 5CYQA 4ELVA 1CZ9A 4BE1A 3MXJA 2Z1IA 3AVMA 3G10A 4HUGA 3V9SA 1RT1A 1WNSA 2AJQA 3DLGA 3TAGA 4Y1DA 4OPJA 3DOKA 3SUOA 4W5QA 4CJSA 3SQ4A 1XC9A 1NJWA 2GUIA 3TAPA 3K5LA 3KD1E 3LDSA 1VSLA 1NKEA 4CIFA 4CEAA 3BGRA 4FLXA 2XRIA 2VWKA 3L2UA 3C94A 2ZQBA 3F73A 2HHVA 1QSYA 3CYMA 1TGOA 4FJIA 2BANA 1VSJA 3MEGA 4LH5A 5CY4A 3KJVA 4C8OA 4FVMA 1X1PA 3LALA 1EXQA 3M8SA 2I5JA 3KLFA 3NF9A 1X9MA 4FJ5A 4Z4FA 2RN2A 1O1WA 1ZBIA 3FFIA 1A5WA 2KW4A 3SYZA 1SL1A 1IKWA 1T7PA 4DTUA 3BDPA 1RTHA 4M42A 1Z26A 3DLBA 1TKZA 5C24A 3OYJA 2PZSA 3OYHA 4BDZA 4HUEA 1C1BA 3DRPA 5CZ2A 3OYLA 3PX6A 4BDPA 2O4IA 3T1AA 2D0AA 1Q8IA 4FJGA 4KHYA 2YNHA 5HLFA 5FDLA 3SPYA 2D0CA 2Y1JA 4N5SA 3QNNA 4DF4A 3RMBA 4K8XA 4J2EA 1UAXA 1YTAA 1FXXA 1D8YA 1RTIA 4I2QA 4CERA 5I42A 1ITGA 4ID5A 4DTJA 3TAFA 2OA8A 3RRHA 1S1WA 4KHNA 3NGYA 3U6FA 2G8WA 4CEQA 4FZYA 2G8UA 4KV8A 5DK5A 2YV0X 2HNZA 4CF9A 3ZSRA 4KHSA 4DS5A 1L3UA 4FW2A 3ISNC 1IO2A 4CGJA 4BE0A 1LWCA 2X6NA 4B08A 3S3MA 4DQIA 3OYDA 2XY8A 3HYFA 1NJYA 2PYJA 2HHWA 1Y97A 3OYIA 1UOCA 1C0UA 2YKMA 1KLNA 5KTQA 4DQPA 2IDOA 5HRNA 3AVNA 1VSMA 4MFBA 3VA0A 4RG8A 1VSIA 3LWMA 3KK3A 1NKCA 1CLQA 4CHQA 3TARA 3HK2A 3VQDA 2W42A 4TSXA 3L2QA 5CZ1A 1TL3A 1JLQA 3P1GA 1WAFA 2E6LA 5K14A 4DSEA 3SUNA 4ZTFA 3ZT1A 4EZ6A 4FJKA 1VRTA 1LAVA 3NE6A 1WAJA 3OVNA 3C6TA 1WN7A 2HVIA 3HXMA 3VQ6A 3LWLA 3V1OA 3F9KA 3L3UA 3AO5A 1HJRA 4I9QA 2VG5A 1IKXA 1U48A 1TK0A 4KKOA 3OJSA 3K2PA 3CG7A 3VQ9A 3O4QA 4DTXA 3RRGA 1BISA 1JL1A 1BCMA 3OYMA 3E01A 4I2PA 3NHGA 1LV5A 4LSNA 4Z4CA 1SKRA 1QQCA 3IAYA 4FK0A 4KPYA 5J2MA 3HO1A 3DRSA 2ETJA 5J2PA 4FW1A 3T3FA 2IS3A 3V9XA 4IG3A 1L5UA 4FLYA 1RBUA 2O4GA 3TWHA 4BWJA 4F8RA 2GBZA 1RT3A 1C6VA 4JRPA 2RKIA 3DI6A 1U49A 3OY9A 1QS4A 4DU3A 2DFEA 2FBVA 4CF8A 4HCBA 2F8SA 4CJVA 1RBVA 4RW8A 1IH7A 4AHUA 4Z4HA 5C25A 2EHGA 4NYFA 5E41A 3IRXA 4FZXC 4M3TA 4E19A 3SQ0A 1Z25A 2IAJA 5HRRA 2OZMA 5DMRA 5HROA 1F21A 1SKSA 3CQ8A 3V9ZA 3EZ5A 1K6YA 4EP5A 1D9FA 4JRQA 1S5JA 3O3HA 2ITGA 3DLKA 1I3AA 1JLBA 3OYFA 3ZCMA 3DLEA 5J1EA 3RMCA 2B4JA 1RT5A 4OJRA 1HYZA 3AO1A 3IG1A 3OS1A 2FBYA 1A5XA 1TKDA 2OYQA 3HSTB 3T19A 4FLUA 1NOYA 4ELTA 4FJLA 3ZT4A 3MAQA 1XI1A 4QOZB 1BIZA 3VQ8A 4AILC 3ZT0A 3DLHA 4AHRA 4XIUA 1ASUA 4DTMA 3SCXA 4DFKA 1TV6A 1BHLA 4DWIA 1S9EA 1NJXA 1FKPA 3SQ1A 2X74A 1ASWA 3K5MA 4EZ9A 3MXMA 3H08A 3CFPA 1QE1A 2P5OA 3VQEA 2P5GA 4M3ZA 4CEOA 4HVJA 2A1RA 4IG0A 1Q9YA 3K5OA 3ITHA 3AVFA 1BL3A 3NF7A 2G8KA 1RCHA 3VQPA 2HNDA 4CIGA 3AVHA 4RW9A 2HVHA 1BGXT 3QIPA 4F2SA 2DTUA 1KTQA 5J2NA 1XHZA 2BGGA 2D0BA 4NCAA 2DY4A 4KB1A 2YHAA 1J9AA 4CJFA 2YNGA 4OVLA 4BWMA 3C95A 4E7HA 3B6OA 1NK0A 4M3RA 1RBSA 4IFYA 4CGHA 2KQ2A 3QETA 3K57A 3U3GA 4CFCA 4KHUA 1RT6A 4HUFA 3V9UA 2G8FA 1ZBUA 4FM2A 2HHTA 2F8TA 1DTTA 2ZD1A 1MU2A 1SUQA 4O55A 1S6QA 3AVGA 2VWJA 1KSPA 3MECA 4FJ7A 2FBTA 3AO4A 4B8CA 4E89A 4CFAA 4PY5A 3OS0A 4FXDA 4YFUA 1NK5A 1HMVA 2DFHA 3OYBA 1T03A 1S6PA 1QTMA 1JXBA 5JS2A 3LANA 5KGWA 4AHSA 5FROA 1RT2A 3L2WA 3SQ2A 3VA3A 5SZTA 4KHQA 4FYDA 4KO0A 3NH1A 3KLEA 1R0AA 3AVJA 4BE2A 1T05A 4DSLA 4M3YA 2HHSA 1KFDA 4AHTA 3ZSWA 4JS5A 1C0TA 5EU7A 4FCYA 1JXEA 1S1UA 1WSIA 4LH4A 3NFAA 3QINA 4CK2A 1IKYA 3NGIA 1NK8A 1LAWA 4DTRA 3NBPA 4CCHA 3M8RA 4DTOA 2B6AA 2VG7A 1NJZA 4ID1A 1W9HA 4RW7A 1IKVA 1X9SA 3O3GA 2RF2A 4N47A 3LAKA 4CHPA 3SNNA 1RTDA 1LW2A 3V81A 4CGFA 4FJMA 1RT4A 3AVAA 1UA0A 4OGCA 4B9MA 3LP2A 3RTVA 2G8VA 4CHOA 3WNHA 2G8HA 4KTQA 3L3VA 2A1SA 4CEFA 3JSMA 4DSIA 1IG9A 4B3OA 2KZZA 1HQUA 3TAMA 2R7YA 4FJHA 3HL8A 3TR8A 4EP4A 3QEPA 4FLZA 1WSHA 1RTJA 3M8QA 1J5OA 2P51A 4N56A 2HW3A 1KCFA 3LAMA 1LWFA 2Y1IA 3HPOA 1L3VA 3TABA 1J54A 1S1TA 4NCGA 4CE9A 3VQBA 4GW6A 5SWMA 3KK1A 1G15A 1TK5A 3ZSVA 4F2RA 4OGEA 3KLIA 4NYNA 2KZMA 1GOAA 2NUBA 3A2FA 3K58A 4QAGA 3PO4A 2QKKA 1BIUA 1JLCA 1WSEA 3PUFA 4IFVA 3V1RA 1QSLA 4E1MA 3RWUA 4CHZA 4DMNA 4CJEA 4I9LA 3HM9A 4Q0BA 4BACA 2KTQA 2HHXA 4FK2A 4IDKA 1SKWA 3EYZA 4CF1A 5T7BA 3NH0A 1JL2A 1FK9A 4CJ4A 3HVTA 3U3YA 4CJRA 4DSJA 3MEEA 3PV8A 1NK4A 1BCOA 3ULDA 4DFJA 3DOLA 3WNEA 3QO9A 4CEDA 1LWEA 3I8DA 4GVMA 4FK4A 2OZSA 5J2QA 2XHBA 1I39A 3NH2A 3ZSZA 1C1CA 4JLHA 3WNGA 5C42A 1HNVA 1RDCA 1B9FA 3MXIA 4M3XA 2Z1HA 4G1QA 3K5NA 2YHBA 4N76A 2OPSA 4QCLA 3SJJA 4B8AB 4O5BA 4DG1A 4Z4GA 1BI4A 3I0RA 4OKKA 3HP6A 3LZJA 2PYLA 1RBRA 5KI6A 4O0JA 4DFPA 3HJFA 4KTZA 1EKEA 4B9TA 4FJ8A 4KI4A 3OYKA 3HP9A 4Z4EA 3CM6A 1KVAA 1SL2A 4F3TA 4N41A 3QLHA 4C8NA 2YNFA 1RNHA 2Q3SA 4MQ3A 4CJ5A 4AHCA 3AVKA 4FLVA 2IC3A 4H4MA 4AHVA 4DS4A 2WOMA 3SUPA 2BDPA 1RBTA 4OPKA 2ATQA 3LP1A 4FLTA 4E7JA 3OS2A 4DQRA 2XO7A 2EX3A 1JKHA 3QESA 4KI6A 1VSEA 3AA2A 5HBMA 1CXUA 3HPHA 2QKBA 4L8RB 3QIOA 4IBNA 4E7IA 1ASVA 4CECA 5D3GA 2X6SA 4OKEA 4CGDA 4CHYA 1EETA 1S1XA 4LD0A 4M3UA 1J53A 2JGUA 4Y1CA 5FRNA 3NF8A 1JLAA 3OYCA 1VSDA 4CESA 4B9SA 4ELUA 4IKFA 2B5JA 3AVBA 3S3OA 4CGIA 4F3OA 1REVA 3PX0A 3L2VA 3QERA 4OLAA 5HRPA 1CZBA 1TL1A 1JLGA 3KKSA 2HB5A 2VG6A 2KFNA 4CJQA 2WONA 1NK6A 4CJUA 3RR7A 1QHTA 3KD5E 4CEBA 4KRFA 4CJPA 3KLGA 3VQ5A 4W5OA 5KRSA 1TVRA 4M41A 4H8KA 4YNQA 3UIQA 1JLEA 3WNFA 4FJ9A 3RMAA 4PUOA 2BE2A 4FJXA 1LW0A 5JS1A 2HMIA 1HQEA 3RR8A 4C8KA 3D45A 3V9WA 4CEZA 3M8PA 3VQ4A 3SUQA 3L2RA 1RT7A 4DF8A 4E3SA 5HP1A 4DSFA 1ZBLA 3JYTA 1WSGA 1QSSA 1S1VA 3AO3A 4J2DA 1VSKA 3AA5X 1B92A 1NOZA 4DTNA 1U04A
chains in the Genus database with same CATH superfamily
1DLOA 4B9UA 4IJNA 2VGNA 4EFHA 2A41A 3V4IA 3VQCA 4FJJA 1T8EA 4W5RA 3DLRA 1TK8A 4YY3K 3KIOA 3LL3A 3P5JA 3TANA 4B9NA 1YAGA 1BG3A 4DU1A 3H46O 4ISGA 5EVZA 4JS4A 1HKGA 1NGAA 3SV3A 3THVA 4C8MA 1VK0A 4OKJA 1NU0A 5EXWA 1HRHA 3LP3A 2GWJA 3G71N 1SAZA 3CJ1A 4KTWA 4BC5A 1C1AA 3VQQA 4E1JA 4ILJA 2VQEK 3SLCA 4HHTA 1MDUB 1WOQA 5I3UA 4ILGB 3TAEA 3VETA 3IDHA 4ZHRA 2O8BA 4BGBA 3AV9A 3VN5A 3CCMN 3T1YK 4RW6A 1I94K 3VQ7A 2OPRA 2O8CB 1RFQA 4ISFA 4DTSA 1EO1A 2QW9A 1YXQA 1QVGM 3NGZA 5M1QA 3F5TA 1YJNN 4C8LA 4CHNA 2X78A 1X9JA 3G6EN 3M6GA 4JKEA 4Z0UA 1BQMA 2PBDA 3AA4A 2HNYA 4FZZA 1UA1A 2E4LA 4JI4K 3VF4A 4CVNE 1JCFA 1TKTA 3SPZA 1HNWK 5AQXA 1IBLK 2P9PA 3MK6A 2XY5A 2FF3B 2IVPA 2Q97A 3KK7A 4DV4K 3SZ2A 4B9VA 2OANA 4H5RA 2D0PA 1D9DA 3QEVA 1NKBA 3PX4A 5BRHA 3P38A 4J2BA 4B1VA 2P9KB 3I0SA 3VPZA 3O3FA 3HI0A 4BC4A 4KHWA 4JKGB 4AH9A 3KLHA 3NCIA 3E9PA 4UQGA 5M1OA 2NRWA 4CF2A 1C0MA 1BQNA 4LF7K 3L8BA 4R79A 1KAXA 3C6UA 3LZIA 3ZSQA 3NDKA 5JMVA 2PFUA 2EWSA 5KRTA 2F7TA 4JNEA 3THYB 1CXQA 3P4IA 3OYGA 3AA3A 4ELVA 2QK9A 5AQUA 4X65K 1EWQA 2P9NB 3G10A 4O5FA 1WNSA 2AJQA 3LM2A 3D6RA 4OPJA 2P9SA 4DV6K 1T3VA 4LFAK 2KLAA 4FOEA 3TAPA 3L0QA 3RVCA 4GY2B 3LDSA 3BGRA 5DM7L 4FLXA 5HL7L 3C94A 2ZQBA 3VOVA 3F73A 4DB3A 2WFBA 1QSYA 3UKUA 3N4QA 4FJIA 3KJVA 4FVMA 4FJ5A 5FLXO 4Z4FA 1NGFA 3N4PA 4DTUA 1OH8A 5FPMA 1Z26A 1TKZA 5AQQA 2PZSA 3HOSA 4BDZA 1C1BA 3T1AA 4KHYA 2Y1JA 3QNNA 3RMBA 1X3MA 4CZMA 3TAFA 4H0YB 3K9JA 5GAGP 4A2BA 4CEQA 5DK5A 4FW2A 3S3MA 4WF9L 4FWMA 1XMOK 3HOTA 4MLHA 3CJBA 1C0UA 4LFBK 5KTQA 3CCQN 5CR4A 3U9DA 1VSIA 3KK3A 1CLQA 3HK2A 1OVYA 2W42A 1IV0A 4TSXA 1W97L 3DWLA 5CZ1A 1TL3A 4ZTFA 4O8UA 3ZT1A 1VRTA 3NE6A 1WN7A 3UB5A 3LWLA 3L3UA 4JKCA 1XQSC 2VG5A 5M1PA 4PL8A 1TK0A 3K2PA 4BR9A 4DTXA 2QWMA 3D2EB 4WQ5C 5B8HA 3E01A 5M1FA 4FK0A 5KPRA 1SKRA 1Z6RA 4KPYA 1K73O 3DRSA 2ETJA 3T3FA 3BEXA 4CJ7A 1L5UA 4FLYA 2O4GA 3TWHA 4F8RA 3J7ZO 3NVMA 2ZF5O 3OY9A 5GAHP 5KQ8A 1RGIA 2F8SA 1VQ7N 2GELA 4GV3A 4M3TA 5CE3A 1Z25A 2IAJA 3UKRA 2OTLN 2OZMA 5HROA 2VGMA 3CQ8A 3B8AX 3H1VX 4EP5A 4IZ9A 1I3AA 2UXBK 4OJRA 2V7YA 4FWLA 1EQYA 3O9SA 3TTFA 4BRKA 3OS1A 2FBYA 2IIRA 3ZEUB 4JI2K 3ZT4A 1BIZA 3THXB 4M63C 3DLHA 1ASUA 5JICA 2QWOA 3EZWA 2FF6A 4DWIA 3TPQA 3LDLA 2X74A 3SJHA 1QE1A 3VQEA 4DR4K 4CEOA 4HVJA 4IG0A 3ULEA 3ITHA 3AVFA 1BL3A 4CIGA 3AVHA 3LDOA 2CGJA 3W0LA 4H03B 3CPEA 5C2DA 2CGKA 4KB1A 4CJFA 4OVLA 1OH5A 1DEJA 5LL6Z 3U3GA 4NLBA 4DQ8A 1RT6A 4HUFA 4B3MK 3V9UA 4FM2A 2HHTA 3CMAN 1DTTA 4CD3A 4CI6A 1S6QA 3QICA 3VF2A 4B8CA 3AO4A 3OS0A 4YFUA 2DFHA 1T03A 4X66K 1HKBA 5JLFA 3SQ2A 4FYDA 3K0SA 1NG9A 3C6AA 1R0AA 4M3YA 1XMQK 1RDUA 3S41A 3AGRA 4LH4A 3NFAA 5GIOA 3R3LA 1NJZA 2VG7A 2HHHK 1W9HA 3V81A 4FJMA 4B9MA 3AVAA 4OGCA 2G8HA 3JSMA 1IG9A 2KZZA 4FJHA 3HL8A 3A5OC 3QEPA 2P51A 3Q7BA 2Y1IA 3TABA 3H6EA 1S1TA 1ZBSA 4OGEA 2NUBA 2W41A 1K8KA 4DCHA 3TSPA 3CJ7A 2HHXA 3DAWA 5E84A 1RDWX 4CF1A 5BR8K 3HVTA 2E8AA 3ID8A 3QO9A 3WNEA 4CEDA 4K41A 3TU5A 3TTCA 1Q18A 2GEMA 5J2QA 4CBXA 3DXMB 1GLLO 2E2PA 3WNGA 1HNVA 1RDCA 1B9FA 5TKYA 1YUWA 3FLCO 3U4LA 2FSJA 4B8AB 4O5BA 3I0RA 4OKKA 3HJFA 3R8EA 4F3TA 2YNFA 4CJ5A 4H4MA 3WXKA 5HOOA 2O8EA 3WXMB 4OPKA 4MDBA 5BN9A 3SMSA 2EX3A 4BRGA 1CXUA 3HPHA 2QKBA 4L8RB 1ASVA 1X3NA 4FO0A 1VHXA 4LC9B 5AQHA 2JGUA 4Y1CA 2A5XA 4IKFA 3C7NB 3VENA 3S3OA 2YHYA 3L2VA 5HRPA 1JLGA 4CJQA 3BZKA 4JEPA 4CJUA 5FPEA 1VQ6N 2FSNA 4PUOA 4H8KA 3RMAA 5JS1A 3D45A 3VQ4A 1GLDG 1C0GA 4DSFA 1ZBLA 4LF8K 2NRRA 1S1VA 3AO3A 4KHPK 4QS7A 3O9UA 4FM1A 1TKXA 1NWKA 1SV5A 1KRPA 4LSLA 5F2RA 4CIEA 3GDQA 4BDYA 4HCCA 1HPZA 3SAFA 4CEEA 3ZSOA 3CC7N 3CFRA 4PWDA 1N5YA 2YCHA 2VWBA 1VQPN 2Q31A 3OYAA 3LPTA 5AQVA 1E4GT 2G8IA 2PY5A 1MWMA 5A2QO 1N6QA 3QNOA 2RPIA 3TAQA 1KFSA 5EOYA 1NJIO 1A5VA 3I33A 1U47A 1L3TA 1X9WA 1EX4A 4CFDA 3VGKA 1HNIA 3BF1A 3DYAA 3CFOA 1YITN 1ZC6A 4KFBA 4KREA 2O8DB 3MCPA 2D5RA 4F9OA 4O0IA 5MLCQ 2NZTA 2QXFA 1R59O 3ZT2A 3FZMA 2Q2RA 5AQWA 4M7XA 4IEEA 4O4GA 1GOCA 4FM0A 2FBXA 4ZTJA 3UE5A 4W5NA 3CPWM 3QEWA 3D7EO 1L3SA 4EHUA 1TAUA 3J7AP 4BC3A 2O8CA 2YI1A 1EP4A 2PAVA 3NAEA 1KVBA 4E0DA 3CJAA 3AVLA 1RDAA 1WSFA 1NGIA 2DFFA 3QMLA 1DT9A 3QEXA 3PSFA 1VQ9N 1ATNA 2KHOA 4W5TA 5FRMA 3A0IX 3BF3A 3MWPA 2YX6A 1NK9A 3OJUA 5AZJB 4DR1K 4DLEA 1YTUA 4CFBA 3EE9A 1SL0A 3VQAA 2F96A 1YVUA 3KHYA 3ENHA 3CC4N 3CCVN 1XUPO 2NRZA 4CJWA 1KLMA 2WC9A 3AARA 1S9GA 4H5NA 5HRSA 4LF6K 4F4KA 4FSVA 2P9KA 3VGMA 4JKAA 3LPUA 2KFZA 1V4TA 1YJ9N 4LY7A 1NGEA 4JKGA 4BE1A 2Z1IA 3AVMA 3J80O 1RT1A 5FPNA 4EHTA 3DLGA 4Y1DA 1CZAN 4W5QA 2QWNA 4CJSA 4A59A 4RTFD 1NKEA 4NO7A 2A40A 2XRIA 2ITMA 2HHVA 3FFKB 1TGOA 2CH5A 3CMEN 1VSJA 5CY4A 1EXQA 3M8SA 3NF9A 3THYA 5AZIB 1SL1A 2P9NA 1KAYA 5C24A 3OYHA 4HUEA 3OBWA 2O4IA 4BRCA 4FJGA 5FDLA 2D0CA 4N5SA 3WQUA 3MDQA 2HBMA 1D8YA 1FXXA 1RTIA 4PKGA 2OA8A 2CGLA 1IBMK 2QWPA 3NGYA 4FZYA 3C0BA 2YV0X 2HNZA 2IVOA 4FL9A 4KHSA 5BPNA 4CZGA 3ISNC 4DQIA 2X6NA 1VQON 2NRTA 2XY8A 2HHWA 4RWTA 1Y97A 3OYIA 1UOCA 3NVKA 2YKMA 2IDOA 4PKIA 5HRNA 3AAQA 4MFBA 3VA0A 3O4WA 4RG8A 1QQNA 1NKCA 3TARA 3ENBA 2QWRA 3L2QA 3P1GA 4DSEA 5K14A 4EZ6A 3OVNA 3C6TA 5JVGL 2HVIA 3VQ6A 3VGLA 3AO5A 3C6HA 3WEEB 4I9QA 1IKXA 1SQKA 2NRHA 4XH1A 2UUAK 1Q81O 4WCEL 1BISA 1BCMA 4GV9A 1QQCA 3HO1A 2ZJRL 4OPAA 3V9XA 4A62A 2FXUA 2E2QA 3DI6A 1U49A 2DFEA 2BUPA 4CF8A 5AQGA 4AHUA 4RW8A 4DR7K 4Z4HA 3VTHA 4E19A 2E1ZA 3SQ0A 3H3OB 4BREA 5HRRA 3GL1A 5LJVA 4XH4A 1SKSA 1JCEA 3EZ5A 3D2EA 5EX5A 5KQDA 2ITGA 3DLKA 2ZJQL 4H0TB 3RMCA 2B4JA 3CCUN 1DGKN 1A5XA 5CHIA 2OYQA 3T19A 4A5AA 4FLUA 4QOZB 4FJLA 3MAQA 3ZX3A 3SCXA 4DFKA 1BHLA 1HR0K 1NJXA 1ASWA 3H08A 4AQYK 2P5GA 2A1RA 4B1ZA 2P9IA 3NF7A 1QHAA 1RCHA 3VQPA 1ATRA 2QA4N 4RW9A 4WFBL 2BGGA 2D0BA 4NCAA 2DY4A 3ZEUA 3EN9A 3C95A 3VTIA 1GLBG 3THXA 1RBSA 4JHDA 3QETA 3RSEB 3FZFA 4JKBA 2G8FA 2F8TA 4O55A 1SUQA 4FXDA 4H0XB 3TTDA 5AFUA 4KO0A 4DR6K 4BE2A 4DSLA 4AHTA 1JXEA 5GADP 4CK2A 2O8FB 3G25A 1NK8A 4DTOA 4K0KK 1X9SA 1U2VB 3O3GA 2RF2A 3LAKA 3SNNA 5C12A 1UA0A 3RTVA 3WNHA 2D1KA 1YJWN 4BQZA 4EAHD 5AR0A 3TAMA 2R7YA 2YHWA 2ZGZA 1WSHA 1J5OA 4JN4A 2HW3A 1KCFA 3EKUA 5LJWA 4DV2K 1J54A 5SWMA 4CE9A 4BRQA 4WQ5A 2UXDK 3O08A 3KLIA 4I6MB 1GOAA 1NGHA 4BQLA 3ZLJA 4IDHA 3CJ9A 2QKKA 1JLCA 2CH6A 3PUFA 3THWB 4E1MA 1YIJN 3RWUA 3WXIA 4DMNA 2QWQA 3WXLA 4I9LA 4FWOA 2E5LK 4FK2A 4IDKA 3EYZA 5KPTA 4CJRA 2P9LB 3MEEA 3HM8A 3PV8A 1BCOA 3CCEN 2NLXA 3SK3A 1TUUA 4BRPA 1GLFO 1VQMN 4JI0K 5KPZA 2OZSA 2XHBA 1C1CA 5C42A 5DM6L 4G1QA 3K5NA 2YHBA 3ENOA 3T69A 1ESVA 4Z4GA 2P9IB 2PYLA 2UXCK 4DFPA 4IOCL 4KI4A 3CM6A 1SL2A 3QLHA 5BPMA 4MQ3A 4AHCA 5AQOA 4JI3K 3OS2A 2XO7A 1ATSA 2Q36A 3QESA 1VSEA 4JHDB 5AQPA 3VESA 3A8YA 4JI6K 4CHYA 1EETA 3DXMA 1S1XA 4LD0A 1VQNN 4IOXA 4CESA 3VEVA 4B9SA 3AVBA 3PX0A 3QERA 2VG6A 3CF5L 2KFNA 1NK6A 3KWGA 2P9UB 5GINA 1QHTA 4CEBA 3IFRA 3VQ5A 3OHRA 3WNFA 2W40A 3M5RA 4YOWA 2BE2A 4FJXA 1Q82O 1QQMA 2UUCK 1T6DA 3M8PA 3VMFB 3SUQA 2OTJN 3QFPA 1QSSA 3C7NA 4CZIA 3LDQA 1KXPA 1B92A 3GBTA 2NRXA 3G0ZA 3VEOA 3PY8A 4WE1A 4H0PA 2BH1A 4IFEA 1V4SA 3IKMA 4CZFA 4DR2K 1VQ8N 1N33K 1ZBHA 4C1NI 1NBWA 4FWQA 3S3NA 4IEIA 3TSUA 3VEWA 3OBYA 4CZKA 2E2NA 4LF9K 2I7NA 4B9LA 4AF1A 1IBKK 1GOBA 4HTUA 2GWKA 2ZE2A 2Z1JA 2YJEA 1KVCA 4H5TA 4E7LA 1U4BA 3P31A 3V6DA 2OPQA 1NK7A 4CK3A 1RILA 4DFMA 4CK1A 1LCUA 1P90A 4FPBA 2W6LA 4CZJA 4H5VA 2JLEA 4DQQA 3MEDA 3IS9A 1TAQA 1DKGD 4WFNL 2XY7A 4I7FA 1BU6O 2HHUA 3KKRA 1G99A 5AQNA 1S22A 3HPGA 3CIPA 4NCBA 1D4XA 2Z1GA 4FWNA 3B6PA 2IOCA 1D5AA 5F1XA 1HYSA 3KZBA 4JI1K 3D0PA 3SBGA 3PO5A 3JS6A 5BRFA 2DPNA 4NB4A 2O8DA 2AA4A 4KAZA 4A61A 2XY6A 4JD2B 4NXMK 4BR2A 4B1UB 4B1YB 3DMJA 1WLJA 3P83D 2V7ZA 4CJKA 4CJLA 2W6KA 3M3ZA 4J2AA 5ADXH 3O1BA 4H4OA 1Q9XA 4OLBA 1NGDA 3O80A 2NNWA 3S9HA 4BROA 4PQUA 2YNIA 3AVCA 3T1HK 1ZBFA 3CETA 3SI6A 4FLWA 2FC0A 5AQFA 5AQZA 4IO9L 4O44A 1XWLA 3DRRA 2YKNA 4DQSA 3MCAB 3ZSYA 4LF5K 4Q0BA 2QWLA 3AO2A 3KK2A 1IG8A 3E9OA 2ASOA 4IJAA 5JVHL 3ZYYX 3OYEA 3A5MC 1GLEG 4Q5VA 1FKOA 4YDUC 4DU4A 1CZ9A 5AZJA 1BA1A 3SAGA 2YJFA 3V9SA 1N8RO 5ELZA 3DOKA 4OPHA 4JI8K 4CZHA 1NJWA 3EE8A 5AJ3K 3K5LA 4X64K 3KD1E 1VSLA 4CIFA 4YOXA 2VWKA 4CZEA 2ZJPL 3CYMA 3MEGA 1GLCG 4C8OA 1X1PA 3LALA 2D4WA 2HBKA 3QBWA 2I5JA 4AM6A 1X9MA 5H1SQ 1A5WA 1Y64A 2KW4A 3AY9A 1IKWA 4MLEA 4DUYK 3SYZA 1RTHA 4M42A 4K43A 3DLBA 3OYJA 4RCHA 1ZXOA 3LM9A 5BPLA 3OYLA 1NNEA 2D0AA 1Q8IA 3L4IA 1TYQB 5AQYA 1K8AO 3SBTA 4FWPA 4BVPA 1YTAA 4I2QA 5I42A 4ID5A 4DTJA 1NM1A 1S1WA 4KHNA 3U6FA 3HTVA 4BG9A 2G8WA 4BRDA 2G8UA 3U9ZA 4CF9A 3FZKA 3TSQA 5AZIA 1ZBIA 1L3UA 4B08A 3OYDA 3R9PA 1NGCA 4LF4K 4FPAA 1LOTB 5F0XA 4M7YA 3CD6N 1KLNA 4B9QA 1T44A 4DQPA 3AVNA 1VSMA 4CHQA 4DR5K 3VQDA 3MN9A 1J5EK 4PL7A 1WAFA 2E6LA 1WAJA 5LMNK 4EIAA 3V1OA 1VAZA 3F9KA 1HJRA 3L4QA 5E26A 4KKOA 3EEQA 3SAHA 4DV7K 1JL1A 3OYMA 1LV5A 3IAYA 4LSNA 4FW1A 2IS3A 2FLOA 1RBUA 4C23A 4BWJA 2GBZA 1U6ZA 3GOIA 3LDPA 2RKIA 4DU3A 1QS4A 4HCBA 1RBVA 3U8XA 1IH7A 4U7BA 4NYFA 3IRXA 4H5WA 3WEEA 3O9RA 3EL2A 5DMRA 3V9ZA 4XH5A 1D9FA 4JRQA 1S5JA 3O3HA 1JLBA 3OYFA 4JKFA 4WYBA 3AO1A 3E1YA 5AQIA 3IG1A 4ELTA 3NMUA 3VQ8A 4AILC 5AQRA 4K25A 4AHRA 4Z94A 4XIUA 4DTMA 2D0OA 1S9EA 1NGGA 4GKJK 3CCJN 4M3ZA 2P5OA 2GX9A 5LMUK 4WQ4C 1Q9YA 3K5OA 1VQLN 3CQYA 5FPDA 2G8KA 2HNDA 3J7YP 3QIPA 3D2FB 5J2NA 5AQLA 1XHZA 1E3MA 1HPMA 4BWMA 5C10A 3B6OA 4M3RA 4IFYA 3FZHA 2KQ2A 3K57A 5EY4A 3AAPA 1ZBUA 3MN6A 3MWTA 2ZD1A 5C15A 1MU2A 3ATVA 4FJ7A 4PY5A 4E89A 4CFAA 1QVFM 1S3XA 1WBDA 4PKHA 3CHWA 4JKHA 5KGWA 4AHSA 5FROA 1RT2A 3OA9A 3VA3A 4J8FA 3NH1A 3KLEA 3DXKB 1T05A 2HHSA 5I9EB 1KFDA 4JS5A 3LDNA 4FCYA 4AM7A 1S1UA 5AQJA 1S72N 1IKYA 1LAWA 3RSEA 3NBPA 4DTRA 3M8RA 2ZWHA 4YOUA 4RW7A 1IJJA 3WXJA 4H0VB 2ASMA 1RTDA 1LW2A 2H3GX 3BP8A 4CGFA 4KTQA 2HOEA 3LP2A 3MX2A 5C0YA 4BR4A 4BG8A 4CEFA 1HQUA 3TR8A 3A5LC 2E2OA 3M8QA 4N56A 2F9TA 3LAMA 1XNRK 1OVQA 3HPOA 3I55N 4H0OA 3KK1A 4NCGA 4DUZK 4GW6A 3R6MA 3IMXA 2WBNA 4F2RA 2O8FA 4NYNA 1NGJA 1QZ5A 3A2FA 4QAGA 3PO4A 3FE1A 1BIUA 1U2VA 5BR9A 1VQ5N 4CJEA 3FGUA 2IVNA 1Q86O 2KTQA 2E88A 1SKWA 2RHKA 1FK9A 4CJ4A 4K42A 3KVGA 1MA9B 4BRNA 3ULDA 2ASPA 3DOLA 4DFJA 2I7PA 3I8DA 4NXNK 4GVMA 1I39A 3NH2A 4BRAA 4JLHA 3MXIA 4I6MA 4QCLA 3SJJA 4PHTX 1XNQK 1BI4A 3HP6A 3THWA 5KI6A 4DHYA 4BRMA 4B9TA 4B3RK 4FJ8A 3HP9A 4Z4EA 1KVAA 1JJ2M 1RNHA 2Q3SA 4DS4A 3A5NC 3AVKA 2WOMA 3QBXA 4E7JA 3LP1A 2P9LA 4HTLA 4FLTA 2AP1A 1FJGK 1HNXK 3GE1A 3AA2A 3ZETB 4BR0A 3QIOA 4E7IA 5D3GA 4CGDA 1NMDA 3DJCA 1J53A 3VEZA 3NF8A 1JLAA 4FOIA 3OYCA 4ELUA 4B1XB 4F3OA 1REVA 1BDGA 4OLAA 1TL1A 3KKSA 2WONA 1TUYA 3O8MA 5AQTA 2WUSA 4CJPA 4W5OA 1TVRA 1K9MO 2A3ZA 4M41A 4YNQA 3MN7A 1JLEA 3UIQA 4FJ9A 3RR8A 4C8KA 3V9WA 3R1XA 4CEZA 3L2RA 4DF8A 4E3SA 3JYTA 1WSGA 1Z05A 2QXLA 1VSKA 4B3SK 3BDPA 1U04A 3CJCA 1WBBA 4IWVA 4E7KA 1YVNA 4QS8A 2P9UA 5AQKA 4FWRA 2O8BB 3ASMA 3EKSA 4GV6A 1HX1A 3CXCM 3O9TA 4LFCK 1VSHA 4DV5K 3M1FA 3Q7CA 2ZM6K 2E6MA 3DM2A 1VRUA 4IO8A 4JK8A 1BA0A 4KB0A 4FJNA 2HMPA 1XC3A 2OPPA 5TKWA 1HJOA 2VCPA 1W0HA 3ALYA 3AVIA 2P1JA 4M45A 1KC8O 3HVRA 4A57A 4U67L 1M90O 1YT3A 4B3TK 2P9PB 4DSKA 3ZT3A 3MN5A 3O1WA 3F2KA 4BRHA 3H1QA 2GUPA 3SV4A 2LSNA 1B9DA 1UWBA 2JWKA 3OYNA 1BI4B 2Q0UA 3HT3A 4DLGA 4CZLA 3K59A 4Y0WA 4ILHA 3QEIA 1E4FT 3BZCA 3MX5A 3RMDA 1XHXA 2QTDA 3QDKA 1BUPA 4CBUA 3P39A 4FWKA 2HHQA 2Q0RA 4ISEA 4QS9A 3HSCA 1U45A 3PLAA 2GV9A 1ZYQA 2KKZA 1MWKA 3NF6A 3ZSXA 4JK7A 1RDBA 4GMJB 4R5PA 3ID6A 1SS6A 1WSJA 3KTQA 4M3WA 4BVOA 1EWRA 2IGIA 4CGGA 2VQFK 4YHHK 1J6ZA 1VSFA 4MO5A 1NLVA 4E1NA 3VF6A 3O4NA 4CJ3A 3EY1A 1HUXA 2P9SB 4GKKK 1DTQA 3QFUA 5KGXA 4DTPA 1KD1O 1BO5O 3V1QA 4RW4A 1RDDA 4CF0A 5CYMA 4JD2A 4UY8O 4ICLA 4PA1A 3TI0A 3KD5E 1JLFA 4CJTA 3UKUB 1HYVA 3BUZB 3CM5A 4K8ZA 1FW6A 4FVUA 3LP0A 3WQTA 3VEXA 4Z4IA 5CYQA 3L6QA 3MXJA 3JAMO 3SMPA 4HUGA 3AGKA 3TAGA 2Q1NA 3VEYA 3ZX0A 2JWLA 3SUOA 3SQ4A 1XC9A 2GUIA 2RE2A 5GAEP 2HBLA 4KBOA 1N34K 4YOYA 4CEAA 3L2UA 4O8KA 3HBTA 1WUAA 3O5BA 2BANA 1M1KO 5LY3A 4LH5A 3QB0A 4WFAL 3KLFA 2RN2A 1O1WA 4BC2A 3FFIA 1T7PA 2FSKA 3DLLL 2QEXN 3C65A 3G4SN 3GG4A 1YF5L 3DRPA 5CZ2A 3PX6A 4BDPA 4HWIA 2YNHA 5HLFA 3SPYA 3CCRN 4BY9C 4MO4A 4DF4A 4JK9A 2BTFA 4K8XA 4J2EA 1UAXA 3E66A 4CERA 1ITGA 4DV3K 3RRHA 1ILYA 2UYTA 4KV8A 3JXUA 3ZSRA 4DS5A 4CGJA 1IO2A 4BE0A 1HLUA 1LWCA 4GVEA 3HYFA 1NJYA 2PYJA 2WTUA 3KWIA 1OH6A 4DR3K 1TYQA 3J8AA 2UUBK 1W2BM 4JKDA 4IXCA 3LWMA 3OTOK 4G9ZA 2V51B 2HSTA 5M1NA 3PIOL 4FWSA 1JLQA 3SUNA 2A42A 1GLJO 4FJKA 1N32K 1LAVA 4XEIA 2HF3A 1Q7YO 3PSIA 3HXMA 3UKRB 3FR0A 1U48A 3W3DA 1YHQN 3MMVA 3OJSA 3CG7A 3CCLN 3VQ9A 3O4QA 3BY5A 3RRGA 4MDAA 2QI2A 4KH6A 4I2PA 3NHGA 4Z4CA 2YHXA 5IWAK 5J2MA 4YOVA 3HZ6A 5J2PA 4IG3A 5GIPA 1RT3A 1C6VA 4JRPA 5C2FA 2QM1A 2FBVA 4CJVA 5C25A 2EHGA 4FZXC 5E41A 2E20A 1JCGA 5AQMA 1F21A 3ULEB 1K6YA 1P8ZA 5JLHA 4YDUA 4BR7A 3ATUA 4BRLA 1SZ2A 3ZCMA 3DLEA 5J1EA 1RT5A 4OX9K 1HYZA 4CW7B 1TKDA 3HSTB 1NOYA 1XI1A 1YI2N 3ZT0A 1TV6A 3IUCA 1FKPA 3SQ1A 4IOAL 3K5MA 4EZ9A 3MXMA 3CFPA 4GNIA 1VQ4N 3I56N 4DKWA 2HBJA 2HF4A 3CC2N 4JI5K 1BWFO 4CBWA 2HVHA 1BGXT 4L3QA 4F2SA 2DTUA 1KTQA 4NLCA 3WT0A 2YHAA 1J9AA 2YNGA 2GTDA 4JYAK 1BOTO 5BREA 4YORA 4E7HA 1W7AA 1NK0A 4CGHA 4CFCA 4KHUA 1HNZK 1O13A 1NGBA 3AVGA 2VWJA 1KSPA 3MECA 2E1YA 2FBTA 1KQSM 2VYPA 4A5BA 1HMVA 5BRDA 1NK5A 3OYBA 1QTMA 1S6PA 1JXBA 4A2AA 5JS2A 3LANA 3L2WA 3D2FA 5SZTA 4KHQA 3AVJA 3ZSWA 1C0TA 3OW2M 1QQOA 5EU7A 1KAZA 2F4VK 1WSIA 3QINA 3NGIA 3F9MA 4CCHA 2B6AA 4ID1A 1IKVA 1K8KB 1OKJA 4DV0K 4N47A 4CHPA 1RT4A 4CD1A 2G8VA 4CHOA 3L3VA 2A1SA 4DSIA 4B3OA 1VQKN 3FZLA 4OO1J 3ZX2A 4EP4A 4FLZA 1RTJA 4BRFA 4C1NK 4X62K 3O9QA 2J4RA 1LWFA 3DXKA 1L3VA 4KH5A 3VQBA 3WUHA 1G15A 1TK5A 3ZSVA 2KZMA 3K58A 1WSEA 3V1RA 4IFVA 1QSLA 2A6AA 4CHZA 3H3NO 3HM9A 4BACA 4BR5A 1NMNA 3CERA 5T7BA 3NH0A 3T7ZA 1JL2A 3CI5A 4V19S 2O8EB 5AQSA 3U3YA 4DSJA 1NK4A 3E9LA 4KH4A 5BN8A 2ZGYA 1LWEA 4BGAA 2F9WA 4FK4A 3ZSZA 4M3XA 3CQXA 5M1KA 2Z1HA 2NRVA 4N76A 2OPSA 4DG1A 3EO3A 4BRIA 3LZJA 1RBRA 1T6CA 4O0JA 4KTZA 1EKEA 4B1WB 4DV1K 3OYKA 4YOTA 4N41A 1GLAG 3J81O 4C8NA 4FLVA 2IC3A 4AHVA 3SUPA 2BDPA 1RBTA 2ATQA 2OCEA 4DQRA 4KI6A 1JKHA 5HBMA 4WQ4A 2UU9K 4IBNA 4CECA 4JAXA 4OKEA 2V52B 2X6SA 3HRGA 4M3UA 5FRNA 5AFUH 1VSDA 2B5JA 4CGIA 3PIPL 1CZBA 3O6WA 2HB5A 1WB9A 4JI7K 3CCSN 3VERA 5IT9O 3RR7A 1HKCA 1H1VA 4KRFA 3KLGA 5KRSA 3ZETA 1LW0A 5ADXA 2HMIA 1HQEA 3K9KA 1OH7A 1RT7A 5HP1A 3H45C 4JV5K 1C0FA 1N36K 4J2DA 1QZ6A 3AA5X 3I8BA 1NOZA 4DTNA
chains in the Genus database with same CATH topology
1DLOA 4FM1A 4B9UA 1TKXA 4E7KA 1SV5A 3G0ZA 1KRPA 4LSLA 3PY8A 3V4IA 3VQCA 4WE1A 4FJJA 1T8EA 4W5RA 3DLRA 4CIEA 4BDYA 1TK8A 4HCCA 3KIOA 3P5JA 3TANA 1ZBHA 4B9NA 3ASMA 1HPZA 4DU1A 4CEEA 3ZSOA 3S3NA 3CFRA 4JS4A 1VSHA 3SV3A 3THVA 1N5YA 4C8MA 4PWDA 2E6MA 3DM2A 1VK0A 4OKJA 1VRUA 4KB0A 1HRHA 4B9LA 3LP3A 4FJNA 2OPPA 3LPTA 3OYAA 1GOBA 4HTUA 2ZE2A 2G8IA 3ALYA 1W0HA 2PY5A 4KTWA 2Z1JA 3AVIA 1N6QA 2P1JA 3QNOA 1C1AA 2RPIA 4M45A 3VQQA 1KVCA 3TAQA 1KFSA 3HVRA 4E7LA 1A5VA 1U4BA 1U47A 1L3TA 1X9WA 4HHTA 1YT3A 1EX4A 5I3UA 3V6DA 2OPQA 4CFDA 3TAEA 4ZHRA 4CK3A 1NK7A 1HNIA 1RILA 3AV9A 3DYAA 3CFOA 3VN5A 4RW6A 4DSKA 4KFBA 4DFMA 3VQ7A 2OPRA 3ZT3A 4CK1A 4KREA 4DTSA 2D5RA 4O0IA 3SV4A 2JLEA 2LSNA 4DQQA 3MEDA 3IS9A 1B9DA 1TAQA 2QXFA 3ZT2A 1UWBA 4I7FA 3NGZA 3OYNA 2XY7A 1BI4B 3HT3A 4DLGA 4C8LA 4CHNA 3K59A 2HHUA 3KKRA 2X78A 3QEIA 4O4GA 3HPGA 1GOCA 3RMDA 1XHXA 4FM0A 4NCBA 2Z1GA 4Z0UA 3AA4A 1BQMA 2FBXA 2IOCA 3B6PA 4ZTJA 2HNYA 4FZZA 4W5NA 1UA1A 1D5AA 2E4LA 3QEWA 1HYSA 1L3SA 1TKTA 3SPZA 3D0PA 2HHQA 1U45A 3PO5A 1TAUA 2GV9A 1ZYQA 2XY5A 1EP4A 3NF6A 3ZSXA 4KAZA 3SZ2A 2XY6A 3NAEA 1KVBA 4B9VA 4E0DA 1RDBA 4GMJB 4R5PA 1D9DA 3AVLA 1RDAA 1WSFA 3DMJA 2DFFA 3QEVA 1WLJA 3PX4A 1NKBA 3P83D 4CJKA 3QEXA 4CJLA 4J2BA 1WSJA 3I0SA 3O3FA 3KTQA 4J2AA 4W5TA 4M3WA 5FRMA 2IGIA 4CGGA 4KHWA 4H4OA 1VSFA 1NK9A 4AH9A 3OJUA 3KLHA 1Q9XA 4OLBA 4DLEA 3NCIA 4E1NA 4UQGA 4CJ3A 3O4NA 4CFBA 1YTUA 1SL0A 3EY1A 3VQAA 3S9HA 4PQUA 2F96A 2YNIA 3AVCA 1YVUA 4CF2A 4CJWA 1DTQA 1KLMA 5KGXA 4DTPA 1S9GA 1ZBFA 1C0MA 3SI6A 1BQNA 3V1QA 3L8BA 4RW4A 5HRSA 1RDDA 4FLWA 4CF0A 5CYMA 2FC0A 4O44A 4ICLA 4PA1A 1XWLA 3TI0A 3C6UA 2YKNA 1JLFA 3DRRA 4CJTA 3ZSYA 1HYVA 3LZIA 3CM5A 4DQSA 4F4KA 3ZSQA 3AO2A 3KK2A 3NDKA 4K8ZA 5KRTA 3LP0A 3LPUA 3OYEA 2KFZA 4Z4IA 1CXQA 4Q5VA 1FKOA 2QK9A 4LY7A 3AA3A 3OYGA 4DU4A 5CYQA 4ELVA 1CZ9A 4BE1A 3MXJA 2Z1IA 3AVMA 3G10A 4HUGA 3V9SA 1RT1A 1WNSA 2AJQA 3DLGA 3TAGA 4Y1DA 4OPJA 3DOKA 3SUOA 4W5QA 4CJSA 3SQ4A 1XC9A 1NJWA 2GUIA 3TAPA 3K5LA 3KD1E 3LDSA 1VSLA 1NKEA 4CIFA 4CEAA 3BGRA 4FLXA 2XRIA 2VWKA 3L2UA 3C94A 2ZQBA 3F73A 2HHVA 1QSYA 3CYMA 1TGOA 4FJIA 2BANA 1VSJA 3MEGA 4LH5A 5CY4A 3KJVA 4C8OA 4FVMA 1X1PA 3LALA 1EXQA 3M8SA 2I5JA 3KLFA 3NF9A 1X9MA 4FJ5A 4Z4FA 2RN2A 1O1WA 1ZBIA 3FFIA 1A5WA 2KW4A 3SYZA 1SL1A 1IKWA 1T7PA 4DTUA 3BDPA 1RTHA 4M42A 1Z26A 3DLBA 1TKZA 5C24A 3OYJA 2PZSA 3OYHA 4BDZA 4HUEA 1C1BA 3DRPA 5CZ2A 3OYLA 3PX6A 4BDPA 2O4IA 3T1AA 2D0AA 1Q8IA 4FJGA 4KHYA 2YNHA 5HLFA 5FDLA 3SPYA 2D0CA 2Y1JA 4N5SA 3QNNA 4DF4A 3RMBA 4K8XA 4J2EA 1UAXA 1YTAA 1FXXA 1D8YA 1RTIA 4I2QA 4CERA 5I42A 1ITGA 4ID5A 4DTJA 3TAFA 2OA8A 3RRHA 1S1WA 4KHNA 3NGYA 3U6FA 2G8WA 4CEQA 4FZYA 2G8UA 4KV8A 5DK5A 2YV0X 2HNZA 4CF9A 3ZSRA 4KHSA 4DS5A 1L3UA 4FW2A 3ISNC 1IO2A 4CGJA 4BE0A 1LWCA 2X6NA 4B08A 3S3MA 4DQIA 3OYDA 2XY8A 3HYFA 1NJYA 2PYJA 2HHWA 1Y97A 3OYIA 1UOCA 1C0UA 2YKMA 1KLNA 5KTQA 4DQPA 2IDOA 5HRNA 3AVNA 1VSMA 4MFBA 3VA0A 4RG8A 1VSIA 3LWMA 3KK3A 1NKCA 1CLQA 4CHQA 3TARA 3HK2A 3VQDA 2W42A 4TSXA 3L2QA 5CZ1A 1TL3A 1JLQA 3P1GA 1WAFA 2E6LA 5K14A 4DSEA 3SUNA 4ZTFA 3ZT1A 4EZ6A 4FJKA 1VRTA 1LAVA 3NE6A 1WAJA 3OVNA 3C6TA 1WN7A 2HVIA 3HXMA 3VQ6A 3LWLA 3V1OA 3F9KA 3L3UA 3AO5A 1HJRA 4I9QA 2VG5A 1IKXA 1U48A 1TK0A 4KKOA 3OJSA 3K2PA 3CG7A 3VQ9A 3O4QA 4DTXA 3RRGA 1BISA 1JL1A 1BCMA 3OYMA 3E01A 4I2PA 3NHGA 1LV5A 4LSNA 4Z4CA 1SKRA 1QQCA 3IAYA 4FK0A 4KPYA 5J2MA 3HO1A 3DRSA 2ETJA 5J2PA 4FW1A 3T3FA 2IS3A 3V9XA 4IG3A 1L5UA 4FLYA 1RBUA 2O4GA 3TWHA 4BWJA 4F8RA 2GBZA 1RT3A 1C6VA 4JRPA 2RKIA 3DI6A 1U49A 3OY9A 1QS4A 4DU3A 2DFEA 2FBVA 4CF8A 4HCBA 2F8SA 4CJVA 1RBVA 4RW8A 1IH7A 4AHUA 4Z4HA 5C25A 2EHGA 4NYFA 5E41A 3IRXA 4FZXC 4M3TA 4E19A 3SQ0A 1Z25A 2IAJA 5HRRA 2OZMA 5DMRA 5HROA 1F21A 1SKSA 3CQ8A 3V9ZA 3EZ5A 1K6YA 4EP5A 1D9FA 4JRQA 1S5JA 3O3HA 2ITGA 3DLKA 1I3AA 1JLBA 3OYFA 3ZCMA 3DLEA 5J1EA 3RMCA 2B4JA 1RT5A 4OJRA 1HYZA 3AO1A 3IG1A 3OS1A 2FBYA 1A5XA 1TKDA 2OYQA 3HSTB 3T19A 4FLUA 1NOYA 4ELTA 4FJLA 3ZT4A 3MAQA 1XI1A 4QOZB 1BIZA 3VQ8A 4AILC 3ZT0A 3DLHA 4AHRA 4XIUA 1ASUA 4DTMA 3SCXA 4DFKA 1TV6A 1BHLA 4DWIA 1S9EA 1NJXA 1FKPA 3SQ1A 2X74A 1ASWA 3K5MA 4EZ9A 3MXMA 3H08A 3CFPA 1QE1A 2P5OA 3VQEA 2P5GA 4M3ZA 4CEOA 4HVJA 2A1RA 4IG0A 1Q9YA 3K5OA 3ITHA 3AVFA 1BL3A 3NF7A 2G8KA 1RCHA 3VQPA 2HNDA 4CIGA 3AVHA 4RW9A 2HVHA 1BGXT 3QIPA 4F2SA 2DTUA 1KTQA 5J2NA 1XHZA 2BGGA 2D0BA 4NCAA 2DY4A 4KB1A 2YHAA 1J9AA 4CJFA 2YNGA 4OVLA 4BWMA 3C95A 4E7HA 3B6OA 1NK0A 4M3RA 1RBSA 4IFYA 4CGHA 2KQ2A 3QETA 3K57A 3U3GA 4CFCA 4KHUA 1RT6A 4HUFA 3V9UA 2G8FA 1ZBUA 4FM2A 2HHTA 2F8TA 1DTTA 2ZD1A 1MU2A 1SUQA 4O55A 1S6QA 3AVGA 2VWJA 1KSPA 3MECA 4FJ7A 2FBTA 3AO4A 4B8CA 4E89A 4CFAA 4PY5A 3OS0A 4FXDA 4YFUA 1NK5A 1HMVA 2DFHA 3OYBA 1T03A 1S6PA 1QTMA 1JXBA 5JS2A 3LANA 5KGWA 4AHSA 5FROA 1RT2A 3L2WA 3SQ2A 3VA3A 5SZTA 4KHQA 4FYDA 4KO0A 3NH1A 3KLEA 1R0AA 3AVJA 4BE2A 1T05A 4DSLA 4M3YA 2HHSA 1KFDA 4AHTA 3ZSWA 4JS5A 1C0TA 5EU7A 4FCYA 1JXEA 1S1UA 1WSIA 4LH4A 3NFAA 3QINA 4CK2A 1IKYA 3NGIA 1NK8A 1LAWA 4DTRA 3NBPA 4CCHA 3M8RA 4DTOA 2B6AA 2VG7A 1NJZA 4ID1A 1W9HA 4RW7A 1IKVA 1X9SA 3O3GA 2RF2A 4N47A 3LAKA 4CHPA 3SNNA 1RTDA 1LW2A 3V81A 4CGFA 4FJMA 1RT4A 3AVAA 1UA0A 4OGCA 4B9MA 3LP2A 3RTVA 2G8VA 4CHOA 3WNHA 2G8HA 4KTQA 3L3VA 2A1SA 4CEFA 3JSMA 4DSIA 1IG9A 4B3OA 2KZZA 1HQUA 3TAMA 2R7YA 4FJHA 3HL8A 3TR8A 4EP4A 3QEPA 4FLZA 1WSHA 1RTJA 3M8QA 1J5OA 2P51A 4N56A 2HW3A 1KCFA 3LAMA 1LWFA 2Y1IA 3HPOA 1L3VA 3TABA 1J54A 1S1TA 4NCGA 4CE9A 3VQBA 4GW6A 5SWMA 3KK1A 1G15A 1TK5A 3ZSVA 4F2RA 4OGEA 3KLIA 4NYNA 2KZMA 1GOAA 2NUBA 3A2FA 3K58A 4QAGA 3PO4A 2QKKA 1BIUA 1JLCA 1WSEA 3PUFA 4IFVA 3V1RA 1QSLA 4E1MA 3RWUA 4CHZA 4DMNA 4CJEA 4I9LA 3HM9A 4Q0BA 4BACA 2KTQA 2HHXA 4FK2A 4IDKA 1SKWA 3EYZA 4CF1A 5T7BA 3NH0A 1JL2A 1FK9A 4CJ4A 3HVTA 3U3YA 4CJRA 4DSJA 3MEEA 3PV8A 1NK4A 1BCOA 3ULDA 4DFJA 3DOLA 3WNEA 3QO9A 4CEDA 1LWEA 3I8DA 4GVMA 4FK4A 2OZSA 5J2QA 2XHBA 1I39A 3NH2A 3ZSZA 1C1CA 4JLHA 3WNGA 5C42A 1HNVA 1RDCA 1B9FA 3MXIA 4M3XA 2Z1HA 4G1QA 3K5NA 2YHBA 4N76A 2OPSA 4QCLA 3SJJA 4B8AB 4O5BA 4DG1A 4Z4GA 1BI4A 3I0RA 4OKKA 3HP6A 3LZJA 2PYLA 1RBRA 5KI6A 4O0JA 4DFPA 3HJFA 4KTZA 1EKEA 4B9TA 4FJ8A 4KI4A 3OYKA 3HP9A 4Z4EA 3CM6A 1KVAA 1SL2A 4F3TA 4N41A 3QLHA 4C8NA 2YNFA 1RNHA 2Q3SA 4MQ3A 4CJ5A 4AHCA 3AVKA 4FLVA 2IC3A 4H4MA 4AHVA 4DS4A 2WOMA 3SUPA 2BDPA 1RBTA 4OPKA 2ATQA 3LP1A 4FLTA 4E7JA 3OS2A 4DQRA 2XO7A 2EX3A 1JKHA 3QESA 4KI6A 1VSEA 3AA2A 5HBMA 1CXUA 3HPHA 2QKBA 4L8RB 3QIOA 4IBNA 4E7IA 1ASVA 4CECA 5D3GA 2X6SA 4OKEA 4CGDA 4CHYA 1EETA 1S1XA 4LD0A 4M3UA 1J53A 2JGUA 4Y1CA 5FRNA 3NF8A 1JLAA 3OYCA 1VSDA 4CESA 4B9SA 4ELUA 4IKFA 2B5JA 3AVBA 3S3OA 4CGIA 4F3OA 1REVA 3PX0A 3L2VA 3QERA 4OLAA 5HRPA 1CZBA 1TL1A 1JLGA 3KKSA 2HB5A 2VG6A 2KFNA 4CJQA 2WONA 1NK6A 4CJUA 3RR7A 1QHTA 3KD5E 4CEBA 4KRFA 4CJPA 3KLGA 3VQ5A 4W5OA 5KRSA 1TVRA 4M41A 4H8KA 4YNQA 3UIQA 1JLEA 3WNFA 4FJ9A 3RMAA 4PUOA 2BE2A 4FJXA 1LW0A 5JS1A 2HMIA 1HQEA 3RR8A 4C8KA 3D45A 3V9WA 4CEZA 3M8PA 3VQ4A 3SUQA 3L2RA 1RT7A 4DF8A 4E3SA 5HP1A 4DSFA 1ZBLA 3JYTA 1WSGA 1QSSA 1S1VA 3AO3A 4J2DA 1VSKA 3AA5X 1B92A 1NOZA 4DTNA 1U04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DLO A;  4FM1 A;  4B9U A;  1TKX A;  4E7K A;  1SV5 A;  3G0Z A;  1KRP A;  4LSL A;  3PY8 A;  3V4I A;  3VQC A;  4WE1 A;  4FJJ A;  1T8E A;  4W5R A;  3DLR A;  4CIE A;  4BDY A;  1TK8 A;  4HCC A;  3KIO A;  3P5J A;  3TAN A;  1ZBH A;  4B9N A;  3ASM A;  1HPZ A;  4DU1 A;  4CEE A;  3ZSO A;  3S3N A;  3CFR A;  4JS4 A;  1VSH A;  3SV3 A;  3THV A;  1N5Y A;  4C8M A;  4PWD A;  2E6M A;  3DM2 A;  1VK0 A;  4OKJ A;  1VRU A;  4KB0 A;  1HRH A;  4B9L A;  3LP3 A;  4FJN A;  2OPP A;  3LPT A;  3OYA A;  1GOB A;  4HTU A;  2ZE2 A;  2G8I A;  3ALY A;  1W0H A;  2PY5 A;  4KTW A;  2Z1J A;  3AVI A;  1N6Q A;  2P1J A;  3QNO A;  1C1A A;  2RPI A;  4M45 A;  3VQQ A;  1KVC A;  3TAQ A;  1KFS A;  3HVR A;  4E7L A;  1A5V A;  1U4B A;  1U47 A;  1L3T A;  1X9W A;  4HHT A;  1YT3 A;  1EX4 A;  5I3U A;  3V6D A;  2OPQ A;  4CFD A;  3TAE A;  4ZHR A;  4CK3 A;  1NK7 A;  1HNI A;  1RIL A;  3AV9 A;  3DYA A;  3CFO A;  3VN5 A;  4RW6 A;  4DSK A;  4KFB A;  4DFM A;  3VQ7 A;  2OPR A;  3ZT3 A;  4CK1 A;  4KRE A;  4DTS A;  2D5R A;  4O0I A;  3SV4 A;  2JLE A;  2LSN A;  4DQQ A;  3MED A;  3IS9 A;  1B9D A;  1TAQ A;  2QXF A;  3ZT2 A;  1UWB A;  4I7F A;  3NGZ A;  3OYN A;  2XY7 A;  1BI4 B;  3HT3 A;  4DLG A;  4C8L A;  4CHN A;  3K59 A;  2HHU A;  3KKR A;  2X78 A;  3QEI A;  4O4G A;  3HPG A;  1GOC A;  3RMD A;  1XHX A;  4FM0 A;  4NCB A;  2Z1G A;  4Z0U A;  3AA4 A;  1BQM A;  2FBX A;  2IOC A;  3B6P A;  4ZTJ A;  2HNY A;  4FZZ A;  4W5N A;  1UA1 A;  1D5A A;  2E4L A;  3QEW A;  1HYS A;  1L3S A;  1TKT A;  3SPZ A;  3D0P A;  2HHQ A;  1U45 A;  3PO5 A;  1TAU A;  2GV9 A;  1ZYQ A;  2XY5 A;  1EP4 A;  3NF6 A;  3ZSX A;  4KAZ A;  3SZ2 A;  2XY6 A;  3NAE A;  1KVB A;  4B9V A;  4E0D A;  1RDB A;  4GMJ B;  4R5P A;  1D9D A;  3AVL A;  1RDA A;  1WSF A;  3DMJ A;  2DFF A;  3QEV A;  1WLJ A;  3PX4 A;  1NKB A;  3P83 D;  4CJK A;  3QEX A;  4CJL A;  4J2B A;  1WSJ A;  3I0S A;  3O3F A;  3KTQ A;  4J2A A;  4W5T A;  4M3W A;  5FRM A;  2IGI A;  4CGG A;  4KHW A;  4H4O A;  1VSF A;  1NK9 A;  4AH9 A;  3OJU A;  3KLH A;  1Q9X A;  4OLB A;  4DLE A;  3NCI A;  4E1N A;  4UQG A;  4CJ3 A;  3O4N A;  4CFB A;  1YTU A;  1SL0 A;  3EY1 A;  3VQA A;  3S9H A;  4PQU A;  2F96 A;  2YNI A;  3AVC A;  1YVU A;  4CF2 A;  4CJW A;  1DTQ A;  1KLM A;  5KGX A;  4DTP A;  1S9G A;  1ZBF A;  1C0M A;  3SI6 A;  1BQN A;  3V1Q A;  3L8B A;  4RW4 A;  5HRS A;  1RDD A;  4FLW A;  4CF0 A;  5CYM A;  2FC0 A;  4O44 A;  4ICL A;  4PA1 A;  1XWL A;  3TI0 A;  3C6U A;  2YKN A;  1JLF A;  3DRR A;  4CJT A;  3ZSY A;  1HYV A;  3LZI A;  3CM5 A;  4DQS A;  4F4K A;  3ZSQ A;  3AO2 A;  3KK2 A;  3NDK A;  4K8Z A;  5KRT A;  3LP0 A;  3LPU A;  3OYE A;  2KFZ A;  4Z4I A;  1CXQ A;  4Q5V A;  1FKO A;  2QK9 A;  4LY7 A;  3AA3 A;  3OYG A;  4DU4 A;  5CYQ A;  4ELV A;  1CZ9 A;  4BE1 A;  3MXJ A;  2Z1I A;  3AVM A;  3G10 A;  4HUG A;  3V9S A;  1RT1 A;  1WNS A;  2AJQ A;  3DLG A;  3TAG A;  4Y1D A;  4OPJ A;  3DOK A;  3SUO A;  4W5Q A;  4CJS A;  3SQ4 A;  1XC9 A;  1NJW A;  2GUI A;  3TAP A;  3K5L A;  3KD1 E;  3LDS A;  1VSL A;  1NKE A;  4CIF A;  4CEA A;  3BGR A;  4FLX A;  2XRI A;  2VWK A;  3L2U A;  3C94 A;  2ZQB A;  3F73 A;  2HHV A;  1QSY A;  3CYM A;  1TGO A;  4FJI A;  2BAN A;  1VSJ A;  3MEG A;  4LH5 A;  5CY4 A;  3KJV A;  4C8O A;  4FVM A;  1X1P A;  3LAL A;  1EXQ A;  3M8S A;  2I5J A;  3KLF A;  3NF9 A;  1X9M A;  4FJ5 A;  4Z4F A;  2RN2 A;  1O1W A;  1ZBI A;  3FFI A;  1A5W A;  2KW4 A;  3SYZ A;  1SL1 A;  1IKW A;  1T7P A;  4DTU A;  3BDP A;  1RTH A;  4M42 A;  1Z26 A;  3DLB A;  1TKZ A;  5C24 A;  3OYJ A;  2PZS A;  3OYH A;  4BDZ A;  4HUE A;  1C1B A;  3DRP A;  5CZ2 A;  3OYL A;  3PX6 A;  4BDP A;  2O4I A;  3T1A A;  2D0A A;  1Q8I A;  4FJG A;  4KHY A;  2YNH A;  5HLF A;  5FDL A;  3SPY A;  2D0C A;  2Y1J A;  4N5S A;  3QNN A;  4DF4 A;  3RMB A;  4K8X A;  4J2E A;  1UAX A;  1YTA A;  1FXX A;  1D8Y A;  1RTI A;  4I2Q A;  4CER A;  5I42 A;  1ITG A;  4ID5 A;  4DTJ A;  3TAF A;  2OA8 A;  3RRH A;  1S1W A;  4KHN A;  3NGY A;  3U6F A;  2G8W A;  4CEQ A;  4FZY A;  2G8U A;  4KV8 A;  5DK5 A;  2YV0 X;  2HNZ A;  4CF9 A;  3ZSR A;  4KHS A;  4DS5 A;  1L3U A;  4FW2 A;  3ISN C;  1IO2 A;  4CGJ A;  4BE0 A;  1LWC A;  2X6N A;  4B08 A;  3S3M A;  4DQI A;  3OYD A;  2XY8 A;  3HYF A;  1NJY A;  2PYJ A;  2HHW A;  1Y97 A;  3OYI A;  1UOC A;  1C0U A;  2YKM A;  1KLN A;  5KTQ A;  4DQP A;  2IDO A;  5HRN A;  3AVN A;  1VSM A;  4MFB A;  3VA0 A;  4RG8 A;  1VSI A;  3LWM A;  3KK3 A;  1NKC A;  1CLQ A;  4CHQ A;  3TAR A;  3HK2 A;  3VQD A;  2W42 A;  4TSX A;  3L2Q A;  5CZ1 A;  1TL3 A;  1JLQ A;  3P1G A;  1WAF A;  2E6L A;  5K14 A;  4DSE A;  3SUN A;  4ZTF A;  3ZT1 A;  4EZ6 A;  4FJK A;  1VRT A;  1LAV A;  3NE6 A;  1WAJ A;  3OVN A;  3C6T A;  1WN7 A;  2HVI A;  3HXM A;  3VQ6 A;  3LWL A;  3V1O A;  3F9K A;  3L3U A;  3AO5 A;  1HJR A;  4I9Q A;  2VG5 A;  1IKX A;  1U48 A;  1TK0 A;  4KKO A;  3OJS A;  3K2P A;  3CG7 A;  3VQ9 A;  3O4Q A;  4DTX A;  3RRG A;  1BIS A;  1JL1 A;  1BCM A;  3OYM A;  3E01 A;  4I2P A;  3NHG A;  1LV5 A;  4LSN A;  4Z4C A;  1SKR A;  1QQC A;  3IAY A;  4FK0 A;  4KPY A;  5J2M A;  3HO1 A;  3DRS A;  2ETJ A;  5J2P A;  4FW1 A;  3T3F A;  2IS3 A;  3V9X A;  4IG3 A;  1L5U A;  4FLY A;  1RBU A;  2O4G A;  3TWH A;  4BWJ A;  4F8R A;  2GBZ A;  1RT3 A;  1C6V A;  4JRP A;  2RKI A;  3DI6 A;  1U49 A;  3OY9 A;  1QS4 A;  4DU3 A;  2DFE A;  2FBV A;  4CF8 A;  4HCB A;  2F8S A;  4CJV A;  1RBV A;  4RW8 A;  1IH7 A;  4AHU A;  4Z4H A;  5C25 A;  2EHG A;  4NYF A;  5E41 A;  3IRX A;  4FZX C;  4M3T A;  4E19 A;  3SQ0 A;  1Z25 A;  2IAJ A;  5HRR A;  2OZM A;  5DMR A;  5HRO A;  1F21 A;  1SKS A;  3CQ8 A;  3V9Z A;  3EZ5 A;  1K6Y A;  4EP5 A;  1D9F A;  4JRQ A;  1S5J A;  3O3H A;  2ITG A;  3DLK A;  1I3A A;  1JLB A;  3OYF A;  3ZCM A;  3DLE A;  5J1E A;  3RMC A;  2B4J A;  1RT5 A;  4OJR A;  1HYZ A;  3AO1 A;  3IG1 A;  3OS1 A;  2FBY A;  1A5X A;  1TKD A;  2OYQ A;  3HST B;  3T19 A;  4FLU A;  1NOY A;  4ELT A;  4FJL A;  3ZT4 A;  3MAQ A;  1XI1 A;  4QOZ B;  1BIZ A;  3VQ8 A;  4AIL C;  3ZT0 A;  3DLH A;  4AHR A;  4XIU A;  1ASU A;  4DTM A;  3SCX A;  4DFK A;  1TV6 A;  1BHL A;  4DWI A;  1S9E A;  1NJX A;  1FKP A;  3SQ1 A;  2X74 A;  1ASW A;  3K5M A;  4EZ9 A;  3MXM A;  3H08 A;  3CFP A;  1QE1 A;  2P5O A;  3VQE A;  2P5G A;  4M3Z A;  4CEO A;  4HVJ A;  2A1R A;  4IG0 A;  1Q9Y A;  3K5O A;  3ITH A;  3AVF A;  1BL3 A;  3NF7 A;  2G8K A;  1RCH A;  3VQP A;  2HND A;  4CIG A;  3AVH A;  4RW9 A;  2HVH A;  1BGX T;  3QIP A;  4F2S A;  2DTU A;  1KTQ A;  5J2N A;  1XHZ A;  2BGG A;  2D0B A;  4NCA A;  2DY4 A;  4KB1 A;  2YHA A;  1J9A A;  4CJF A;  2YNG A;  4OVL A;  4BWM A;  3C95 A;  4E7H A;  3B6O A;  1NK0 A;  4M3R A;  1RBS A;  4IFY A;  4CGH A;  2KQ2 A;  3QET A;  3K57 A;  3U3G A;  4CFC A;  4KHU A;  1RT6 A;  4HUF A;  3V9U A;  2G8F A;  1ZBU A;  4FM2 A;  2HHT A;  2F8T A;  1DTT A;  2ZD1 A;  1MU2 A;  1SUQ A;  4O55 A;  1S6Q A;  3AVG A;  2VWJ A;  1KSP A;  3MEC A;  4FJ7 A;  2FBT A;  3AO4 A;  4B8C A;  4E89 A;  4CFA A;  4PY5 A;  3OS0 A;  4FXD A;  4YFU A;  1NK5 A;  1HMV A;  2DFH A;  3OYB A;  1T03 A;  1S6P A;  1QTM A;  1JXB A;  5JS2 A;  3LAN A;  5KGW A;  4AHS A;  5FRO A;  1RT2 A;  3L2W A;  3SQ2 A;  3VA3 A;  5SZT A;  4KHQ A;  4FYD A;  4KO0 A;  3NH1 A;  3KLE A;  1R0A A;  3AVJ A;  4BE2 A;  1T05 A;  4DSL A;  4M3Y A;  2HHS A;  1KFD A;  4AHT A;  3ZSW A;  4JS5 A;  1C0T A;  5EU7 A;  4FCY A;  1JXE A;  1S1U A;  1WSI A;  4LH4 A;  3NFA A;  3QIN A;  4CK2 A;  1IKY A;  3NGI A;  1NK8 A;  1LAW A;  4DTR A;  3NBP A;  4CCH A;  3M8R A;  4DTO A;  2B6A A;  2VG7 A;  1NJZ A;  4ID1 A;  1W9H A;  4RW7 A;  1IKV A;  1X9S A;  3O3G A;  2RF2 A;  4N47 A;  3LAK A;  4CHP A;  3SNN A;  1RTD A;  1LW2 A;  3V81 A;  4CGF A;  4FJM A;  1RT4 A;  3AVA A;  1UA0 A;  4OGC A;  4B9M A;  3LP2 A;  3RTV A;  2G8V A;  4CHO A;  3WNH A;  2G8H A;  4KTQ A;  3L3V A;  2A1S A;  4CEF A;  3JSM A;  4DSI A;  1IG9 A;  4B3O A;  2KZZ A;  1HQU A;  3TAM A;  2R7Y A;  4FJH A;  3HL8 A;  3TR8 A;  4EP4 A;  3QEP A;  4FLZ A;  1WSH A;  1RTJ A;  3M8Q A;  1J5O A;  2P51 A;  4N56 A;  2HW3 A;  1KCF A;  3LAM A;  1LWF A;  2Y1I A;  3HPO A;  1L3V A;  3TAB A;  1J54 A;  1S1T A;  4NCG A;  4CE9 A;  3VQB A;  4GW6 A;  5SWM A;  3KK1 A;  1G15 A;  1TK5 A;  3ZSV A;  4F2R A;  4OGE A;  3KLI A;  4NYN A;  2KZM A;  1GOA A;  2NUB A;  3A2F A;  3K58 A;  4QAG A;  3PO4 A;  2QKK A;  1BIU A;  1JLC A;  1WSE A;  3PUF A;  4IFV A;  3V1R A;  1QSL A;  4E1M A;  3RWU A;  4CHZ A;  4DMN A;  4CJE A;  4I9L A;  3HM9 A;  4Q0B A;  4BAC A;  2KTQ A;  2HHX A;  4FK2 A;  4IDK A;  1SKW A;  3EYZ A;  4CF1 A;  5T7B A;  3NH0 A;  1JL2 A;  1FK9 A;  4CJ4 A;  3HVT A;  3U3Y A;  4CJR A;  4DSJ A;  3MEE A;  3PV8 A;  1NK4 A;  1BCO A;  3ULD A;  4DFJ A;  3DOL A;  3WNE A;  3QO9 A;  4CED A;  1LWE A;  3I8D A;  4GVM A;  4FK4 A;  2OZS A;  5J2Q A;  2XHB A;  1I39 A;  3NH2 A;  3ZSZ A;  1C1C A;  4JLH A;  3WNG A;  5C42 A;  1HNV A;  1RDC A;  1B9F A;  3MXI A;  4M3X A;  2Z1H A;  4G1Q A;  3K5N A;  2YHB A;  4N76 A;  2OPS A;  4QCL A;  3SJJ A;  4B8A B;  4O5B A;  4DG1 A;  4Z4G A;  1BI4 A;  3I0R A;  4OKK A;  3HP6 A;  3LZJ A;  2PYL A;  1RBR A;  5KI6 A;  4O0J A;  4DFP A;  3HJF A;  4KTZ A;  1EKE A;  4B9T A;  4FJ8 A;  4KI4 A;  3OYK A;  3HP9 A;  4Z4E A;  3CM6 A;  1KVA A;  1SL2 A;  4F3T A;  4N41 A;  3QLH A;  4C8N A;  2YNF A;  1RNH A;  2Q3S A;  4MQ3 A;  4CJ5 A;  4AHC A;  3AVK A;  4FLV A;  2IC3 A;  4H4M A;  4AHV A;  4DS4 A;  2WOM A;  3SUP A;  2BDP A;  1RBT A;  4OPK A;  2ATQ A;  3LP1 A;  4FLT A;  4E7J A;  3OS2 A;  4DQR A;  2XO7 A;  2EX3 A;  1JKH A;  3QES A;  4KI6 A;  1VSE A;  3AA2 A;  5HBM A;  1CXU A;  3HPH A;  2QKB A;  4L8R B;  3QIO A;  4IBN A;  4E7I A;  1ASV A;  4CEC A;  5D3G A;  2X6S A;  4OKE A;  4CGD A;  4CHY A;  1EET A;  1S1X A;  4LD0 A;  4M3U A;  1J53 A;  2JGU A;  4Y1C A;  5FRN A;  3NF8 A;  1JLA A;  3OYC A;  1VSD A;  4CES A;  4B9S A;  4ELU A;  4IKF A;  2B5J A;  3AVB A;  3S3O A;  4CGI A;  4F3O A;  1REV A;  3PX0 A;  3L2V A;  3QER A;  4OLA A;  5HRP A;  1CZB A;  1TL1 A;  1JLG A;  3KKS A;  2HB5 A;  2VG6 A;  2KFN A;  4CJQ A;  2WON A;  1NK6 A;  4CJU A;  3RR7 A;  1QHT A;  3KD5 E;  4CEB A;  4KRF A;  4CJP A;  3KLG A;  3VQ5 A;  4W5O A;  5KRS A;  1TVR A;  4M41 A;  4H8K A;  4YNQ A;  3UIQ A;  1JLE A;  3WNF A;  4FJ9 A;  3RMA A;  4PUO A;  2BE2 A;  4FJX A;  1LW0 A;  5JS1 A;  2HMI A;  1HQE A;  3RR8 A;  4C8K A;  3D45 A;  3V9W A;  4CEZ A;  3M8P A;  3VQ4 A;  3SUQ A;  3L2R A;  1RT7 A;  4DF8 A;  4E3S A;  5HP1 A;  4DSF A;  1ZBL A;  3JYT A;  1WSG A;  1QSS A;  1S1V A;  3AO3 A;  4J2D A;  1VSK A;  3AA5 X;  1B92 A;  1NOZ A;  4DTN A;  1U04 A; 
#chains in the Genus database with same CATH topology
 1DLO A;  4B9U A;  4IJN A;  2VGN A;  4EFH A;  2A41 A;  3V4I A;  3VQC A;  4FJJ A;  1T8E A;  4W5R A;  3DLR A;  1TK8 A;  4YY3 K;  3KIO A;  3LL3 A;  3P5J A;  3TAN A;  4B9N A;  1YAG A;  1BG3 A;  4DU1 A;  3H46 O;  4ISG A;  5EVZ A;  4JS4 A;  1HKG A;  1NGA A;  3SV3 A;  3THV A;  4C8M A;  1VK0 A;  4OKJ A;  1NU0 A;  5EXW A;  1HRH A;  3LP3 A;  2GWJ A;  3G71 N;  1SAZ A;  3CJ1 A;  4KTW A;  4BC5 A;  1C1A A;  3VQQ A;  4E1J A;  4ILJ A;  2VQE K;  3SLC A;  4HHT A;  1MDU B;  1WOQ A;  5I3U A;  4ILG B;  3TAE A;  3VET A;  3IDH A;  4ZHR A;  2O8B A;  4BGB A;  3AV9 A;  3VN5 A;  3CCM N;  3T1Y K;  4RW6 A;  1I94 K;  3VQ7 A;  2OPR A;  2O8C B;  1RFQ A;  4ISF A;  4DTS A;  1EO1 A;  2QW9 A;  1YXQ A;  1QVG M;  3NGZ A;  5M1Q A;  3F5T A;  1YJN N;  4C8L A;  4CHN A;  2X78 A;  1X9J A;  3G6E N;  3M6G A;  4JKE A;  4Z0U A;  1BQM A;  2PBD A;  3AA4 A;  2HNY A;  4FZZ A;  1UA1 A;  2E4L A;  4JI4 K;  3VF4 A;  4CVN E;  1JCF A;  1TKT A;  3SPZ A;  1HNW K;  5AQX A;  1IBL K;  2P9P A;  3MK6 A;  2XY5 A;  2FF3 B;  2IVP A;  2Q97 A;  3KK7 A;  4DV4 K;  3SZ2 A;  4B9V A;  2OAN A;  4H5R A;  2D0P A;  1D9D A;  3QEV A;  1NKB A;  3PX4 A;  5BRH A;  3P38 A;  4J2B A;  4B1V A;  2P9K B;  3I0S A;  3VPZ A;  3O3F A;  3HI0 A;  4BC4 A;  4KHW A;  4JKG B;  4AH9 A;  3KLH A;  3NCI A;  3E9P A;  4UQG A;  5M1O A;  2NRW A;  4CF2 A;  1C0M A;  1BQN A;  4LF7 K;  3L8B A;  4R79 A;  1KAX A;  3C6U A;  3LZI A;  3ZSQ A;  3NDK A;  5JMV A;  2PFU A;  2EWS A;  5KRT A;  2F7T A;  4JNE A;  3THY B;  1CXQ A;  3P4I A;  3OYG A;  3AA3 A;  4ELV A;  2QK9 A;  5AQU A;  4X65 K;  1EWQ A;  2P9N B;  3G10 A;  4O5F A;  1WNS A;  2AJQ A;  3LM2 A;  3D6R A;  4OPJ A;  2P9S A;  4DV6 K;  1T3V A;  4LFA K;  2KLA A;  4FOE A;  3TAP A;  3L0Q A;  3RVC A;  4GY2 B;  3LDS A;  3BGR A;  5DM7 L;  4FLX A;  5HL7 L;  3C94 A;  2ZQB A;  3VOV A;  3F73 A;  4DB3 A;  2WFB A;  1QSY A;  3UKU A;  3N4Q A;  4FJI A;  3KJV A;  4FVM A;  4FJ5 A;  5FLX O;  4Z4F A;  1NGF A;  3N4P A;  4DTU A;  1OH8 A;  5FPM A;  1Z26 A;  1TKZ A;  5AQQ A;  2PZS A;  3HOS A;  4BDZ A;  1C1B A;  3T1A A;  4KHY A;  2Y1J A;  3QNN A;  3RMB A;  1X3M A;  4CZM A;  3TAF A;  4H0Y B;  3K9J A;  5GAG P;  4A2B A;  4CEQ A;  5DK5 A;  4FW2 A;  3S3M A;  4WF9 L;  4FWM A;  1XMO K;  3HOT A;  4MLH A;  3CJB A;  1C0U A;  4LFB K;  5KTQ A;  3CCQ N;  5CR4 A;  3U9D A;  1VSI A;  3KK3 A;  1CLQ A;  3HK2 A;  1OVY A;  2W42 A;  1IV0 A;  4TSX A;  1W97 L;  3DWL A;  5CZ1 A;  1TL3 A;  4ZTF A;  4O8U A;  3ZT1 A;  1VRT A;  3NE6 A;  1WN7 A;  3UB5 A;  3LWL A;  3L3U A;  4JKC A;  1XQS C;  2VG5 A;  5M1P A;  4PL8 A;  1TK0 A;  3K2P A;  4BR9 A;  4DTX A;  2QWM A;  3D2E B;  4WQ5 C;  5B8H A;  3E01 A;  5M1F A;  4FK0 A;  5KPR A;  1SKR A;  1Z6R A;  4KPY A;  1K73 O;  3DRS A;  2ETJ A;  3T3F A;  3BEX A;  4CJ7 A;  1L5U A;  4FLY A;  2O4G A;  3TWH A;  4F8R A;  3J7Z O;  3NVM A;  2ZF5 O;  3OY9 A;  5GAH P;  5KQ8 A;  1RGI A;  2F8S A;  1VQ7 N;  2GEL A;  4GV3 A;  4M3T A;  5CE3 A;  1Z25 A;  2IAJ A;  3UKR A;  2OTL N;  2OZM A;  5HRO A;  2VGM A;  3CQ8 A;  3B8A X;  3H1V X;  4EP5 A;  4IZ9 A;  1I3A A;  2UXB K;  4OJR A;  2V7Y A;  4FWL A;  1EQY A;  3O9S A;  3TTF A;  4BRK A;  3OS1 A;  2FBY A;  2IIR A;  3ZEU B;  4JI2 K;  3ZT4 A;  1BIZ A;  3THX B;  4M63 C;  3DLH A;  1ASU A;  5JIC A;  2QWO A;  3EZW A;  2FF6 A;  4DWI A;  3TPQ A;  3LDL A;  2X74 A;  3SJH A;  1QE1 A;  3VQE A;  4DR4 K;  4CEO A;  4HVJ A;  4IG0 A;  3ULE A;  3ITH A;  3AVF A;  1BL3 A;  4CIG A;  3AVH A;  3LDO A;  2CGJ A;  3W0L A;  4H03 B;  3CPE A;  5C2D A;  2CGK A;  4KB1 A;  4CJF A;  4OVL A;  1OH5 A;  1DEJ A;  5LL6 Z;  3U3G A;  4NLB A;  4DQ8 A;  1RT6 A;  4HUF A;  4B3M K;  3V9U A;  4FM2 A;  2HHT A;  3CMA N;  1DTT A;  4CD3 A;  4CI6 A;  1S6Q A;  3QIC A;  3VF2 A;  4B8C A;  3AO4 A;  3OS0 A;  4YFU A;  2DFH A;  1T03 A;  4X66 K;  1HKB A;  5JLF A;  3SQ2 A;  4FYD A;  3K0S A;  1NG9 A;  3C6A A;  1R0A A;  4M3Y A;  1XMQ K;  1RDU A;  3S41 A;  3AGR A;  4LH4 A;  3NFA A;  5GIO A;  3R3L A;  1NJZ A;  2VG7 A;  2HHH K;  1W9H A;  3V81 A;  4FJM A;  4B9M A;  3AVA A;  4OGC A;  2G8H A;  3JSM A;  1IG9 A;  2KZZ A;  4FJH A;  3HL8 A;  3A5O C;  3QEP A;  2P51 A;  3Q7B A;  2Y1I A;  3TAB A;  3H6E A;  1S1T A;  1ZBS A;  4OGE A;  2NUB A;  2W41 A;  1K8K A;  4DCH A;  3TSP A;  3CJ7 A;  2HHX A;  3DAW A;  5E84 A;  1RDW X;  4CF1 A;  5BR8 K;  3HVT A;  2E8A A;  3ID8 A;  3QO9 A;  3WNE A;  4CED A;  4K41 A;  3TU5 A;  3TTC A;  1Q18 A;  2GEM A;  5J2Q A;  4CBX A;  3DXM B;  1GLL O;  2E2P A;  3WNG A;  1HNV A;  1RDC A;  1B9F A;  5TKY A;  1YUW A;  3FLC O;  3U4L A;  2FSJ A;  4B8A B;  4O5B A;  3I0R A;  4OKK A;  3HJF A;  3R8E A;  4F3T A;  2YNF A;  4CJ5 A;  4H4M A;  3WXK A;  5HOO A;  2O8E A;  3WXM B;  4OPK A;  4MDB A;  5BN9 A;  3SMS A;  2EX3 A;  4BRG A;  1CXU A;  3HPH A;  2QKB A;  4L8R B;  1ASV A;  1X3N A;  4FO0 A;  1VHX A;  4LC9 B;  5AQH A;  2JGU A;  4Y1C A;  2A5X A;  4IKF A;  3C7N B;  3VEN A;  3S3O A;  2YHY A;  3L2V A;  5HRP A;  1JLG A;  4CJQ A;  3BZK A;  4JEP A;  4CJU A;  5FPE A;  1VQ6 N;  2FSN A;  4PUO A;  4H8K A;  3RMA A;  5JS1 A;  3D45 A;  3VQ4 A;  1GLD G;  1C0G A;  4DSF A;  1ZBL A;  4LF8 K;  2NRR A;  1S1V A;  3AO3 A;  4KHP K;  4QS7 A;  3O9U A;  4FM1 A;  1TKX A;  1NWK A;  1SV5 A;  1KRP A;  4LSL A;  5F2R A;  4CIE A;  3GDQ A;  4BDY A;  4HCC A;  1HPZ A;  3SAF A;  4CEE A;  3ZSO A;  3CC7 N;  3CFR A;  4PWD A;  1N5Y A;  2YCH A;  2VWB A;  1VQP N;  2Q31 A;  3OYA A;  3LPT A;  5AQV A;  1E4G T;  2G8I A;  2PY5 A;  1MWM A;  5A2Q O;  1N6Q A;  3QNO A;  2RPI A;  3TAQ A;  1KFS A;  5EOY A;  1NJI O;  1A5V A;  3I33 A;  1U47 A;  1L3T A;  1X9W A;  1EX4 A;  4CFD A;  3VGK A;  1HNI A;  3BF1 A;  3DYA A;  3CFO A;  1YIT N;  1ZC6 A;  4KFB A;  4KRE A;  2O8D B;  3MCP A;  2D5R A;  4F9O A;  4O0I A;  5MLC Q;  2NZT A;  2QXF A;  1R59 O;  3ZT2 A;  3FZM A;  2Q2R A;  5AQW A;  4M7X A;  4IEE A;  4O4G A;  1GOC A;  4FM0 A;  2FBX A;  4ZTJ A;  3UE5 A;  4W5N A;  3CPW M;  3QEW A;  3D7E O;  1L3S A;  4EHU A;  1TAU A;  3J7A P;  4BC3 A;  2O8C A;  2YI1 A;  1EP4 A;  2PAV A;  3NAE A;  1KVB A;  4E0D A;  3CJA A;  3AVL A;  1RDA A;  1WSF A;  1NGI A;  2DFF A;  3QML A;  1DT9 A;  3QEX A;  3PSF A;  1VQ9 N;  1ATN A;  2KHO A;  4W5T A;  5FRM A;  3A0I X;  3BF3 A;  3MWP A;  2YX6 A;  1NK9 A;  3OJU A;  5AZJ B;  4DR1 K;  4DLE A;  1YTU A;  4CFB A;  3EE9 A;  1SL0 A;  3VQA A;  2F96 A;  1YVU A;  3KHY A;  3ENH A;  3CC4 N;  3CCV N;  1XUP O;  2NRZ A;  4CJW A;  1KLM A;  2WC9 A;  3AAR A;  1S9G A;  4H5N A;  5HRS A;  4LF6 K;  4F4K A;  4FSV A;  2P9K A;  3VGM A;  4JKA A;  3LPU A;  2KFZ A;  1V4T A;  1YJ9 N;  4LY7 A;  1NGE A;  4JKG A;  4BE1 A;  2Z1I A;  3AVM A;  3J80 O;  1RT1 A;  5FPN A;  4EHT A;  3DLG A;  4Y1D A;  1CZA N;  4W5Q A;  2QWN A;  4CJS A;  4A59 A;  4RTF D;  1NKE A;  4NO7 A;  2A40 A;  2XRI A;  2ITM A;  2HHV A;  3FFK B;  1TGO A;  2CH5 A;  3CME N;  1VSJ A;  5CY4 A;  1EXQ A;  3M8S A;  3NF9 A;  3THY A;  5AZI B;  1SL1 A;  2P9N A;  1KAY A;  5C24 A;  3OYH A;  4HUE A;  3OBW A;  2O4I A;  4BRC A;  4FJG A;  5FDL A;  2D0C A;  4N5S A;  3WQU A;  3MDQ A;  2HBM A;  1D8Y A;  1FXX A;  1RTI A;  4PKG A;  2OA8 A;  2CGL A;  1IBM K;  2QWP A;  3NGY A;  4FZY A;  3C0B A;  2YV0 X;  2HNZ A;  2IVO A;  4FL9 A;  4KHS A;  5BPN A;  4CZG A;  3ISN C;  4DQI A;  2X6N A;  1VQO N;  2NRT A;  2XY8 A;  2HHW A;  4RWT A;  1Y97 A;  3OYI A;  1UOC A;  3NVK A;  2YKM A;  2IDO A;  4PKI A;  5HRN A;  3AAQ A;  4MFB A;  3VA0 A;  3O4W A;  4RG8 A;  1QQN A;  1NKC A;  3TAR A;  3ENB A;  2QWR A;  3L2Q A;  3P1G A;  4DSE A;  5K14 A;  4EZ6 A;  3OVN A;  3C6T A;  5JVG L;  2HVI A;  3VQ6 A;  3VGL A;  3AO5 A;  3C6H A;  3WEE B;  4I9Q A;  1IKX A;  1SQK A;  2NRH A;  4XH1 A;  2UUA K;  1Q81 O;  4WCE L;  1BIS A;  1BCM A;  4GV9 A;  1QQC A;  3HO1 A;  2ZJR L;  4OPA A;  3V9X A;  4A62 A;  2FXU A;  2E2Q A;  3DI6 A;  1U49 A;  2DFE A;  2BUP A;  4CF8 A;  5AQG A;  4AHU A;  4RW8 A;  4DR7 K;  4Z4H A;  3VTH A;  4E19 A;  2E1Z A;  3SQ0 A;  3H3O B;  4BRE A;  5HRR A;  3GL1 A;  5LJV A;  4XH4 A;  1SKS A;  1JCE A;  3EZ5 A;  3D2E A;  5EX5 A;  5KQD A;  2ITG A;  3DLK A;  2ZJQ L;  4H0T B;  3RMC A;  2B4J A;  3CCU N;  1DGK N;  1A5X A;  5CHI A;  2OYQ A;  3T19 A;  4A5A A;  4FLU A;  4QOZ B;  4FJL A;  3MAQ A;  3ZX3 A;  3SCX A;  4DFK A;  1BHL A;  1HR0 K;  1NJX A;  1ASW A;  3H08 A;  4AQY K;  2P5G A;  2A1R A;  4B1Z A;  2P9I A;  3NF7 A;  1QHA A;  1RCH A;  3VQP A;  1ATR A;  2QA4 N;  4RW9 A;  4WFB L;  2BGG A;  2D0B A;  4NCA A;  2DY4 A;  3ZEU A;  3EN9 A;  3C95 A;  3VTI A;  1GLB G;  3THX A;  1RBS A;  4JHD A;  3QET A;  3RSE B;  3FZF A;  4JKB A;  2G8F A;  2F8T A;  4O55 A;  1SUQ A;  4FXD A;  4H0X B;  3TTD A;  5AFU A;  4KO0 A;  4DR6 K;  4BE2 A;  4DSL A;  4AHT A;  1JXE A;  5GAD P;  4CK2 A;  2O8F B;  3G25 A;  1NK8 A;  4DTO A;  4K0K K;  1X9S A;  1U2V B;  3O3G A;  2RF2 A;  3LAK A;  3SNN A;  5C12 A;  1UA0 A;  3RTV A;  3WNH A;  2D1K A;  1YJW N;  4BQZ A;  4EAH D;  5AR0 A;  3TAM A;  2R7Y A;  2YHW A;  2ZGZ A;  1WSH A;  1J5O A;  4JN4 A;  2HW3 A;  1KCF A;  3EKU A;  5LJW A;  4DV2 K;  1J54 A;  5SWM A;  4CE9 A;  4BRQ A;  4WQ5 A;  2UXD K;  3O08 A;  3KLI A;  4I6M B;  1GOA A;  1NGH A;  4BQL A;  3ZLJ A;  4IDH A;  3CJ9 A;  2QKK A;  1JLC A;  2CH6 A;  3PUF A;  3THW B;  4E1M A;  1YIJ N;  3RWU A;  3WXI A;  4DMN A;  2QWQ A;  3WXL A;  4I9L A;  4FWO A;  2E5L K;  4FK2 A;  4IDK A;  3EYZ A;  5KPT A;  4CJR A;  2P9L B;  3MEE A;  3HM8 A;  3PV8 A;  1BCO A;  3CCE N;  2NLX A;  3SK3 A;  1TUU A;  4BRP A;  1GLF O;  1VQM N;  4JI0 K;  5KPZ A;  2OZS A;  2XHB A;  1C1C A;  5C42 A;  5DM6 L;  4G1Q A;  3K5N A;  2YHB A;  3ENO A;  3T69 A;  1ESV A;  4Z4G A;  2P9I B;  2PYL A;  2UXC K;  4DFP A;  4IOC L;  4KI4 A;  3CM6 A;  1SL2 A;  3QLH A;  5BPM A;  4MQ3 A;  4AHC A;  5AQO A;  4JI3 K;  3OS2 A;  2XO7 A;  1ATS A;  2Q36 A;  3QES A;  1VSE A;  4JHD B;  5AQP A;  3VES A;  3A8Y A;  4JI6 K;  4CHY A;  1EET A;  3DXM A;  1S1X A;  4LD0 A;  1VQN N;  4IOX A;  4CES A;  3VEV A;  4B9S A;  3AVB A;  3PX0 A;  3QER A;  2VG6 A;  3CF5 L;  2KFN A;  1NK6 A;  3KWG A;  2P9U B;  5GIN A;  1QHT A;  4CEB A;  3IFR A;  3VQ5 A;  3OHR A;  3WNF A;  2W40 A;  3M5R A;  4YOW A;  2BE2 A;  4FJX A;  1Q82 O;  1QQM A;  2UUC K;  1T6D A;  3M8P A;  3VMF B;  3SUQ A;  2OTJ N;  3QFP A;  1QSS A;  3C7N A;  4CZI A;  3LDQ A;  1KXP A;  1B92 A;  3GBT A;  2NRX A;  3G0Z A;  3VEO A;  3PY8 A;  4WE1 A;  4H0P A;  2BH1 A;  4IFE A;  1V4S A;  3IKM A;  4CZF A;  4DR2 K;  1VQ8 N;  1N33 K;  1ZBH A;  4C1N I;  1NBW A;  4FWQ A;  3S3N A;  4IEI A;  3TSU A;  3VEW A;  3OBY A;  4CZK A;  2E2N A;  4LF9 K;  2I7N A;  4B9L A;  4AF1 A;  1IBK K;  1GOB A;  4HTU A;  2GWK A;  2ZE2 A;  2Z1J A;  2YJE A;  1KVC A;  4H5T A;  4E7L A;  1U4B A;  3P31 A;  3V6D A;  2OPQ A;  1NK7 A;  4CK3 A;  1RIL A;  4DFM A;  4CK1 A;  1LCU A;  1P90 A;  4FPB A;  2W6L A;  4CZJ A;  4H5V A;  2JLE A;  4DQQ A;  3MED A;  3IS9 A;  1TAQ A;  1DKG D;  4WFN L;  2XY7 A;  4I7F A;  1BU6 O;  2HHU A;  3KKR A;  1G99 A;  5AQN A;  1S22 A;  3HPG A;  3CIP A;  4NCB A;  1D4X A;  2Z1G A;  4FWN A;  3B6P A;  2IOC A;  1D5A A;  5F1X A;  1HYS A;  3KZB A;  4JI1 K;  3D0P A;  3SBG A;  3PO5 A;  3JS6 A;  5BRF A;  2DPN A;  4NB4 A;  2O8D A;  2AA4 A;  4KAZ A;  4A61 A;  2XY6 A;  4JD2 B;  4NXM K;  4BR2 A;  4B1U B;  4B1Y B;  3DMJ A;  1WLJ A;  3P83 D;  2V7Z A;  4CJK A;  4CJL A;  2W6K A;  3M3Z A;  4J2A A;  5ADX H;  3O1B A;  4H4O A;  1Q9X A;  4OLB A;  1NGD A;  3O80 A;  2NNW A;  3S9H A;  4BRO A;  4PQU A;  2YNI A;  3AVC A;  3T1H K;  1ZBF A;  3CET A;  3SI6 A;  4FLW A;  2FC0 A;  5AQF A;  5AQZ A;  4IO9 L;  4O44 A;  1XWL A;  3DRR A;  2YKN A;  4DQS A;  3MCA B;  3ZSY A;  4LF5 K;  4Q0B A;  2QWL A;  3AO2 A;  3KK2 A;  1IG8 A;  3E9O A;  2ASO A;  4IJA A;  5JVH L;  3ZYY X;  3OYE A;  3A5M C;  1GLE G;  4Q5V A;  1FKO A;  4YDU C;  4DU4 A;  1CZ9 A;  5AZJ A;  1BA1 A;  3SAG A;  2YJF A;  3V9S A;  1N8R O;  5ELZ A;  3DOK A;  4OPH A;  4JI8 K;  4CZH A;  1NJW A;  3EE8 A;  5AJ3 K;  3K5L A;  4X64 K;  3KD1 E;  1VSL A;  4CIF A;  4YOX A;  2VWK A;  4CZE A;  2ZJP L;  3CYM A;  3MEG A;  1GLC G;  4C8O A;  1X1P A;  3LAL A;  2D4W A;  2HBK A;  3QBW A;  2I5J A;  4AM6 A;  1X9M A;  5H1S Q;  1A5W A;  1Y64 A;  2KW4 A;  3AY9 A;  1IKW A;  4MLE A;  4DUY K;  3SYZ A;  1RTH A;  4M42 A;  4K43 A;  3DLB A;  3OYJ A;  4RCH A;  1ZXO A;  3LM9 A;  5BPL A;  3OYL A;  1NNE A;  2D0A A;  1Q8I A;  3L4I A;  1TYQ B;  5AQY A;  1K8A O;  3SBT A;  4FWP A;  4BVP A;  1YTA A;  4I2Q A;  5I42 A;  4ID5 A;  4DTJ A;  1NM1 A;  1S1W A;  4KHN A;  3U6F A;  3HTV A;  4BG9 A;  2G8W A;  4BRD A;  2G8U A;  3U9Z A;  4CF9 A;  3FZK A;  3TSQ A;  5AZI A;  1ZBI A;  1L3U A;  4B08 A;  3OYD A;  3R9P A;  1NGC A;  4LF4 K;  4FPA A;  1LOT B;  5F0X A;  4M7Y A;  3CD6 N;  1KLN A;  4B9Q A;  1T44 A;  4DQP A;  3AVN A;  1VSM A;  4CHQ A;  4DR5 K;  3VQD A;  3MN9 A;  1J5E K;  4PL7 A;  1WAF A;  2E6L A;  1WAJ A;  5LMN K;  4EIA A;  3V1O A;  1VAZ A;  3F9K A;  1HJR A;  3L4Q A;  5E26 A;  4KKO A;  3EEQ A;  3SAH A;  4DV7 K;  1JL1 A;  3OYM A;  1LV5 A;  3IAY A;  4LSN A;  4FW1 A;  2IS3 A;  2FLO A;  1RBU A;  4C23 A;  4BWJ A;  2GBZ A;  1U6Z A;  3GOI A;  3LDP A;  2RKI A;  4DU3 A;  1QS4 A;  4HCB A;  1RBV A;  3U8X A;  1IH7 A;  4U7B A;  4NYF A;  3IRX A;  4H5W A;  3WEE A;  3O9R A;  3EL2 A;  5DMR A;  3V9Z A;  4XH5 A;  1D9F A;  4JRQ A;  1S5J A;  3O3H A;  1JLB A;  3OYF A;  4JKF A;  4WYB A;  3AO1 A;  3E1Y A;  5AQI A;  3IG1 A;  4ELT A;  3NMU A;  3VQ8 A;  4AIL C;  5AQR A;  4K25 A;  4AHR A;  4Z94 A;  4XIU A;  4DTM A;  2D0O A;  1S9E A;  1NGG A;  4GKJ K;  3CCJ N;  4M3Z A;  2P5O A;  2GX9 A;  5LMU K;  4WQ4 C;  1Q9Y A;  3K5O A;  1VQL N;  3CQY A;  5FPD A;  2G8K A;  2HND A;  3J7Y P;  3QIP A;  3D2F B;  5J2N A;  5AQL A;  1XHZ A;  1E3M A;  1HPM A;  4BWM A;  5C10 A;  3B6O A;  4M3R A;  4IFY A;  3FZH A;  2KQ2 A;  3K57 A;  5EY4 A;  3AAP A;  1ZBU A;  3MN6 A;  3MWT A;  2ZD1 A;  5C15 A;  1MU2 A;  3ATV A;  4FJ7 A;  4PY5 A;  4E89 A;  4CFA A;  1QVF M;  1S3X A;  1WBD A;  4PKH A;  3CHW A;  4JKH A;  5KGW A;  4AHS A;  5FRO A;  1RT2 A;  3OA9 A;  3VA3 A;  4J8F A;  3NH1 A;  3KLE A;  3DXK B;  1T05 A;  2HHS A;  5I9E B;  1KFD A;  4JS5 A;  3LDN A;  4FCY A;  4AM7 A;  1S1U A;  5AQJ A;  1S72 N;  1IKY A;  1LAW A;  3RSE A;  3NBP A;  4DTR A;  3M8R A;  2ZWH A;  4YOU A;  4RW7 A;  1IJJ A;  3WXJ A;  4H0V B;  2ASM A;  1RTD A;  1LW2 A;  2H3G X;  3BP8 A;  4CGF A;  4KTQ A;  2HOE A;  3LP2 A;  3MX2 A;  5C0Y A;  4BR4 A;  4BG8 A;  4CEF A;  1HQU A;  3TR8 A;  3A5L C;  2E2O A;  3M8Q A;  4N56 A;  2F9T A;  3LAM A;  1XNR K;  1OVQ A;  3HPO A;  3I55 N;  4H0O A;  3KK1 A;  4NCG A;  4DUZ K;  4GW6 A;  3R6M A;  3IMX A;  2WBN A;  4F2R A;  2O8F A;  4NYN A;  1NGJ A;  1QZ5 A;  3A2F A;  4QAG A;  3PO4 A;  3FE1 A;  1BIU A;  1U2V A;  5BR9 A;  1VQ5 N;  4CJE A;  3FGU A;  2IVN A;  1Q86 O;  2KTQ A;  2E88 A;  1SKW A;  2RHK A;  1FK9 A;  4CJ4 A;  4K42 A;  3KVG A;  1MA9 B;  4BRN A;  3ULD A;  2ASP A;  3DOL A;  4DFJ A;  2I7P A;  3I8D A;  4NXN K;  4GVM A;  1I39 A;  3NH2 A;  4BRA A;  4JLH A;  3MXI A;  4I6M A;  4QCL A;  3SJJ A;  4PHT X;  1XNQ K;  1BI4 A;  3HP6 A;  3THW A;  5KI6 A;  4DHY A;  4BRM A;  4B9T A;  4B3R K;  4FJ8 A;  3HP9 A;  4Z4E A;  1KVA A;  1JJ2 M;  1RNH A;  2Q3S A;  4DS4 A;  3A5N C;  3AVK A;  2WOM A;  3QBX A;  4E7J A;  3LP1 A;  2P9L A;  4HTL A;  4FLT A;  2AP1 A;  1FJG K;  1HNX K;  3GE1 A;  3AA2 A;  3ZET B;  4BR0 A;  3QIO A;  4E7I A;  5D3G A;  4CGD A;  1NMD A;  3DJC A;  1J53 A;  3VEZ A;  3NF8 A;  1JLA A;  4FOI A;  3OYC A;  4ELU A;  4B1X B;  4F3O A;  1REV A;  1BDG A;  4OLA A;  1TL1 A;  3KKS A;  2WON A;  1TUY A;  3O8M A;  5AQT A;  2WUS A;  4CJP A;  4W5O A;  1TVR A;  1K9M O;  2A3Z A;  4M41 A;  4YNQ A;  3MN7 A;  1JLE A;  3UIQ A;  4FJ9 A;  3RR8 A;  4C8K A;  3V9W A;  3R1X A;  4CEZ A;  3L2R A;  4DF8 A;  4E3S A;  3JYT A;  1WSG A;  1Z05 A;  2QXL A;  1VSK A;  4B3S K;  3BDP A;  1U04 A;  3CJC A;  1WBB A;  4IWV A;  4E7K A;  1YVN A;  4QS8 A;  2P9U A;  5AQK A;  4FWR A;  2O8B B;  3ASM A;  3EKS A;  4GV6 A;  1HX1 A;  3CXC M;  3O9T A;  4LFC K;  1VSH A;  4DV5 K;  3M1F A;  3Q7C A;  2ZM6 K;  2E6M A;  3DM2 A;  1VRU A;  4IO8 A;  4JK8 A;  1BA0 A;  4KB0 A;  4FJN A;  2HMP A;  1XC3 A;  2OPP A;  5TKW A;  1HJO A;  2VCP A;  1W0H A;  3ALY A;  3AVI A;  2P1J A;  4M45 A;  1KC8 O;  3HVR A;  4A57 A;  4U67 L;  1M90 O;  1YT3 A;  4B3T K;  2P9P B;  4DSK A;  3ZT3 A;  3MN5 A;  3O1W A;  3F2K A;  4BRH A;  3H1Q A;  2GUP A;  3SV4 A;  2LSN A;  1B9D A;  1UWB A;  2JWK A;  3OYN A;  1BI4 B;  2Q0U A;  3HT3 A;  4DLG A;  4CZL A;  3K59 A;  4Y0W A;  4ILH A;  3QEI A;  1E4F T;  3BZC A;  3MX5 A;  3RMD A;  1XHX A;  2QTD A;  3QDK A;  1BUP A;  4CBU A;  3P39 A;  4FWK A;  2HHQ A;  2Q0R A;  4ISE A;  4QS9 A;  3HSC A;  1U45 A;  3PLA A;  2GV9 A;  1ZYQ A;  2KKZ A;  1MWK A;  3NF6 A;  3ZSX A;  4JK7 A;  1RDB A;  4GMJ B;  4R5P A;  3ID6 A;  1SS6 A;  1WSJ A;  3KTQ A;  4M3W A;  4BVO A;  1EWR A;  2IGI A;  4CGG A;  2VQF K;  4YHH K;  1J6Z A;  1VSF A;  4MO5 A;  1NLV A;  4E1N A;  3VF6 A;  3O4N A;  4CJ3 A;  3EY1 A;  1HUX A;  2P9S B;  4GKK K;  1DTQ A;  3QFU A;  5KGX A;  4DTP A;  1KD1 O;  1BO5 O;  3V1Q A;  4RW4 A;  1RDD A;  4CF0 A;  5CYM A;  4JD2 A;  4UY8 O;  4ICL A;  4PA1 A;  3TI0 A;  3KD5 E;  1JLF A;  4CJT A;  3UKU B;  1HYV A;  3BUZ B;  3CM5 A;  4K8Z A;  1FW6 A;  4FVU A;  3LP0 A;  3WQT A;  3VEX A;  4Z4I A;  5CYQ A;  3L6Q A;  3MXJ A;  3JAM O;  3SMP A;  4HUG A;  3AGK A;  3TAG A;  2Q1N A;  3VEY A;  3ZX0 A;  2JWL A;  3SUO A;  3SQ4 A;  1XC9 A;  2GUI A;  2RE2 A;  5GAE P;  2HBL A;  4KBO A;  1N34 K;  4YOY A;  4CEA A;  3L2U A;  4O8K A;  3HBT A;  1WUA A;  3O5B A;  2BAN A;  1M1K O;  5LY3 A;  4LH5 A;  3QB0 A;  4WFA L;  3KLF A;  2RN2 A;  1O1W A;  4BC2 A;  3FFI A;  1T7P A;  2FSK A;  3DLL L;  2QEX N;  3C65 A;  3G4S N;  3GG4 A;  1YF5 L;  3DRP A;  5CZ2 A;  3PX6 A;  4BDP A;  4HWI A;  2YNH A;  5HLF A;  3SPY A;  3CCR N;  4BY9 C;  4MO4 A;  4DF4 A;  4JK9 A;  2BTF A;  4K8X A;  4J2E A;  1UAX A;  3E66 A;  4CER A;  1ITG A;  4DV3 K;  3RRH A;  1ILY A;  2UYT A;  4KV8 A;  3JXU A;  3ZSR A;  4DS5 A;  4CGJ A;  1IO2 A;  4BE0 A;  1HLU A;  1LWC A;  4GVE A;  3HYF A;  1NJY A;  2PYJ A;  2WTU A;  3KWI A;  1OH6 A;  4DR3 K;  1TYQ A;  3J8A A;  2UUB K;  1W2B M;  4JKD A;  4IXC A;  3LWM A;  3OTO K;  4G9Z A;  2V51 B;  2HST A;  5M1N A;  3PIO L;  4FWS A;  1JLQ A;  3SUN A;  2A42 A;  1GLJ O;  4FJK A;  1N32 K;  1LAV A;  4XEI A;  2HF3 A;  1Q7Y O;  3PSI A;  3HXM A;  3UKR B;  3FR0 A;  1U48 A;  3W3D A;  1YHQ N;  3MMV A;  3OJS A;  3CG7 A;  3CCL N;  3VQ9 A;  3O4Q A;  3BY5 A;  3RRG A;  4MDA A;  2QI2 A;  4KH6 A;  4I2P A;  3NHG A;  4Z4C A;  2YHX A;  5IWA K;  5J2M A;  4YOV A;  3HZ6 A;  5J2P A;  4IG3 A;  5GIP A;  1RT3 A;  1C6V A;  4JRP A;  5C2F A;  2QM1 A;  2FBV A;  4CJV A;  5C25 A;  2EHG A;  4FZX C;  5E41 A;  2E20 A;  1JCG A;  5AQM A;  1F21 A;  3ULE B;  1K6Y A;  1P8Z A;  5JLH A;  4YDU A;  4BR7 A;  3ATU A;  4BRL A;  1SZ2 A;  3ZCM A;  3DLE A;  5J1E A;  1RT5 A;  4OX9 K;  1HYZ A;  4CW7 B;  1TKD A;  3HST B;  1NOY A;  1XI1 A;  1YI2 N;  3ZT0 A;  1TV6 A;  3IUC A;  1FKP A;  3SQ1 A;  4IOA L;  3K5M A;  4EZ9 A;  3MXM A;  3CFP A;  4GNI A;  1VQ4 N;  3I56 N;  4DKW A;  2HBJ A;  2HF4 A;  3CC2 N;  4JI5 K;  1BWF O;  4CBW A;  2HVH A;  1BGX T;  4L3Q A;  4F2S A;  2DTU A;  1KTQ A;  4NLC A;  3WT0 A;  2YHA A;  1J9A A;  2YNG A;  2GTD A;  4JYA K;  1BOT O;  5BRE A;  4YOR A;  4E7H A;  1W7A A;  1NK0 A;  4CGH A;  4CFC A;  4KHU A;  1HNZ K;  1O13 A;  1NGB A;  3AVG A;  2VWJ A;  1KSP A;  3MEC A;  2E1Y A;  2FBT A;  1KQS M;  2VYP A;  4A5B A;  1HMV A;  5BRD A;  1NK5 A;  3OYB A;  1QTM A;  1S6P A;  1JXB A;  4A2A A;  5JS2 A;  3LAN A;  3L2W A;  3D2F A;  5SZT A;  4KHQ A;  3AVJ A;  3ZSW A;  1C0T A;  3OW2 M;  1QQO A;  5EU7 A;  1KAZ A;  2F4V K;  1WSI A;  3QIN A;  3NGI A;  3F9M A;  4CCH A;  2B6A A;  4ID1 A;  1IKV A;  1K8K B;  1OKJ A;  4DV0 K;  4N47 A;  4CHP A;  1RT4 A;  4CD1 A;  2G8V A;  4CHO A;  3L3V A;  2A1S A;  4DSI A;  4B3O A;  1VQK N;  3FZL A;  4OO1 J;  3ZX2 A;  4EP4 A;  4FLZ A;  1RTJ A;  4BRF A;  4C1N K;  4X62 K;  3O9Q A;  2J4R A;  1LWF A;  3DXK A;  1L3V A;  4KH5 A;  3VQB A;  3WUH A;  1G15 A;  1TK5 A;  3ZSV A;  2KZM A;  3K58 A;  1WSE A;  3V1R A;  4IFV A;  1QSL A;  2A6A A;  4CHZ A;  3H3N O;  3HM9 A;  4BAC A;  4BR5 A;  1NMN A;  3CER A;  5T7B A;  3NH0 A;  3T7Z A;  1JL2 A;  3CI5 A;  4V19 S;  2O8E B;  5AQS A;  3U3Y A;  4DSJ A;  1NK4 A;  3E9L A;  4KH4 A;  5BN8 A;  2ZGY A;  1LWE A;  4BGA A;  2F9W A;  4FK4 A;  3ZSZ A;  4M3X A;  3CQX A;  5M1K A;  2Z1H A;  2NRV A;  4N76 A;  2OPS A;  4DG1 A;  3EO3 A;  4BRI A;  3LZJ A;  1RBR A;  1T6C A;  4O0J A;  4KTZ A;  1EKE A;  4B1W B;  4DV1 K;  3OYK A;  4YOT A;  4N41 A;  1GLA G;  3J81 O;  4C8N A;  4FLV A;  2IC3 A;  4AHV A;  3SUP A;  2BDP A;  1RBT A;  2ATQ A;  2OCE A;  4DQR A;  4KI6 A;  1JKH A;  5HBM A;  4WQ4 A;  2UU9 K;  4IBN A;  4CEC A;  4JAX A;  4OKE A;  2V52 B;  2X6S A;  3HRG A;  4M3U A;  5FRN A;  5AFU H;  1VSD A;  2B5J A;  4CGI A;  3PIP L;  1CZB A;  3O6W A;  2HB5 A;  1WB9 A;  4JI7 K;  3CCS N;  3VER A;  5IT9 O;  3RR7 A;  1HKC A;  1H1V A;  4KRF A;  3KLG A;  5KRS A;  3ZET A;  1LW0 A;  5ADX A;  2HMI A;  1HQE A;  3K9K A;  1OH7 A;  1RT7 A;  5HP1 A;  3H45 C;  4JV5 K;  1C0F A;  1N36 K;  4J2D A;  1QZ6 A;  3AA5 X;  3I8B A;  1NOZ A;  4DTN A; 
#chains in the Genus database with same CATH homology
 1DLO A;  4FM1 A;  4B9U A;  1TKX A;  4E7K A;  1SV5 A;  3G0Z A;  1KRP A;  4LSL A;  3PY8 A;  3V4I A;  3VQC A;  4WE1 A;  4FJJ A;  1T8E A;  4W5R A;  3DLR A;  4CIE A;  4BDY A;  1TK8 A;  4HCC A;  3KIO A;  3P5J A;  3TAN A;  1ZBH A;  4B9N A;  3ASM A;  1HPZ A;  4DU1 A;  4CEE A;  3ZSO A;  3S3N A;  3CFR A;  4JS4 A;  1VSH A;  3SV3 A;  3THV A;  1N5Y A;  4C8M A;  4PWD A;  2E6M A;  3DM2 A;  1VK0 A;  4OKJ A;  1VRU A;  4KB0 A;  1HRH A;  4B9L A;  3LP3 A;  4FJN A;  2OPP A;  3LPT A;  3OYA A;  1GOB A;  4HTU A;  2ZE2 A;  2G8I A;  3ALY A;  1W0H A;  2PY5 A;  4KTW A;  2Z1J A;  3AVI A;  1N6Q A;  2P1J A;  3QNO A;  1C1A A;  2RPI A;  4M45 A;  3VQQ A;  1KVC A;  3TAQ A;  1KFS A;  3HVR A;  4E7L A;  1A5V A;  1U4B A;  1U47 A;  1L3T A;  1X9W A;  4HHT A;  1YT3 A;  1EX4 A;  5I3U A;  3V6D A;  2OPQ A;  4CFD A;  3TAE A;  4ZHR A;  4CK3 A;  1NK7 A;  1HNI A;  1RIL A;  3AV9 A;  3DYA A;  3CFO A;  3VN5 A;  4RW6 A;  4DSK A;  4KFB A;  4DFM A;  3VQ7 A;  2OPR A;  3ZT3 A;  4CK1 A;  4KRE A;  4DTS A;  2D5R A;  4O0I A;  3SV4 A;  2JLE A;  2LSN A;  4DQQ A;  3MED A;  3IS9 A;  1B9D A;  1TAQ A;  2QXF A;  3ZT2 A;  1UWB A;  4I7F A;  3NGZ A;  3OYN A;  2XY7 A;  1BI4 B;  3HT3 A;  4DLG A;  4C8L A;  4CHN A;  3K59 A;  2HHU A;  3KKR A;  2X78 A;  3QEI A;  4O4G A;  3HPG A;  1GOC A;  3RMD A;  1XHX A;  4FM0 A;  4NCB A;  2Z1G A;  4Z0U A;  3AA4 A;  1BQM A;  2FBX A;  2IOC A;  3B6P A;  4ZTJ A;  2HNY A;  4FZZ A;  4W5N A;  1UA1 A;  1D5A A;  2E4L A;  3QEW A;  1HYS A;  1L3S A;  1TKT A;  3SPZ A;  3D0P A;  2HHQ A;  1U45 A;  3PO5 A;  1TAU A;  2GV9 A;  1ZYQ A;  2XY5 A;  1EP4 A;  3NF6 A;  3ZSX A;  4KAZ A;  3SZ2 A;  2XY6 A;  3NAE A;  1KVB A;  4B9V A;  4E0D A;  1RDB A;  4GMJ B;  4R5P A;  1D9D A;  3AVL A;  1RDA A;  1WSF A;  3DMJ A;  2DFF A;  3QEV A;  1WLJ A;  3PX4 A;  1NKB A;  3P83 D;  4CJK A;  3QEX A;  4CJL A;  4J2B A;  1WSJ A;  3I0S A;  3O3F A;  3KTQ A;  4J2A A;  4W5T A;  4M3W A;  5FRM A;  2IGI A;  4CGG A;  4KHW A;  4H4O A;  1VSF A;  1NK9 A;  4AH9 A;  3OJU A;  3KLH A;  1Q9X A;  4OLB A;  4DLE A;  3NCI A;  4E1N A;  4UQG A;  4CJ3 A;  3O4N A;  4CFB A;  1YTU A;  1SL0 A;  3EY1 A;  3VQA A;  3S9H A;  4PQU A;  2F96 A;  2YNI A;  3AVC A;  1YVU A;  4CF2 A;  4CJW A;  1DTQ A;  1KLM A;  5KGX A;  4DTP A;  1S9G A;  1ZBF A;  1C0M A;  3SI6 A;  1BQN A;  3V1Q A;  3L8B A;  4RW4 A;  5HRS A;  1RDD A;  4FLW A;  4CF0 A;  5CYM A;  2FC0 A;  4O44 A;  4ICL A;  4PA1 A;  1XWL A;  3TI0 A;  3C6U A;  2YKN A;  1JLF A;  3DRR A;  4CJT A;  3ZSY A;  1HYV A;  3LZI A;  3CM5 A;  4DQS A;  4F4K A;  3ZSQ A;  3AO2 A;  3KK2 A;  3NDK A;  4K8Z A;  5KRT A;  3LP0 A;  3LPU A;  3OYE A;  2KFZ A;  4Z4I A;  1CXQ A;  4Q5V A;  1FKO A;  2QK9 A;  4LY7 A;  3AA3 A;  3OYG A;  4DU4 A;  5CYQ A;  4ELV A;  1CZ9 A;  4BE1 A;  3MXJ A;  2Z1I A;  3AVM A;  3G10 A;  4HUG A;  3V9S A;  1RT1 A;  1WNS A;  2AJQ A;  3DLG A;  3TAG A;  4Y1D A;  4OPJ A;  3DOK A;  3SUO A;  4W5Q A;  4CJS A;  3SQ4 A;  1XC9 A;  1NJW A;  2GUI A;  3TAP A;  3K5L A;  3KD1 E;  3LDS A;  1VSL A;  1NKE A;  4CIF A;  4CEA A;  3BGR A;  4FLX A;  2XRI A;  2VWK A;  3L2U A;  3C94 A;  2ZQB A;  3F73 A;  2HHV A;  1QSY A;  3CYM A;  1TGO A;  4FJI A;  2BAN A;  1VSJ A;  3MEG A;  4LH5 A;  5CY4 A;  3KJV A;  4C8O A;  4FVM A;  1X1P A;  3LAL A;  1EXQ A;  3M8S A;  2I5J A;  3KLF A;  3NF9 A;  1X9M A;  4FJ5 A;  4Z4F A;  2RN2 A;  1O1W A;  1ZBI A;  3FFI A;  1A5W A;  2KW4 A;  3SYZ A;  1SL1 A;  1IKW A;  1T7P A;  4DTU A;  3BDP A;  1RTH A;  4M42 A;  1Z26 A;  3DLB A;  1TKZ A;  5C24 A;  3OYJ A;  2PZS A;  3OYH A;  4BDZ A;  4HUE A;  1C1B A;  3DRP A;  5CZ2 A;  3OYL A;  3PX6 A;  4BDP A;  2O4I A;  3T1A A;  2D0A A;  1Q8I A;  4FJG A;  4KHY A;  2YNH A;  5HLF A;  5FDL A;  3SPY A;  2D0C A;  2Y1J A;  4N5S A;  3QNN A;  4DF4 A;  3RMB A;  4K8X A;  4J2E A;  1UAX A;  1YTA A;  1FXX A;  1D8Y A;  1RTI A;  4I2Q A;  4CER A;  5I42 A;  1ITG A;  4ID5 A;  4DTJ A;  3TAF A;  2OA8 A;  3RRH A;  1S1W A;  4KHN A;  3NGY A;  3U6F A;  2G8W A;  4CEQ A;  4FZY A;  2G8U A;  4KV8 A;  5DK5 A;  2YV0 X;  2HNZ A;  4CF9 A;  3ZSR A;  4KHS A;  4DS5 A;  1L3U A;  4FW2 A;  3ISN C;  1IO2 A;  4CGJ A;  4BE0 A;  1LWC A;  2X6N A;  4B08 A;  3S3M A;  4DQI A;  3OYD A;  2XY8 A;  3HYF A;  1NJY A;  2PYJ A;  2HHW A;  1Y97 A;  3OYI A;  1UOC A;  1C0U A;  2YKM A;  1KLN A;  5KTQ A;  4DQP A;  2IDO A;  5HRN A;  3AVN A;  1VSM A;  4MFB A;  3VA0 A;  4RG8 A;  1VSI A;  3LWM A;  3KK3 A;  1NKC A;  1CLQ A;  4CHQ A;  3TAR A;  3HK2 A;  3VQD A;  2W42 A;  4TSX A;  3L2Q A;  5CZ1 A;  1TL3 A;  1JLQ A;  3P1G A;  1WAF A;  2E6L A;  5K14 A;  4DSE A;  3SUN A;  4ZTF A;  3ZT1 A;  4EZ6 A;  4FJK A;  1VRT A;  1LAV A;  3NE6 A;  1WAJ A;  3OVN A;  3C6T A;  1WN7 A;  2HVI A;  3HXM A;  3VQ6 A;  3LWL A;  3V1O A;  3F9K A;  3L3U A;  3AO5 A;  1HJR A;  4I9Q A;  2VG5 A;  1IKX A;  1U48 A;  1TK0 A;  4KKO A;  3OJS A;  3K2P A;  3CG7 A;  3VQ9 A;  3O4Q A;  4DTX A;  3RRG A;  1BIS A;  1JL1 A;  1BCM A;  3OYM A;  3E01 A;  4I2P A;  3NHG A;  1LV5 A;  4LSN A;  4Z4C A;  1SKR A;  1QQC A;  3IAY A;  4FK0 A;  4KPY A;  5J2M A;  3HO1 A;  3DRS A;  2ETJ A;  5J2P A;  4FW1 A;  3T3F A;  2IS3 A;  3V9X A;  4IG3 A;  1L5U A;  4FLY A;  1RBU A;  2O4G A;  3TWH A;  4BWJ A;  4F8R A;  2GBZ A;  1RT3 A;  1C6V A;  4JRP A;  2RKI A;  3DI6 A;  1U49 A;  3OY9 A;  1QS4 A;  4DU3 A;  2DFE A;  2FBV A;  4CF8 A;  4HCB A;  2F8S A;  4CJV A;  1RBV A;  4RW8 A;  1IH7 A;  4AHU A;  4Z4H A;  5C25 A;  2EHG A;  4NYF A;  5E41 A;  3IRX A;  4FZX C;  4M3T A;  4E19 A;  3SQ0 A;  1Z25 A;  2IAJ A;  5HRR A;  2OZM A;  5DMR A;  5HRO A;  1F21 A;  1SKS A;  3CQ8 A;  3V9Z A;  3EZ5 A;  1K6Y A;  4EP5 A;  1D9F A;  4JRQ A;  1S5J A;  3O3H A;  2ITG A;  3DLK A;  1I3A A;  1JLB A;  3OYF A;  3ZCM A;  3DLE A;  5J1E A;  3RMC A;  2B4J A;  1RT5 A;  4OJR A;  1HYZ A;  3AO1 A;  3IG1 A;  3OS1 A;  2FBY A;  1A5X A;  1TKD A;  2OYQ A;  3HST B;  3T19 A;  4FLU A;  1NOY A;  4ELT A;  4FJL A;  3ZT4 A;  3MAQ A;  1XI1 A;  4QOZ B;  1BIZ A;  3VQ8 A;  4AIL C;  3ZT0 A;  3DLH A;  4AHR A;  4XIU A;  1ASU A;  4DTM A;  3SCX A;  4DFK A;  1TV6 A;  1BHL A;  4DWI A;  1S9E A;  1NJX A;  1FKP A;  3SQ1 A;  2X74 A;  1ASW A;  3K5M A;  4EZ9 A;  3MXM A;  3H08 A;  3CFP A;  1QE1 A;  2P5O A;  3VQE A;  2P5G A;  4M3Z A;  4CEO A;  4HVJ A;  2A1R A;  4IG0 A;  1Q9Y A;  3K5O A;  3ITH A;  3AVF A;  1BL3 A;  3NF7 A;  2G8K A;  1RCH A;  3VQP A;  2HND A;  4CIG A;  3AVH A;  4RW9 A;  2HVH A;  1BGX T;  3QIP A;  4F2S A;  2DTU A;  1KTQ A;  5J2N A;  1XHZ A;  2BGG A;  2D0B A;  4NCA A;  2DY4 A;  4KB1 A;  2YHA A;  1J9A A;  4CJF A;  2YNG A;  4OVL A;  4BWM A;  3C95 A;  4E7H A;  3B6O A;  1NK0 A;  4M3R A;  1RBS A;  4IFY A;  4CGH A;  2KQ2 A;  3QET A;  3K57 A;  3U3G A;  4CFC A;  4KHU A;  1RT6 A;  4HUF A;  3V9U A;  2G8F A;  1ZBU A;  4FM2 A;  2HHT A;  2F8T A;  1DTT A;  2ZD1 A;  1MU2 A;  1SUQ A;  4O55 A;  1S6Q A;  3AVG A;  2VWJ A;  1KSP A;  3MEC A;  4FJ7 A;  2FBT A;  3AO4 A;  4B8C A;  4E89 A;  4CFA A;  4PY5 A;  3OS0 A;  4FXD A;  4YFU A;  1NK5 A;  1HMV A;  2DFH A;  3OYB A;  1T03 A;  1S6P A;  1QTM A;  1JXB A;  5JS2 A;  3LAN A;  5KGW A;  4AHS A;  5FRO A;  1RT2 A;  3L2W A;  3SQ2 A;  3VA3 A;  5SZT A;  4KHQ A;  4FYD A;  4KO0 A;  3NH1 A;  3KLE A;  1R0A A;  3AVJ A;  4BE2 A;  1T05 A;  4DSL A;  4M3Y A;  2HHS A;  1KFD A;  4AHT A;  3ZSW A;  4JS5 A;  1C0T A;  5EU7 A;  4FCY A;  1JXE A;  1S1U A;  1WSI A;  4LH4 A;  3NFA A;  3QIN A;  4CK2 A;  1IKY A;  3NGI A;  1NK8 A;  1LAW A;  4DTR A;  3NBP A;  4CCH A;  3M8R A;  4DTO A;  2B6A A;  2VG7 A;  1NJZ A;  4ID1 A;  1W9H A;  4RW7 A;  1IKV A;  1X9S A;  3O3G A;  2RF2 A;  4N47 A;  3LAK A;  4CHP A;  3SNN A;  1RTD A;  1LW2 A;  3V81 A;  4CGF A;  4FJM A;  1RT4 A;  3AVA A;  1UA0 A;  4OGC A;  4B9M A;  3LP2 A;  3RTV A;  2G8V A;  4CHO A;  3WNH A;  2G8H A;  4KTQ A;  3L3V A;  2A1S A;  4CEF A;  3JSM A;  4DSI A;  1IG9 A;  4B3O A;  2KZZ A;  1HQU A;  3TAM A;  2R7Y A;  4FJH A;  3HL8 A;  3TR8 A;  4EP4 A;  3QEP A;  4FLZ A;  1WSH A;  1RTJ A;  3M8Q A;  1J5O A;  2P51 A;  4N56 A;  2HW3 A;  1KCF A;  3LAM A;  1LWF A;  2Y1I A;  3HPO A;  1L3V A;  3TAB A;  1J54 A;  1S1T A;  4NCG A;  4CE9 A;  3VQB A;  4GW6 A;  5SWM A;  3KK1 A;  1G15 A;  1TK5 A;  3ZSV A;  4F2R A;  4OGE A;  3KLI A;  4NYN A;  2KZM A;  1GOA A;  2NUB A;  3A2F A;  3K58 A;  4QAG A;  3PO4 A;  2QKK A;  1BIU A;  1JLC A;  1WSE A;  3PUF A;  4IFV A;  3V1R A;  1QSL A;  4E1M A;  3RWU A;  4CHZ A;  4DMN A;  4CJE A;  4I9L A;  3HM9 A;  4Q0B A;  4BAC A;  2KTQ A;  2HHX A;  4FK2 A;  4IDK A;  1SKW A;  3EYZ A;  4CF1 A;  5T7B A;  3NH0 A;  1JL2 A;  1FK9 A;  4CJ4 A;  3HVT A;  3U3Y A;  4CJR A;  4DSJ A;  3MEE A;  3PV8 A;  1NK4 A;  1BCO A;  3ULD A;  4DFJ A;  3DOL A;  3WNE A;  3QO9 A;  4CED A;  1LWE A;  3I8D A;  4GVM A;  4FK4 A;  2OZS A;  5J2Q A;  2XHB A;  1I39 A;  3NH2 A;  3ZSZ A;  1C1C A;  4JLH A;  3WNG A;  5C42 A;  1HNV A;  1RDC A;  1B9F A;  3MXI A;  4M3X A;  2Z1H A;  4G1Q A;  3K5N A;  2YHB A;  4N76 A;  2OPS A;  4QCL A;  3SJJ A;  4B8A B;  4O5B A;  4DG1 A;  4Z4G A;  1BI4 A;  3I0R A;  4OKK A;  3HP6 A;  3LZJ A;  2PYL A;  1RBR A;  5KI6 A;  4O0J A;  4DFP A;  3HJF A;  4KTZ A;  1EKE A;  4B9T A;  4FJ8 A;  4KI4 A;  3OYK A;  3HP9 A;  4Z4E A;  3CM6 A;  1KVA A;  1SL2 A;  4F3T A;  4N41 A;  3QLH A;  4C8N A;  2YNF A;  1RNH A;  2Q3S A;  4MQ3 A;  4CJ5 A;  4AHC A;  3AVK A;  4FLV A;  2IC3 A;  4H4M A;  4AHV A;  4DS4 A;  2WOM A;  3SUP A;  2BDP A;  1RBT A;  4OPK A;  2ATQ A;  3LP1 A;  4FLT A;  4E7J A;  3OS2 A;  4DQR A;  2XO7 A;  2EX3 A;  1JKH A;  3QES A;  4KI6 A;  1VSE A;  3AA2 A;  5HBM A;  1CXU A;  3HPH A;  2QKB A;  4L8R B;  3QIO A;  4IBN A;  4E7I A;  1ASV A;  4CEC A;  5D3G A;  2X6S A;  4OKE A;  4CGD A;  4CHY A;  1EET A;  1S1X A;  4LD0 A;  4M3U A;  1J53 A;  2JGU A;  4Y1C A;  5FRN A;  3NF8 A;  1JLA A;  3OYC A;  1VSD A;  4CES A;  4B9S A;  4ELU A;  4IKF A;  2B5J A;  3AVB A;  3S3O A;  4CGI A;  4F3O A;  1REV A;  3PX0 A;  3L2V A;  3QER A;  4OLA A;  5HRP A;  1CZB A;  1TL1 A;  1JLG A;  3KKS A;  2HB5 A;  2VG6 A;  2KFN A;  4CJQ A;  2WON A;  1NK6 A;  4CJU A;  3RR7 A;  1QHT A;  3KD5 E;  4CEB A;  4KRF A;  4CJP A;  3KLG A;  3VQ5 A;  4W5O A;  5KRS A;  1TVR A;  4M41 A;  4H8K A;  4YNQ A;  3UIQ A;  1JLE A;  3WNF A;  4FJ9 A;  3RMA A;  4PUO A;  2BE2 A;  4FJX A;  1LW0 A;  5JS1 A;  2HMI A;  1HQE A;  3RR8 A;  4C8K A;  3D45 A;  3V9W A;  4CEZ A;  3M8P A;  3VQ4 A;  3SUQ A;  3L2R A;  1RT7 A;  4DF8 A;  4E3S A;  5HP1 A;  4DSF A;  1ZBL A;  3JYT A;  1WSG A;  1QSS A;  1S1V A;  3AO3 A;  4J2D A;  1VSK A;  3AA5 X;  1B92 A;  1NOZ A;  4DTN A;  1U04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...