3ZT1A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt1A00
4MQ3A 1BIUA 4F8RA 1BCMA 4HUGA 4HUFA 4J2EA 3EZ5A 3A2FA 5FRMA 1ZBIA 4FW2A 4CJSA 3TAFA 1FK9A 4B9LA 2RPIA 1CXUA 3ISNC 3O3HA 1NK4A 3PO5A 4Z0UA 3DLGA 1JLAA 3OS1A 2D5RA 4DLGA 4B9NA 3HM9A 4KTWA 3ZSRA 1UA0A 1IKXA 4FLWA 3S9HA 4EP4A 4EP5A 3OVNA 1EETA 1U04A 4CEAA 4CJQA 1S1UA 1WSHA 3ZSOA 1JLBA 1TL3A 4AHVA 4OPKA 1BHLA 4F3OA 3TWHA 3SUQA 4KHWA 4FYDA 1WAJA 3HSTB 1VSDA 3L2VA 1NK5A 5KTQA 1U48A 4CE9A 4JS5A 2P5OA 3HT3A 2FC0A 4LY7A 4CEBA 1JLEA 1QSYA 4DSLA 3WNFA 3ULDA 4FK2A 2IC3A 3VQQA 1XC9A 1NJZA 3NF6A 2XRIA 3G0ZA 3QEXA 2O4IA 4KHQA 3H08A 4ICLA 3K5NA 3MXMA 4M3XA 1KLMA 5HRSA 2HW3A 4FZZA 1TVRA 1R0AA 3TARA 1IKVA 1HYSA 1VSHA 3RMAA 4Q0BA 3QETA 2G8IA 1L3TA 4E7LA 2PY5A 3OYHA 3MXJA 4H4OA 3LP2A 4FLVA 3O3GA 3LWMA 4DFPA 1NKBA 3HP9A 3AVGA 3SJJA 4Z4EA 1Q9YA 4CK3A 2YKNA 4CIFA 3PV8A 1IG9A 1S1WA 3NE6A 3MEGA 5FRNA 4G1QA 3RTVA 1Y97A 4KI6A 3HPHA 4KI4A 4M3TA 3LWLA 3AVAA 5SWMA 4DSIA 4AHTA 1KFSA 3V4IA 4DTXA 2VG5A 3CM5A 3F9KA 3LP1A 2XO7A 1KVAA 4Q5VA 3NAEA 3SYZA 1ASUA 1U4BA 1SL2A 2E6LA 3OYAA 3LZJA 4E0DA 4CK1A 2PZSA 1S6QA 1VRTA 3L3VA 4KB1A 3MECA 3KK2A 4PQUA 3SI6A 1NK0A 1J5OA 1JL2A 3QIPA 4CJ3A 4CF9A 1JL1A 2OZSA 4CHQA 4BACA 1NOZA 2YNIA 4DSEA 3K58A 4GMJB 4BE0A 4ELVA 3KKSA 1VSMA 4FJ5A 3TR8A 4CJWA 1KVBA 4FJHA 1HRHA 4FW1A 4FLTA 4Y1CA 1A5VA 3AO2A 3AVLA 3RRHA 1SL1A 1QSLA 2F8SA 2OYQA 2RKIA 3VQPA 4ID1A 5HRRA 3L2QA 4OLBA 2KQ2A 3NH0A 4I9QA 5J1EA 3LAKA 1L3SA 1B9DA 2Q3SA 4KPYA 2KTQA 1BI4B 2WONA 3ZSQA 3L2RA 4B08A 1NK7A 3VQDA 4IFYA 1DTTA 3I8DA 4DLEA 1RT1A 2VG6A 3OJUA 3WNGA 5J2MA 1S9EA 2D0BA 4W5RA 5J2NA 1T8EA 3HK2A 3P1GA 4M41A 1BQNA 4CJLA 3QNOA 4BWMA 3TAQA 3NF9A 1HYZA 1FKOA 3NBPA 2BDPA 1VSIA 3O3FA 3OYIA 2G8WA 4N41A 4KREA 3AVIA 3AV9A 4DU4A 4O5BA 4KV8A 2IAJA 5KRSA 4KTQA 4DQQA 4FZYA 4E7HA 1KFDA 4DTJA 3TABA 3ZT4A 4DS4A 3AVJA 1T05A 3D45A 2OPPA 5J2QA 4O44A 2BE2A 1GOBA 1LW2A 3MEEA 1JXBA 3CFRA 4AHCA 4LD0A 1RDBA 4O0JA 1U49A 4HCCA 4CFCA 3PX0A 4M3ZA 4CIEA 2KFNA 2Z1GA 4QOZB 4NYFA 3ZCMA 3PY8A 4N5SA 2QKBA 1UOCA 1VK0A 3AA4A 1S5JA 5HBMA 3V9XA 5DK5A 2DTUA 4OGEA 4W5QA 4DFKA 2KW4A 3TAMA 5HLFA 4UQGA 1SV5A 3AVFA 2YV0X 1LWCA 1RCHA 3FFIA 3I0SA 1SL0A 3DOLA 5HRPA 2EX3A 1EP4A 4GW6A 5CZ1A 4CEOA 4CJUA 4FLUA 4QCLA 1RBRA 1SKRA 4OJRA 3LPUA 3HYFA 1GOAA 3QINA 4EZ9A 1CLQA 1TKXA 3TAEA 1VSFA 3OYDA 4KHYA 3V1QA 3D0PA 4N47A 3TAPA 4B8AB 4CF2A 1Q8IA 2GV9A 1J53A 4BDYA 2HHSA 3AA2A 4PY5A 1RT7A 4CGDA 4FJ7A 4OGCA 4PUOA 3VQCA 3AVNA 3HPGA 3ZT0A 2B4JA 1SKWA 4B3OA 3QESA 2QKKA 1WSJA 2DFHA 4FLZA 4J2AA 1RBUA 5EU7A 4PA1A 4H8KA 3MAQA 4DTOA 4CF0A 4L8RB 3DRRA 4E1MA 1S1VA 3IAYA 3K59A 4OLAA 3OYFA 4J2BA 4CJEA 4IDKA 3LDSA 3AO5A 3VQEA 4CEFA 2I5JA 4DTPA 1EKEA 3ALYA 3KLEA 4FLXA 3RMBA 4LSLA 2D0AA 3WNEA 1F21A 4DTUA 1NK9A 4N76A 5KRTA 4J2DA 3LP3A 1S1XA 2G8FA 4C8KA 4YNQA 3VA3A 4FLYA 1A5WA 3KD5E 1RT2A 4HUEA 3K57A 4MFBA 2HMIA 1DLOA 3VQ9A 4NCGA 3HVRA 4I2PA 3VN5A 1C1BA 2VWJA 1JLQA 4CGJA 4E3SA 2X6SA 4FJMA 3KD1E 1EX4A 1LW0A 3AVHA 4CEZA 4BE1A 4Z4IA 3JSMA 3OYMA 4CJTA 3SV3A 4N56A 1Z25A 1RDCA 4CHYA 4QAGA 3CQ8A 4O55A 4CEQA 4RW9A 3QERA 3OYLA 3AVKA 3CFPA 4B9MA 5JS1A 3OYCA 1NOYA 2HHWA 3OS2A 4C8OA 4EZ6A 4DFMA 2IDOA 2FBVA 4JLHA 4M45A 3NH2A 4CFAA 1WAFA 2KFZA 2G8HA 2IGIA 3P83D 4FVMA 3LZIA 4IG3A 3OJSA 4DTNA 4F2SA 1SUQA 3TAGA 3HL8A 2OPRA 2DFEA 1W9HA 3ZT2A 4CK2A 1ZBHA 2HHVA 2OZMA 4BE2A 2E6MA 3NGYA 4B9TA 4FM2A 4RW4A 1D8YA 4CFDA 2HVHA 4DF4A 3S3OA 1C0TA 2F8TA 2GBZA 2LSNA 3AVBA 3C6TA 3C6UA 4E7JA 3PX4A 1FXXA 3PUFA 4KTZA 3VQ4A 1C1AA 4YFUA 5E41A 1RNHA 1D5AA 1EXQA 2IOCA 2JLEA 3CFOA 1BIZA 1CZ9A 3LP0A 4C8MA 3ZT1A 4OPJA 4M3YA 1T7PA 2PYJA 3V1RA 1IH7A 3K5OA 4CF1A 1D9DA 2ETJA 4Y1DA 1RTJA 2HNYA 3K2PA 1NJYA 5I3UA 1TKDA 3M8RA 4F4KA 1HMVA 4WE1A 5C42A 4RG8A 4O0IA 4KHSA 3G10A 3AA5X 2B6AA 4CJVA 1NK8A 1RBVA 1YT3A 3T3FA 1LAWA 4W5TA 1Q9XA 3SZ2A 5CYQA 5KI6A 2A1RA 4FJKA 3RR8A 2RN2A 1FKPA 1QHTA 3U3YA 1RBSA 3KLFA 4FJ8A 3BDPA 4RW7A 3DLKA 1KLNA 1Z26A 3DM2A 2VWKA 4CJKA 3ZSYA 1ZBFA 4OKJA 1TV6A 4DG1A 2VG7A 2XHBA 3SQ4A 3F73A 3S3NA 2OA8A 4F2RA 3LPTA 5K14A 3KLGA 1YTAA 1NKEA 4E89A 4LSNA 3MXIA 1L5UA 3ZT3A 2G8VA 2HHUA 2YHAA 4HVJA 1HJRA 2OPQA 2QXFA 4ZTFA 1VSJA 4FK0A 3KLHA 4GVMA 2O4GA 4CJPA 4LH5A 4O4GA 4RW8A 2Y1IA 5D3GA 1HNVA 4HTUA 4BDPA 1WLJA 4CGGA 3OYNA 1S1TA 2XY5A 3B6OA 1XI1A 2BGGA 3JYTA 1WSIA 1TAUA 3I0RA 3QIOA 4CHZA 3NF8A 3E01A 4ELUA 3NGZA 3AVCA 1RT6A 2RF2A 4JS4A 1L3VA 4KAZA 1TL1A 4CCHA 5FROA 4E7KA 4DQPA 2HNDA 4CJ5A 2WOMA 1I39A 4LH4A 4R5PA 3L2WA 1TK5A 4OKEA 1C0UA 3AA3A 3VQ8A 5JS2A 3CM6A 1LWEA 1RTIA 1KTQA 1TK8A 4DWIA 4HCBA 4FM1A 2EHGA 3VQAA 4FJ9A 3O4QA 4CIGA 3NDKA 3VQ6A 4DU1A 4CGHA 3K5LA 2OPSA 2HVIA 1UAXA 2Z1IA 1GOCA 2P1JA 4H4MA 4AH9A 3OYBA 3KLIA 3L2UA 1JLGA 1RDAA 1RDDA 2YNGA 3DOKA 3KTQA 4DSKA 4KB0A 3SUOA 4KHUA 3IRXA 1C1CA 3IS9A 1JLCA 4KO0A 1X9SA 1RILA 1TGOA 4B8CA 1WSEA 4OKKA 2ZE2A 3LANA 3VA0A 1RT3A 2ATQA 1JXEA 2XY7A 1KSPA 4Z4FA 2Y1JA 3B6PA 1HYVA 4W5OA 4DF8A 2PYLA 2D0CA 3HJFA 2ZQBA 1XHXA 5HRNA 1HPZA 1QSSA 1TK0A 4CFBA 4M42A 4DSJA 3O4NA 2JGUA 3VQ5A 3T1AA 1J9AA 1DTQA 4IKFA 3SPZA 3QO9A 3U3GA 3DRSA 4F3TA 3DI6A 3NCIA 3HP6A 1KCFA 3SQ1A 1W0HA 4FCYA 1RT5A 3ZSZA 1I3AA 1XWLA 1ZBUA 1CZBA 2X6NA 1LWFA 1QE1A 3CYMA 3OYJA 1ITGA 3PX6A 1RTDA 3ZSXA 3S3MA 3RWUA 2DY4A 3NGIA 1D9FA 3QLHA 3KKRA 1L3UA 2A1SA 4CHPA 3KIOA 3VQ7A 3DLBA 4ID5A 1X1PA 4ZTJA 1WSFA 3ZSWA 4JRPA 3U6FA 3AVMA 1O1WA 3LAMA 3V9SA 1NJXA 4K8XA 3HPOA 2F96A 1HQEA 1TKZA 5FDLA 3AO3A 3M8QA 2W42A 3ZSVA 4I7FA 3EYZA 3RRGA 2YNFA 4NYNA 1CXQA 3PO4A 3DLHA 4M3UA 2KZMA 1QQCA 4CERA 5HROA 3V81A 1N5YA 1N6QA 2P5GA 4NCBA 1MU2A 3T19A 3OS0A 4CHOA 2G8UA 2FBYA 2YKMA 3C95A 5CZ2A 3QEPA 1U47A 1T03A 1NJWA 5T7BA 3AO4A 3V1OA 3QEVA 1U45A 1RTHA 4JRQA 4B9SA 1QTMA 4CJ4A 2AJQA 3SNNA 4E19A 1NK6A 5J2PA 1LV5A 2B5JA 2FBXA 1S6PA 2Z1HA 3OY9A 4IG0A 1VRUA 2QK9A 2HB5A 4CJRA 1REVA 3RMDA 4BWJA 5KGWA 4CGFA 4IFVA 4TSXA 3IG1A 3V6DA 3V9ZA 4OVLA 4DTRA 3HXMA 4DTSA 3LALA 1UA1A 3UIQA 3L8BA 3DYAA 3VQBA 4FJXA 3KK1A 3SUNA 3V9WA 1HNIA 3TANA 3ASMA 4AHRA 1VSLA 2KZZA 2R7YA 2HHXA 3SQ0A 1SKSA 1ASWA 1B92A 2DFFA 4Z4CA 3SV4A 4DQSA 3M8SA 1IO2A 3EY1A 1JKHA 3M8PA 1WNSA 4CHNA 3C94A 4AILC 3RMCA 3BGRA 1J54A 2X74A 1JLFA 3MEDA 3NH1A 4XIUA 4ELTA 4FJGA 1BI4A 4BDZA 2ZD1A 4C8LA 4DQIA 1X9MA 4NCAA 4FJLA 3TI0A 3OYEA 1X9WA 4K8ZA 1ASVA 3SCXA 2HNZA 2IS3A 2XY8A 3P5JA 2HHTA 3CG7A 4DMNA 1KVCA 1BGXT 2YNHA 1NKCA 3AO1A 1B9FA 2YHBA 4Z4GA 1K6YA 2ITGA 2GUIA 4Z4HA 1ZYQA 4DSFA 3QEIA 4ZHRA 2XY6A 3DLRA 3OYGA 5HP1A 4B9VA 1XHZA 4FJJA 4KFBA 3K5MA 4DS5A 3QNNA 3NHGA 4E7IA 1IKWA 4CJFA 4FM0A 3NF7A 4FZXC 4CF8A 3DMJA 4W5NA 4M3RA 4CECA 2HHQA 1G15A 5CYMA 1BL3A 4C8NA 4FJIA 1VSEA 4FK4A 4B9UA 1UWBA 1C6VA 3KK3A 3RR7A 4KRFA 4AHSA 4PWDA 5KGXA 1C0MA 5SZTA 2FBTA 4FJNA 1IKYA 1BCOA 3HVTA 1BQMA 4KHNA 4CEDA 1QS4A 4DFJA 1ZBLA 4E1NA 4RW6A 1RBTA 3ITHA 3QEWA 4CEEA 1TAQA 3DLEA 4I9LA 4DTMA 5C24A 5I42A 1BISA 2P51A 3HO1A 2Z1JA 1TKTA 4AHUA 1LAVA 1HQUA 3L3UA 3V9UA 4M3WA 3SUPA 1WSGA 4DU3A 2E4LA 4I2QA 4CESA 1YVUA 4KKOA 5CY4A 2X78A 5DMRA 3SPYA 5C25A 4DQRA 3THVA 3OYKA 4FXDA 3NFAA 4HHTA 3KJVA 3SQ2A 2G8KA 1S9GA 4CGIA 1KRPA 1YTUA 1VSKA 3DRPA 1RT4A 4IBNA 1WN7A 3WNHA 1A5XA 2BANA 2NUBA
chains in the Genus database with same CATH superfamily
3GOIA 4HUFA 4FW2A 4CJSA 4IO8A 1FK9A 4B9LA 2RPIA 4Z0UA 5GIOA 4B3RK 3KWIA 1BA1A 5LL6Z 4YDUA 3ZYYX 1HKCA 1U04A 1WSHA 1NGAA 1JLBA 4OPKA 4FYDA 2UUBK 2QW9A 3WQTA 1NK5A 1U48A 3UKRB 4CE9A 3HT3A 4DB3A 1VQKN 3MX2A 2O8EA 4DSLA 3WNFA 1IBMK 3ULDA 2GELA 5BREA 5M1KA 3Q7BA 1NJZA 4BRCA 1HR0K 4FPAA 4BRHA 1YIJN 3H3NO 4KHQA 4YY3K 3H08A 4ICLA 3OA9A 3J7YP 2VQEK 1VSHA 3RMAA 4Q0BA 3G25A 5AQIA 1P8ZA 3LWMA 4DFPA 1NKBA 2NRRA 3HP9A 3SJJA 1IG9A 1GLDG 4H0TB 4DR5K 3HPHA 4KI6A 4AM7A 2D1KA 4DSIA 2QTDA 4YOVA 2Q97A 4Q5VA 4JI7K 1U4BA 3LZJA 4CK1A 4LF6K 2PZSA 1S6QA 1VRTA 3MECA 3KK2A 3CI5A 4MDBA 4CJ3A 2OZSA 4KBOA 5FPNA 4CHQA 2E2OA 4C1NK 4FJ5A 4M42A 4GMJB 4JHDA 3CCQN 3TR8A 4CJWA 2PBDA 3CPWM 3PLAA 1HX1A 4Y1CA 1A5VA 3RRHA 1QSLA 1BOTO 3L2QA 1R59O 2KQ2A 4I9QA 4KPYA 3N4PA 2WONA 4B08A 4IFYA 3HI0A 3I8DA 3T7ZA 4FVUA 5F2RA 5DM6L 5DM7L 4W5RA 2JWLA 4M41A 1BQNA 3NBPA 2BDPA 3AV9A 4A5AA 4KV8A 2UXCK 4KTQA 4DQQA 4FZYA 4DTJA 3ENBA 4JD2A 2BE2A 1NGJA 4LD0A 4CFCA 2E5LK 1N36K 4CIEA 2KFNA 2JWKA 3AY9A 4DUYK 4B1YB 3RSEA 3KVGA 2DTUA 4OGEA 3TAMA 5M1NA 1SV5A 2P9KB 4BRFA 3AVFA 2ZF5O 1LWCA 3I0SA 2QEXN 1EP4A 4GW6A 4CJUA 1CLQA 3VETA 3D0PA 1Q8IA 1ESVA 2P9UB 3AA2A 4CGDA 2QKKA 4DR6K 1J5EK 1WSJA 4AQYK 4A62A 1RBUA 5EU7A 4PA1A 4H8KA 1WB9A 4LF8K 4DTOA 5GAGP 4CZFA 4FPBA 4E1MA 4OLAA 4CJEA 3CCJN 4DTPA 5BR8K 1EKEA 3ALYA 4LFBK 4O8UA 3WNEA 4BC4A 4N76A 3VEYA 4RTFD 1S1XA 3P4IA 3ID8A 3VA3A 1RT2A 4AF1A 1S72N 3K57A 3QDKA 1DLOA 4CZEA 4NCGA 3VN5A 2VWJA 3TSPA 4CEZA 2OCEA 4DV4K 2P9LB 4BE1A 3VF6A 4IEEA 4CJTA 3R9PA 1NGDA 2Q1NA 3OYLA 5JVHL 3OYCA 3OS2A 2AA4A 4EZ6A 2VGMA 4I6MA 1WAFA 4CFAA 2IGIA 3LZIA 4MO5A 4IOAL 4F2SA 4DTNA 3QB0A 1LCUA 3CCRN 2OPRA 1W9HA 2YI1A 2HHVA 3WXIA 3NGYA 1YUWA 4DF4A 1IBKK 1HNZK 5KPZA 3PX4A 1FXXA 1X9JA 3QBWA 4DR1K 1D5AA 1EXQA 4LFCK 2JLEA 2H3GX 1GLEG 3DWLA 4BR7A 1Z05A 5A2QO 3K5OA 4CF1A 4Y1DA 4YDUC 5F1XA 1NMDA 3VEXA 3UKUB 3M8RA 4F4KA 3MX5A 3BZKA 4RG8A 3T3FA 1SZ2A 3IKMA 2RN2A 1QHTA 5LMUK 5BPLA 4QS9A 1NMNA 3GE1A 1Z26A 4JKCA 3J8AA 3DM2A 4CJKA 3CF5L 1TV6A 2VCPA 2VG7A 3SQ4A 3VEVA 2O8DB 2D0PA 1QQOA 3VOVA 4LSNA 2YHAA 1HJRA 2GUPA 3SK3A 3CPEA 2ZGYA 3KLHA 4GVMA 3FZKA 5AQNA 3AGKA 4RW8A 4HTUA 4BDPA 4ISGA 1S1TA 5AQPA 3HOTA 4PKGA 3JYTA 1TAUA 5GADP 3NF8A 3ENOA 3AVCA 3NGZA 2RF2A 1L3VA 5FROA 2QI2A 4DQPA 2WOMA 4R5PA 3L2WA 1OH7A 2IIRA 3VQ8A 3CM6A 1RTIA 1KTQA 3TSUA 3N4QA 4CIGA 3R1XA 2Z1IA 4R79A 3L2UA 2Q0UA 1IBLK 1U6ZA 1JLGA 4K25A 4DV2K 5F0XA 3IRXA 3IS9A 1JLCA 1T6CA 3LANA 1RT3A 2ATQA 3LDLA 2FSNA 3B6PA 4W5OA 4DF8A 3JAMO 5HRNA 1QSSA 3T1AA 1DTQA 3SPZA 1BWFO 3SLCA 3QO9A 3DRSA 5JLHA 2CH6A 1GLJO 3NCIA 1KCFA 1W0HA 1I3AA 2YHYA 1XMQK 5BRFA 1CZBA 3L4QA 3S3MA 2DY4A 1SAZA 3OW2M 3KKRA 3C0BA 3KIOA 4CHPA 3DLBA 4ID5A 2O8CB 3HO1A 1WSFA 1NJXA 1KAZA 3H1VX 1NGHA 2VYPA 2F96A 1HQEA 1TKZA 3O4WA 3EYZA 3DLHA 4M3UA 4CERA 4X64K 2P5GA 3EE8A 3CCSN 3M5RA 1MU2A 5AQWA 3TTCA 3MN6A 1K9MO 4CHOA 2FBYA 5C12A 4K43A 4M7XA 3VTIA 4U67L 2ZM6K 2I7PA 2OTJN 3C7NA 2GTDA 1XC3A 4FWMA 4V19S 1JCEA 5J2PA 4KH5A 1S6PA 2Z1HA 1REVA 4BWJA 3HTVA 3J7AP 3HXMA 4DTSA 3LALA 4WFNL 3P31A 4FJXA 2QWLA 3ASMA 1O13A 2R7YA 2HHXA 3U8XA 3WT0A 1SKSA 4WQ4C 3CQXA 1B92A 4Z4CA 1M1KO 3O9QA 1JKHA 3M8PA 4CHNA 2KKZA 2X74A 1JLFA 3NH1A 4ELTA 3CCEN 1S3XA 3H45C 1ASVA 2IS3A 1H1VA 2HHTA 1E4GT 5AFUA 2UXDK 5MLCQ 4IOCL 4Z4HA 5E26A 1G99A 4LF4K 5KPTA 4DS5A 3QNNA 4E7IA 4PKIA 2A40A 2HHQA 4FJIA 4C1NI 3KK3A 4KRFA 4AHSA 4Y0WA 4IXCA 4PWDA 5KGXA 4PKHA 4BRAA 1IKYA 1BCOA 2F7TA 4CEDA 4OX9K 2IVPA 4DFJA 3CHWA 1WBBA 3KK7A 4RW6A 3QEWA 4I9LA 4CW7B 1BISA 4MLEA 5AQFA 3OBYA 2O8BA 1QQNA 1W97L 1VQMN 5CY4A 2ASMA 4DQRA 3OYKA 5ADXH 4CZGA 5LY3A 1VSKA 4IBNA 2V51B 1A5XA 5AJ3K 3AARA 4MQ3A 4J2EA 5FRMA 3VERA 2HMPA 3ISNC 4A2BA 4WFAL 3OS1A 2GEMA 4DLGA 3MCPA 1IKXA 4GV9A 2E2QA 4FLWA 3IMXA 5LJVA 4CBUA 4EP5A 4CJQA 1EETA 4H0OA 4EFHA 1TL3A 1RDUA 4AHVA 1BHLA 4F3OA 1V4SA 3SUQA 4KHWA 1VQNN 3CCLN 5AZIB 3HSTB 3WXKA 2HF3A 4NXMK 4JS5A 2E8AA 3THWB 2FC0A 4CEBA 2NZTA 1V4TA 1QSYA 3D6RA 5AQHA 4FK2A 3FZLA 2CGLA 4DV5K 1XUPO 4JAXA 2ZGZA 2UU9K 3FR0A 4JI0K 3U9ZA 1KAYA 3QEXA 4IEIA 3K5NA 4YOXA 4FZZA 3TARA 1IKVA 4C23A 4YOWA 4DV6K 2G8IA 1L3TA 2PY5A 5M1OA 5TKYA 4H4OA 3O3GA 3IUCA 2ASOA 3AVGA 5AQRA 4Z4EA 3PV8A 2ITMA 1S1WA 5FRNA 4G1QA 3RTVA 4KI4A 4M3TA 3AVAA 3J7ZO 3TTDA 4DTXA 1NGIA 3M6GA 3CM5A 1KVAA 5C10A 3NAEA 3SYZA 3DXKA 1SL2A 1I94K 3OYAA 3VMFB 4E0DA 3L3VA 3R8EA 1J5OA 5KQDA 4CF9A 3EN9A 4NXNK 3O9TA 3FZFA 2YNIA 4ELVA 4BE0A 1VSMA 2ZJQL 3EZWA 4FJHA 1K73O 2E1ZA 1XQSC 2F8SA 5AQUA 2RKIA 5HRRA 1Q86O 4IJNA 1C0FA 1B9DA 2KTQA 3SJHA 3ZETA 3L2RA 3S41A 5KQ8A 2RE2A 3VTHA 1RT1A 1U2VB 1Z6RA 3WNGA 1HKBA 2D0BA 1T8EA 2Q0RA 4CJLA 4CJ7A 1FKOA 4BROA 1WBDA 4KREA 2G8WA 4DU4A 3LDNA 4H5TA 5KRSA 3TABA 3ZT4A 4DS4A 4O44A 3MEEA 1GOBA 1LW2A 1JXBA 5C0YA 4O0JA 1U49A 4HCCA 4M3ZA 4QOZB 5E84A 4NYFA 1CZAN 3WEEA 1UOCA 2OANA 1VK0A 3AA4A 5IT9O 5DK5A 4CZLA 4W5QA 4GKJK 2KW4A 5HLFA 4UQGA 3MCAB 4BRGA 2P9SA 3HBTA 3QMLA 1NGFA 2NRXA 1SL0A 3O5BA 5HRPA 5CZ1A 3J81O 4CEOA 4OJRA 3LPUA 1GOAA 4EZ9A 4N47A 1EQYA 4CF2A 3ID6A 2HHSA 4PY5A 1RT7A 3AAQA 4PUOA 1T3VA 3VQCA 5AQLA 3HPGA 2B4JA 3F9MA 1NNEA 2I7NA 2DFHA 4BC5A 4BRPA 3D2EB 4FLZA 2V7ZA 1ZBSA 1OH5A 4A59A 3MAQA 4FWPA 1S1VA 3IAYA 4GV3A 4B1VA 3CQYA 4H0PA 3VQEA 3AO5A 4CEFA 1ZXOA 3KLEA 3H1QA 3H3OB 1NK9A 4DTUA 4H5VA 4JI1K 1FJGK 2ZWHA 5GAEP 4J2DA 4C8KA 3SAHA 4BRMA 3KD5E 4HUEA 4MFBA 1NGGA 4BGBA 1C1BA 3F2KA 4FJMA 2X6SA 3KD1E 3AVHA 3TU5A 4J8FA 5LMNK 4FWRA 3SV3A 3OYMA 3ATVA 4N56A 4B9MA 4RW9A 4ILHA 3QERA 2O8EB 2ASPA 4H5RA 5TKWA 4JLHA 5AQVA 3ULEA 2G8HA 3P83D 3ZX0A 4NLCA 3OJSA 2DFEA 3ZT2A 1ZBHA 4CD3A 2BH1A 4BE2A 4B9TA 4CVNE 4FM2A 4YOTA 1W7AA 1RFQA 4JI6K 4B1ZA 3O9UA 1D8YA 2HVHA 1NWKA 2Q2RA 2LSNA 3C6TA 4E7JA 4A2AA 3K9KA 3PUFA 4KTZA 3VQ4A 2W6LA 5JLFA 5AQTA 5E41A 1RNHA 1BIZA 4M3YA 3U4LA 1T7PA 1RGIA 2PYJA 2A41A 3V1RA 3R3LA 2ETJA 1ILYA 3VGLA 1NJYA 1TKDA 2O8FA 1HMVA 4WE1A 2B6AA 4IFEA 1IJJA 1BUPA 3SZ2A 5CYQA 3I33A 3U3YA 1RBSA 4JHDB 4FJ8A 3BDPA 1KC8O 4RW7A 3NVKA 2VWKA 4O8KA 4OKJA 4DG1A 2XHBA 3F73A 2OA8A 4F2RA 3LPTA 4O5FA 5K14A 3KLGA 4WQ5A 3A5NC 4E89A 3MXIA 3HOSA 3E9PA 4HVJA 4ZTFA 4CJPA 4LH5A 4CBXA 3B6OA 4XH5A 4DV7K 2BGGA 3QIOA 3TTFA 4JS4A 4BR2A 3RVCA 4KAZA 3LDQA 2HNDA 3SMPA 1I39A 4JD2B 4LH4A 2GWKA 4XH1A 1C0UA 2QWMA 1C0GA 1LWEA 2V52B 3DAWA 4DWIA 3NDKA 3VQ6A 3VF4A 1GLFO 3RSEB 3OYBA 3KLIA 2J4RA 4RCHA 3DOKA 3PIOL 1RILA 4OPHA 1TGOA 4B8CA 1WSEA 2WBNA 2NRTA 2XY7A 1KSPA 4Z4FA 5IWAK 2D0CA 1XHXA 4CFBA 4DSJA 3O4NA 2JGUA 1OVYA 1DEJA 4DV1K 3I8BA 4IKFA 3U3GA 4IJAA 2FXUA 4FCYA 3WXLA 3ZSZA 3BF3A 2WUSA 1RTDA 3QLHA 3OBWA 2A1SA 3VQ7A 1N34K 1X1PA 2NRHA 3ZSWA 4JRPA 4DV3K 3V9SA 3HPOA 3M8QA 3RRGA 4NYNA 5FPDA 2KZMA 1N6QA 3T19A 2KHOA 2G8UA 4H0YB 3CD6N 2YKMA 3C95A 5CZ2A 3QEPA 3AO4A 3V1OA 4M63C 1YITN 1RTHA 3QICA 3ENHA 1QTMA 4CJ4A 3ZEUA 2AJQA 2E2NA 3A5OC 3IDHA 4OO1J 3EKSA 2B5JA 2E1YA 2P9PA 3SBTA 2HB5A 2GWJA 5KGWA 4TSXA 3IG1A 4I6MB 4JKGA 4BRLA 3L8BA 3DYAA 3VQBA 4B3MK 1HNIA 4AHRA 3LM2A 3SQ0A 1VQ7N 1J6ZA 1ASWA 4DQSA 2HBJA 3EY1A 1WNSA 4A57A 4AILC 3U9DA 3CJCA 4FJGA 1BI4A 4BDZA 4NCAA 1X9WA 1DGKN 2HNZA 3MMVA 4DMNA 3TPQA 4Z4GA 4KH6A 1ZYQA 3EEQA 4QS8A 3QEIA 2XY6A 4LF5K 3DLRA 3OYGA 4FJJA 5AZJA 5EXWA 5AQZA 2KLAA 4JKEA 3NHGA 4CJFA 1YF5L 3CERA 4CECA 4DR2K 4FK4A 1C6VA 4BGAA 5B8HA 2F9WA 5I9EB 1SS6A 2FBTA 4FJNA 3HVTA 2D4WA 1QS4A 4H03B 4DKWA 4BRQA 3ITHA 3M3ZA 2E2PA 3CJBA 4F9OA 2NRZA 5CR4A 5FPMA 3SUPA 3FGUA 3C6AA 5DMRA 4KKOA 2X78A 3SQ2A 4JNEA 2G8KA 3MN5A 3DRPA 1RT4A 1WN7A 1YI2N 2BANA 1BIUA 4F8RA 4HUGA 3E1YA 2P9IA 3TAFA 1N32K 1YJNN 3FLCO 1CXUA 5ELZA 4BY9C 1JLAA 5C2DA 2D5RA 3ZSRA 1UA0A 2FF3B 2UUAK 3QFUA 1NG9A 4EP4A 3OVNA 3K0SA 3NMUA 4CEAA 1S1UA 1ATRA 3J80O 3ZSOA 3TWHA 1BO5O 4BC3A 5AFUH 1VSDA 1MDUB 2P5OA 4WQ5C 3MWTA 4DCHA 5AQMA 4YHHK 1NJIO 2IC3A 3VQQA 1XC9A 5AQJA 2XRIA 4BR9A 4FOEA 1VQ6N 1JCGA 1KLMA 1TVRA 1R0AA 1HYSA 1XNRK 5FPEA 3QETA 3OYHA 2QM1A 3MXJA 2HOEA 1W2BM 3LP2A 4FLVA 4DHYA 3THYA 1Q9YA 4EHTA 4CK3A 3MEGA 2UYTA 3GG4A 3LWLA 3C7NB 1VQON 3KHYA 2VG5A 3LP1A 4LC9B 2XO7A 1BU6O 1YVNA 2E6LA 4JI4K 1ATSA 2Q31A 1NK0A 1JL2A 1JL1A 3CJ1A 3BZCA 2HHHK 2AP1A 3K58A 3KKSA 1E3MA 1GLBG 1KVBA 5AQKA 4FLTA 3AO2A 3AVLA 4JKFA 2QWPA 3QBXA 2OYQA 3VQPA 4ID1A 1GLAG 4WYBA 5KPRA 4OLBA 3EE9A 5LJWA 3NH0A 5EOYA 4CZHA 5J1EA 1L3SA 3EKUA 3ZSQA 4UY8O 1NK7A 3VQDA 1DTTA 2VG6A 4MDAA 3OJUA 4JV5K 4G9ZA 5J2NA 3P1GA 4DUZK 3QNOA 4BWMA 1HYZA 4N41A 1VSIA 3AVIA 4BR5A 2HBMA 4LF7K 4E7HA 1KFDA 4CZJA 1T05A 3D45A 2OPPA 3CFRA 4H5WA 1RDBA 3PX0A 4JI3K 4JKBA 3PY8A 1FW6A 4KH4A 3JXUA 1TUUA 4HWIA 3FFIA 1RCHA 3E66A 1EWQA 3DOLA 1VAZA 2EX3A 3I55N 4FLUA 4QCLA 2PAVA 1SKRA 3HYFA 3QINA 2A6AA 5AQGA 3TAEA 4JI5K 3OYDA 4NLBA 3V1QA 3TAPA 2O8BB 3Q7CA 4BDYA 1SKWA 4B3OA 2P9NA 3ZLJA 4CF0A 3T69A 5M1PA 2QA4N 1Q18A 2W40A 4IDKA 1BA0A 3VGMA 3LDSA 1MWMA 2I5JA 3D7EO 2Q36A 4FLXA 3G6EN 3RMBA 3FE1A 3G71N 1EO1A 2G8FA 4YNQA 4FLYA 1A5WA 3CC2N 2HMIA 3VQ9A 5AQXA 4I2PA 2FF6A 3IFRA 4CGJA 3BEXA 3E9LA 1EX4A 1LW0A 3VESA 3A5LC 3JSMA 2RHKA 1Z25A 4CHYA 3U6FA 4O55A 1ATNA 3K9JA 3AVKA 4FWKA 4C8OA 2IDOA 1X3NA 4M45A 4JKAA 3HL8A 4IDHA 4IOXA 3DXMA 2E6MA 4RW4A 3SAGA 1TYQA 1GLLO 4CFDA 1C0TA 2GBZA 2BTFA 3C6UA 3HM8A 1XMOK 1C1AA 4YFUA 3CFOA 2IOCA 1CZ9A 3ZT1A 4OPJA 4FWQA 4BRDA 1IH7A 3C6HA 3DXKB 1RTJA 5I3UA 3CIPA 3CETA 1QZ5A 5C42A 4O0IA 3PSFA 4CJVA 1LAWA 2CGKA 3THXA 3CMEN 2A1RA 4FJKA 1FKPA 4U7BA 1K8KA 1HNWK 5C15A 1ZBFA 5CE3A 3S3NA 2NNWA 4ILJA 3H46O 1NKEA 3ZETB 2G8VA 4CZMA 3D2FA 2Y1IA 2O4GA 4O4GA 1DKGD 1RDWX 1WLJA 1VHXA 3OYNA 1WOQA 4GY2B 4H5NA 1XI1A 1WSIA 4ELUA 5JVGL 1RT6A 4JK9A 4JEPA 4JK8A 3P39A 4CJ5A 1MWKA 3AA3A 4BC2A 1QVGM 5JS2A 1TK8A 2V7YA 2EHGA 3VQAA 2FSJA 4FJ9A 3F5TA 1XNQK 1D4XA 4DU1A 3K5LA 2HVIA 3WEEB 1UAXA 5BPMA 1GOCA 3T1HK 2P1JA 5AQYA 4DSKA 4KB0A 2W41A 3SUOA 4KHUA 4KO0A 1C1CA 1LOTB 4FSVA 3LDOA 5BPNA 4K41A 3L6QA 2P9SB 4OKKA 3BF1A 4FWSA 2HBKA 2Y1JA 3GL1A 2PYLA 2FSKA 3PSIA 3HJFA 2ZQBA 1VQPN 1TK0A 3VQ5A 3VGKA 2QWQA 4YORA 3UKRA 2YHWA 3SMSA 4H0XB 4PL7A 4JI2K 3SQ1A 4E1JA 1Q81O 4BRKA 1ZBUA 1LWFA 1QE1A 3CYMA 3OYJA 1ITGA 3HRGA 4GV6A 3NGIA 4CI6A 4RWTA 4A5BA 1KFSA 4BR0A 1KAXA 4ZTJA 4K8XA 1YAGA 3AO3A 4CZIA 3ZSVA 2YNFA 1KD1O 4DQ8A 3BY5A 4NCBA 4BQZA 4B3TK 3L0QA 5T7BA 1NJWA 1M90O 2NLXA 5BN8A 1NK6A 2QWNA 3G4SN 2FBXA 4IG0A 2QK9A 4CJRA 2NRVA 2A5XA 3V6DA 1BDGA 3KWGA 4GVEA 3ULEB 3V9ZA 5HOOA 4FWOA 3CCMN 3UIQA 2UUCK 4BRNA 3KK1A 4DV0K 4LF9K 3TANA 1VSLA 3CXCM 5JICA 3FZHA 3M8SA 1HLUA 5CHIA 3SBGA 3RMCA 3BGRA 1J54A 4DQIA 4C8LA 4XH4A 3UB5A 4FJLA 1P90A 1GLCG 3TI0A 1IV0A 5AQOA 4K8ZA 3SCXA 3HSCA 3P5JA 1NLVA 3CG7A 1NKCA 1ZC6A 1B9FA 4AM6A 2O8FB 4FO0A 3W0LA 1K6YA 2ITGA 1YXQA 2GUIA 4DSFA 1KQSM 5HP1A 4ZHRA 4ISFA 5H1SQ 1XHZA 4KFBA 3K5MA 3A8YA 1IKWA 3O9RA 4IO9L 4FM0A 3NF7A 4FZXC 3DMJA 4M3RA 1G15A 5CYMA 1BL3A 1VSEA 2VQFK 1UWBA 2QXLA 3H6EA 4QS7A 4KHNA 2P9KA 2DPNA 1S22A 1K8AO 3CCUN 3WQUA 3DLEA 4DTMA 5C24A 2P51A 2Z1JA 1TKTA 1HQUA 2WFBA 5M1QA 3V9UA 4M3WA 1WSGA 1OKJA 2P9UA 1YVUA 1Q7YO 4FXDA 3JS6A 3NFAA 3UE5A 4X65K 1KRPA 1YTUA 4DR4K 1VQ8N 3WNHA 2NUBA 3LL3A 1OH8A 3VEOA 1BCMA 3MN9A 3EZ5A 3A2FA 1ZBIA 5EX5A 3O1BA 3CJ7A 3O3HA 1NK4A 3PO5A 2VWBA 3DLGA 1OH6A 4B9NA 3HM9A 4KTWA 3S9HA 4JK7A 4JYAK 4WQ4A 3MDQA 3GDQA 4K42A 4BG8A 1WAJA 3L2VA 5KTQA 5GIPA 2WTUA 4EHUA 2P9LA 4B1XB 3M1FA 4LY7A 1JLEA 3VEZA 3CCVN 4YOUA 3NF6A 3G0ZA 4WF9L 5HL7L 1WUAA 2O4IA 3MXMA 4M3XA 5HRSA 2HW3A 3VENA 1IG8A 1HJOA 4E7LA 3O9SA 1YHQN 2F9TA 4KHPK 2YKNA 4CIFA 2BUPA 1NM1A 1Y97A 4WFBL 4JN4A 5SWMA 4PL8A 4AHTA 3V4IA 3ZEUB 3F9KA 1HKGA 1ASUA 2P9PB 3UKUA 3AAPA 3R6MA 2WC9A 4KB1A 4PQUA 3SI6A 3QIPA 4JKGB 4CD1A 1QZ6A 3PIPL 3VF2A 4BACA 1NOZA 4DSEA 3B8AX 1SQKA 1HRHA 4FW1A 1SL1A 4MO4A 2YCHA 4ISEA 4BVPA 3W3DA 2O8DA 4FOIA 2E20A 3LAKA 2Q3SA 1BI4B 4DLEA 5J2MA 1S9EA 3HK2A 2CGJA 3TAQA 1YJWN 3NF9A 4GKKK 3O3FA 3OYIA 1JJ2M 3QFPA 4O5BA 2IAJA 1VQ9N 3AVJA 5AZJB 5J2QA 4AHCA 3WXMB 2YHXA 2Z1GA 4EIAA 2D0OA 3ZCMA 2A3ZA 4N5SA 2QKBA 1VQ4N 1S5JA 5HBMA 4K0KK 3V9XA 1KXPA 4DFKA 2QWOA 2YV0X 5EY4A 3O80A 5C2FA 1T44A 1BG3A 1Q82O 1RBRA 2IVOA 1TKXA 1VSFA 4KHYA 2NRWA 4B8AB 2GV9A 1J53A 4FJ7A 4OGCA 3AVNA 4IWVA 3ZT0A 3QESA 3MN7A 4J2AA 1QVFM 4L8RB 3DRRA 2P9IB 3K59A 3OYFA 4J2BA 2O8CA 4IZ9A 2CH5A 3VEWA 4LSLA 2D0AA 1F21A 3FFKB 5KRTA 4DR3K 3LP3A 3CC7N 3MWPA 1Y64A 3HVRA 1JLQA 1OVQA 4E3SA 3EL2A 4FL9A 4Z4IA 1RDCA 4QAGA 3CQ8A 4CEQA 4EAHD 3VPZA 3CFPA 5JS1A 1NOYA 2HHWA 3OTOK 4DFMA 2FBVA 5M1FA 3AGRA 3NH2A 4A61A 2KFZA 3O08A 4FVMA 4ILGB 4IG3A 1SUQA 3TSQA 3TAGA 3WUHA 4CK2A 2OZMA 2VGNA 3OHRA 4Z94A 3L4IA 2A42A 1HUXA 4H0VB 4HTLA 3THYB 3S3OA 2F8TA 3AVBA 1DT9A 2F4VK 3NE6A 4C8MA 3LP0A 2ZJPL 2W6KA 3LDPA 1D9DA 2HNYA 3K2PA 4JKDA 1MA9B 2UXBK 3HZ6A 4B9QA 4KHSA 3WXJA 4X66K 3G10A 4FWLA 3AA5X 1NGEA 1NK8A 3CC4N 1RBVA 1YT3A 3CMAN 4W5TA 4JKHA 1Q9XA 5KI6A 3RR8A 3KLFA 2YJFA 3DLKA 1KLNA 1NBWA 2HBLA 3ZSYA 1YJ9N 1YTAA 4CBWA 2HHUA 4PHTX 1L5UA 3ZT3A 2OPQA 2QXFA 1HNXK 1VSJA 4FK0A 2FLOA 5D3GA 1HNVA 4CGGA 3DLLL 2XY5A 2IVNA 3I0RA 4CHZA 3E01A 2YJEA 1TL1A 4CCHA 1JCFA 4E7KA 1TK5A 4OKEA 4BQLA 3EO3A 1VQLN 4HCBA 4FM1A 4BVOA 3O4QA 4CGHA 2OPSA 3O6WA 4H4MA 3O1WA 4AH9A 5BN9A 1RDAA 3KTQA 1RDDA 2YNGA 4WCEL 4NB4A 1E4FT 1X9SA 1N33K 3T1YK 2ZE2A 3VA0A 1JXEA 3ZX2A 1HPMA 1HYVA 5BRHA 1VQ5N 1HPZA 3NVMA 4L3QA 1QQMA 5AZIA 2HF4A 1J9AA 4CZKA 3ZX3A 4F3TA 3DI6A 3THWA 3HP6A 2P9NB 4DR7K 4OPAA 4BRIA 1RT5A 1XWLA 4B1UB 2X6NA 3RWUA 3PX6A 3ZSXA 2YX6A 1D9FA 3BUZB 3A5MC 1L3UA 3LM9A 3AVMA 1O1WA 3LAMA 4GNIA 1EWRA 1NU0A 5EVZA 1NGCA 5FDLA 2W42A 4I7FA 1CXQA 3PO4A 3ATUA 1QQCA 3A0IX 5HROA 3V81A 1N5YA 3OS0A 4MLHA 1U47A 5GINA 1T03A 1QHAA 4BG9A 3QEVA 1U45A 4JRQA 4B9SA 1N8RO 3SNNA 4E19A 1LV5A 4B1WB 3DJCA 4LFAK 3OY9A 1VRUA 3RMDA 4CGFA 4IFVA 3I56N 4OVLA 4DTRA 5FLXO 5ADXA 1UA1A 4XEIA 3DXMB 3SUNA 3V9WA 3C65A 5JMVA 2KZZA 5BRDA 1T6DA 3GBTA 1TYQB 5AQSA 2DFFA 3SV4A 1IO2A 3C94A 2E88A 3MEDA 4XIUA 2ZD1A 2ZJRL 1X9MA 3MK6A 4YOYA 1X3MA 3OYEA 1U2VA 2XY8A 1KVCA 1BGXT 2YNHA 3AO1A 3FZMA 2YHBA 1NGBA 2QWRA 3E9OA 4B3SK 4B9VA 3P38A 3THXB 3KZBA 4CF8A 1K8KB 4W5NA 2GX9A 3O8MA 2HSTA 4C8NA 2OTLN 5BR9A 4B9UA 3CJ9A 3RR7A 1TUYA 1C0MA 4BR4A 5SZTA 5GAHP 2EWSA 4JI8K 5AR0A 4FWNA 4NO7A 1BQMA 3CJAA 4BREA 1ZBLA 5AQQA 3SAFA 3D2FB 4E1NA 1RBTA 4CEEA 1TAQA 3BP8A 5I42A 4AHUA 1LAVA 3L3UA 4DU3A 2PFUA 2E4LA 4I2QA 4CESA 4M7YA 3SPYA 5C25A 3THVA 4HHTA 3KJVA 1S9GA 4CGIA 4X62K 3D2EA
chains in the Genus database with same CATH topology
4MQ3A 1BIUA 4F8RA 1BCMA 4HUGA 4HUFA 4J2EA 3EZ5A 3A2FA 5FRMA 1ZBIA 4FW2A 4CJSA 3TAFA 1FK9A 4B9LA 2RPIA 1CXUA 3ISNC 3O3HA 1NK4A 3PO5A 4Z0UA 3DLGA 1JLAA 3OS1A 2D5RA 4DLGA 4B9NA 3HM9A 4KTWA 3ZSRA 1UA0A 1IKXA 4FLWA 3S9HA 4EP4A 4EP5A 3OVNA 1EETA 1U04A 4CEAA 4CJQA 1S1UA 1WSHA 3ZSOA 1JLBA 1TL3A 4AHVA 4OPKA 1BHLA 4F3OA 3TWHA 3SUQA 4KHWA 4FYDA 1WAJA 3HSTB 1VSDA 3L2VA 1NK5A 5KTQA 1U48A 4CE9A 4JS5A 2P5OA 3HT3A 2FC0A 4LY7A 4CEBA 1JLEA 1QSYA 4DSLA 3WNFA 3ULDA 4FK2A 2IC3A 3VQQA 1XC9A 1NJZA 3NF6A 2XRIA 3G0ZA 3QEXA 2O4IA 4KHQA 3H08A 4ICLA 3K5NA 3MXMA 4M3XA 1KLMA 5HRSA 2HW3A 4FZZA 1TVRA 1R0AA 3TARA 1IKVA 1HYSA 1VSHA 3RMAA 4Q0BA 3QETA 2G8IA 1L3TA 4E7LA 2PY5A 3OYHA 3MXJA 4H4OA 3LP2A 4FLVA 3O3GA 3LWMA 4DFPA 1NKBA 3HP9A 3AVGA 3SJJA 4Z4EA 1Q9YA 4CK3A 2YKNA 4CIFA 3PV8A 1IG9A 1S1WA 3NE6A 3MEGA 5FRNA 4G1QA 3RTVA 1Y97A 4KI6A 3HPHA 4KI4A 4M3TA 3LWLA 3AVAA 5SWMA 4DSIA 4AHTA 1KFSA 3V4IA 4DTXA 2VG5A 3CM5A 3F9KA 3LP1A 2XO7A 1KVAA 4Q5VA 3NAEA 3SYZA 1ASUA 1U4BA 1SL2A 2E6LA 3OYAA 3LZJA 4E0DA 4CK1A 2PZSA 1S6QA 1VRTA 3L3VA 4KB1A 3MECA 3KK2A 4PQUA 3SI6A 1NK0A 1J5OA 1JL2A 3QIPA 4CJ3A 4CF9A 1JL1A 2OZSA 4CHQA 4BACA 1NOZA 2YNIA 4DSEA 3K58A 4GMJB 4BE0A 4ELVA 3KKSA 1VSMA 4FJ5A 3TR8A 4CJWA 1KVBA 4FJHA 1HRHA 4FW1A 4FLTA 4Y1CA 1A5VA 3AO2A 3AVLA 3RRHA 1SL1A 1QSLA 2F8SA 2OYQA 2RKIA 3VQPA 4ID1A 5HRRA 3L2QA 4OLBA 2KQ2A 3NH0A 4I9QA 5J1EA 3LAKA 1L3SA 1B9DA 2Q3SA 4KPYA 2KTQA 1BI4B 2WONA 3ZSQA 3L2RA 4B08A 1NK7A 3VQDA 4IFYA 1DTTA 3I8DA 4DLEA 1RT1A 2VG6A 3OJUA 3WNGA 5J2MA 1S9EA 2D0BA 4W5RA 5J2NA 1T8EA 3HK2A 3P1GA 4M41A 1BQNA 4CJLA 3QNOA 4BWMA 3TAQA 3NF9A 1HYZA 1FKOA 3NBPA 2BDPA 1VSIA 3O3FA 3OYIA 2G8WA 4N41A 4KREA 3AVIA 3AV9A 4DU4A 4O5BA 4KV8A 2IAJA 5KRSA 4KTQA 4DQQA 4FZYA 4E7HA 1KFDA 4DTJA 3TABA 3ZT4A 4DS4A 3AVJA 1T05A 3D45A 2OPPA 5J2QA 4O44A 2BE2A 1GOBA 1LW2A 3MEEA 1JXBA 3CFRA 4AHCA 4LD0A 1RDBA 4O0JA 1U49A 4HCCA 4CFCA 3PX0A 4M3ZA 4CIEA 2KFNA 2Z1GA 4QOZB 4NYFA 3ZCMA 3PY8A 4N5SA 2QKBA 1UOCA 1VK0A 3AA4A 1S5JA 5HBMA 3V9XA 5DK5A 2DTUA 4OGEA 4W5QA 4DFKA 2KW4A 3TAMA 5HLFA 4UQGA 1SV5A 3AVFA 2YV0X 1LWCA 1RCHA 3FFIA 3I0SA 1SL0A 3DOLA 5HRPA 2EX3A 1EP4A 4GW6A 5CZ1A 4CEOA 4CJUA 4FLUA 4QCLA 1RBRA 1SKRA 4OJRA 3LPUA 3HYFA 1GOAA 3QINA 4EZ9A 1CLQA 1TKXA 3TAEA 1VSFA 3OYDA 4KHYA 3V1QA 3D0PA 4N47A 3TAPA 4B8AB 4CF2A 1Q8IA 2GV9A 1J53A 4BDYA 2HHSA 3AA2A 4PY5A 1RT7A 4CGDA 4FJ7A 4OGCA 4PUOA 3VQCA 3AVNA 3HPGA 3ZT0A 2B4JA 1SKWA 4B3OA 3QESA 2QKKA 1WSJA 2DFHA 4FLZA 4J2AA 1RBUA 5EU7A 4PA1A 4H8KA 3MAQA 4DTOA 4CF0A 4L8RB 3DRRA 4E1MA 1S1VA 3IAYA 3K59A 4OLAA 3OYFA 4J2BA 4CJEA 4IDKA 3LDSA 3AO5A 3VQEA 4CEFA 2I5JA 4DTPA 1EKEA 3ALYA 3KLEA 4FLXA 3RMBA 4LSLA 2D0AA 3WNEA 1F21A 4DTUA 1NK9A 4N76A 5KRTA 4J2DA 3LP3A 1S1XA 2G8FA 4C8KA 4YNQA 3VA3A 4FLYA 1A5WA 3KD5E 1RT2A 4HUEA 3K57A 4MFBA 2HMIA 1DLOA 3VQ9A 4NCGA 3HVRA 4I2PA 3VN5A 1C1BA 2VWJA 1JLQA 4CGJA 4E3SA 2X6SA 4FJMA 3KD1E 1EX4A 1LW0A 3AVHA 4CEZA 4BE1A 4Z4IA 3JSMA 3OYMA 4CJTA 3SV3A 4N56A 1Z25A 1RDCA 4CHYA 4QAGA 3CQ8A 4O55A 4CEQA 4RW9A 3QERA 3OYLA 3AVKA 3CFPA 4B9MA 5JS1A 3OYCA 1NOYA 2HHWA 3OS2A 4C8OA 4EZ6A 4DFMA 2IDOA 2FBVA 4JLHA 4M45A 3NH2A 4CFAA 1WAFA 2KFZA 2G8HA 2IGIA 3P83D 4FVMA 3LZIA 4IG3A 3OJSA 4DTNA 4F2SA 1SUQA 3TAGA 3HL8A 2OPRA 2DFEA 1W9HA 3ZT2A 4CK2A 1ZBHA 2HHVA 2OZMA 4BE2A 2E6MA 3NGYA 4B9TA 4FM2A 4RW4A 1D8YA 4CFDA 2HVHA 4DF4A 3S3OA 1C0TA 2F8TA 2GBZA 2LSNA 3AVBA 3C6TA 3C6UA 4E7JA 3PX4A 1FXXA 3PUFA 4KTZA 3VQ4A 1C1AA 4YFUA 5E41A 1RNHA 1D5AA 1EXQA 2IOCA 2JLEA 3CFOA 1BIZA 1CZ9A 3LP0A 4C8MA 3ZT1A 4OPJA 4M3YA 1T7PA 2PYJA 3V1RA 1IH7A 3K5OA 4CF1A 1D9DA 2ETJA 4Y1DA 1RTJA 2HNYA 3K2PA 1NJYA 5I3UA 1TKDA 3M8RA 4F4KA 1HMVA 4WE1A 5C42A 4RG8A 4O0IA 4KHSA 3G10A 3AA5X 2B6AA 4CJVA 1NK8A 1RBVA 1YT3A 3T3FA 1LAWA 4W5TA 1Q9XA 3SZ2A 5CYQA 5KI6A 2A1RA 4FJKA 3RR8A 2RN2A 1FKPA 1QHTA 3U3YA 1RBSA 3KLFA 4FJ8A 3BDPA 4RW7A 3DLKA 1KLNA 1Z26A 3DM2A 2VWKA 4CJKA 3ZSYA 1ZBFA 4OKJA 1TV6A 4DG1A 2VG7A 2XHBA 3SQ4A 3F73A 3S3NA 2OA8A 4F2RA 3LPTA 5K14A 3KLGA 1YTAA 1NKEA 4E89A 4LSNA 3MXIA 1L5UA 3ZT3A 2G8VA 2HHUA 2YHAA 4HVJA 1HJRA 2OPQA 2QXFA 4ZTFA 1VSJA 4FK0A 3KLHA 4GVMA 2O4GA 4CJPA 4LH5A 4O4GA 4RW8A 2Y1IA 5D3GA 1HNVA 4HTUA 4BDPA 1WLJA 4CGGA 3OYNA 1S1TA 2XY5A 3B6OA 1XI1A 2BGGA 3JYTA 1WSIA 1TAUA 3I0RA 3QIOA 4CHZA 3NF8A 3E01A 4ELUA 3NGZA 3AVCA 1RT6A 2RF2A 4JS4A 1L3VA 4KAZA 1TL1A 4CCHA 5FROA 4E7KA 4DQPA 2HNDA 4CJ5A 2WOMA 1I39A 4LH4A 4R5PA 3L2WA 1TK5A 4OKEA 1C0UA 3AA3A 3VQ8A 5JS2A 3CM6A 1LWEA 1RTIA 1KTQA 1TK8A 4DWIA 4HCBA 4FM1A 2EHGA 3VQAA 4FJ9A 3O4QA 4CIGA 3NDKA 3VQ6A 4DU1A 4CGHA 3K5LA 2OPSA 2HVIA 1UAXA 2Z1IA 1GOCA 2P1JA 4H4MA 4AH9A 3OYBA 3KLIA 3L2UA 1JLGA 1RDAA 1RDDA 2YNGA 3DOKA 3KTQA 4DSKA 4KB0A 3SUOA 4KHUA 3IRXA 1C1CA 3IS9A 1JLCA 4KO0A 1X9SA 1RILA 1TGOA 4B8CA 1WSEA 4OKKA 2ZE2A 3LANA 3VA0A 1RT3A 2ATQA 1JXEA 2XY7A 1KSPA 4Z4FA 2Y1JA 3B6PA 1HYVA 4W5OA 4DF8A 2PYLA 2D0CA 3HJFA 2ZQBA 1XHXA 5HRNA 1HPZA 1QSSA 1TK0A 4CFBA 4M42A 4DSJA 3O4NA 2JGUA 3VQ5A 3T1AA 1J9AA 1DTQA 4IKFA 3SPZA 3QO9A 3U3GA 3DRSA 4F3TA 3DI6A 3NCIA 3HP6A 1KCFA 3SQ1A 1W0HA 4FCYA 1RT5A 3ZSZA 1I3AA 1XWLA 1ZBUA 1CZBA 2X6NA 1LWFA 1QE1A 3CYMA 3OYJA 1ITGA 3PX6A 1RTDA 3ZSXA 3S3MA 3RWUA 2DY4A 3NGIA 1D9FA 3QLHA 3KKRA 1L3UA 2A1SA 4CHPA 3KIOA 3VQ7A 3DLBA 4ID5A 1X1PA 4ZTJA 1WSFA 3ZSWA 4JRPA 3U6FA 3AVMA 1O1WA 3LAMA 3V9SA 1NJXA 4K8XA 3HPOA 2F96A 1HQEA 1TKZA 5FDLA 3AO3A 3M8QA 2W42A 3ZSVA 4I7FA 3EYZA 3RRGA 2YNFA 4NYNA 1CXQA 3PO4A 3DLHA 4M3UA 2KZMA 1QQCA 4CERA 5HROA 3V81A 1N5YA 1N6QA 2P5GA 4NCBA 1MU2A 3T19A 3OS0A 4CHOA 2G8UA 2FBYA 2YKMA 3C95A 5CZ2A 3QEPA 1U47A 1T03A 1NJWA 5T7BA 3AO4A 3V1OA 3QEVA 1U45A 1RTHA 4JRQA 4B9SA 1QTMA 4CJ4A 2AJQA 3SNNA 4E19A 1NK6A 5J2PA 1LV5A 2B5JA 2FBXA 1S6PA 2Z1HA 3OY9A 4IG0A 1VRUA 2QK9A 2HB5A 4CJRA 1REVA 3RMDA 4BWJA 5KGWA 4CGFA 4IFVA 4TSXA 3IG1A 3V6DA 3V9ZA 4OVLA 4DTRA 3HXMA 4DTSA 3LALA 1UA1A 3UIQA 3L8BA 3DYAA 3VQBA 4FJXA 3KK1A 3SUNA 3V9WA 1HNIA 3TANA 3ASMA 4AHRA 1VSLA 2KZZA 2R7YA 2HHXA 3SQ0A 1SKSA 1ASWA 1B92A 2DFFA 4Z4CA 3SV4A 4DQSA 3M8SA 1IO2A 3EY1A 1JKHA 3M8PA 1WNSA 4CHNA 3C94A 4AILC 3RMCA 3BGRA 1J54A 2X74A 1JLFA 3MEDA 3NH1A 4XIUA 4ELTA 4FJGA 1BI4A 4BDZA 2ZD1A 4C8LA 4DQIA 1X9MA 4NCAA 4FJLA 3TI0A 3OYEA 1X9WA 4K8ZA 1ASVA 3SCXA 2HNZA 2IS3A 2XY8A 3P5JA 2HHTA 3CG7A 4DMNA 1KVCA 1BGXT 2YNHA 1NKCA 3AO1A 1B9FA 2YHBA 4Z4GA 1K6YA 2ITGA 2GUIA 4Z4HA 1ZYQA 4DSFA 3QEIA 4ZHRA 2XY6A 3DLRA 3OYGA 5HP1A 4B9VA 1XHZA 4FJJA 4KFBA 3K5MA 4DS5A 3QNNA 3NHGA 4E7IA 1IKWA 4CJFA 4FM0A 3NF7A 4FZXC 4CF8A 3DMJA 4W5NA 4M3RA 4CECA 2HHQA 1G15A 5CYMA 1BL3A 4C8NA 4FJIA 1VSEA 4FK4A 4B9UA 1UWBA 1C6VA 3KK3A 3RR7A 4KRFA 4AHSA 4PWDA 5KGXA 1C0MA 5SZTA 2FBTA 4FJNA 1IKYA 1BCOA 3HVTA 1BQMA 4KHNA 4CEDA 1QS4A 4DFJA 1ZBLA 4E1NA 4RW6A 1RBTA 3ITHA 3QEWA 4CEEA 1TAQA 3DLEA 4I9LA 4DTMA 5C24A 5I42A 1BISA 2P51A 3HO1A 2Z1JA 1TKTA 4AHUA 1LAVA 1HQUA 3L3UA 3V9UA 4M3WA 3SUPA 1WSGA 4DU3A 2E4LA 4I2QA 4CESA 1YVUA 4KKOA 5CY4A 2X78A 5DMRA 3SPYA 5C25A 4DQRA 3THVA 3OYKA 4FXDA 3NFAA 4HHTA 3KJVA 3SQ2A 2G8KA 1S9GA 4CGIA 1KRPA 1YTUA 1VSKA 3DRPA 1RT4A 4IBNA 1WN7A 3WNHA 1A5XA 2BANA 2NUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MQ3 A;  1BIU A;  4F8R A;  1BCM A;  4HUG A;  4HUF A;  4J2E A;  3EZ5 A;  3A2F A;  5FRM A;  1ZBI A;  4FW2 A;  4CJS A;  3TAF A;  1FK9 A;  4B9L A;  2RPI A;  1CXU A;  3ISN C;  3O3H A;  1NK4 A;  3PO5 A;  4Z0U A;  3DLG A;  1JLA A;  3OS1 A;  2D5R A;  4DLG A;  4B9N A;  3HM9 A;  4KTW A;  3ZSR A;  1UA0 A;  1IKX A;  4FLW A;  3S9H A;  4EP4 A;  4EP5 A;  3OVN A;  1EET A;  1U04 A;  4CEA A;  4CJQ A;  1S1U A;  1WSH A;  3ZSO A;  1JLB A;  1TL3 A;  4AHV A;  4OPK A;  1BHL A;  4F3O A;  3TWH A;  3SUQ A;  4KHW A;  4FYD A;  1WAJ A;  3HST B;  1VSD A;  3L2V A;  1NK5 A;  5KTQ A;  1U48 A;  4CE9 A;  4JS5 A;  2P5O A;  3HT3 A;  2FC0 A;  4LY7 A;  4CEB A;  1JLE A;  1QSY A;  4DSL A;  3WNF A;  3ULD A;  4FK2 A;  2IC3 A;  3VQQ A;  1XC9 A;  1NJZ A;  3NF6 A;  2XRI A;  3G0Z A;  3QEX A;  2O4I A;  4KHQ A;  3H08 A;  4ICL A;  3K5N A;  3MXM A;  4M3X A;  1KLM A;  5HRS A;  2HW3 A;  4FZZ A;  1TVR A;  1R0A A;  3TAR A;  1IKV A;  1HYS A;  1VSH A;  3RMA A;  4Q0B A;  3QET A;  2G8I A;  1L3T A;  4E7L A;  2PY5 A;  3OYH A;  3MXJ A;  4H4O A;  3LP2 A;  4FLV A;  3O3G A;  3LWM A;  4DFP A;  1NKB A;  3HP9 A;  3AVG A;  3SJJ A;  4Z4E A;  1Q9Y A;  4CK3 A;  2YKN A;  4CIF A;  3PV8 A;  1IG9 A;  1S1W A;  3NE6 A;  3MEG A;  5FRN A;  4G1Q A;  3RTV A;  1Y97 A;  4KI6 A;  3HPH A;  4KI4 A;  4M3T A;  3LWL A;  3AVA A;  5SWM A;  4DSI A;  4AHT A;  1KFS A;  3V4I A;  4DTX A;  2VG5 A;  3CM5 A;  3F9K A;  3LP1 A;  2XO7 A;  1KVA A;  4Q5V A;  3NAE A;  3SYZ A;  1ASU A;  1U4B A;  1SL2 A;  2E6L A;  3OYA A;  3LZJ A;  4E0D A;  4CK1 A;  2PZS A;  1S6Q A;  1VRT A;  3L3V A;  4KB1 A;  3MEC A;  3KK2 A;  4PQU A;  3SI6 A;  1NK0 A;  1J5O A;  1JL2 A;  3QIP A;  4CJ3 A;  4CF9 A;  1JL1 A;  2OZS A;  4CHQ A;  4BAC A;  1NOZ A;  2YNI A;  4DSE A;  3K58 A;  4GMJ B;  4BE0 A;  4ELV A;  3KKS A;  1VSM A;  4FJ5 A;  3TR8 A;  4CJW A;  1KVB A;  4FJH A;  1HRH A;  4FW1 A;  4FLT A;  4Y1C A;  1A5V A;  3AO2 A;  3AVL A;  3RRH A;  1SL1 A;  1QSL A;  2F8S A;  2OYQ A;  2RKI A;  3VQP A;  4ID1 A;  5HRR A;  3L2Q A;  4OLB A;  2KQ2 A;  3NH0 A;  4I9Q A;  5J1E A;  3LAK A;  1L3S A;  1B9D A;  2Q3S A;  4KPY A;  2KTQ A;  1BI4 B;  2WON A;  3ZSQ A;  3L2R A;  4B08 A;  1NK7 A;  3VQD A;  4IFY A;  1DTT A;  3I8D A;  4DLE A;  1RT1 A;  2VG6 A;  3OJU A;  3WNG A;  5J2M A;  1S9E A;  2D0B A;  4W5R A;  5J2N A;  1T8E A;  3HK2 A;  3P1G A;  4M41 A;  1BQN A;  4CJL A;  3QNO A;  4BWM A;  3TAQ A;  3NF9 A;  1HYZ A;  1FKO A;  3NBP A;  2BDP A;  1VSI A;  3O3F A;  3OYI A;  2G8W A;  4N41 A;  4KRE A;  3AVI A;  3AV9 A;  4DU4 A;  4O5B A;  4KV8 A;  2IAJ A;  5KRS A;  4KTQ A;  4DQQ A;  4FZY A;  4E7H A;  1KFD A;  4DTJ A;  3TAB A;  3ZT4 A;  4DS4 A;  3AVJ A;  1T05 A;  3D45 A;  2OPP A;  5J2Q A;  4O44 A;  2BE2 A;  1GOB A;  1LW2 A;  3MEE A;  1JXB A;  3CFR A;  4AHC A;  4LD0 A;  1RDB A;  4O0J A;  1U49 A;  4HCC A;  4CFC A;  3PX0 A;  4M3Z A;  4CIE A;  2KFN A;  2Z1G A;  4QOZ B;  4NYF A;  3ZCM A;  3PY8 A;  4N5S A;  2QKB A;  1UOC A;  1VK0 A;  3AA4 A;  1S5J A;  5HBM A;  3V9X A;  5DK5 A;  2DTU A;  4OGE A;  4W5Q A;  4DFK A;  2KW4 A;  3TAM A;  5HLF A;  4UQG A;  1SV5 A;  3AVF A;  2YV0 X;  1LWC A;  1RCH A;  3FFI A;  3I0S A;  1SL0 A;  3DOL A;  5HRP A;  2EX3 A;  1EP4 A;  4GW6 A;  5CZ1 A;  4CEO A;  4CJU A;  4FLU A;  4QCL A;  1RBR A;  1SKR A;  4OJR A;  3LPU A;  3HYF A;  1GOA A;  3QIN A;  4EZ9 A;  1CLQ A;  1TKX A;  3TAE A;  1VSF A;  3OYD A;  4KHY A;  3V1Q A;  3D0P A;  4N47 A;  3TAP A;  4B8A B;  4CF2 A;  1Q8I A;  2GV9 A;  1J53 A;  4BDY A;  2HHS A;  3AA2 A;  4PY5 A;  1RT7 A;  4CGD A;  4FJ7 A;  4OGC A;  4PUO A;  3VQC A;  3AVN A;  3HPG A;  3ZT0 A;  2B4J A;  1SKW A;  4B3O A;  3QES A;  2QKK A;  1WSJ A;  2DFH A;  4FLZ A;  4J2A A;  1RBU A;  5EU7 A;  4PA1 A;  4H8K A;  3MAQ A;  4DTO A;  4CF0 A;  4L8R B;  3DRR A;  4E1M A;  1S1V A;  3IAY A;  3K59 A;  4OLA A;  3OYF A;  4J2B A;  4CJE A;  4IDK A;  3LDS A;  3AO5 A;  3VQE A;  4CEF A;  2I5J A;  4DTP A;  1EKE A;  3ALY A;  3KLE A;  4FLX A;  3RMB A;  4LSL A;  2D0A A;  3WNE A;  1F21 A;  4DTU A;  1NK9 A;  4N76 A;  5KRT A;  4J2D A;  3LP3 A;  1S1X A;  2G8F A;  4C8K A;  4YNQ A;  3VA3 A;  4FLY A;  1A5W A;  3KD5 E;  1RT2 A;  4HUE A;  3K57 A;  4MFB A;  2HMI A;  1DLO A;  3VQ9 A;  4NCG A;  3HVR A;  4I2P A;  3VN5 A;  1C1B A;  2VWJ A;  1JLQ A;  4CGJ A;  4E3S A;  2X6S A;  4FJM A;  3KD1 E;  1EX4 A;  1LW0 A;  3AVH A;  4CEZ A;  4BE1 A;  4Z4I A;  3JSM A;  3OYM A;  4CJT A;  3SV3 A;  4N56 A;  1Z25 A;  1RDC A;  4CHY A;  4QAG A;  3CQ8 A;  4O55 A;  4CEQ A;  4RW9 A;  3QER A;  3OYL A;  3AVK A;  3CFP A;  4B9M A;  5JS1 A;  3OYC A;  1NOY A;  2HHW A;  3OS2 A;  4C8O A;  4EZ6 A;  4DFM A;  2IDO A;  2FBV A;  4JLH A;  4M45 A;  3NH2 A;  4CFA A;  1WAF A;  2KFZ A;  2G8H A;  2IGI A;  3P83 D;  4FVM A;  3LZI A;  4IG3 A;  3OJS A;  4DTN A;  4F2S A;  1SUQ A;  3TAG A;  3HL8 A;  2OPR A;  2DFE A;  1W9H A;  3ZT2 A;  4CK2 A;  1ZBH A;  2HHV A;  2OZM A;  4BE2 A;  2E6M A;  3NGY A;  4B9T A;  4FM2 A;  4RW4 A;  1D8Y A;  4CFD A;  2HVH A;  4DF4 A;  3S3O A;  1C0T A;  2F8T A;  2GBZ A;  2LSN A;  3AVB A;  3C6T A;  3C6U A;  4E7J A;  3PX4 A;  1FXX A;  3PUF A;  4KTZ A;  3VQ4 A;  1C1A A;  4YFU A;  5E41 A;  1RNH A;  1D5A A;  1EXQ A;  2IOC A;  2JLE A;  3CFO A;  1BIZ A;  1CZ9 A;  3LP0 A;  4C8M A;  3ZT1 A;  4OPJ A;  4M3Y A;  1T7P A;  2PYJ A;  3V1R A;  1IH7 A;  3K5O A;  4CF1 A;  1D9D A;  2ETJ A;  4Y1D A;  1RTJ A;  2HNY A;  3K2P A;  1NJY A;  5I3U A;  1TKD A;  3M8R A;  4F4K A;  1HMV A;  4WE1 A;  5C42 A;  4RG8 A;  4O0I A;  4KHS A;  3G10 A;  3AA5 X;  2B6A A;  4CJV A;  1NK8 A;  1RBV A;  1YT3 A;  3T3F A;  1LAW A;  4W5T A;  1Q9X A;  3SZ2 A;  5CYQ A;  5KI6 A;  2A1R A;  4FJK A;  3RR8 A;  2RN2 A;  1FKP A;  1QHT A;  3U3Y A;  1RBS A;  3KLF A;  4FJ8 A;  3BDP A;  4RW7 A;  3DLK A;  1KLN A;  1Z26 A;  3DM2 A;  2VWK A;  4CJK A;  3ZSY A;  1ZBF A;  4OKJ A;  1TV6 A;  4DG1 A;  2VG7 A;  2XHB A;  3SQ4 A;  3F73 A;  3S3N A;  2OA8 A;  4F2R A;  3LPT A;  5K14 A;  3KLG A;  1YTA A;  1NKE A;  4E89 A;  4LSN A;  3MXI A;  1L5U A;  3ZT3 A;  2G8V A;  2HHU A;  2YHA A;  4HVJ A;  1HJR A;  2OPQ A;  2QXF A;  4ZTF A;  1VSJ A;  4FK0 A;  3KLH A;  4GVM A;  2O4G A;  4CJP A;  4LH5 A;  4O4G A;  4RW8 A;  2Y1I A;  5D3G A;  1HNV A;  4HTU A;  4BDP A;  1WLJ A;  4CGG A;  3OYN A;  1S1T A;  2XY5 A;  3B6O A;  1XI1 A;  2BGG A;  3JYT A;  1WSI A;  1TAU A;  3I0R A;  3QIO A;  4CHZ A;  3NF8 A;  3E01 A;  4ELU A;  3NGZ A;  3AVC A;  1RT6 A;  2RF2 A;  4JS4 A;  1L3V A;  4KAZ A;  1TL1 A;  4CCH A;  5FRO A;  4E7K A;  4DQP A;  2HND A;  4CJ5 A;  2WOM A;  1I39 A;  4LH4 A;  4R5P A;  3L2W A;  1TK5 A;  4OKE A;  1C0U A;  3AA3 A;  3VQ8 A;  5JS2 A;  3CM6 A;  1LWE A;  1RTI A;  1KTQ A;  1TK8 A;  4DWI A;  4HCB A;  4FM1 A;  2EHG A;  3VQA A;  4FJ9 A;  3O4Q A;  4CIG A;  3NDK A;  3VQ6 A;  4DU1 A;  4CGH A;  3K5L A;  2OPS A;  2HVI A;  1UAX A;  2Z1I A;  1GOC A;  2P1J A;  4H4M A;  4AH9 A;  3OYB A;  3KLI A;  3L2U A;  1JLG A;  1RDA A;  1RDD A;  2YNG A;  3DOK A;  3KTQ A;  4DSK A;  4KB0 A;  3SUO A;  4KHU A;  3IRX A;  1C1C A;  3IS9 A;  1JLC A;  4KO0 A;  1X9S A;  1RIL A;  1TGO A;  4B8C A;  1WSE A;  4OKK A;  2ZE2 A;  3LAN A;  3VA0 A;  1RT3 A;  2ATQ A;  1JXE A;  2XY7 A;  1KSP A;  4Z4F A;  2Y1J A;  3B6P A;  1HYV A;  4W5O A;  4DF8 A;  2PYL A;  2D0C A;  3HJF A;  2ZQB A;  1XHX A;  5HRN A;  1HPZ A;  1QSS A;  1TK0 A;  4CFB A;  4M42 A;  4DSJ A;  3O4N A;  2JGU A;  3VQ5 A;  3T1A A;  1J9A A;  1DTQ A;  4IKF A;  3SPZ A;  3QO9 A;  3U3G A;  3DRS A;  4F3T A;  3DI6 A;  3NCI A;  3HP6 A;  1KCF A;  3SQ1 A;  1W0H A;  4FCY A;  1RT5 A;  3ZSZ A;  1I3A A;  1XWL A;  1ZBU A;  1CZB A;  2X6N A;  1LWF A;  1QE1 A;  3CYM A;  3OYJ A;  1ITG A;  3PX6 A;  1RTD A;  3ZSX A;  3S3M A;  3RWU A;  2DY4 A;  3NGI A;  1D9F A;  3QLH A;  3KKR A;  1L3U A;  2A1S A;  4CHP A;  3KIO A;  3VQ7 A;  3DLB A;  4ID5 A;  1X1P A;  4ZTJ A;  1WSF A;  3ZSW A;  4JRP A;  3U6F A;  3AVM A;  1O1W A;  3LAM A;  3V9S A;  1NJX A;  4K8X A;  3HPO A;  2F96 A;  1HQE A;  1TKZ A;  5FDL A;  3AO3 A;  3M8Q A;  2W42 A;  3ZSV A;  4I7F A;  3EYZ A;  3RRG A;  2YNF A;  4NYN A;  1CXQ A;  3PO4 A;  3DLH A;  4M3U A;  2KZM A;  1QQC A;  4CER A;  5HRO A;  3V81 A;  1N5Y A;  1N6Q A;  2P5G A;  4NCB A;  1MU2 A;  3T19 A;  3OS0 A;  4CHO A;  2G8U A;  2FBY A;  2YKM A;  3C95 A;  5CZ2 A;  3QEP A;  1U47 A;  1T03 A;  1NJW A;  5T7B A;  3AO4 A;  3V1O A;  3QEV A;  1U45 A;  1RTH A;  4JRQ A;  4B9S A;  1QTM A;  4CJ4 A;  2AJQ A;  3SNN A;  4E19 A;  1NK6 A;  5J2P A;  1LV5 A;  2B5J A;  2FBX A;  1S6P A;  2Z1H A;  3OY9 A;  4IG0 A;  1VRU A;  2QK9 A;  2HB5 A;  4CJR A;  1REV A;  3RMD A;  4BWJ A;  5KGW A;  4CGF A;  4IFV A;  4TSX A;  3IG1 A;  3V6D A;  3V9Z A;  4OVL A;  4DTR A;  3HXM A;  4DTS A;  3LAL A;  1UA1 A;  3UIQ A;  3L8B A;  3DYA A;  3VQB A;  4FJX A;  3KK1 A;  3SUN A;  3V9W A;  1HNI A;  3TAN A;  3ASM A;  4AHR A;  1VSL A;  2KZZ A;  2R7Y A;  2HHX A;  3SQ0 A;  1SKS A;  1ASW A;  1B92 A;  2DFF A;  4Z4C A;  3SV4 A;  4DQS A;  3M8S A;  1IO2 A;  3EY1 A;  1JKH A;  3M8P A;  1WNS A;  4CHN A;  3C94 A;  4AIL C;  3RMC A;  3BGR A;  1J54 A;  2X74 A;  1JLF A;  3MED A;  3NH1 A;  4XIU A;  4ELT A;  4FJG A;  1BI4 A;  4BDZ A;  2ZD1 A;  4C8L A;  4DQI A;  1X9M A;  4NCA A;  4FJL A;  3TI0 A;  3OYE A;  1X9W A;  4K8Z A;  1ASV A;  3SCX A;  2HNZ A;  2IS3 A;  2XY8 A;  3P5J A;  2HHT A;  3CG7 A;  4DMN A;  1KVC A;  1BGX T;  2YNH A;  1NKC A;  3AO1 A;  1B9F A;  2YHB A;  4Z4G A;  1K6Y A;  2ITG A;  2GUI A;  4Z4H A;  1ZYQ A;  4DSF A;  3QEI A;  4ZHR A;  2XY6 A;  3DLR A;  3OYG A;  5HP1 A;  4B9V A;  1XHZ A;  4FJJ A;  4KFB A;  3K5M A;  4DS5 A;  3QNN A;  3NHG A;  4E7I A;  1IKW A;  4CJF A;  4FM0 A;  3NF7 A;  4FZX C;  4CF8 A;  3DMJ A;  4W5N A;  4M3R A;  4CEC A;  2HHQ A;  1G15 A;  5CYM A;  1BL3 A;  4C8N A;  4FJI A;  1VSE A;  4FK4 A;  4B9U A;  1UWB A;  1C6V A;  3KK3 A;  3RR7 A;  4KRF A;  4AHS A;  4PWD A;  5KGX A;  1C0M A;  5SZT A;  2FBT A;  4FJN A;  1IKY A;  1BCO A;  3HVT A;  1BQM A;  4KHN A;  4CED A;  1QS4 A;  4DFJ A;  1ZBL A;  4E1N A;  4RW6 A;  1RBT A;  3ITH A;  3QEW A;  4CEE A;  1TAQ A;  3DLE A;  4I9L A;  4DTM A;  5C24 A;  5I42 A;  1BIS A;  2P51 A;  3HO1 A;  2Z1J A;  1TKT A;  4AHU A;  1LAV A;  1HQU A;  3L3U A;  3V9U A;  4M3W A;  3SUP A;  1WSG A;  4DU3 A;  2E4L A;  4I2Q A;  4CES A;  1YVU A;  4KKO A;  5CY4 A;  2X78 A;  5DMR A;  3SPY A;  5C25 A;  4DQR A;  3THV A;  3OYK A;  4FXD A;  3NFA A;  4HHT A;  3KJV A;  3SQ2 A;  2G8K A;  1S9G A;  4CGI A;  1KRP A;  1YTU A;  1VSK A;  3DRP A;  1RT4 A;  4IBN A;  1WN7 A;  3WNH A;  1A5X A;  2BAN A;  2NUB A; 
#chains in the Genus database with same CATH topology
 3GOI A;  4HUF A;  4FW2 A;  4CJS A;  4IO8 A;  1FK9 A;  4B9L A;  2RPI A;  4Z0U A;  5GIO A;  4B3R K;  3KWI A;  1BA1 A;  5LL6 Z;  4YDU A;  3ZYY X;  1HKC A;  1U04 A;  1WSH A;  1NGA A;  1JLB A;  4OPK A;  4FYD A;  2UUB K;  2QW9 A;  3WQT A;  1NK5 A;  1U48 A;  3UKR B;  4CE9 A;  3HT3 A;  4DB3 A;  1VQK N;  3MX2 A;  2O8E A;  4DSL A;  3WNF A;  1IBM K;  3ULD A;  2GEL A;  5BRE A;  5M1K A;  3Q7B A;  1NJZ A;  4BRC A;  1HR0 K;  4FPA A;  4BRH A;  1YIJ N;  3H3N O;  4KHQ A;  4YY3 K;  3H08 A;  4ICL A;  3OA9 A;  3J7Y P;  2VQE K;  1VSH A;  3RMA A;  4Q0B A;  3G25 A;  5AQI A;  1P8Z A;  3LWM A;  4DFP A;  1NKB A;  2NRR A;  3HP9 A;  3SJJ A;  1IG9 A;  1GLD G;  4H0T B;  4DR5 K;  3HPH A;  4KI6 A;  4AM7 A;  2D1K A;  4DSI A;  2QTD A;  4YOV A;  2Q97 A;  4Q5V A;  4JI7 K;  1U4B A;  3LZJ A;  4CK1 A;  4LF6 K;  2PZS A;  1S6Q A;  1VRT A;  3MEC A;  3KK2 A;  3CI5 A;  4MDB A;  4CJ3 A;  2OZS A;  4KBO A;  5FPN A;  4CHQ A;  2E2O A;  4C1N K;  4FJ5 A;  4M42 A;  4GMJ B;  4JHD A;  3CCQ N;  3TR8 A;  4CJW A;  2PBD A;  3CPW M;  3PLA A;  1HX1 A;  4Y1C A;  1A5V A;  3RRH A;  1QSL A;  1BOT O;  3L2Q A;  1R59 O;  2KQ2 A;  4I9Q A;  4KPY A;  3N4P A;  2WON A;  4B08 A;  4IFY A;  3HI0 A;  3I8D A;  3T7Z A;  4FVU A;  5F2R A;  5DM6 L;  5DM7 L;  4W5R A;  2JWL A;  4M41 A;  1BQN A;  3NBP A;  2BDP A;  3AV9 A;  4A5A A;  4KV8 A;  2UXC K;  4KTQ A;  4DQQ A;  4FZY A;  4DTJ A;  3ENB A;  4JD2 A;  2BE2 A;  1NGJ A;  4LD0 A;  4CFC A;  2E5L K;  1N36 K;  4CIE A;  2KFN A;  2JWK A;  3AY9 A;  4DUY K;  4B1Y B;  3RSE A;  3KVG A;  2DTU A;  4OGE A;  3TAM A;  5M1N A;  1SV5 A;  2P9K B;  4BRF A;  3AVF A;  2ZF5 O;  1LWC A;  3I0S A;  2QEX N;  1EP4 A;  4GW6 A;  4CJU A;  1CLQ A;  3VET A;  3D0P A;  1Q8I A;  1ESV A;  2P9U B;  3AA2 A;  4CGD A;  2QKK A;  4DR6 K;  1J5E K;  1WSJ A;  4AQY K;  4A62 A;  1RBU A;  5EU7 A;  4PA1 A;  4H8K A;  1WB9 A;  4LF8 K;  4DTO A;  5GAG P;  4CZF A;  4FPB A;  4E1M A;  4OLA A;  4CJE A;  3CCJ N;  4DTP A;  5BR8 K;  1EKE A;  3ALY A;  4LFB K;  4O8U A;  3WNE A;  4BC4 A;  4N76 A;  3VEY A;  4RTF D;  1S1X A;  3P4I A;  3ID8 A;  3VA3 A;  1RT2 A;  4AF1 A;  1S72 N;  3K57 A;  3QDK A;  1DLO A;  4CZE A;  4NCG A;  3VN5 A;  2VWJ A;  3TSP A;  4CEZ A;  2OCE A;  4DV4 K;  2P9L B;  4BE1 A;  3VF6 A;  4IEE A;  4CJT A;  3R9P A;  1NGD A;  2Q1N A;  3OYL A;  5JVH L;  3OYC A;  3OS2 A;  2AA4 A;  4EZ6 A;  2VGM A;  4I6M A;  1WAF A;  4CFA A;  2IGI A;  3LZI A;  4MO5 A;  4IOA L;  4F2S A;  4DTN A;  3QB0 A;  1LCU A;  3CCR N;  2OPR A;  1W9H A;  2YI1 A;  2HHV A;  3WXI A;  3NGY A;  1YUW A;  4DF4 A;  1IBK K;  1HNZ K;  5KPZ A;  3PX4 A;  1FXX A;  1X9J A;  3QBW A;  4DR1 K;  1D5A A;  1EXQ A;  4LFC K;  2JLE A;  2H3G X;  1GLE G;  3DWL A;  4BR7 A;  1Z05 A;  5A2Q O;  3K5O A;  4CF1 A;  4Y1D A;  4YDU C;  5F1X A;  1NMD A;  3VEX A;  3UKU B;  3M8R A;  4F4K A;  3MX5 A;  3BZK A;  4RG8 A;  3T3F A;  1SZ2 A;  3IKM A;  2RN2 A;  1QHT A;  5LMU K;  5BPL A;  4QS9 A;  1NMN A;  3GE1 A;  1Z26 A;  4JKC A;  3J8A A;  3DM2 A;  4CJK A;  3CF5 L;  1TV6 A;  2VCP A;  2VG7 A;  3SQ4 A;  3VEV A;  2O8D B;  2D0P A;  1QQO A;  3VOV A;  4LSN A;  2YHA A;  1HJR A;  2GUP A;  3SK3 A;  3CPE A;  2ZGY A;  3KLH A;  4GVM A;  3FZK A;  5AQN A;  3AGK A;  4RW8 A;  4HTU A;  4BDP A;  4ISG A;  1S1T A;  5AQP A;  3HOT A;  4PKG A;  3JYT A;  1TAU A;  5GAD P;  3NF8 A;  3ENO A;  3AVC A;  3NGZ A;  2RF2 A;  1L3V A;  5FRO A;  2QI2 A;  4DQP A;  2WOM A;  4R5P A;  3L2W A;  1OH7 A;  2IIR A;  3VQ8 A;  3CM6 A;  1RTI A;  1KTQ A;  3TSU A;  3N4Q A;  4CIG A;  3R1X A;  2Z1I A;  4R79 A;  3L2U A;  2Q0U A;  1IBL K;  1U6Z A;  1JLG A;  4K25 A;  4DV2 K;  5F0X A;  3IRX A;  3IS9 A;  1JLC A;  1T6C A;  3LAN A;  1RT3 A;  2ATQ A;  3LDL A;  2FSN A;  3B6P A;  4W5O A;  4DF8 A;  3JAM O;  5HRN A;  1QSS A;  3T1A A;  1DTQ A;  3SPZ A;  1BWF O;  3SLC A;  3QO9 A;  3DRS A;  5JLH A;  2CH6 A;  1GLJ O;  3NCI A;  1KCF A;  1W0H A;  1I3A A;  2YHY A;  1XMQ K;  5BRF A;  1CZB A;  3L4Q A;  3S3M A;  2DY4 A;  1SAZ A;  3OW2 M;  3KKR A;  3C0B A;  3KIO A;  4CHP A;  3DLB A;  4ID5 A;  2O8C B;  3HO1 A;  1WSF A;  1NJX A;  1KAZ A;  3H1V X;  1NGH A;  2VYP A;  2F96 A;  1HQE A;  1TKZ A;  3O4W A;  3EYZ A;  3DLH A;  4M3U A;  4CER A;  4X64 K;  2P5G A;  3EE8 A;  3CCS N;  3M5R A;  1MU2 A;  5AQW A;  3TTC A;  3MN6 A;  1K9M O;  4CHO A;  2FBY A;  5C12 A;  4K43 A;  4M7X A;  3VTI A;  4U67 L;  2ZM6 K;  2I7P A;  2OTJ N;  3C7N A;  2GTD A;  1XC3 A;  4FWM A;  4V19 S;  1JCE A;  5J2P A;  4KH5 A;  1S6P A;  2Z1H A;  1REV A;  4BWJ A;  3HTV A;  3J7A P;  3HXM A;  4DTS A;  3LAL A;  4WFN L;  3P31 A;  4FJX A;  2QWL A;  3ASM A;  1O13 A;  2R7Y A;  2HHX A;  3U8X A;  3WT0 A;  1SKS A;  4WQ4 C;  3CQX A;  1B92 A;  4Z4C A;  1M1K O;  3O9Q A;  1JKH A;  3M8P A;  4CHN A;  2KKZ A;  2X74 A;  1JLF A;  3NH1 A;  4ELT A;  3CCE N;  1S3X A;  3H45 C;  1ASV A;  2IS3 A;  1H1V A;  2HHT A;  1E4G T;  5AFU A;  2UXD K;  5MLC Q;  4IOC L;  4Z4H A;  5E26 A;  1G99 A;  4LF4 K;  5KPT A;  4DS5 A;  3QNN A;  4E7I A;  4PKI A;  2A40 A;  2HHQ A;  4FJI A;  4C1N I;  3KK3 A;  4KRF A;  4AHS A;  4Y0W A;  4IXC A;  4PWD A;  5KGX A;  4PKH A;  4BRA A;  1IKY A;  1BCO A;  2F7T A;  4CED A;  4OX9 K;  2IVP A;  4DFJ A;  3CHW A;  1WBB A;  3KK7 A;  4RW6 A;  3QEW A;  4I9L A;  4CW7 B;  1BIS A;  4MLE A;  5AQF A;  3OBY A;  2O8B A;  1QQN A;  1W97 L;  1VQM N;  5CY4 A;  2ASM A;  4DQR A;  3OYK A;  5ADX H;  4CZG A;  5LY3 A;  1VSK A;  4IBN A;  2V51 B;  1A5X A;  5AJ3 K;  3AAR A;  4MQ3 A;  4J2E A;  5FRM A;  3VER A;  2HMP A;  3ISN C;  4A2B A;  4WFA L;  3OS1 A;  2GEM A;  4DLG A;  3MCP A;  1IKX A;  4GV9 A;  2E2Q A;  4FLW A;  3IMX A;  5LJV A;  4CBU A;  4EP5 A;  4CJQ A;  1EET A;  4H0O A;  4EFH A;  1TL3 A;  1RDU A;  4AHV A;  1BHL A;  4F3O A;  1V4S A;  3SUQ A;  4KHW A;  1VQN N;  3CCL N;  5AZI B;  3HST B;  3WXK A;  2HF3 A;  4NXM K;  4JS5 A;  2E8A A;  3THW B;  2FC0 A;  4CEB A;  2NZT A;  1V4T A;  1QSY A;  3D6R A;  5AQH A;  4FK2 A;  3FZL A;  2CGL A;  4DV5 K;  1XUP O;  4JAX A;  2ZGZ A;  2UU9 K;  3FR0 A;  4JI0 K;  3U9Z A;  1KAY A;  3QEX A;  4IEI A;  3K5N A;  4YOX A;  4FZZ A;  3TAR A;  1IKV A;  4C23 A;  4YOW A;  4DV6 K;  2G8I A;  1L3T A;  2PY5 A;  5M1O A;  5TKY A;  4H4O A;  3O3G A;  3IUC A;  2ASO A;  3AVG A;  5AQR A;  4Z4E A;  3PV8 A;  2ITM A;  1S1W A;  5FRN A;  4G1Q A;  3RTV A;  4KI4 A;  4M3T A;  3AVA A;  3J7Z O;  3TTD A;  4DTX A;  1NGI A;  3M6G A;  3CM5 A;  1KVA A;  5C10 A;  3NAE A;  3SYZ A;  3DXK A;  1SL2 A;  1I94 K;  3OYA A;  3VMF B;  4E0D A;  3L3V A;  3R8E A;  1J5O A;  5KQD A;  4CF9 A;  3EN9 A;  4NXN K;  3O9T A;  3FZF A;  2YNI A;  4ELV A;  4BE0 A;  1VSM A;  2ZJQ L;  3EZW A;  4FJH A;  1K73 O;  2E1Z A;  1XQS C;  2F8S A;  5AQU A;  2RKI A;  5HRR A;  1Q86 O;  4IJN A;  1C0F A;  1B9D A;  2KTQ A;  3SJH A;  3ZET A;  3L2R A;  3S41 A;  5KQ8 A;  2RE2 A;  3VTH A;  1RT1 A;  1U2V B;  1Z6R A;  3WNG A;  1HKB A;  2D0B A;  1T8E A;  2Q0R A;  4CJL A;  4CJ7 A;  1FKO A;  4BRO A;  1WBD A;  4KRE A;  2G8W A;  4DU4 A;  3LDN A;  4H5T A;  5KRS A;  3TAB A;  3ZT4 A;  4DS4 A;  4O44 A;  3MEE A;  1GOB A;  1LW2 A;  1JXB A;  5C0Y A;  4O0J A;  1U49 A;  4HCC A;  4M3Z A;  4QOZ B;  5E84 A;  4NYF A;  1CZA N;  3WEE A;  1UOC A;  2OAN A;  1VK0 A;  3AA4 A;  5IT9 O;  5DK5 A;  4CZL A;  4W5Q A;  4GKJ K;  2KW4 A;  5HLF A;  4UQG A;  3MCA B;  4BRG A;  2P9S A;  3HBT A;  3QML A;  1NGF A;  2NRX A;  1SL0 A;  3O5B A;  5HRP A;  5CZ1 A;  3J81 O;  4CEO A;  4OJR A;  3LPU A;  1GOA A;  4EZ9 A;  4N47 A;  1EQY A;  4CF2 A;  3ID6 A;  2HHS A;  4PY5 A;  1RT7 A;  3AAQ A;  4PUO A;  1T3V A;  3VQC A;  5AQL A;  3HPG A;  2B4J A;  3F9M A;  1NNE A;  2I7N A;  2DFH A;  4BC5 A;  4BRP A;  3D2E B;  4FLZ A;  2V7Z A;  1ZBS A;  1OH5 A;  4A59 A;  3MAQ A;  4FWP A;  1S1V A;  3IAY A;  4GV3 A;  4B1V A;  3CQY A;  4H0P A;  3VQE A;  3AO5 A;  4CEF A;  1ZXO A;  3KLE A;  3H1Q A;  3H3O B;  1NK9 A;  4DTU A;  4H5V A;  4JI1 K;  1FJG K;  2ZWH A;  5GAE P;  4J2D A;  4C8K A;  3SAH A;  4BRM A;  3KD5 E;  4HUE A;  4MFB A;  1NGG A;  4BGB A;  1C1B A;  3F2K A;  4FJM A;  2X6S A;  3KD1 E;  3AVH A;  3TU5 A;  4J8F A;  5LMN K;  4FWR A;  3SV3 A;  3OYM A;  3ATV A;  4N56 A;  4B9M A;  4RW9 A;  4ILH A;  3QER A;  2O8E B;  2ASP A;  4H5R A;  5TKW A;  4JLH A;  5AQV A;  3ULE A;  2G8H A;  3P83 D;  3ZX0 A;  4NLC A;  3OJS A;  2DFE A;  3ZT2 A;  1ZBH A;  4CD3 A;  2BH1 A;  4BE2 A;  4B9T A;  4CVN E;  4FM2 A;  4YOT A;  1W7A A;  1RFQ A;  4JI6 K;  4B1Z A;  3O9U A;  1D8Y A;  2HVH A;  1NWK A;  2Q2R A;  2LSN A;  3C6T A;  4E7J A;  4A2A A;  3K9K A;  3PUF A;  4KTZ A;  3VQ4 A;  2W6L A;  5JLF A;  5AQT A;  5E41 A;  1RNH A;  1BIZ A;  4M3Y A;  3U4L A;  1T7P A;  1RGI A;  2PYJ A;  2A41 A;  3V1R A;  3R3L A;  2ETJ A;  1ILY A;  3VGL A;  1NJY A;  1TKD A;  2O8F A;  1HMV A;  4WE1 A;  2B6A A;  4IFE A;  1IJJ A;  1BUP A;  3SZ2 A;  5CYQ A;  3I33 A;  3U3Y A;  1RBS A;  4JHD B;  4FJ8 A;  3BDP A;  1KC8 O;  4RW7 A;  3NVK A;  2VWK A;  4O8K A;  4OKJ A;  4DG1 A;  2XHB A;  3F73 A;  2OA8 A;  4F2R A;  3LPT A;  4O5F A;  5K14 A;  3KLG A;  4WQ5 A;  3A5N C;  4E89 A;  3MXI A;  3HOS A;  3E9P A;  4HVJ A;  4ZTF A;  4CJP A;  4LH5 A;  4CBX A;  3B6O A;  4XH5 A;  4DV7 K;  2BGG A;  3QIO A;  3TTF A;  4JS4 A;  4BR2 A;  3RVC A;  4KAZ A;  3LDQ A;  2HND A;  3SMP A;  1I39 A;  4JD2 B;  4LH4 A;  2GWK A;  4XH1 A;  1C0U A;  2QWM A;  1C0G A;  1LWE A;  2V52 B;  3DAW A;  4DWI A;  3NDK A;  3VQ6 A;  3VF4 A;  1GLF O;  3RSE B;  3OYB A;  3KLI A;  2J4R A;  4RCH A;  3DOK A;  3PIO L;  1RIL A;  4OPH A;  1TGO A;  4B8C A;  1WSE A;  2WBN A;  2NRT A;  2XY7 A;  1KSP A;  4Z4F A;  5IWA K;  2D0C A;  1XHX A;  4CFB A;  4DSJ A;  3O4N A;  2JGU A;  1OVY A;  1DEJ A;  4DV1 K;  3I8B A;  4IKF A;  3U3G A;  4IJA A;  2FXU A;  4FCY A;  3WXL A;  3ZSZ A;  3BF3 A;  2WUS A;  1RTD A;  3QLH A;  3OBW A;  2A1S A;  3VQ7 A;  1N34 K;  1X1P A;  2NRH A;  3ZSW A;  4JRP A;  4DV3 K;  3V9S A;  3HPO A;  3M8Q A;  3RRG A;  4NYN A;  5FPD A;  2KZM A;  1N6Q A;  3T19 A;  2KHO A;  2G8U A;  4H0Y B;  3CD6 N;  2YKM A;  3C95 A;  5CZ2 A;  3QEP A;  3AO4 A;  3V1O A;  4M63 C;  1YIT N;  1RTH A;  3QIC A;  3ENH A;  1QTM A;  4CJ4 A;  3ZEU A;  2AJQ A;  2E2N A;  3A5O C;  3IDH A;  4OO1 J;  3EKS A;  2B5J A;  2E1Y A;  2P9P A;  3SBT A;  2HB5 A;  2GWJ A;  5KGW A;  4TSX A;  3IG1 A;  4I6M B;  4JKG A;  4BRL A;  3L8B A;  3DYA A;  3VQB A;  4B3M K;  1HNI A;  4AHR A;  3LM2 A;  3SQ0 A;  1VQ7 N;  1J6Z A;  1ASW A;  4DQS A;  2HBJ A;  3EY1 A;  1WNS A;  4A57 A;  4AIL C;  3U9D A;  3CJC A;  4FJG A;  1BI4 A;  4BDZ A;  4NCA A;  1X9W A;  1DGK N;  2HNZ A;  3MMV A;  4DMN A;  3TPQ A;  4Z4G A;  4KH6 A;  1ZYQ A;  3EEQ A;  4QS8 A;  3QEI A;  2XY6 A;  4LF5 K;  3DLR A;  3OYG A;  4FJJ A;  5AZJ A;  5EXW A;  5AQZ A;  2KLA A;  4JKE A;  3NHG A;  4CJF A;  1YF5 L;  3CER A;  4CEC A;  4DR2 K;  4FK4 A;  1C6V A;  4BGA A;  5B8H A;  2F9W A;  5I9E B;  1SS6 A;  2FBT A;  4FJN A;  3HVT A;  2D4W A;  1QS4 A;  4H03 B;  4DKW A;  4BRQ A;  3ITH A;  3M3Z A;  2E2P A;  3CJB A;  4F9O A;  2NRZ A;  5CR4 A;  5FPM A;  3SUP A;  3FGU A;  3C6A A;  5DMR A;  4KKO A;  2X78 A;  3SQ2 A;  4JNE A;  2G8K A;  3MN5 A;  3DRP A;  1RT4 A;  1WN7 A;  1YI2 N;  2BAN A;  1BIU A;  4F8R A;  4HUG A;  3E1Y A;  2P9I A;  3TAF A;  1N32 K;  1YJN N;  3FLC O;  1CXU A;  5ELZ A;  4BY9 C;  1JLA A;  5C2D A;  2D5R A;  3ZSR A;  1UA0 A;  2FF3 B;  2UUA K;  3QFU A;  1NG9 A;  4EP4 A;  3OVN A;  3K0S A;  3NMU A;  4CEA A;  1S1U A;  1ATR A;  3J80 O;  3ZSO A;  3TWH A;  1BO5 O;  4BC3 A;  5AFU H;  1VSD A;  1MDU B;  2P5O A;  4WQ5 C;  3MWT A;  4DCH A;  5AQM A;  4YHH K;  1NJI O;  2IC3 A;  3VQQ A;  1XC9 A;  5AQJ A;  2XRI A;  4BR9 A;  4FOE A;  1VQ6 N;  1JCG A;  1KLM A;  1TVR A;  1R0A A;  1HYS A;  1XNR K;  5FPE A;  3QET A;  3OYH A;  2QM1 A;  3MXJ A;  2HOE A;  1W2B M;  3LP2 A;  4FLV A;  4DHY A;  3THY A;  1Q9Y A;  4EHT A;  4CK3 A;  3MEG A;  2UYT A;  3GG4 A;  3LWL A;  3C7N B;  1VQO N;  3KHY A;  2VG5 A;  3LP1 A;  4LC9 B;  2XO7 A;  1BU6 O;  1YVN A;  2E6L A;  4JI4 K;  1ATS A;  2Q31 A;  1NK0 A;  1JL2 A;  1JL1 A;  3CJ1 A;  3BZC A;  2HHH K;  2AP1 A;  3K58 A;  3KKS A;  1E3M A;  1GLB G;  1KVB A;  5AQK A;  4FLT A;  3AO2 A;  3AVL A;  4JKF A;  2QWP A;  3QBX A;  2OYQ A;  3VQP A;  4ID1 A;  1GLA G;  4WYB A;  5KPR A;  4OLB A;  3EE9 A;  5LJW A;  3NH0 A;  5EOY A;  4CZH A;  5J1E A;  1L3S A;  3EKU A;  3ZSQ A;  4UY8 O;  1NK7 A;  3VQD A;  1DTT A;  2VG6 A;  4MDA A;  3OJU A;  4JV5 K;  4G9Z A;  5J2N A;  3P1G A;  4DUZ K;  3QNO A;  4BWM A;  1HYZ A;  4N41 A;  1VSI A;  3AVI A;  4BR5 A;  2HBM A;  4LF7 K;  4E7H A;  1KFD A;  4CZJ A;  1T05 A;  3D45 A;  2OPP A;  3CFR A;  4H5W A;  1RDB A;  3PX0 A;  4JI3 K;  4JKB A;  3PY8 A;  1FW6 A;  4KH4 A;  3JXU A;  1TUU A;  4HWI A;  3FFI A;  1RCH A;  3E66 A;  1EWQ A;  3DOL A;  1VAZ A;  2EX3 A;  3I55 N;  4FLU A;  4QCL A;  2PAV A;  1SKR A;  3HYF A;  3QIN A;  2A6A A;  5AQG A;  3TAE A;  4JI5 K;  3OYD A;  4NLB A;  3V1Q A;  3TAP A;  2O8B B;  3Q7C A;  4BDY A;  1SKW A;  4B3O A;  2P9N A;  3ZLJ A;  4CF0 A;  3T69 A;  5M1P A;  2QA4 N;  1Q18 A;  2W40 A;  4IDK A;  1BA0 A;  3VGM A;  3LDS A;  1MWM A;  2I5J A;  3D7E O;  2Q36 A;  4FLX A;  3G6E N;  3RMB A;  3FE1 A;  3G71 N;  1EO1 A;  2G8F A;  4YNQ A;  4FLY A;  1A5W A;  3CC2 N;  2HMI A;  3VQ9 A;  5AQX A;  4I2P A;  2FF6 A;  3IFR A;  4CGJ A;  3BEX A;  3E9L A;  1EX4 A;  1LW0 A;  3VES A;  3A5L C;  3JSM A;  2RHK A;  1Z25 A;  4CHY A;  3U6F A;  4O55 A;  1ATN A;  3K9J A;  3AVK A;  4FWK A;  4C8O A;  2IDO A;  1X3N A;  4M45 A;  4JKA A;  3HL8 A;  4IDH A;  4IOX A;  3DXM A;  2E6M A;  4RW4 A;  3SAG A;  1TYQ A;  1GLL O;  4CFD A;  1C0T A;  2GBZ A;  2BTF A;  3C6U A;  3HM8 A;  1XMO K;  1C1A A;  4YFU A;  3CFO A;  2IOC A;  1CZ9 A;  3ZT1 A;  4OPJ A;  4FWQ A;  4BRD A;  1IH7 A;  3C6H A;  3DXK B;  1RTJ A;  5I3U A;  3CIP A;  3CET A;  1QZ5 A;  5C42 A;  4O0I A;  3PSF A;  4CJV A;  1LAW A;  2CGK A;  3THX A;  3CME N;  2A1R A;  4FJK A;  1FKP A;  4U7B A;  1K8K A;  1HNW K;  5C15 A;  1ZBF A;  5CE3 A;  3S3N A;  2NNW A;  4ILJ A;  3H46 O;  1NKE A;  3ZET B;  2G8V A;  4CZM A;  3D2F A;  2Y1I A;  2O4G A;  4O4G A;  1DKG D;  1RDW X;  1WLJ A;  1VHX A;  3OYN A;  1WOQ A;  4GY2 B;  4H5N A;  1XI1 A;  1WSI A;  4ELU A;  5JVG L;  1RT6 A;  4JK9 A;  4JEP A;  4JK8 A;  3P39 A;  4CJ5 A;  1MWK A;  3AA3 A;  4BC2 A;  1QVG M;  5JS2 A;  1TK8 A;  2V7Y A;  2EHG A;  3VQA A;  2FSJ A;  4FJ9 A;  3F5T A;  1XNQ K;  1D4X A;  4DU1 A;  3K5L A;  2HVI A;  3WEE B;  1UAX A;  5BPM A;  1GOC A;  3T1H K;  2P1J A;  5AQY A;  4DSK A;  4KB0 A;  2W41 A;  3SUO A;  4KHU A;  4KO0 A;  1C1C A;  1LOT B;  4FSV A;  3LDO A;  5BPN A;  4K41 A;  3L6Q A;  2P9S B;  4OKK A;  3BF1 A;  4FWS A;  2HBK A;  2Y1J A;  3GL1 A;  2PYL A;  2FSK A;  3PSI A;  3HJF A;  2ZQB A;  1VQP N;  1TK0 A;  3VQ5 A;  3VGK A;  2QWQ A;  4YOR A;  3UKR A;  2YHW A;  3SMS A;  4H0X B;  4PL7 A;  4JI2 K;  3SQ1 A;  4E1J A;  1Q81 O;  4BRK A;  1ZBU A;  1LWF A;  1QE1 A;  3CYM A;  3OYJ A;  1ITG A;  3HRG A;  4GV6 A;  3NGI A;  4CI6 A;  4RWT A;  4A5B A;  1KFS A;  4BR0 A;  1KAX A;  4ZTJ A;  4K8X A;  1YAG A;  3AO3 A;  4CZI A;  3ZSV A;  2YNF A;  1KD1 O;  4DQ8 A;  3BY5 A;  4NCB A;  4BQZ A;  4B3T K;  3L0Q A;  5T7B A;  1NJW A;  1M90 O;  2NLX A;  5BN8 A;  1NK6 A;  2QWN A;  3G4S N;  2FBX A;  4IG0 A;  2QK9 A;  4CJR A;  2NRV A;  2A5X A;  3V6D A;  1BDG A;  3KWG A;  4GVE A;  3ULE B;  3V9Z A;  5HOO A;  4FWO A;  3CCM N;  3UIQ A;  2UUC K;  4BRN A;  3KK1 A;  4DV0 K;  4LF9 K;  3TAN A;  1VSL A;  3CXC M;  5JIC A;  3FZH A;  3M8S A;  1HLU A;  5CHI A;  3SBG A;  3RMC A;  3BGR A;  1J54 A;  4DQI A;  4C8L A;  4XH4 A;  3UB5 A;  4FJL A;  1P90 A;  1GLC G;  3TI0 A;  1IV0 A;  5AQO A;  4K8Z A;  3SCX A;  3HSC A;  3P5J A;  1NLV A;  3CG7 A;  1NKC A;  1ZC6 A;  1B9F A;  4AM6 A;  2O8F B;  4FO0 A;  3W0L A;  1K6Y A;  2ITG A;  1YXQ A;  2GUI A;  4DSF A;  1KQS M;  5HP1 A;  4ZHR A;  4ISF A;  5H1S Q;  1XHZ A;  4KFB A;  3K5M A;  3A8Y A;  1IKW A;  3O9R A;  4IO9 L;  4FM0 A;  3NF7 A;  4FZX C;  3DMJ A;  4M3R A;  1G15 A;  5CYM A;  1BL3 A;  1VSE A;  2VQF K;  1UWB A;  2QXL A;  3H6E A;  4QS7 A;  4KHN A;  2P9K A;  2DPN A;  1S22 A;  1K8A O;  3CCU N;  3WQU A;  3DLE A;  4DTM A;  5C24 A;  2P51 A;  2Z1J A;  1TKT A;  1HQU A;  2WFB A;  5M1Q A;  3V9U A;  4M3W A;  1WSG A;  1OKJ A;  2P9U A;  1YVU A;  1Q7Y O;  4FXD A;  3JS6 A;  3NFA A;  3UE5 A;  4X65 K;  1KRP A;  1YTU A;  4DR4 K;  1VQ8 N;  3WNH A;  2NUB A;  3LL3 A;  1OH8 A;  3VEO A;  1BCM A;  3MN9 A;  3EZ5 A;  3A2F A;  1ZBI A;  5EX5 A;  3O1B A;  3CJ7 A;  3O3H A;  1NK4 A;  3PO5 A;  2VWB A;  3DLG A;  1OH6 A;  4B9N A;  3HM9 A;  4KTW A;  3S9H A;  4JK7 A;  4JYA K;  4WQ4 A;  3MDQ A;  3GDQ A;  4K42 A;  4BG8 A;  1WAJ A;  3L2V A;  5KTQ A;  5GIP A;  2WTU A;  4EHU A;  2P9L A;  4B1X B;  3M1F A;  4LY7 A;  1JLE A;  3VEZ A;  3CCV N;  4YOU A;  3NF6 A;  3G0Z A;  4WF9 L;  5HL7 L;  1WUA A;  2O4I A;  3MXM A;  4M3X A;  5HRS A;  2HW3 A;  3VEN A;  1IG8 A;  1HJO A;  4E7L A;  3O9S A;  1YHQ N;  2F9T A;  4KHP K;  2YKN A;  4CIF A;  2BUP A;  1NM1 A;  1Y97 A;  4WFB L;  4JN4 A;  5SWM A;  4PL8 A;  4AHT A;  3V4I A;  3ZEU B;  3F9K A;  1HKG A;  1ASU A;  2P9P B;  3UKU A;  3AAP A;  3R6M A;  2WC9 A;  4KB1 A;  4PQU A;  3SI6 A;  3QIP A;  4JKG B;  4CD1 A;  1QZ6 A;  3PIP L;  3VF2 A;  4BAC A;  1NOZ A;  4DSE A;  3B8A X;  1SQK A;  1HRH A;  4FW1 A;  1SL1 A;  4MO4 A;  2YCH A;  4ISE A;  4BVP A;  3W3D A;  2O8D A;  4FOI A;  2E20 A;  3LAK A;  2Q3S A;  1BI4 B;  4DLE A;  5J2M A;  1S9E A;  3HK2 A;  2CGJ A;  3TAQ A;  1YJW N;  3NF9 A;  4GKK K;  3O3F A;  3OYI A;  1JJ2 M;  3QFP A;  4O5B A;  2IAJ A;  1VQ9 N;  3AVJ A;  5AZJ B;  5J2Q A;  4AHC A;  3WXM B;  2YHX A;  2Z1G A;  4EIA A;  2D0O A;  3ZCM A;  2A3Z A;  4N5S A;  2QKB A;  1VQ4 N;  1S5J A;  5HBM A;  4K0K K;  3V9X A;  1KXP A;  4DFK A;  2QWO A;  2YV0 X;  5EY4 A;  3O80 A;  5C2F A;  1T44 A;  1BG3 A;  1Q82 O;  1RBR A;  2IVO A;  1TKX A;  1VSF A;  4KHY A;  2NRW A;  4B8A B;  2GV9 A;  1J53 A;  4FJ7 A;  4OGC A;  3AVN A;  4IWV A;  3ZT0 A;  3QES A;  3MN7 A;  4J2A A;  1QVF M;  4L8R B;  3DRR A;  2P9I B;  3K59 A;  3OYF A;  4J2B A;  2O8C A;  4IZ9 A;  2CH5 A;  3VEW A;  4LSL A;  2D0A A;  1F21 A;  3FFK B;  5KRT A;  4DR3 K;  3LP3 A;  3CC7 N;  3MWP A;  1Y64 A;  3HVR A;  1JLQ A;  1OVQ A;  4E3S A;  3EL2 A;  4FL9 A;  4Z4I A;  1RDC A;  4QAG A;  3CQ8 A;  4CEQ A;  4EAH D;  3VPZ A;  3CFP A;  5JS1 A;  1NOY A;  2HHW A;  3OTO K;  4DFM A;  2FBV A;  5M1F A;  3AGR A;  3NH2 A;  4A61 A;  2KFZ A;  3O08 A;  4FVM A;  4ILG B;  4IG3 A;  1SUQ A;  3TSQ A;  3TAG A;  3WUH A;  4CK2 A;  2OZM A;  2VGN A;  3OHR A;  4Z94 A;  3L4I A;  2A42 A;  1HUX A;  4H0V B;  4HTL A;  3THY B;  3S3O A;  2F8T A;  3AVB A;  1DT9 A;  2F4V K;  3NE6 A;  4C8M A;  3LP0 A;  2ZJP L;  2W6K A;  3LDP A;  1D9D A;  2HNY A;  3K2P A;  4JKD A;  1MA9 B;  2UXB K;  3HZ6 A;  4B9Q A;  4KHS A;  3WXJ A;  4X66 K;  3G10 A;  4FWL A;  3AA5 X;  1NGE A;  1NK8 A;  3CC4 N;  1RBV A;  1YT3 A;  3CMA N;  4W5T A;  4JKH A;  1Q9X A;  5KI6 A;  3RR8 A;  3KLF A;  2YJF A;  3DLK A;  1KLN A;  1NBW A;  2HBL A;  3ZSY A;  1YJ9 N;  1YTA A;  4CBW A;  2HHU A;  4PHT X;  1L5U A;  3ZT3 A;  2OPQ A;  2QXF A;  1HNX K;  1VSJ A;  4FK0 A;  2FLO A;  5D3G A;  1HNV A;  4CGG A;  3DLL L;  2XY5 A;  2IVN A;  3I0R A;  4CHZ A;  3E01 A;  2YJE A;  1TL1 A;  4CCH A;  1JCF A;  4E7K A;  1TK5 A;  4OKE A;  4BQL A;  3EO3 A;  1VQL N;  4HCB A;  4FM1 A;  4BVO A;  3O4Q A;  4CGH A;  2OPS A;  3O6W A;  4H4M A;  3O1W A;  4AH9 A;  5BN9 A;  1RDA A;  3KTQ A;  1RDD A;  2YNG A;  4WCE L;  4NB4 A;  1E4F T;  1X9S A;  1N33 K;  3T1Y K;  2ZE2 A;  3VA0 A;  1JXE A;  3ZX2 A;  1HPM A;  1HYV A;  5BRH A;  1VQ5 N;  1HPZ A;  3NVM A;  4L3Q A;  1QQM A;  5AZI A;  2HF4 A;  1J9A A;  4CZK A;  3ZX3 A;  4F3T A;  3DI6 A;  3THW A;  3HP6 A;  2P9N B;  4DR7 K;  4OPA A;  4BRI A;  1RT5 A;  1XWL A;  4B1U B;  2X6N A;  3RWU A;  3PX6 A;  3ZSX A;  2YX6 A;  1D9F A;  3BUZ B;  3A5M C;  1L3U A;  3LM9 A;  3AVM A;  1O1W A;  3LAM A;  4GNI A;  1EWR A;  1NU0 A;  5EVZ A;  1NGC A;  5FDL A;  2W42 A;  4I7F A;  1CXQ A;  3PO4 A;  3ATU A;  1QQC A;  3A0I X;  5HRO A;  3V81 A;  1N5Y A;  3OS0 A;  4MLH A;  1U47 A;  5GIN A;  1T03 A;  1QHA A;  4BG9 A;  3QEV A;  1U45 A;  4JRQ A;  4B9S A;  1N8R O;  3SNN A;  4E19 A;  1LV5 A;  4B1W B;  3DJC A;  4LFA K;  3OY9 A;  1VRU A;  3RMD A;  4CGF A;  4IFV A;  3I56 N;  4OVL A;  4DTR A;  5FLX O;  5ADX A;  1UA1 A;  4XEI A;  3DXM B;  3SUN A;  3V9W A;  3C65 A;  5JMV A;  2KZZ A;  5BRD A;  1T6D A;  3GBT A;  1TYQ B;  5AQS A;  2DFF A;  3SV4 A;  1IO2 A;  3C94 A;  2E88 A;  3MED A;  4XIU A;  2ZD1 A;  2ZJR L;  1X9M A;  3MK6 A;  4YOY A;  1X3M A;  3OYE A;  1U2V A;  2XY8 A;  1KVC A;  1BGX T;  2YNH A;  3AO1 A;  3FZM A;  2YHB A;  1NGB A;  2QWR A;  3E9O A;  4B3S K;  4B9V A;  3P38 A;  3THX B;  3KZB A;  4CF8 A;  1K8K B;  4W5N A;  2GX9 A;  3O8M A;  2HST A;  4C8N A;  2OTL N;  5BR9 A;  4B9U A;  3CJ9 A;  3RR7 A;  1TUY A;  1C0M A;  4BR4 A;  5SZT A;  5GAH P;  2EWS A;  4JI8 K;  5AR0 A;  4FWN A;  4NO7 A;  1BQM A;  3CJA A;  4BRE A;  1ZBL A;  5AQQ A;  3SAF A;  3D2F B;  4E1N A;  1RBT A;  4CEE A;  1TAQ A;  3BP8 A;  5I42 A;  4AHU A;  1LAV A;  3L3U A;  4DU3 A;  2PFU A;  2E4L A;  4I2Q A;  4CES A;  4M7Y A;  3SPY A;  5C25 A;  3THV A;  4HHT A;  3KJV A;  1S9G A;  4CGI A;  4X62 K;  3D2E A; 
#chains in the Genus database with same CATH homology
 4MQ3 A;  1BIU A;  4F8R A;  1BCM A;  4HUG A;  4HUF A;  4J2E A;  3EZ5 A;  3A2F A;  5FRM A;  1ZBI A;  4FW2 A;  4CJS A;  3TAF A;  1FK9 A;  4B9L A;  2RPI A;  1CXU A;  3ISN C;  3O3H A;  1NK4 A;  3PO5 A;  4Z0U A;  3DLG A;  1JLA A;  3OS1 A;  2D5R A;  4DLG A;  4B9N A;  3HM9 A;  4KTW A;  3ZSR A;  1UA0 A;  1IKX A;  4FLW A;  3S9H A;  4EP4 A;  4EP5 A;  3OVN A;  1EET A;  1U04 A;  4CEA A;  4CJQ A;  1S1U A;  1WSH A;  3ZSO A;  1JLB A;  1TL3 A;  4AHV A;  4OPK A;  1BHL A;  4F3O A;  3TWH A;  3SUQ A;  4KHW A;  4FYD A;  1WAJ A;  3HST B;  1VSD A;  3L2V A;  1NK5 A;  5KTQ A;  1U48 A;  4CE9 A;  4JS5 A;  2P5O A;  3HT3 A;  2FC0 A;  4LY7 A;  4CEB A;  1JLE A;  1QSY A;  4DSL A;  3WNF A;  3ULD A;  4FK2 A;  2IC3 A;  3VQQ A;  1XC9 A;  1NJZ A;  3NF6 A;  2XRI A;  3G0Z A;  3QEX A;  2O4I A;  4KHQ A;  3H08 A;  4ICL A;  3K5N A;  3MXM A;  4M3X A;  1KLM A;  5HRS A;  2HW3 A;  4FZZ A;  1TVR A;  1R0A A;  3TAR A;  1IKV A;  1HYS A;  1VSH A;  3RMA A;  4Q0B A;  3QET A;  2G8I A;  1L3T A;  4E7L A;  2PY5 A;  3OYH A;  3MXJ A;  4H4O A;  3LP2 A;  4FLV A;  3O3G A;  3LWM A;  4DFP A;  1NKB A;  3HP9 A;  3AVG A;  3SJJ A;  4Z4E A;  1Q9Y A;  4CK3 A;  2YKN A;  4CIF A;  3PV8 A;  1IG9 A;  1S1W A;  3NE6 A;  3MEG A;  5FRN A;  4G1Q A;  3RTV A;  1Y97 A;  4KI6 A;  3HPH A;  4KI4 A;  4M3T A;  3LWL A;  3AVA A;  5SWM A;  4DSI A;  4AHT A;  1KFS A;  3V4I A;  4DTX A;  2VG5 A;  3CM5 A;  3F9K A;  3LP1 A;  2XO7 A;  1KVA A;  4Q5V A;  3NAE A;  3SYZ A;  1ASU A;  1U4B A;  1SL2 A;  2E6L A;  3OYA A;  3LZJ A;  4E0D A;  4CK1 A;  2PZS A;  1S6Q A;  1VRT A;  3L3V A;  4KB1 A;  3MEC A;  3KK2 A;  4PQU A;  3SI6 A;  1NK0 A;  1J5O A;  1JL2 A;  3QIP A;  4CJ3 A;  4CF9 A;  1JL1 A;  2OZS A;  4CHQ A;  4BAC A;  1NOZ A;  2YNI A;  4DSE A;  3K58 A;  4GMJ B;  4BE0 A;  4ELV A;  3KKS A;  1VSM A;  4FJ5 A;  3TR8 A;  4CJW A;  1KVB A;  4FJH A;  1HRH A;  4FW1 A;  4FLT A;  4Y1C A;  1A5V A;  3AO2 A;  3AVL A;  3RRH A;  1SL1 A;  1QSL A;  2F8S A;  2OYQ A;  2RKI A;  3VQP A;  4ID1 A;  5HRR A;  3L2Q A;  4OLB A;  2KQ2 A;  3NH0 A;  4I9Q A;  5J1E A;  3LAK A;  1L3S A;  1B9D A;  2Q3S A;  4KPY A;  2KTQ A;  1BI4 B;  2WON A;  3ZSQ A;  3L2R A;  4B08 A;  1NK7 A;  3VQD A;  4IFY A;  1DTT A;  3I8D A;  4DLE A;  1RT1 A;  2VG6 A;  3OJU A;  3WNG A;  5J2M A;  1S9E A;  2D0B A;  4W5R A;  5J2N A;  1T8E A;  3HK2 A;  3P1G A;  4M41 A;  1BQN A;  4CJL A;  3QNO A;  4BWM A;  3TAQ A;  3NF9 A;  1HYZ A;  1FKO A;  3NBP A;  2BDP A;  1VSI A;  3O3F A;  3OYI A;  2G8W A;  4N41 A;  4KRE A;  3AVI A;  3AV9 A;  4DU4 A;  4O5B A;  4KV8 A;  2IAJ A;  5KRS A;  4KTQ A;  4DQQ A;  4FZY A;  4E7H A;  1KFD A;  4DTJ A;  3TAB A;  3ZT4 A;  4DS4 A;  3AVJ A;  1T05 A;  3D45 A;  2OPP A;  5J2Q A;  4O44 A;  2BE2 A;  1GOB A;  1LW2 A;  3MEE A;  1JXB A;  3CFR A;  4AHC A;  4LD0 A;  1RDB A;  4O0J A;  1U49 A;  4HCC A;  4CFC A;  3PX0 A;  4M3Z A;  4CIE A;  2KFN A;  2Z1G A;  4QOZ B;  4NYF A;  3ZCM A;  3PY8 A;  4N5S A;  2QKB A;  1UOC A;  1VK0 A;  3AA4 A;  1S5J A;  5HBM A;  3V9X A;  5DK5 A;  2DTU A;  4OGE A;  4W5Q A;  4DFK A;  2KW4 A;  3TAM A;  5HLF A;  4UQG A;  1SV5 A;  3AVF A;  2YV0 X;  1LWC A;  1RCH A;  3FFI A;  3I0S A;  1SL0 A;  3DOL A;  5HRP A;  2EX3 A;  1EP4 A;  4GW6 A;  5CZ1 A;  4CEO A;  4CJU A;  4FLU A;  4QCL A;  1RBR A;  1SKR A;  4OJR A;  3LPU A;  3HYF A;  1GOA A;  3QIN A;  4EZ9 A;  1CLQ A;  1TKX A;  3TAE A;  1VSF A;  3OYD A;  4KHY A;  3V1Q A;  3D0P A;  4N47 A;  3TAP A;  4B8A B;  4CF2 A;  1Q8I A;  2GV9 A;  1J53 A;  4BDY A;  2HHS A;  3AA2 A;  4PY5 A;  1RT7 A;  4CGD A;  4FJ7 A;  4OGC A;  4PUO A;  3VQC A;  3AVN A;  3HPG A;  3ZT0 A;  2B4J A;  1SKW A;  4B3O A;  3QES A;  2QKK A;  1WSJ A;  2DFH A;  4FLZ A;  4J2A A;  1RBU A;  5EU7 A;  4PA1 A;  4H8K A;  3MAQ A;  4DTO A;  4CF0 A;  4L8R B;  3DRR A;  4E1M A;  1S1V A;  3IAY A;  3K59 A;  4OLA A;  3OYF A;  4J2B A;  4CJE A;  4IDK A;  3LDS A;  3AO5 A;  3VQE A;  4CEF A;  2I5J A;  4DTP A;  1EKE A;  3ALY A;  3KLE A;  4FLX A;  3RMB A;  4LSL A;  2D0A A;  3WNE A;  1F21 A;  4DTU A;  1NK9 A;  4N76 A;  5KRT A;  4J2D A;  3LP3 A;  1S1X A;  2G8F A;  4C8K A;  4YNQ A;  3VA3 A;  4FLY A;  1A5W A;  3KD5 E;  1RT2 A;  4HUE A;  3K57 A;  4MFB A;  2HMI A;  1DLO A;  3VQ9 A;  4NCG A;  3HVR A;  4I2P A;  3VN5 A;  1C1B A;  2VWJ A;  1JLQ A;  4CGJ A;  4E3S A;  2X6S A;  4FJM A;  3KD1 E;  1EX4 A;  1LW0 A;  3AVH A;  4CEZ A;  4BE1 A;  4Z4I A;  3JSM A;  3OYM A;  4CJT A;  3SV3 A;  4N56 A;  1Z25 A;  1RDC A;  4CHY A;  4QAG A;  3CQ8 A;  4O55 A;  4CEQ A;  4RW9 A;  3QER A;  3OYL A;  3AVK A;  3CFP A;  4B9M A;  5JS1 A;  3OYC A;  1NOY A;  2HHW A;  3OS2 A;  4C8O A;  4EZ6 A;  4DFM A;  2IDO A;  2FBV A;  4JLH A;  4M45 A;  3NH2 A;  4CFA A;  1WAF A;  2KFZ A;  2G8H A;  2IGI A;  3P83 D;  4FVM A;  3LZI A;  4IG3 A;  3OJS A;  4DTN A;  4F2S A;  1SUQ A;  3TAG A;  3HL8 A;  2OPR A;  2DFE A;  1W9H A;  3ZT2 A;  4CK2 A;  1ZBH A;  2HHV A;  2OZM A;  4BE2 A;  2E6M A;  3NGY A;  4B9T A;  4FM2 A;  4RW4 A;  1D8Y A;  4CFD A;  2HVH A;  4DF4 A;  3S3O A;  1C0T A;  2F8T A;  2GBZ A;  2LSN A;  3AVB A;  3C6T A;  3C6U A;  4E7J A;  3PX4 A;  1FXX A;  3PUF A;  4KTZ A;  3VQ4 A;  1C1A A;  4YFU A;  5E41 A;  1RNH A;  1D5A A;  1EXQ A;  2IOC A;  2JLE A;  3CFO A;  1BIZ A;  1CZ9 A;  3LP0 A;  4C8M A;  3ZT1 A;  4OPJ A;  4M3Y A;  1T7P A;  2PYJ A;  3V1R A;  1IH7 A;  3K5O A;  4CF1 A;  1D9D A;  2ETJ A;  4Y1D A;  1RTJ A;  2HNY A;  3K2P A;  1NJY A;  5I3U A;  1TKD A;  3M8R A;  4F4K A;  1HMV A;  4WE1 A;  5C42 A;  4RG8 A;  4O0I A;  4KHS A;  3G10 A;  3AA5 X;  2B6A A;  4CJV A;  1NK8 A;  1RBV A;  1YT3 A;  3T3F A;  1LAW A;  4W5T A;  1Q9X A;  3SZ2 A;  5CYQ A;  5KI6 A;  2A1R A;  4FJK A;  3RR8 A;  2RN2 A;  1FKP A;  1QHT A;  3U3Y A;  1RBS A;  3KLF A;  4FJ8 A;  3BDP A;  4RW7 A;  3DLK A;  1KLN A;  1Z26 A;  3DM2 A;  2VWK A;  4CJK A;  3ZSY A;  1ZBF A;  4OKJ A;  1TV6 A;  4DG1 A;  2VG7 A;  2XHB A;  3SQ4 A;  3F73 A;  3S3N A;  2OA8 A;  4F2R A;  3LPT A;  5K14 A;  3KLG A;  1YTA A;  1NKE A;  4E89 A;  4LSN A;  3MXI A;  1L5U A;  3ZT3 A;  2G8V A;  2HHU A;  2YHA A;  4HVJ A;  1HJR A;  2OPQ A;  2QXF A;  4ZTF A;  1VSJ A;  4FK0 A;  3KLH A;  4GVM A;  2O4G A;  4CJP A;  4LH5 A;  4O4G A;  4RW8 A;  2Y1I A;  5D3G A;  1HNV A;  4HTU A;  4BDP A;  1WLJ A;  4CGG A;  3OYN A;  1S1T A;  2XY5 A;  3B6O A;  1XI1 A;  2BGG A;  3JYT A;  1WSI A;  1TAU A;  3I0R A;  3QIO A;  4CHZ A;  3NF8 A;  3E01 A;  4ELU A;  3NGZ A;  3AVC A;  1RT6 A;  2RF2 A;  4JS4 A;  1L3V A;  4KAZ A;  1TL1 A;  4CCH A;  5FRO A;  4E7K A;  4DQP A;  2HND A;  4CJ5 A;  2WOM A;  1I39 A;  4LH4 A;  4R5P A;  3L2W A;  1TK5 A;  4OKE A;  1C0U A;  3AA3 A;  3VQ8 A;  5JS2 A;  3CM6 A;  1LWE A;  1RTI A;  1KTQ A;  1TK8 A;  4DWI A;  4HCB A;  4FM1 A;  2EHG A;  3VQA A;  4FJ9 A;  3O4Q A;  4CIG A;  3NDK A;  3VQ6 A;  4DU1 A;  4CGH A;  3K5L A;  2OPS A;  2HVI A;  1UAX A;  2Z1I A;  1GOC A;  2P1J A;  4H4M A;  4AH9 A;  3OYB A;  3KLI A;  3L2U A;  1JLG A;  1RDA A;  1RDD A;  2YNG A;  3DOK A;  3KTQ A;  4DSK A;  4KB0 A;  3SUO A;  4KHU A;  3IRX A;  1C1C A;  3IS9 A;  1JLC A;  4KO0 A;  1X9S A;  1RIL A;  1TGO A;  4B8C A;  1WSE A;  4OKK A;  2ZE2 A;  3LAN A;  3VA0 A;  1RT3 A;  2ATQ A;  1JXE A;  2XY7 A;  1KSP A;  4Z4F A;  2Y1J A;  3B6P A;  1HYV A;  4W5O A;  4DF8 A;  2PYL A;  2D0C A;  3HJF A;  2ZQB A;  1XHX A;  5HRN A;  1HPZ A;  1QSS A;  1TK0 A;  4CFB A;  4M42 A;  4DSJ A;  3O4N A;  2JGU A;  3VQ5 A;  3T1A A;  1J9A A;  1DTQ A;  4IKF A;  3SPZ A;  3QO9 A;  3U3G A;  3DRS A;  4F3T A;  3DI6 A;  3NCI A;  3HP6 A;  1KCF A;  3SQ1 A;  1W0H A;  4FCY A;  1RT5 A;  3ZSZ A;  1I3A A;  1XWL A;  1ZBU A;  1CZB A;  2X6N A;  1LWF A;  1QE1 A;  3CYM A;  3OYJ A;  1ITG A;  3PX6 A;  1RTD A;  3ZSX A;  3S3M A;  3RWU A;  2DY4 A;  3NGI A;  1D9F A;  3QLH A;  3KKR A;  1L3U A;  2A1S A;  4CHP A;  3KIO A;  3VQ7 A;  3DLB A;  4ID5 A;  1X1P A;  4ZTJ A;  1WSF A;  3ZSW A;  4JRP A;  3U6F A;  3AVM A;  1O1W A;  3LAM A;  3V9S A;  1NJX A;  4K8X A;  3HPO A;  2F96 A;  1HQE A;  1TKZ A;  5FDL A;  3AO3 A;  3M8Q A;  2W42 A;  3ZSV A;  4I7F A;  3EYZ A;  3RRG A;  2YNF A;  4NYN A;  1CXQ A;  3PO4 A;  3DLH A;  4M3U A;  2KZM A;  1QQC A;  4CER A;  5HRO A;  3V81 A;  1N5Y A;  1N6Q A;  2P5G A;  4NCB A;  1MU2 A;  3T19 A;  3OS0 A;  4CHO A;  2G8U A;  2FBY A;  2YKM A;  3C95 A;  5CZ2 A;  3QEP A;  1U47 A;  1T03 A;  1NJW A;  5T7B A;  3AO4 A;  3V1O A;  3QEV A;  1U45 A;  1RTH A;  4JRQ A;  4B9S A;  1QTM A;  4CJ4 A;  2AJQ A;  3SNN A;  4E19 A;  1NK6 A;  5J2P A;  1LV5 A;  2B5J A;  2FBX A;  1S6P A;  2Z1H A;  3OY9 A;  4IG0 A;  1VRU A;  2QK9 A;  2HB5 A;  4CJR A;  1REV A;  3RMD A;  4BWJ A;  5KGW A;  4CGF A;  4IFV A;  4TSX A;  3IG1 A;  3V6D A;  3V9Z A;  4OVL A;  4DTR A;  3HXM A;  4DTS A;  3LAL A;  1UA1 A;  3UIQ A;  3L8B A;  3DYA A;  3VQB A;  4FJX A;  3KK1 A;  3SUN A;  3V9W A;  1HNI A;  3TAN A;  3ASM A;  4AHR A;  1VSL A;  2KZZ A;  2R7Y A;  2HHX A;  3SQ0 A;  1SKS A;  1ASW A;  1B92 A;  2DFF A;  4Z4C A;  3SV4 A;  4DQS A;  3M8S A;  1IO2 A;  3EY1 A;  1JKH A;  3M8P A;  1WNS A;  4CHN A;  3C94 A;  4AIL C;  3RMC A;  3BGR A;  1J54 A;  2X74 A;  1JLF A;  3MED A;  3NH1 A;  4XIU A;  4ELT A;  4FJG A;  1BI4 A;  4BDZ A;  2ZD1 A;  4C8L A;  4DQI A;  1X9M A;  4NCA A;  4FJL A;  3TI0 A;  3OYE A;  1X9W A;  4K8Z A;  1ASV A;  3SCX A;  2HNZ A;  2IS3 A;  2XY8 A;  3P5J A;  2HHT A;  3CG7 A;  4DMN A;  1KVC A;  1BGX T;  2YNH A;  1NKC A;  3AO1 A;  1B9F A;  2YHB A;  4Z4G A;  1K6Y A;  2ITG A;  2GUI A;  4Z4H A;  1ZYQ A;  4DSF A;  3QEI A;  4ZHR A;  2XY6 A;  3DLR A;  3OYG A;  5HP1 A;  4B9V A;  1XHZ A;  4FJJ A;  4KFB A;  3K5M A;  4DS5 A;  3QNN A;  3NHG A;  4E7I A;  1IKW A;  4CJF A;  4FM0 A;  3NF7 A;  4FZX C;  4CF8 A;  3DMJ A;  4W5N A;  4M3R A;  4CEC A;  2HHQ A;  1G15 A;  5CYM A;  1BL3 A;  4C8N A;  4FJI A;  1VSE A;  4FK4 A;  4B9U A;  1UWB A;  1C6V A;  3KK3 A;  3RR7 A;  4KRF A;  4AHS A;  4PWD A;  5KGX A;  1C0M A;  5SZT A;  2FBT A;  4FJN A;  1IKY A;  1BCO A;  3HVT A;  1BQM A;  4KHN A;  4CED A;  1QS4 A;  4DFJ A;  1ZBL A;  4E1N A;  4RW6 A;  1RBT A;  3ITH A;  3QEW A;  4CEE A;  1TAQ A;  3DLE A;  4I9L A;  4DTM A;  5C24 A;  5I42 A;  1BIS A;  2P51 A;  3HO1 A;  2Z1J A;  1TKT A;  4AHU A;  1LAV A;  1HQU A;  3L3U A;  3V9U A;  4M3W A;  3SUP A;  1WSG A;  4DU3 A;  2E4L A;  4I2Q A;  4CES A;  1YVU A;  4KKO A;  5CY4 A;  2X78 A;  5DMR A;  3SPY A;  5C25 A;  4DQR A;  3THV A;  3OYK A;  4FXD A;  3NFA A;  4HHT A;  3KJV A;  3SQ2 A;  2G8K A;  1S9G A;  4CGI A;  1KRP A;  1YTU A;  1VSK A;  3DRP A;  1RT4 A;  4IBN A;  1WN7 A;  3WNH A;  1A5X A;  2BAN A;  2NUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...