3ZT1A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt1A00
4JS5A 3DOLA 2O4IA 4BDPA 3ZT2A 4I7FA 4E1MA 1I3AA 4F3TA 1HPZA 3OYNA 4ZTJA 4W5TA 1WSIA 3E01A 3ZT4A 4B8CA 3OYKA 5C24A 4LH5A 4LSNA 5T7BA 4FJ7A 3PX4A 1SKRA 2D0BA 2HNDA 4CF2A 1HYSA 4O5BA 3OY9A 3TI0A 5HRPA 2E6MA 4OVLA 1RBTA 2FBVA 1Y97A 3SYZA 4B9LA 4DTOA 3QEXA 4FLVA 1YTUA 1ZBIA 3DRRA 4W5OA 4HUFA 2G8IA 2W42A 2YNFA 2HHXA 2GBZA 3T1AA 1CXQA 3NGYA 3ZSXA 4CGGA 3NE6A 4DSIA 4FJGA 3SQ2A 4F2RA 3VQDA 1A5XA 1FKPA 4QAGA 3SUNA 4DTPA 3DOKA 1MU2A 4H4MA 5JS2A 4CFAA 4Q5VA 1IKWA 1LWCA 1JKHA 3CG7A 4C8OA 3TAMA 2EX3A 2HB5A 5J2QA 4CEOA 1LWFA 1WSJA 4CJPA 3OYEA 3IG1A 3ZT0A 3VQCA 4B08A 4FJIA 2KFNA 4RG8A 1RDCA 3VQ6A 1QTMA 2HHVA 3AA5X 1KVBA 1BIZA 3HP6A 3MEEA 4G1QA 3LWLA 3G0ZA 4OLAA 2YKNA 4OJRA 1UA1A 3V6DA 4BDYA 1I39A 4QCLA 1KCFA 4H8KA 4M3YA 1RT4A 3AA2A 1Q9XA 1XI1A 1JLAA 4BACA 3QINA 3LALA 4DTXA 2XY8A 2D5RA 4KHWA 2KTQA 4DU4A 2FBTA 3V4IA 3SPYA 4DSJA 1T05A 2E6LA 1NK5A 3M8QA 4FK0A 2X6NA 3A2FA 1TV6A 3L3UA 3CFPA 3SNNA 3VQ9A 1YVUA 2KW4A 1RT2A 3ISNC 4E7IA 5FRMA 3OS1A 4CK1A 1TK5A 1KFSA 3I0RA 2G8WA 3ZSRA 4CE9A 4EP5A 4OKEA 4E1NA 4OGCA 3NH0A 5KI6A 3EZ5A 4E7KA 1NOYA 1W9HA 1WN7A 4NCAA 5JS1A 1D5AA 1UAXA 1WSEA 2Z1HA 1JLEA 3B6PA 4CF1A 4DF8A 3VN5A 1KVCA 1LAVA 3NF6A 4ZHRA 2G8VA 3RR7A 4FYDA 2XRIA 3QIOA 1NJWA 3SZ2A 3PO5A 1QHTA 1BHLA 1EXQA 3SUQA 2D0AA 3NHGA 1IG9A 3C95A 4CEAA 3RWUA 1LWEA 4FXDA 4DMNA 3AVAA 3OYBA 2OA8A 2P5OA 3UIQA 4FLXA 4DSLA 3QEIA 4FK4A 2IAJA 3OYMA 2DFEA 4ICLA 3AV9A 4DFKA 4KO0A 1SUQA 4M3UA 1HMVA 2Y1JA 2OZSA 3ZCMA 4E0DA 3NH1A 2DFFA 2DFHA 1FXXA 1JL2A 4CK2A 4Y1DA 1RT1A 3OYIA 3TAFA 4FK2A 4C8MA 1NK7A 1ZBHA 3RMAA 3ZSWA 1L5UA 1VSHA 4CFBA 4HCCA 1WLJA 1RTJA 4RW6A 2YHAA 4HUEA 3CYMA 4IG0A 2OPQA 2HHTA 4IFYA 2FBYA 2Z1IA 3HO1A 1C6VA 2P1JA 1T03A 4UQGA 3D45A 4RW8A 3PV8A 2A1SA 2X74A 1FKOA 4DF4A 1C1AA 2RKIA 4M41A 4CFCA 4N76A 2Q3SA 1BQMA 2ZE2A 3AO5A 4EZ6A 4K8XA 1SL0A 4KKOA 1TAQA 3CFOA 1RTHA 4M3WA 4CECA 2G8UA 2KFZA 4O0JA 5DK5A 1EKEA 1RBUA 4O44A 3SQ0A 4AHRA 3NCIA 1JLGA 4DSEA 1B9FA 2HHUA 3KLHA 3V9ZA 3QEVA 4KI6A 1GOBA 1TGOA 2O4GA 3DMJA 3SV4A 3AVKA 2QK9A 3C94A 3SI6A 5HP1A 3P83D 1SKSA 2ZD1A 2OYQA 4CESA 3T3FA 3LP2A 4CJSA 2HHWA 1J9AA 4DLEA 4QOZB 3SJJA 3JYTA 4LY7A 3LAKA 4E7LA 4BE0A 4CIEA 4CGDA 1J53A 1K6YA 1BI4A 4DQQA 1TKDA 3PO4A 3G10A 1VSEA 4RW4A 3OYDA 4FCYA 4FZYA 3AO1A 1D9FA 3RMDA 1F21A 4FJHA 3IS9A 3DLHA 3MAQA 4CERA 2Y1IA 3V81A 3AVCA 3RMCA 3QEWA 3AVBA 3C6TA 2HVHA 3KLIA 3MEGA 1NK9A 2VWJA 1EP4A 3K58A 3KD5E 4AHVA 4JRQA 4FJXA 1J54A 1RT7A 1X1PA 3PUFA 2E4LA 3VQ8A 3CQ8A 1ASVA 4Z4IA 2DTUA 1U04A 4IFVA 3OJUA 4CIFA 4R5PA 4DTSA 1HYZA 4HUGA 1KTQA 2FC0A 3HPOA 3HSTB 4OGEA 3O4QA 4OLBA 3AVHA 3DLRA 3K57A 4E7HA 1BGXT 1S9GA 3V1OA 4CGIA 4DTJA 3KTQA 1RTDA 1SL1A 3KK1A 4ZTFA 1ZBFA 4W5NA 4XIUA 3MEDA 1U49A 2HHQA 4HCBA 3S3NA 4EZ9A 3K5LA 2F96A 2YNIA 3TAEA 2X78A 2G8FA 3ASMA 3DLEA 1TK8A 4KI4A 3RTVA 4B9TA 4B9VA 3BDPA 4CK3A 3KK3A 1S1TA 2ZQBA 3DLGA 4CJVA 4BE2A 1X9WA 2YNGA 4Q0BA 4DS4A 5HLFA 1RBVA 2VWKA 3M8RA 4N41A 4AHCA 1U47A 3P1GA 4E19A 1BCMA 2PZSA 3S9HA 4Z4EA 4BWJA 4M3ZA 5EU7A 3S3MA 4F4KA 3OVNA 2DY4A 1O1WA 3AVMA 4J2AA 2IC3A 4IDKA 3K2PA 3P5JA 4CF8A 3DYAA 4Y1CA 4CHYA 1UWBA 3AVIA 1L3TA 1Z25A 4IBNA 4CJ5A 4PWDA 4NYFA 1Z26A 3LPTA 3SQ4A 4HVJA 1B9DA 2B5JA 5J2PA 3AVFA 2YNHA 5DMRA 2RF2A 1REVA 3V9XA 1RDAA 2G8KA 3HK2A 1LAWA 1S6QA 4CEZA 3OJSA 2NUBA 1RNHA 3MXIA 3L2VA 3LZIA 1R0AA 1L3VA 5HBMA 4CHPA 4CIGA 2XHBA 3QNNA 3HL8A 4EP4A 1BCOA 3KJVA 3VA3A 4C8LA 1UOCA 3AO4A 1ASWA 3LAMA 2XY7A 1JXBA 4KB1A 1ITGA 5CZ2A 3ZT1A 4FZZA 4CEQA 3NGIA 3IRXA 1A5VA 3SV3A 3MECA 2QKKA 1NJYA 2BDPA 3LPUA 4DFJA 4CJQA 5J2MA 1S1XA 2RN2A 1N6QA 2P51A 3TARA 4KB0A 3CM6A 3KLFA 4DU1A 3SUOA 3SCXA 4M42A 3HM9A 3VQ5A 4Z4CA 4JLHA 4DTRA 1NOZA 1RDDA 1CLQA 1WNSA 1CXUA 3LDSA 3QEPA 3IAYA 1HQEA 3OYFA 3NF8A 3AA4A 4MFBA 3KKSA 1SKWA 4CFDA 3HVTA 4KHQA 3QESA 2XY5A 1KVAA 1BI4B 3HPHA 2ITGA 4M3TA 3EY1A 2Z1JA 1C0TA 3TR8A 4WE1A 4DQPA 2PYJA 5K14A 3AVNA 4I9LA 1VSMA 3SQ1A 4B9NA 4PQUA 2BANA 4FLYA 2JLEA 3KD1E 1VSKA 3DRPA 5C25A 4I9QA 2GUIA 2I5JA 3I0SA 2IGIA 2YKMA 3V9UA 3PY8A 4CJKA 4DS5A 1DLOA 2WOMA 4ID1A 2KZZA 4AHTA 2LSNA 3V1RA 3JSMA 3DI6A 5FROA 3F73A 2ETJA 2X6SA 1KSPA 1S1UA 3QERA 3FFIA 3HP9A 1JLBA 4RW9A 4B8AB 4ID5A 4PA1A 4H4OA 4DTNA 4CHNA 4O0IA 1SL2A 4M45A 4CCHA 4FJJA 1RBRA 2BGGA 1IH7A 4J2EA 1RILA 3ZSVA 2Z1GA 3LWMA 1L3SA 4B9MA 3HVRA 1NJZA 3DLBA 4CGHA 4FW1A 1VK0A 3T19A 1B92A 2HNZA 3VQ7A 3U3YA 1XHZA 3NGZA 1BQNA 3OYAA 5CZ1A 4DQSA 1QSYA 5D3GA 3L2UA 1ZYQA 1RTIA 1KLMA 3F9KA 3NF7A 3HT3A 4BE1A 4E7JA 1NK6A 1RT3A 3VA0A 4IKFA 3QO9A 4N5SA 4L8RB 3SUPA 1ZBLA 4CHQA 4I2PA 1L3UA 1CZ9A 1EETA 1S6PA 1JL1A 1HNVA 2XY6A 2PY5A 3KIOA 4C8KA 2F8SA 3QETA 1WSHA 4CGFA 3RRHA 1NKCA 3VQAA 1XHXA 1TKTA 1YTAA 4CJLA 4LSLA 3ZSOA 3KLGA 3L3VA 5HRSA 2F8TA 2KQ2A 3MXMA 5CY4A 4CGJA 4KAZA 1WAJA 4M3XA 1QS4A 3AO2A 4CEEA 2QKBA 1VSLA 1S1WA 5I42A 4CHOA 4CJ3A 1UA0A 1DTQA 4FJLA 3NDKA 3AVLA 3D0PA 4KTQA 4PUOA 2R7YA 1GOCA 1LW0A 3VQBA 3NAEA 3DLKA 1GOAA 4RW7A 3ZSZA 4CEFA 4FJMA 3M8SA 4JRPA 3L2QA 2D0CA 4FM1A 3NFAA 1C1BA 4TSXA 4NCBA 3VQ4A 4FM0A 1QSSA 5HROA 1BL3A 5CYMA 1VRTA 3TAGA 4KHSA 2AJQA 4W5QA 2GV9A 2HNYA 3ITHA 3OYGA 4DTUA 1NJXA 1DTTA 4HTUA 4FJKA 4CF0A 5CYQA 3DRSA 4IG3A 1JXEA 1CZBA 3H08A 4AHUA 4Z4GA 5KRSA 1RBSA 1WSFA 1YT3A 4M3RA 1NKBA 3ALYA 1TKZA 1HNIA 1Q9YA 3THVA 4AHSA 2WONA 1C1CA 1WAFA 4W5RA 4BDZA 3C6UA 5KGWA 1JLCA 4Z4FA 1LW2A 3KK2A 1IO2A 1X9MA 3WNHA 4KHYA 1RCHA 4DLGA 4J2DA 3O3GA 4F8RA 3OYJA 4DWIA 1WSGA 4PY5A 4ELTA 1HRHA 2OPRA 3BGRA 1S9EA 4OKJA 4N47A 3U3GA 4FZXC 1TVRA 4DQRA 3O3HA 2B4JA 3NH2A 3MXJA 4CJWA 1KFDA 2BE2A 3CM5A 4JS4A 4F3OA 4FJ5A 2HHSA 1VSDA 3QLHA 4DTMA 2B6AA 2YV0X 1N5YA 2KZMA 2VG7A 3LANA 3L2RA 1KLNA 4CJ4A 4ELVA 3ZSQA 5KRTA 3TAQA 5C42A 1BIUA 5E41A 4Z4HA 3I8DA 2ATQA 3V9SA 2QXFA 1S1VA 4Z0UA 1JLFA 3WNEA 5J2NA 4CJFA 1RT5A 5KGXA 2IDOA 4KREA 2VG5A 3TAPA 2IS3A 1S5JA 1QQCA 5FRNA 2HW3A 1U4BA 4KRFA 2VG6A 5KTQA 4B3OA 4KV8A 3LP1A 1TKXA 2OPSA 4CHZA 2HVIA 4DQIA 4O55A 5FDLA 1RT6A 1RDBA 1U45A 3OS0A 2HMIA 3L2WA 3HXMA 3ULDA 1NKEA 2OPPA 4KFBA 3V1QA 4J2BA 2IOCA 1ZBUA 1HYVA 1A5WA 3AA3A 4DU3A 1D8YA 4FLUA 3OYLA 1BISA 3TANA 4OKKA 1TK0A 3K5NA 3DM2A 4FM2A 1T8EA 1QE1A 1VSIA 3OS2A 4FVMA 4HHTA 2XO7A 2EHGA 1X9SA 1KRPA 4K8ZA 3U6FA 1LV5A 1D9DA 4FJNA 3LP0A 4CEDA 4DFMA 4CEBA 4O4GA 4KHNA 3RRGA 4CJUA 1XC9A 3L8BA 1XWLA 4OPKA 4YNQA 4NYNA 3ZSYA 3VQQA 4E3SA 1HJRA 3V9WA 4GVMA 4B9SA 1NK0A 5SWMA 4CJTA 4KHUA 3HYFA 4FJ9A 3M8PA 3HJFA 2G8HA 2OZMA 3K5MA 3KLEA 4FLWA 1VRUA 1T7PA 3EYZA 5J1EA 1JLQA 3CFRA 4AILC 3OYCA 4DSFA 4LD0A 4AH9A 4DSKA 4E89A 3VQPA 4CJRA 4F2SA 3HPGA 4C8NA 5HRNA 4OPJA 3WNFA 3PX0A 3TABA 3LP3A 2P5GA 1J5OA 4CF9A 4YFUA 3OYHA 4DFPA 4B9UA 4FW2A 1ASUA 1VSFA 1FK9A 3SPZA 3RR8A 1C0UA 1EX4A 3QIPA 3AO3A 1NK8A 4KTWA 5HRRA 1IKVA 4MQ3A 4CJEA 4FJ8A 1SV5A 3NBPA 3B6OA 4KTZA 4DG1A 2RPIA 4I2QA 3AVJA 1TL1A 3O3FA 4FLTA 4ELUA 4GMJB 1U48A 2JGUA 3LZJA 1C0MA 3TWHA 4NCGA 3PX6A 1HQUA 5I3UA 3KKRA 1G15A 1IKYA 1W0HA 2FBXA 4FLZA 3QNOA 3O4NA 1TAUA 4KPYA 3VQEA 4LH4A 1QSLA 5SZTA 3S3OA 2PYLA 1Q8IA 2A1RA 2YHBA 1IKXA 3WNGA 1NK4A 1VSJA 1TL3A 4GW6A 3K5OA 3K59A 3ZT3A 3RMBA 4BWMA 3NF9A 3AVGA 4N56A
chains in the Genus database with same CATH superfamily
4JS5A 2O4IA 3G25A 4Y0WA 1ATRA 4ZTJA 3AY9A 3OYKA 3S41A 3OBWA 4LSNA 1HYSA 2HNDA 4H5NA 2FBVA 4X62K 1J5EK 4DTOA 2Q0RA 1LCUA 3QEXA 4FLVA 4WYBA 4HUFA 1QQNA 2G8IA 3T1AA 3ZSXA 4FJGA 4DSIA 1E3MA 4JI0K 1MU2A 1IKWA 3CG7A 2Q2RA 2KHOA 3H1VX 1LWFA 1WSJA 4CJPA 3OYEA 2OTLN 3ZT0A 4MDAA 4FJIA 2QTDA 4RG8A 1HKBA 2HHVA 3HP6A 3LWLA 3CC2N 4OLAA 3G4SN 3TSPA 4BDYA 4B1ZA 3AA2A 1Q9XA 1XI1A 2RHKA 3HRGA 3C0BA 2F7TA 4DTXA 3MX2A 3R6MA 5ADXH 4KHWA 2W6LA 3V4IA 5CR4A 3SPYA 1T05A 4CZLA 1K9MO 2X6NA 1VQNN 1LOTB 4E7IA 1RT2A 3OS1A 3DLLL 1TK5A 3F2KA 2ZF5O 4E1NA 4E7KA 3N4QA 1ZBSA 2E1ZA 1NGCA 3EE9A 1UAXA 2Z1HA 1LAVA 1Y64A 2WTUA 3CD6N 1NJWA 5AQOA 4JK8A 1QHTA 1BHLA 3ZEUB 1BU6O 4IDHA 3RWUA 2NRRA 4DMNA 3OYBA 2V52B 2OA8A 1HPMA 2P5OA 4FLXA 3QEIA 2NLXA 2UUCK 4DR1K 4JHDA 4ICLA 3BY5A 2CGJA 3NH1A 1BOTO 5KQDA 3CJAA 4JK9A 1JJ2M 1L5UA 3H3OB 5BR8K 4RW6A 2O8DA 4HUEA 4M7YA 2OPQA 3VTIA 2A1SA 4LF9K 2Q3SA 3U4LA 3AO5A 4I6MA 1SL0A 4KKOA 3WXKA 1RTHA 2QW9A 4CECA 2KFZA 5M1KA 3CCLN 4AHRA 4DR5K 1JLGA 2GTDA 3KLHA 3V9ZA 3QEVA 3O1WA 3SMSA 3CCSN 1GOBA 1TGOA 3SI6A 5HP1A 1OKJA 4CESA 3CJ7A 2HHWA 4QOZB 3JYTA 4LY7A 3ID8A 4CGDA 1K6YA 3G10A 1S3XA 1D9FA 5EOYA 3RMDA 1F21A 3IS9A 3DLHA 1YAGA 4FWOA 4JN4A 2QM1A 4BQLA 1NK9A 1OH6A 1XNQK 4FJXA 4Z4IA 1M90O 1U04A 2QWLA 3WXMB 3MMVA 3HPOA 1OH7A 3HSTB 3O4QA 3AVHA 2A6AA 1KD1O 4FWLA 1DEJA 1BGXT 1S9GA 4NLBA 4E7HA 4DR6K 5M1NA 3KK1A 4ZTFA 4W5NA 1U49A 4FWPA 2HHQA 3UKRA 2AP1A 4G9ZA 4HCBA 4FL9A 2F96A 3TAEA 2X78A 1XUPO 3DLEA 3SBGA 4KI4A 4UY8O 2O8BA 4B9TA 2HBJA 2QK9A 4Q0BA 3DLGA 1XMQK 1N34K 5HLFA 4WQ5C 4A61A 2VWKA 1QVGM 4AHCA 1U47A 4PL8A 4BREA 4A2AA 3CCMN 4BWJA 3N4PA 4H5RA 5EU7A 3S3MA 3OVNA 2DY4A 1O1WA 4J2AA 2IC3A 4IDKA 3SJHA 2NRVA 4Y1CA 4CHYA 3AVIA 1L3TA 4IBNA 3D7EO 3IDHA 2UUBK 3SQ4A 4HVJA 1B9DA 5JICA 2YNHA 3O5BA 2RF2A 4LFBK 4ILGB 5EX5A 4XH1A 3LZIA 1R0AA 2XHBA 3HL8A 3VA3A 4C8LA 1UOCA 3AO4A 3NVMA 1ASWA 1ITGA 4CEQA 4BRHA 4Z94A 4BROA 4BGAA 4JAXA 3C6AA 2RN2A 4KB0A 3SUOA 3SCXA 3LDPA 1CLQA 1GLFO 4BQZA 3AA4A 3PSFA 2QA4N 1SKWA 3QESA 4XH5A 1K73O 4ISEA 2Z1JA 1C0TA 4WE1A 3PIPL 4I9LA 3SQ1A 2BANA 4FLYA 3KD1E 3J8AA 2AA4A 5JVGL 1VQMN 4I9QA 2NRWA 2GUIA 3I0SA 4IJNA 4DS5A 4B3TK 3DI6A 2W41A 5FROA 5DM6L 3F73A 1S1UA 3FE1A 3FFIA 3C6HA 4ID5A 4PA1A 4H4OA 4CHNA 4M45A 3CCVN 5AR0A 2Z1GA 3LWMA 4GKJK 3Q7BA 5F1XA 4CGHA 4FW1A 3T19A 3VQ7A 2E20A 3ENBA 3FLCO 4IZ9A 3DAWA 4CZFA 1ZYQA 3ULEA 3FZHA 3NF7A 4E7JA 4F9OA 4JI2K 3L0QA 1YI2N 4DV5K 4JKAA 3VA0A 4IKFA 2ASPA 1L3UA 1YF5L 3EKUA 1JL1A 3QETA 1TKTA 4FWKA 3L3VA 4BRNA 2KQ2A 2FF3B 5CY4A 4KAZA 1QS4A 3ULEB 3AO2A 4CEEA 4R79A 2QKBA 4FWMA 3ZEUA 4DV2K 1LW0A 3ZSZA 4JRPA 3L2QA 3NFAA 4NCBA 3G6EN 3TTFA 5A2QO 1VHXA 3TPQA 4W5QA 2GV9A 2HNYA 3SAFA 1NJXA 1VQ8N 3CJCA 5CYQA 3H08A 4M3RA 4JI8K 1GLAG 4W5RA 1C1CA 4BDZA 1WBDA 4Z4FA 1JLCA 1LW2A 3KK2A 1X9MA 3WNHA 4KHYA 1RCHA 4NXNK 4L3QA 4BRIA 4DWIA 1WSGA 2VQFK 3CHWA 3U3GA 3HSCA 4DR7K 3OHRA 3O8MA 3O3HA 2B4JA 3O9UA 3MXJA 4CJWA 1YVNA 5AZJA 4JS4A 2NRXA 1NM1A 1S22A 1VSDA 3QLHA 1N5YA 3T69A 4YOTA 4Z4HA 2ATQA 4CW7B 5EVZA 4JI7K 2O8FA 4FWRA 4A2BA 1S5JA 2GWJA 3LDOA 2P9IB 3MCAB 2VG6A 2O8EB 3CC4N 3TU5A 4DQIA 4JKEA 2Q31A 4AM7A 4J2BA 5FPDA 2Q97A 1A5WA 3T7ZA 4OKKA 1TK0A 1RFQA 3K5NA 4FM2A 1QE1A 3OS2A 4FVMA 2YCHA 4CEDA 4O4GA 1XC9A 3CIPA 1XWLA 1YXQA 3ZSYA 2D0OA 4MLHA 3M8PA 3K5MA 3KLEA 2CGLA 1U2VA 3MCPA 4JKCA 1I94K 4DSKA 3GL1A 3VQPA 3SK3A 3PX0A 3O9RA 2P5GA 4YFUA 3OYHA 4DFPA 3A5NC 4GY2B 3RR8A 3SPZA 1EX4A 3MWTA 4BRAA 1HR0K 2DPNA 4MQ3A 4YOUA 3NBPA 4RTFD 3LDNA 4I2QA 2O8DB 2JGUA 4DB3A 2UXDK 3LZJA 3TWHA 5BRDA 4B1YB 2FBXA 4FPAA 3CXCM 3VF4A 3O4NA 4KPYA 3C7NA 4EHTA 1QSLA 3S3OA 3SBTA 5FPMA 1VQ5N 1RDWX 1TL3A 3K5OA 4C1NK 2UXBK 3ID6A 4BDPA 1I3AA 1HPZA 4W5TA 3ZT4A 4FJ7A 1SKRA 4CF2A 4O5BA 3OY9A 1RBTA 2F4VK 2FLOA 1Y97A 4B9LA 2YHWA 1ZBIA 1IJJA 4OX9K 1CXQA 1EWRA 4CGGA 3SQ2A 3VQDA 1A5XA 3SUNA 3DOKA 4CFAA 4H4MA 1YIJN 4LFAK 3TAMA 2HB5A 5J2QA 4CEOA 1ATNA 3VQCA 4MDBA 2O8CA 1BIZA 3G0ZA 2GEMA 1DT9A 4AF1A 4M3YA 4QS8A 5C2DA 4BACA 3P39A 2D5RA 3D2FB 4DU4A 3CCJN 4BR5A 3CI5A 4JV5K 2HF4A 2QWOA 1YJWN 3CFPA 4H5WA 3VQ9A 2KW4A 2P9IA 2IIRA 5FRMA 4CK1A 1KFSA 3K9JA 3ZSRA 1SZ2A 2H3GX 4OKEA 4OGCA 3EZ5A 5KI6A 1QHAA 1NOYA 1W9HA 1WN7A 3D2EA 2EWSA 4DF8A 3VN5A 3NF6A 4ZHRA 3J80O 3WXLA 3QIOA 1NLVA 4JI1K 3NHGA 1CZAN 4GVEA 3VPZA 4FXDA 2HBLA 4GV6A 2ITMA 4DSLA 1VQKN 4JKFA 1Q82O 2OZSA 4BR0A 4LC9B 3R9PA 4E0DA 1ATSA 3HBTA 2DFHA 4CK2A 1RT1A 3TAFA 3RMAA 4JI3K 3ZSWA 2QEXN 5M1FA 3CQXA 1N32K 4CFBA 1WLJA 2HHTA 2YHAA 1KQSM 3CYMA 4IG0A 5LJWA 2P1JA 3D45A 4RW8A 4FVUA 3PV8A 1FKOA 4NB4A 1BQMA 2ZE2A 4K8XA 4M3WA 4O0JA 1EKEA 1IG8A 1B9FA 3EO3A 2HHUA 1G99A 3DMJA 3SV4A 3AVKA 4CJSA 3I56N 4JKGA 3SJJA 4E7LA 4BE0A 4DQQA 3PO4A 3QB0A 3OBYA 1IBKK 4RW4A 3OYDA 4FZYA 3AO1A 3E9LA 3CJ1A 5M1QA 1GLEG 4DCHA 3KZBA 3MAQA 4CERA 4BRPA 3AAPA 3ATVA 2Y1IA 3RMCA 3QEWA 2ZGZA 2QWPA 3FZFA 3KLIA 3P38A 5AQJA 3MEGA 5LJVA 3KD5E 3ZETA 1X1PA 1RT7A 4DR3K 3THWA 2E4LA 3VQ8A 2E2PA 4IFVA 5AQKA 4B9QA 5AQVA 1HYZA 3VF6A 2FXUA 4OLBA 3DLRA 3BZKA 3OA9A 3V1OA 4CGIA 4DTJA 4XIUA 3MEDA 5F0XA 2CH6A 1Q18A 3DWLA 3S3NA 3K5LA 2G8FA 2BUPA 4IO9L 3KK3A 1S1TA 2YNGA 3EKSA 5FPNA 1BWFO 4BY9C 4QS9A 4B1UB 1BCMA 3S9HA 4AM6A 2QI2A 3HM8A 3K2PA 3DYAA 3VEYA 2YJEA 4NYFA 5C12A 2B5JA 3VF2A 5J2PA 5DMRA 3VEXA 1REVA 4H0PA 1RDAA 3AGRA 3HK2A 4CEZA 1S6QA 3OJSA 5AQFA 3MXIA 1L3VA 4CIGA 5EY4A 1BCOA 2E8AA 3LAMA 4JD2A 2XY7A 4YDUC 2FSKA 1YITN 2PFUA 5CZ2A 3ZT1A 3NGIA 3SV3A 3MX5A 4H03B 4CBWA 2P9LA 4DU1A 3A5LC 3FZLA 3HM9A 3VQ5A 5BPMA 4JLHA 4DTRA 1NOZA 1CXUA 1HQEA 3OYFA 1DKGD 4MFBA 3KKSA 4CFDA 2XY5A 4DQPA 5K14A 1VSMA 5AQXA 3MN9A 1HNXK 1DLOA 2WOMA 5GINA 3V1RA 3JSMA 4K41A 3NVKA 1YHQN 2D1KA 2X6SA 2HOEA 3HP9A 1JLBA 4RW9A 1Z6RA 5AQHA 4B8AB 4BR7A 2I7NA 1SL2A 4CCHA 2BGGA 1IH7A 1RILA 4LF4K 2GX9A 2UYTA 4B9MA 3DLBA 1VK0A 1XHZA 2HNZA 1ZXOA 3NGZA 4DQSA 4BRDA 1RT3A 4WQ5A 3SUPA 4CHQA 4X66K 1CZ9A 1S6PA 1IBLK 4C8KA 3KIOA 4V19S 4WQ4C 3THWB 4CGFA 2PBDA 1NKCA 3MN7A 4CJLA 4LSLA 1BO5O 3ZSOA 3I33A 2F8TA 3MXMA 2P9NB 1WAJA 1J6ZA 1EO1A 1QQOA 1S1WA 3HZ6A 4YHHK 5I42A 1VQ4N 4GV9A 3CCEN 2OANA 3D0PA 4KTQA 1WBBA 2E5LK 4PUOA 1GOCA 3ZLJA 3BF1A 3NAEA 4RW7A 4CEFA 5BN8A 3SAHA 4BG8A 1QSSA 1VRTA 3TTCA 4KHSA 2AJQA 1D4XA 3ITHA 3OYGA 1OVYA 1HKGA 1JXEA 4O8UA 4AHUA 1YT3A 4KH6A 4EZ6A 1TKZA 1HJOA 4AHSA 2WONA 3C6UA 1SS6A 2W6KA 3UKUB 1IO2A 3J7ZO 5AQYA 4PY5A 5BPNA 5AQUA 2OPRA 1S9EA 5C10A 1TVRA 5IWAK 2BE2A 3CMAN 1Z05A 2HHSA 4F3OA 4FJ5A 1T3VA 3L2RA 1KLNA 3HTVA 4DHYA 2A40A 3I8DA 3V9SA 4YORA 1HX1A 2P9LB 5J2NA 1RT5A 2IDOA 3AGKA 2VWBA 2IS3A 5FRNA 5AQGA 1U4BA 4DV1K 2P9UA 3JXUA 2OPSA 4JHDB 2IVPA 5FDLA 4WFNL 1NGIA 5C0YA 1NKEA 4DUZK 4KFBA 3V1QA 3AA3A 1D8YA 1BG3A 3CERA 5D3GA 2F9TA 2HSTA 3LP0A 4CEBA 4KHNA 3RRGA 4CJUA 2YX6A 4YNQA 3VQQA 4E3SA 3J81O 2P9KB 4DV0K 4JKHA 4I6MB 4KHUA 3QBXA 3CCUN 4FLWA 3THYA 1VRUA 4JI6K 4OPHA 3FFKB 3CFRA 1TYQA 4DSFA 4LD0A 4AH9A 4BRQA 4CJRA 1K8AO 4K42A 4AQYK 4B9UA 2O8BB 4FW2A 1NGAA 5HRRA 1IKVA 1SV5A 4KTZA 3B6OA 4ELUA 2RPIA 3FZMA 3AVJA 1TL1A 3KWGA 1U48A 5GADP 3O80A 4NCGA 3CPEA 1G15A 4FLZA 3CF5L 2F9WA 3VQEA 4LH4A 1Q8IA 5JMVA 2A1RA 1NNEA 1IKXA 3WNGA 4OPAA 1NK4A 3ZT3A 2QWMA 4M63C 1SQKA 3JS6A 3DOLA 3ZT2A 4I7FA 4E1MA 2O8EA 4F3TA 3OYNA 1WSIA 2OCEA 1QZ6A 3PX4A 2D0BA 3TI0A 2BTFA 5HRPA 4X64K 4OVLA 4KBOA 3SYZA 2OTJN 5B8HA 1W97L 2W42A 2HHXA 3F5TA 3NE6A 4F2RA 2O8FB 5M1OA 3VOVA 1JKHA 4WF9L 4C8OA 5GIPA 4B1WB 2E1YA 2QWNA 4B08A 1OH8A 1RDCA 4JEPA 3VQ6A 4YOVA 3MEEA 1VQPN 5LMNK 2YKNA 3V6DA 4QCLA 1RT4A 2WC9A 3DJCA 1QVFM 1JLAA 3LALA 3GOIA 2V51B 3FGUA 3H1QA 2FBTA 4BRFA 4DSJA 1NK5A 3LDQA 2WFBA 1TV6A 4E1JA 5KPRA 1YVUA 3ISNC 3MN6A 4BR9A 2E88A 3RSEB 3I0RA 2G8WA 4EP5A 3E1YA 3NH0A 3MDQA 1D5AA 3AARA 1KVCA 2G8VA 4FYDA 3RR7A 3QFUA 1K8KB 3I8BA 3PO5A 1EXQA 3SUQA 2D0AA 3C95A 2VGNA 1LWEA 1HLUA 4RCHA 5AQWA 2Q0UA 2HMPA 4FK4A 3OYMA 1NGDA 1WUAA 2DFEA 1W2BM 3AV9A 4DFKA 4KHPK 4IXCA 5TKYA 4M3UA 3TTDA 3CJBA 2DFFA 4DV7K 1FXXA 4Y1DA 3OYIA 4FK2A 1NK7A 4FOEA 1VSHA 4ILJA 4HCCA 1RTJA 5I9EB 4PKHA 3HO1A 3L4IA 4UQGA 4KH4A 3UB5A 2X74A 4CZIA 4DF4A 1C1AA 2RKIA 4M41A 4WFBL 3RVCA 4N76A 3U8XA 3O9SA 3D2FA 1KAYA 1TAQA 4IOXA 4BC3A 4BG9A 5DK5A 1RBUA 2ZJRL 4O44A 3SQ0A 4DSEA 4KI6A 4BRMA 1GLCG 1VQ9N 2FF6A 3C94A 4CZHA 2OYQA 2ZD1A 2VQEK 3LP2A 1J9AA 4DLEA 4H0OA 4NLCA 3LAKA 2KZZA 4CIEA 1BI4A 3VGMA 3GBTA 4FSVA 1VSEA 2E2NA 2FSJA 2VCPA 4FCYA 1YJNN 4CD3A 3AVCA 3WUHA 3AVBA 2HVHA 4J8FA 3H46O 5TKWA 2VWJA 3K58A 4AHVA 4JRQA 4LF6K 3CQ8A 1ASVA 2GWKA 3WXJA 3OJUA 4R5PA 4DTSA 2KLAA 4H5TA 5AQQA 4JK7A 1RTDA 1SL1A 1ZBFA 4U7BA 3BUZB 4FPBA 3O4WA 3K0SA 4IJAA 3QICA 1M1KO 4JKDA 3ASMA 3THXA 4H0YB 3TSQA 4B9VA 3BDPA 4CK3A 4CJVA 5F2RA 5CHIA 4DS4A 1RBVA 5LL6Z 4DR2K 3M8RA 1TYQB 3IUCA 4N41A 3P1GA 3MWPA 4NO7A 4E19A 4BVPA 2PZSA 4Z4EA 4FWQA 3UKRB 1DGKN 4M3ZA 1P90A 3THYB 3L6QA 3VMFB 4CF8A 5ELZA 1UWBA 5GAGP 1Z25A 4CJ5A 3AVFA 3QDKA 2G8KA 1JCEA 1LAWA 4IO8A 2NUBA 3W3DA 3L2VA 5HBMA 3U9ZA 2P9SB 4EP4A 3KJVA 4KB1A 4YOYA 4FZZA 3IRXA 3MECA 2QKKA 2BDPA 3LPUA 3T1YK 2ZWHA 4DFJA 5J2MA 5AQLA 1S1XA 1N6QA 2P51A 3CM6A 4M42A 5AQPA 3IMXA 1RDDA 3PIOL 4CBXA 1WNSA 3IAYA 5AQRA 1NWKA 3NF8A 3HVTA 4K0KK 1BI4B 1MDUB 2A41A 2IVNA 4H0TB 2PYJA 4B9NA 3PLAA 1NGEA 2JLEA 1VSKA 3DRPA 5C25A 2I5JA 1QQMA 2YKMA 3PY8A 3V9UA 1NGFA 4CJKA 1EQYA 4ID1A 5H1SQ 4AHTA 3R3LA 3B8AX 2ETJA 5AQSA 1KSPA 1H1VA 5MLCQ 1GLDG 4O0IA 4FJJA 1RBRA 4J2EA 3KVGA 2WBNA 1RDUA 3C65A 3O9TA 4B1VA 3HVRA 1B92A 4CZGA 4LF8K 1BQNA 2CH5A 5CZ1A 1QSYA 1KLMA 3HT3A 4BE1A 1NK6A 2V7YA 3VEOA 4N5SA 4L8RB 1ZBLA 4I2PA 1EETA 1Q81O 2PY5A 2XY6A 2F8SA 1W7AA 4BR4A 3RRHA 3VQAA 1XHXA 4JKGB 4BC2A 4YOXA 3KLGA 4M3XA 1VSLA 3TSUA 1NBWA 2ZM6K 3O1BA 3EE8A 1NMDA 4CHOA 4FJLA 1KXPA 1N33K 3IKMA 4IWVA 4HTLA 3C7NB 3FR0A 3VQBA 4FJMA 1VQ6N 1GOAA 2P9SA 1X3MA 3M8SA 3P4IA 4BRCA 2RE2A 2QWRA 4FM0A 3ZX0A 5CYMA 1XNRK 1U6ZA 4FJKA 4CF0A 3HI0A 1YJ9N 3RSEA 1CZBA 5KRSA 5AZIB 1RBSA 1NKBA 3ALYA 1YTUA 3VTHA 5HOOA 5KGWA 2ZJQL 3SAGA 2ZJPL 4DLGA 1VQ7N 4J2DA 4F8RA 2NZTA 3NMUA 1HRHA 2I7PA 3BGRA 4N47A 4FZXC 5AJ3K 4DQRA 3UKUA 1QZ5A 3CM5A 4PKGA 4DTMA 1FW6A 2B6AA 2KZMA 4K43A 4X65K 3ZSQA 5KRTA 3TAQA 5C42A 1BIUA 1IV0A 5FLXO 1S1VA 4Z0UA 4C1NI 3FZKA 4KREA 2VG5A 3TAPA 3LDLA 1HNWK 1X3NA 1MWMA 2ASOA 2D0PA 4HWIA 2HW3A 3EEQA 4KRFA 5KTQA 4B3OA 4KV8A 4CHZA 2HVIA 1K8KA 4O55A 3E66A 1RDBA 1U45A 2HMIA 1Q86O 3HXMA 3ULDA 3VGLA 2OPPA 1ZBUA 2P9NA 4DU3A 3R1XA 4A57A 3OYLA 4FLUA 5JLHA 5HL7L 3T1HK 1VSIA 4EFHA 1KRPA 2EHGA 2NRHA 3EL2A 3U6FA 1LV5A 5AQNA 4DFMA 3VGKA 2Q1NA 4GNIA 4NYNA 4JI5K 1HJRA 3V9WA 4GVMA 4B9SA 1NK0A 5SWMA 4CJTA 5AZJB 2G8HA 2A5XA 1C0GA 4DV6K 3EYZA 3P31A 5J1EA 1JLQA 5AZIA 3HPGA 4C8NA 5HRNA 5GAEP 3WNFA 4OPJA 3TABA 3LP3A 1J5OA 1ASUA 1RGIA 1VSFA 1BDGA 4KTWA 2E2OA 4FJ8A 4FLTA 4YDUA 1TUUA 1C0MA 3PX6A 1HQUA 3WQTA 1W0HA 3F9MA 1TAUA 4MO5A 4JD2B 2PYLA 3DXKB 1NMNA 5AQMA 2YHBA 3RMBA 4GW6A 4BWMA 3AVGA 4YY3K 4N56A 4B3RK 3VERA 4C23A 5AFUA 4FWSA 3E01A 4B8CA 5C24A 4LH5A 5T7BA 4IEIA 4H0XB 4MO4A 3VETA 3WQUA 2E6MA 4PKIA 5BN9A 5KPZA 1IBMK 1V4SA 3DRRA 4W5OA 2YNFA 1O13A 2GBZA 3NGYA 1R59O 5FPEA 4LF7K 2V7ZA 1FKPA 4QAGA 4DTPA 3SLCA 5JS2A 4Q5VA 1LWCA 4O8KA 2EX3A 3MK6A 1BA0A 3IG1A 4BRLA 2KFNA 2WUSA 3BP8A 1QTMA 3VEZA 2P9PB 3AA5X 3ZYYX 1KVBA 2YHYA 1E4GT 3J7AP 4G1QA 4OJRA 3VEVA 1UA1A 5AQZA 4FWNA 5C15A 1I39A 1KCFA 2YHXA 4H8KA 4B3MK 1NU0A 3KK7A 3MN5A 3QINA 4CVNE 1X9JA 2XY8A 3J7YP 2KTQA 2CGKA 3KWIA 1T6DA 2E6LA 3M8QA 4FK0A 3A2FA 3L3UA 3JAMO 3SNNA 2VYPA 4LF5K 3GE1A 4CE9A 3O9QA 1SAZA 2A3ZA 1XMOK 4NCAA 1VQLN 5JS1A 1WSEA 4CF1A 1JLEA 3B6PA 4IOAL 2IVOA 4BRKA 2NRZA 2XRIA 3SZ2A 4BRGA 4ISFA 1IG9A 4EAHD 3D2EB 4CEAA 3A5OC 3R8EA 3AVAA 3L4QA 3UIQA 5BRHA 2IAJA 4KO0A 1SUQA 1HMVA 2Y1JA 3ZCMA 1JL2A 4DUYK 4C8MA 3OW2M 1NGHA 1ZBHA 1KAZA 1YUWA 4CJ7A 4XEIA 4IFYA 2FBYA 2Z1IA 1C6VA 2YI1A 1T03A 1U2VB 3CMEN 4CFCA 5GAHP 1JCGA 3ENHA 3W0LA 3HOSA 1MA9B 3CFOA 2HBMA 4A62A 1TUYA 2G8UA 4A5AA 3NCIA 3BZCA 3WEEB 2O4GA 4JKBA 1NGBA 4OO1J 4KH5A 4IEEA 3P83D 1SKSA 3T3FA 4H5VA 2W40A 1ILYA 4FOIA 5AQIA 4BR2A 2DTUA 1TKDA 1J53A 2JWKA 3GDQA 1NGJA 3CETA 5ADXA 3BF3A 4CZEA 3LM9A 3K9KA 4FJHA 1P8ZA 2A42A 3V81A 3SMPA 4IOCL 3C6TA 3QFPA 1EP4A 4BGBA 1J54A 3PUFA 5GIOA 4JNEA 5EXWA 4CZMA 4CIFA 2D4WA 4HUGA 2P9UB 1KTQA 2FC0A 4OGEA 1WOQA 4BVOA 3K57A 3D6RA 3KTQA 3CCRN 1NJIO 3A0IX 5KPTA 1S72N 4EZ9A 2YNIA 1T44A 1ZC6A 1TK8A 4CBUA 1BUPA 3RTVA 1X9WA 2ZQBA 4BE2A 4BC5A 2JWLA 2Q36A 5AFUH 4F4KA 3U9DA 3AVMA 4ILHA 3P5JA 4WQ4A 1T6CA 4PWDA 2HF3A 1Z26A 2O8CB 3LPTA 3V9XA 3CQYA 4DKWA 3O6WA 1RNHA 4CHPA 3QNNA 1JXBA 1N36K 4ISGA 2P9KA 1A5VA 1NJYA 3ZETB 1ESVA 4CJQA 3TARA 3KLFA 4LFCK 1C0FA 4Z4CA 2GUPA 3AAQA 1MWKA 4BC4A 3LDSA 3QEPA 3BEXA 3ZX3A 4KHQA 1KVAA 3IFRA 2NRTA 3HPHA 3EN9A 2ITGA 4M3TA 3EY1A 3TR8A 3AVNA 4PQUA 3H6EA 4JYAK 3DXMA 5KQ8A 2IGIA 5BREA 3QMLA 2NNWA 2LSNA 2UUAK 1VAZA 2ASMA 3QERA 3CC7N 3UE5A 1Q7YO 1XQSC 4DTNA 3G71N 4O5FA 4DV3K 4EHUA 2UXCK 2HHHK 3VEWA 2BH1A 1GLJO 3ZSVA 1L3SA 1KC8O 1NJZA 1NG9A 4DQ8A 3U3YA 3OYAA 4CZJA 2GELA 2ZGYA 3L2UA 3M1FA 1RTIA 3F9KA 5M1PA 5C2FA 5BR9A 5CE3A 3QO9A 3E9PA 1OVQA 1HNVA 4CD1A 4DV4K 1GLLO 1WSHA 3A8YA 3VENA 1JCFA 1YTAA 4XH4A 4PHTX 2PAVA 4A59A 5HRSA 5LMUK 4CI6A 4CGJA 2E2QA 4B1XB 1N8RO 4K25A 1WB9A 4IFEA 3WT0A 5JVHL 4CJ3A 4MLEA 1UA0A 1DTQA 3NDKA 3CPWM 5IT9O 3AVLA 1BA1A 2R7YA 3DLKA 4U67L 2D0CA 4FM1A 1FJGK 1C1BA 4TSXA 3M6GA 3VQ4A 3H3NO 2KKZA 5HROA 1BL3A 3TAGA 4EIAA 4DTUA 1DTTA 2VGMA 4HTUA 3DRSA 4IG3A 4Z4GA 1WSFA 3ATUA 1HNIA 1Q9YA 3THVA 2UU9K 1WAFA 5BPLA 2P9PA 3CJ9A 3O3GA 3OYJA 3WXIA 4ELTA 1HUXA 4OKJA 5AQTA 4DR4K 1HNZK 3NH2A 1KFDA 4CZKA 2QWQA 2YJFA 3HOTA 2J4RA 5LY3A 2YV0X 2VG7A 3LANA 1XC3A 1GLBG 4CJ4A 3PSIA 4ELVA 5DM7L 3LM2A 3ZX2A 5E41A 3M5RA 2QXFA 3WNEA 1JLFA 4CJFA 5KGXA 4FO0A 3OTOK 5E26A 1QQCA 1KAXA 2FSNA 3LL3A 3DXMB 3LP1A 1OH5A 1TKXA 1VQON 1RT6A 4B3SK 3OS0A 3H45C 4YOWA 3L2WA 1E4FT 1V4TA 2IOCA 1HYVA 3CCQN 1BISA 3TANA 4RWTA 1NGGA 3I55N 1T8EA 3DM2A 2QXLA 4HHTA 2XO7A 1X9SA 4K8ZA 1D9DA 4FJNA 3KHYA 3L8BA 4OPKA 3GG4A 4WCEL 3DXKA 3HYFA 4NXMK 4FJ9A 2HBKA 3HJFA 3WEEA 2OZMA 1T7PA 4H0VB 4AILC 3A5MC 3OYCA 3QBWA 4QS7A 1HKCA 4E89A 5BRFA 3O08A 4F2SA 3M3ZA 3E9OA 4CF9A 3THXB 1FK9A 5E84A 1C0UA 3QIPA 3AO3A 1NK8A 4PL7A 3VESA 3ENOA 4CJEA 4DG1A 3O3FA 4GMJB 3EZWA 4A5BA 1EWQA 5JLFA 5I3UA 3KKRA 1IKYA 4GV3A 4GKKK 3QNOA 5SZTA 4M7XA 4JI4K 4WFAL 1VSJA 3K59A 3NF9A 3Q7CA
chains in the Genus database with same CATH topology
4JS5A 3DOLA 2O4IA 4BDPA 3ZT2A 4I7FA 4E1MA 1I3AA 4F3TA 1HPZA 3OYNA 4ZTJA 4W5TA 1WSIA 3E01A 3ZT4A 4B8CA 3OYKA 5C24A 4LH5A 4LSNA 5T7BA 4FJ7A 3PX4A 1SKRA 2D0BA 2HNDA 4CF2A 1HYSA 4O5BA 3OY9A 3TI0A 5HRPA 2E6MA 4OVLA 1RBTA 2FBVA 1Y97A 3SYZA 4B9LA 4DTOA 3QEXA 4FLVA 1YTUA 1ZBIA 3DRRA 4W5OA 4HUFA 2G8IA 2W42A 2YNFA 2HHXA 2GBZA 3T1AA 1CXQA 3NGYA 3ZSXA 4CGGA 3NE6A 4DSIA 4FJGA 3SQ2A 4F2RA 3VQDA 1A5XA 1FKPA 4QAGA 3SUNA 4DTPA 3DOKA 1MU2A 4H4MA 5JS2A 4CFAA 4Q5VA 1IKWA 1LWCA 1JKHA 3CG7A 4C8OA 3TAMA 2EX3A 2HB5A 5J2QA 4CEOA 1LWFA 1WSJA 4CJPA 3OYEA 3IG1A 3ZT0A 3VQCA 4B08A 4FJIA 2KFNA 4RG8A 1RDCA 3VQ6A 1QTMA 2HHVA 3AA5X 1KVBA 1BIZA 3HP6A 3MEEA 4G1QA 3LWLA 3G0ZA 4OLAA 2YKNA 4OJRA 1UA1A 3V6DA 4BDYA 1I39A 4QCLA 1KCFA 4H8KA 4M3YA 1RT4A 3AA2A 1Q9XA 1XI1A 1JLAA 4BACA 3QINA 3LALA 4DTXA 2XY8A 2D5RA 4KHWA 2KTQA 4DU4A 2FBTA 3V4IA 3SPYA 4DSJA 1T05A 2E6LA 1NK5A 3M8QA 4FK0A 2X6NA 3A2FA 1TV6A 3L3UA 3CFPA 3SNNA 3VQ9A 1YVUA 2KW4A 1RT2A 3ISNC 4E7IA 5FRMA 3OS1A 4CK1A 1TK5A 1KFSA 3I0RA 2G8WA 3ZSRA 4CE9A 4EP5A 4OKEA 4E1NA 4OGCA 3NH0A 5KI6A 3EZ5A 4E7KA 1NOYA 1W9HA 1WN7A 4NCAA 5JS1A 1D5AA 1UAXA 1WSEA 2Z1HA 1JLEA 3B6PA 4CF1A 4DF8A 3VN5A 1KVCA 1LAVA 3NF6A 4ZHRA 2G8VA 3RR7A 4FYDA 2XRIA 3QIOA 1NJWA 3SZ2A 3PO5A 1QHTA 1BHLA 1EXQA 3SUQA 2D0AA 3NHGA 1IG9A 3C95A 4CEAA 3RWUA 1LWEA 4FXDA 4DMNA 3AVAA 3OYBA 2OA8A 2P5OA 3UIQA 4FLXA 4DSLA 3QEIA 4FK4A 2IAJA 3OYMA 2DFEA 4ICLA 3AV9A 4DFKA 4KO0A 1SUQA 4M3UA 1HMVA 2Y1JA 2OZSA 3ZCMA 4E0DA 3NH1A 2DFFA 2DFHA 1FXXA 1JL2A 4CK2A 4Y1DA 1RT1A 3OYIA 3TAFA 4FK2A 4C8MA 1NK7A 1ZBHA 3RMAA 3ZSWA 1L5UA 1VSHA 4CFBA 4HCCA 1WLJA 1RTJA 4RW6A 2YHAA 4HUEA 3CYMA 4IG0A 2OPQA 2HHTA 4IFYA 2FBYA 2Z1IA 3HO1A 1C6VA 2P1JA 1T03A 4UQGA 3D45A 4RW8A 3PV8A 2A1SA 2X74A 1FKOA 4DF4A 1C1AA 2RKIA 4M41A 4CFCA 4N76A 2Q3SA 1BQMA 2ZE2A 3AO5A 4EZ6A 4K8XA 1SL0A 4KKOA 1TAQA 3CFOA 1RTHA 4M3WA 4CECA 2G8UA 2KFZA 4O0JA 5DK5A 1EKEA 1RBUA 4O44A 3SQ0A 4AHRA 3NCIA 1JLGA 4DSEA 1B9FA 2HHUA 3KLHA 3V9ZA 3QEVA 4KI6A 1GOBA 1TGOA 2O4GA 3DMJA 3SV4A 3AVKA 2QK9A 3C94A 3SI6A 5HP1A 3P83D 1SKSA 2ZD1A 2OYQA 4CESA 3T3FA 3LP2A 4CJSA 2HHWA 1J9AA 4DLEA 4QOZB 3SJJA 3JYTA 4LY7A 3LAKA 4E7LA 4BE0A 4CIEA 4CGDA 1J53A 1K6YA 1BI4A 4DQQA 1TKDA 3PO4A 3G10A 1VSEA 4RW4A 3OYDA 4FCYA 4FZYA 3AO1A 1D9FA 3RMDA 1F21A 4FJHA 3IS9A 3DLHA 3MAQA 4CERA 2Y1IA 3V81A 3AVCA 3RMCA 3QEWA 3AVBA 3C6TA 2HVHA 3KLIA 3MEGA 1NK9A 2VWJA 1EP4A 3K58A 3KD5E 4AHVA 4JRQA 4FJXA 1J54A 1RT7A 1X1PA 3PUFA 2E4LA 3VQ8A 3CQ8A 1ASVA 4Z4IA 2DTUA 1U04A 4IFVA 3OJUA 4CIFA 4R5PA 4DTSA 1HYZA 4HUGA 1KTQA 2FC0A 3HPOA 3HSTB 4OGEA 3O4QA 4OLBA 3AVHA 3DLRA 3K57A 4E7HA 1BGXT 1S9GA 3V1OA 4CGIA 4DTJA 3KTQA 1RTDA 1SL1A 3KK1A 4ZTFA 1ZBFA 4W5NA 4XIUA 3MEDA 1U49A 2HHQA 4HCBA 3S3NA 4EZ9A 3K5LA 2F96A 2YNIA 3TAEA 2X78A 2G8FA 3ASMA 3DLEA 1TK8A 4KI4A 3RTVA 4B9TA 4B9VA 3BDPA 4CK3A 3KK3A 1S1TA 2ZQBA 3DLGA 4CJVA 4BE2A 1X9WA 2YNGA 4Q0BA 4DS4A 5HLFA 1RBVA 2VWKA 3M8RA 4N41A 4AHCA 1U47A 3P1GA 4E19A 1BCMA 2PZSA 3S9HA 4Z4EA 4BWJA 4M3ZA 5EU7A 3S3MA 4F4KA 3OVNA 2DY4A 1O1WA 3AVMA 4J2AA 2IC3A 4IDKA 3K2PA 3P5JA 4CF8A 3DYAA 4Y1CA 4CHYA 1UWBA 3AVIA 1L3TA 1Z25A 4IBNA 4CJ5A 4PWDA 4NYFA 1Z26A 3LPTA 3SQ4A 4HVJA 1B9DA 2B5JA 5J2PA 3AVFA 2YNHA 5DMRA 2RF2A 1REVA 3V9XA 1RDAA 2G8KA 3HK2A 1LAWA 1S6QA 4CEZA 3OJSA 2NUBA 1RNHA 3MXIA 3L2VA 3LZIA 1R0AA 1L3VA 5HBMA 4CHPA 4CIGA 2XHBA 3QNNA 3HL8A 4EP4A 1BCOA 3KJVA 3VA3A 4C8LA 1UOCA 3AO4A 1ASWA 3LAMA 2XY7A 1JXBA 4KB1A 1ITGA 5CZ2A 3ZT1A 4FZZA 4CEQA 3NGIA 3IRXA 1A5VA 3SV3A 3MECA 2QKKA 1NJYA 2BDPA 3LPUA 4DFJA 4CJQA 5J2MA 1S1XA 2RN2A 1N6QA 2P51A 3TARA 4KB0A 3CM6A 3KLFA 4DU1A 3SUOA 3SCXA 4M42A 3HM9A 3VQ5A 4Z4CA 4JLHA 4DTRA 1NOZA 1RDDA 1CLQA 1WNSA 1CXUA 3LDSA 3QEPA 3IAYA 1HQEA 3OYFA 3NF8A 3AA4A 4MFBA 3KKSA 1SKWA 4CFDA 3HVTA 4KHQA 3QESA 2XY5A 1KVAA 1BI4B 3HPHA 2ITGA 4M3TA 3EY1A 2Z1JA 1C0TA 3TR8A 4WE1A 4DQPA 2PYJA 5K14A 3AVNA 4I9LA 1VSMA 3SQ1A 4B9NA 4PQUA 2BANA 4FLYA 2JLEA 3KD1E 1VSKA 3DRPA 5C25A 4I9QA 2GUIA 2I5JA 3I0SA 2IGIA 2YKMA 3V9UA 3PY8A 4CJKA 4DS5A 1DLOA 2WOMA 4ID1A 2KZZA 4AHTA 2LSNA 3V1RA 3JSMA 3DI6A 5FROA 3F73A 2ETJA 2X6SA 1KSPA 1S1UA 3QERA 3FFIA 3HP9A 1JLBA 4RW9A 4B8AB 4ID5A 4PA1A 4H4OA 4DTNA 4CHNA 4O0IA 1SL2A 4M45A 4CCHA 4FJJA 1RBRA 2BGGA 1IH7A 4J2EA 1RILA 3ZSVA 2Z1GA 3LWMA 1L3SA 4B9MA 3HVRA 1NJZA 3DLBA 4CGHA 4FW1A 1VK0A 3T19A 1B92A 2HNZA 3VQ7A 3U3YA 1XHZA 3NGZA 1BQNA 3OYAA 5CZ1A 4DQSA 1QSYA 5D3GA 3L2UA 1ZYQA 1RTIA 1KLMA 3F9KA 3NF7A 3HT3A 4BE1A 4E7JA 1NK6A 1RT3A 3VA0A 4IKFA 3QO9A 4N5SA 4L8RB 3SUPA 1ZBLA 4CHQA 4I2PA 1L3UA 1CZ9A 1EETA 1S6PA 1JL1A 1HNVA 2XY6A 2PY5A 3KIOA 4C8KA 2F8SA 3QETA 1WSHA 4CGFA 3RRHA 1NKCA 3VQAA 1XHXA 1TKTA 1YTAA 4CJLA 4LSLA 3ZSOA 3KLGA 3L3VA 5HRSA 2F8TA 2KQ2A 3MXMA 5CY4A 4CGJA 4KAZA 1WAJA 4M3XA 1QS4A 3AO2A 4CEEA 2QKBA 1VSLA 1S1WA 5I42A 4CHOA 4CJ3A 1UA0A 1DTQA 4FJLA 3NDKA 3AVLA 3D0PA 4KTQA 4PUOA 2R7YA 1GOCA 1LW0A 3VQBA 3NAEA 3DLKA 1GOAA 4RW7A 3ZSZA 4CEFA 4FJMA 3M8SA 4JRPA 3L2QA 2D0CA 4FM1A 3NFAA 1C1BA 4TSXA 4NCBA 3VQ4A 4FM0A 1QSSA 5HROA 1BL3A 5CYMA 1VRTA 3TAGA 4KHSA 2AJQA 4W5QA 2GV9A 2HNYA 3ITHA 3OYGA 4DTUA 1NJXA 1DTTA 4HTUA 4FJKA 4CF0A 5CYQA 3DRSA 4IG3A 1JXEA 1CZBA 3H08A 4AHUA 4Z4GA 5KRSA 1RBSA 1WSFA 1YT3A 4M3RA 1NKBA 3ALYA 1TKZA 1HNIA 1Q9YA 3THVA 4AHSA 2WONA 1C1CA 1WAFA 4W5RA 4BDZA 3C6UA 5KGWA 1JLCA 4Z4FA 1LW2A 3KK2A 1IO2A 1X9MA 3WNHA 4KHYA 1RCHA 4DLGA 4J2DA 3O3GA 4F8RA 3OYJA 4DWIA 1WSGA 4PY5A 4ELTA 1HRHA 2OPRA 3BGRA 1S9EA 4OKJA 4N47A 3U3GA 4FZXC 1TVRA 4DQRA 3O3HA 2B4JA 3NH2A 3MXJA 4CJWA 1KFDA 2BE2A 3CM5A 4JS4A 4F3OA 4FJ5A 2HHSA 1VSDA 3QLHA 4DTMA 2B6AA 2YV0X 1N5YA 2KZMA 2VG7A 3LANA 3L2RA 1KLNA 4CJ4A 4ELVA 3ZSQA 5KRTA 3TAQA 5C42A 1BIUA 5E41A 4Z4HA 3I8DA 2ATQA 3V9SA 2QXFA 1S1VA 4Z0UA 1JLFA 3WNEA 5J2NA 4CJFA 1RT5A 5KGXA 2IDOA 4KREA 2VG5A 3TAPA 2IS3A 1S5JA 1QQCA 5FRNA 2HW3A 1U4BA 4KRFA 2VG6A 5KTQA 4B3OA 4KV8A 3LP1A 1TKXA 2OPSA 4CHZA 2HVIA 4DQIA 4O55A 5FDLA 1RT6A 1RDBA 1U45A 3OS0A 2HMIA 3L2WA 3HXMA 3ULDA 1NKEA 2OPPA 4KFBA 3V1QA 4J2BA 2IOCA 1ZBUA 1HYVA 1A5WA 3AA3A 4DU3A 1D8YA 4FLUA 3OYLA 1BISA 3TANA 4OKKA 1TK0A 3K5NA 3DM2A 4FM2A 1T8EA 1QE1A 1VSIA 3OS2A 4FVMA 4HHTA 2XO7A 2EHGA 1X9SA 1KRPA 4K8ZA 3U6FA 1LV5A 1D9DA 4FJNA 3LP0A 4CEDA 4DFMA 4CEBA 4O4GA 4KHNA 3RRGA 4CJUA 1XC9A 3L8BA 1XWLA 4OPKA 4YNQA 4NYNA 3ZSYA 3VQQA 4E3SA 1HJRA 3V9WA 4GVMA 4B9SA 1NK0A 5SWMA 4CJTA 4KHUA 3HYFA 4FJ9A 3M8PA 3HJFA 2G8HA 2OZMA 3K5MA 3KLEA 4FLWA 1VRUA 1T7PA 3EYZA 5J1EA 1JLQA 3CFRA 4AILC 3OYCA 4DSFA 4LD0A 4AH9A 4DSKA 4E89A 3VQPA 4CJRA 4F2SA 3HPGA 4C8NA 5HRNA 4OPJA 3WNFA 3PX0A 3TABA 3LP3A 2P5GA 1J5OA 4CF9A 4YFUA 3OYHA 4DFPA 4B9UA 4FW2A 1ASUA 1VSFA 1FK9A 3SPZA 3RR8A 1C0UA 1EX4A 3QIPA 3AO3A 1NK8A 4KTWA 5HRRA 1IKVA 4MQ3A 4CJEA 4FJ8A 1SV5A 3NBPA 3B6OA 4KTZA 4DG1A 2RPIA 4I2QA 3AVJA 1TL1A 3O3FA 4FLTA 4ELUA 4GMJB 1U48A 2JGUA 3LZJA 1C0MA 3TWHA 4NCGA 3PX6A 1HQUA 5I3UA 3KKRA 1G15A 1IKYA 1W0HA 2FBXA 4FLZA 3QNOA 3O4NA 1TAUA 4KPYA 3VQEA 4LH4A 1QSLA 5SZTA 3S3OA 2PYLA 1Q8IA 2A1RA 2YHBA 1IKXA 3WNGA 1NK4A 1VSJA 1TL3A 4GW6A 3K5OA 3K59A 3ZT3A 3RMBA 4BWMA 3NF9A 3AVGA 4N56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JS5 A;  3DOL A;  2O4I A;  4BDP A;  3ZT2 A;  4I7F A;  4E1M A;  1I3A A;  4F3T A;  1HPZ A;  3OYN A;  4ZTJ A;  4W5T A;  1WSI A;  3E01 A;  3ZT4 A;  4B8C A;  3OYK A;  5C24 A;  4LH5 A;  4LSN A;  5T7B A;  4FJ7 A;  3PX4 A;  1SKR A;  2D0B A;  2HND A;  4CF2 A;  1HYS A;  4O5B A;  3OY9 A;  3TI0 A;  5HRP A;  2E6M A;  4OVL A;  1RBT A;  2FBV A;  1Y97 A;  3SYZ A;  4B9L A;  4DTO A;  3QEX A;  4FLV A;  1YTU A;  1ZBI A;  3DRR A;  4W5O A;  4HUF A;  2G8I A;  2W42 A;  2YNF A;  2HHX A;  2GBZ A;  3T1A A;  1CXQ A;  3NGY A;  3ZSX A;  4CGG A;  3NE6 A;  4DSI A;  4FJG A;  3SQ2 A;  4F2R A;  3VQD A;  1A5X A;  1FKP A;  4QAG A;  3SUN A;  4DTP A;  3DOK A;  1MU2 A;  4H4M A;  5JS2 A;  4CFA A;  4Q5V A;  1IKW A;  1LWC A;  1JKH A;  3CG7 A;  4C8O A;  3TAM A;  2EX3 A;  2HB5 A;  5J2Q A;  4CEO A;  1LWF A;  1WSJ A;  4CJP A;  3OYE A;  3IG1 A;  3ZT0 A;  3VQC A;  4B08 A;  4FJI A;  2KFN A;  4RG8 A;  1RDC A;  3VQ6 A;  1QTM A;  2HHV A;  3AA5 X;  1KVB A;  1BIZ A;  3HP6 A;  3MEE A;  4G1Q A;  3LWL A;  3G0Z A;  4OLA A;  2YKN A;  4OJR A;  1UA1 A;  3V6D A;  4BDY A;  1I39 A;  4QCL A;  1KCF A;  4H8K A;  4M3Y A;  1RT4 A;  3AA2 A;  1Q9X A;  1XI1 A;  1JLA A;  4BAC A;  3QIN A;  3LAL A;  4DTX A;  2XY8 A;  2D5R A;  4KHW A;  2KTQ A;  4DU4 A;  2FBT A;  3V4I A;  3SPY A;  4DSJ A;  1T05 A;  2E6L A;  1NK5 A;  3M8Q A;  4FK0 A;  2X6N A;  3A2F A;  1TV6 A;  3L3U A;  3CFP A;  3SNN A;  3VQ9 A;  1YVU A;  2KW4 A;  1RT2 A;  3ISN C;  4E7I A;  5FRM A;  3OS1 A;  4CK1 A;  1TK5 A;  1KFS A;  3I0R A;  2G8W A;  3ZSR A;  4CE9 A;  4EP5 A;  4OKE A;  4E1N A;  4OGC A;  3NH0 A;  5KI6 A;  3EZ5 A;  4E7K A;  1NOY A;  1W9H A;  1WN7 A;  4NCA A;  5JS1 A;  1D5A A;  1UAX A;  1WSE A;  2Z1H A;  1JLE A;  3B6P A;  4CF1 A;  4DF8 A;  3VN5 A;  1KVC A;  1LAV A;  3NF6 A;  4ZHR A;  2G8V A;  3RR7 A;  4FYD A;  2XRI A;  3QIO A;  1NJW A;  3SZ2 A;  3PO5 A;  1QHT A;  1BHL A;  1EXQ A;  3SUQ A;  2D0A A;  3NHG A;  1IG9 A;  3C95 A;  4CEA A;  3RWU A;  1LWE A;  4FXD A;  4DMN A;  3AVA A;  3OYB A;  2OA8 A;  2P5O A;  3UIQ A;  4FLX A;  4DSL A;  3QEI A;  4FK4 A;  2IAJ A;  3OYM A;  2DFE A;  4ICL A;  3AV9 A;  4DFK A;  4KO0 A;  1SUQ A;  4M3U A;  1HMV A;  2Y1J A;  2OZS A;  3ZCM A;  4E0D A;  3NH1 A;  2DFF A;  2DFH A;  1FXX A;  1JL2 A;  4CK2 A;  4Y1D A;  1RT1 A;  3OYI A;  3TAF A;  4FK2 A;  4C8M A;  1NK7 A;  1ZBH A;  3RMA A;  3ZSW A;  1L5U A;  1VSH A;  4CFB A;  4HCC A;  1WLJ A;  1RTJ A;  4RW6 A;  2YHA A;  4HUE A;  3CYM A;  4IG0 A;  2OPQ A;  2HHT A;  4IFY A;  2FBY A;  2Z1I A;  3HO1 A;  1C6V A;  2P1J A;  1T03 A;  4UQG A;  3D45 A;  4RW8 A;  3PV8 A;  2A1S A;  2X74 A;  1FKO A;  4DF4 A;  1C1A A;  2RKI A;  4M41 A;  4CFC A;  4N76 A;  2Q3S A;  1BQM A;  2ZE2 A;  3AO5 A;  4EZ6 A;  4K8X A;  1SL0 A;  4KKO A;  1TAQ A;  3CFO A;  1RTH A;  4M3W A;  4CEC A;  2G8U A;  2KFZ A;  4O0J A;  5DK5 A;  1EKE A;  1RBU A;  4O44 A;  3SQ0 A;  4AHR A;  3NCI A;  1JLG A;  4DSE A;  1B9F A;  2HHU A;  3KLH A;  3V9Z A;  3QEV A;  4KI6 A;  1GOB A;  1TGO A;  2O4G A;  3DMJ A;  3SV4 A;  3AVK A;  2QK9 A;  3C94 A;  3SI6 A;  5HP1 A;  3P83 D;  1SKS A;  2ZD1 A;  2OYQ A;  4CES A;  3T3F A;  3LP2 A;  4CJS A;  2HHW A;  1J9A A;  4DLE A;  4QOZ B;  3SJJ A;  3JYT A;  4LY7 A;  3LAK A;  4E7L A;  4BE0 A;  4CIE A;  4CGD A;  1J53 A;  1K6Y A;  1BI4 A;  4DQQ A;  1TKD A;  3PO4 A;  3G10 A;  1VSE A;  4RW4 A;  3OYD A;  4FCY A;  4FZY A;  3AO1 A;  1D9F A;  3RMD A;  1F21 A;  4FJH A;  3IS9 A;  3DLH A;  3MAQ A;  4CER A;  2Y1I A;  3V81 A;  3AVC A;  3RMC A;  3QEW A;  3AVB A;  3C6T A;  2HVH A;  3KLI A;  3MEG A;  1NK9 A;  2VWJ A;  1EP4 A;  3K58 A;  3KD5 E;  4AHV A;  4JRQ A;  4FJX A;  1J54 A;  1RT7 A;  1X1P A;  3PUF A;  2E4L A;  3VQ8 A;  3CQ8 A;  1ASV A;  4Z4I A;  2DTU A;  1U04 A;  4IFV A;  3OJU A;  4CIF A;  4R5P A;  4DTS A;  1HYZ A;  4HUG A;  1KTQ A;  2FC0 A;  3HPO A;  3HST B;  4OGE A;  3O4Q A;  4OLB A;  3AVH A;  3DLR A;  3K57 A;  4E7H A;  1BGX T;  1S9G A;  3V1O A;  4CGI A;  4DTJ A;  3KTQ A;  1RTD A;  1SL1 A;  3KK1 A;  4ZTF A;  1ZBF A;  4W5N A;  4XIU A;  3MED A;  1U49 A;  2HHQ A;  4HCB A;  3S3N A;  4EZ9 A;  3K5L A;  2F96 A;  2YNI A;  3TAE A;  2X78 A;  2G8F A;  3ASM A;  3DLE A;  1TK8 A;  4KI4 A;  3RTV A;  4B9T A;  4B9V A;  3BDP A;  4CK3 A;  3KK3 A;  1S1T A;  2ZQB A;  3DLG A;  4CJV A;  4BE2 A;  1X9W A;  2YNG A;  4Q0B A;  4DS4 A;  5HLF A;  1RBV A;  2VWK A;  3M8R A;  4N41 A;  4AHC A;  1U47 A;  3P1G A;  4E19 A;  1BCM A;  2PZS A;  3S9H A;  4Z4E A;  4BWJ A;  4M3Z A;  5EU7 A;  3S3M A;  4F4K A;  3OVN A;  2DY4 A;  1O1W A;  3AVM A;  4J2A A;  2IC3 A;  4IDK A;  3K2P A;  3P5J A;  4CF8 A;  3DYA A;  4Y1C A;  4CHY A;  1UWB A;  3AVI A;  1L3T A;  1Z25 A;  4IBN A;  4CJ5 A;  4PWD A;  4NYF A;  1Z26 A;  3LPT A;  3SQ4 A;  4HVJ A;  1B9D A;  2B5J A;  5J2P A;  3AVF A;  2YNH A;  5DMR A;  2RF2 A;  1REV A;  3V9X A;  1RDA A;  2G8K A;  3HK2 A;  1LAW A;  1S6Q A;  4CEZ A;  3OJS A;  2NUB A;  1RNH A;  3MXI A;  3L2V A;  3LZI A;  1R0A A;  1L3V A;  5HBM A;  4CHP A;  4CIG A;  2XHB A;  3QNN A;  3HL8 A;  4EP4 A;  1BCO A;  3KJV A;  3VA3 A;  4C8L A;  1UOC A;  3AO4 A;  1ASW A;  3LAM A;  2XY7 A;  1JXB A;  4KB1 A;  1ITG A;  5CZ2 A;  3ZT1 A;  4FZZ A;  4CEQ A;  3NGI A;  3IRX A;  1A5V A;  3SV3 A;  3MEC A;  2QKK A;  1NJY A;  2BDP A;  3LPU A;  4DFJ A;  4CJQ A;  5J2M A;  1S1X A;  2RN2 A;  1N6Q A;  2P51 A;  3TAR A;  4KB0 A;  3CM6 A;  3KLF A;  4DU1 A;  3SUO A;  3SCX A;  4M42 A;  3HM9 A;  3VQ5 A;  4Z4C A;  4JLH A;  4DTR A;  1NOZ A;  1RDD A;  1CLQ A;  1WNS A;  1CXU A;  3LDS A;  3QEP A;  3IAY A;  1HQE A;  3OYF A;  3NF8 A;  3AA4 A;  4MFB A;  3KKS A;  1SKW A;  4CFD A;  3HVT A;  4KHQ A;  3QES A;  2XY5 A;  1KVA A;  1BI4 B;  3HPH A;  2ITG A;  4M3T A;  3EY1 A;  2Z1J A;  1C0T A;  3TR8 A;  4WE1 A;  4DQP A;  2PYJ A;  5K14 A;  3AVN A;  4I9L A;  1VSM A;  3SQ1 A;  4B9N A;  4PQU A;  2BAN A;  4FLY A;  2JLE A;  3KD1 E;  1VSK A;  3DRP A;  5C25 A;  4I9Q A;  2GUI A;  2I5J A;  3I0S A;  2IGI A;  2YKM A;  3V9U A;  3PY8 A;  4CJK A;  4DS5 A;  1DLO A;  2WOM A;  4ID1 A;  2KZZ A;  4AHT A;  2LSN A;  3V1R A;  3JSM A;  3DI6 A;  5FRO A;  3F73 A;  2ETJ A;  2X6S A;  1KSP A;  1S1U A;  3QER A;  3FFI A;  3HP9 A;  1JLB A;  4RW9 A;  4B8A B;  4ID5 A;  4PA1 A;  4H4O A;  4DTN A;  4CHN A;  4O0I A;  1SL2 A;  4M45 A;  4CCH A;  4FJJ A;  1RBR A;  2BGG A;  1IH7 A;  4J2E A;  1RIL A;  3ZSV A;  2Z1G A;  3LWM A;  1L3S A;  4B9M A;  3HVR A;  1NJZ A;  3DLB A;  4CGH A;  4FW1 A;  1VK0 A;  3T19 A;  1B92 A;  2HNZ A;  3VQ7 A;  3U3Y A;  1XHZ A;  3NGZ A;  1BQN A;  3OYA A;  5CZ1 A;  4DQS A;  1QSY A;  5D3G A;  3L2U A;  1ZYQ A;  1RTI A;  1KLM A;  3F9K A;  3NF7 A;  3HT3 A;  4BE1 A;  4E7J A;  1NK6 A;  1RT3 A;  3VA0 A;  4IKF A;  3QO9 A;  4N5S A;  4L8R B;  3SUP A;  1ZBL A;  4CHQ A;  4I2P A;  1L3U A;  1CZ9 A;  1EET A;  1S6P A;  1JL1 A;  1HNV A;  2XY6 A;  2PY5 A;  3KIO A;  4C8K A;  2F8S A;  3QET A;  1WSH A;  4CGF A;  3RRH A;  1NKC A;  3VQA A;  1XHX A;  1TKT A;  1YTA A;  4CJL A;  4LSL A;  3ZSO A;  3KLG A;  3L3V A;  5HRS A;  2F8T A;  2KQ2 A;  3MXM A;  5CY4 A;  4CGJ A;  4KAZ A;  1WAJ A;  4M3X A;  1QS4 A;  3AO2 A;  4CEE A;  2QKB A;  1VSL A;  1S1W A;  5I42 A;  4CHO A;  4CJ3 A;  1UA0 A;  1DTQ A;  4FJL A;  3NDK A;  3AVL A;  3D0P A;  4KTQ A;  4PUO A;  2R7Y A;  1GOC A;  1LW0 A;  3VQB A;  3NAE A;  3DLK A;  1GOA A;  4RW7 A;  3ZSZ A;  4CEF A;  4FJM A;  3M8S A;  4JRP A;  3L2Q A;  2D0C A;  4FM1 A;  3NFA A;  1C1B A;  4TSX A;  4NCB A;  3VQ4 A;  4FM0 A;  1QSS A;  5HRO A;  1BL3 A;  5CYM A;  1VRT A;  3TAG A;  4KHS A;  2AJQ A;  4W5Q A;  2GV9 A;  2HNY A;  3ITH A;  3OYG A;  4DTU A;  1NJX A;  1DTT A;  4HTU A;  4FJK A;  4CF0 A;  5CYQ A;  3DRS A;  4IG3 A;  1JXE A;  1CZB A;  3H08 A;  4AHU A;  4Z4G A;  5KRS A;  1RBS A;  1WSF A;  1YT3 A;  4M3R A;  1NKB A;  3ALY A;  1TKZ A;  1HNI A;  1Q9Y A;  3THV A;  4AHS A;  2WON A;  1C1C A;  1WAF A;  4W5R A;  4BDZ A;  3C6U A;  5KGW A;  1JLC A;  4Z4F A;  1LW2 A;  3KK2 A;  1IO2 A;  1X9M A;  3WNH A;  4KHY A;  1RCH A;  4DLG A;  4J2D A;  3O3G A;  4F8R A;  3OYJ A;  4DWI A;  1WSG A;  4PY5 A;  4ELT A;  1HRH A;  2OPR A;  3BGR A;  1S9E A;  4OKJ A;  4N47 A;  3U3G A;  4FZX C;  1TVR A;  4DQR A;  3O3H A;  2B4J A;  3NH2 A;  3MXJ A;  4CJW A;  1KFD A;  2BE2 A;  3CM5 A;  4JS4 A;  4F3O A;  4FJ5 A;  2HHS A;  1VSD A;  3QLH A;  4DTM A;  2B6A A;  2YV0 X;  1N5Y A;  2KZM A;  2VG7 A;  3LAN A;  3L2R A;  1KLN A;  4CJ4 A;  4ELV A;  3ZSQ A;  5KRT A;  3TAQ A;  5C42 A;  1BIU A;  5E41 A;  4Z4H A;  3I8D A;  2ATQ A;  3V9S A;  2QXF A;  1S1V A;  4Z0U A;  1JLF A;  3WNE A;  5J2N A;  4CJF A;  1RT5 A;  5KGX A;  2IDO A;  4KRE A;  2VG5 A;  3TAP A;  2IS3 A;  1S5J A;  1QQC A;  5FRN A;  2HW3 A;  1U4B A;  4KRF A;  2VG6 A;  5KTQ A;  4B3O A;  4KV8 A;  3LP1 A;  1TKX A;  2OPS A;  4CHZ A;  2HVI A;  4DQI A;  4O55 A;  5FDL A;  1RT6 A;  1RDB A;  1U45 A;  3OS0 A;  2HMI A;  3L2W A;  3HXM A;  3ULD A;  1NKE A;  2OPP A;  4KFB A;  3V1Q A;  4J2B A;  2IOC A;  1ZBU A;  1HYV A;  1A5W A;  3AA3 A;  4DU3 A;  1D8Y A;  4FLU A;  3OYL A;  1BIS A;  3TAN A;  4OKK A;  1TK0 A;  3K5N A;  3DM2 A;  4FM2 A;  1T8E A;  1QE1 A;  1VSI A;  3OS2 A;  4FVM A;  4HHT A;  2XO7 A;  2EHG A;  1X9S A;  1KRP A;  4K8Z A;  3U6F A;  1LV5 A;  1D9D A;  4FJN A;  3LP0 A;  4CED A;  4DFM A;  4CEB A;  4O4G A;  4KHN A;  3RRG A;  4CJU A;  1XC9 A;  3L8B A;  1XWL A;  4OPK A;  4YNQ A;  4NYN A;  3ZSY A;  3VQQ A;  4E3S A;  1HJR A;  3V9W A;  4GVM A;  4B9S A;  1NK0 A;  5SWM A;  4CJT A;  4KHU A;  3HYF A;  4FJ9 A;  3M8P A;  3HJF A;  2G8H A;  2OZM A;  3K5M A;  3KLE A;  4FLW A;  1VRU A;  1T7P A;  3EYZ A;  5J1E A;  1JLQ A;  3CFR A;  4AIL C;  3OYC A;  4DSF A;  4LD0 A;  4AH9 A;  4DSK A;  4E89 A;  3VQP A;  4CJR A;  4F2S A;  3HPG A;  4C8N A;  5HRN A;  4OPJ A;  3WNF A;  3PX0 A;  3TAB A;  3LP3 A;  2P5G A;  1J5O A;  4CF9 A;  4YFU A;  3OYH A;  4DFP A;  4B9U A;  4FW2 A;  1ASU A;  1VSF A;  1FK9 A;  3SPZ A;  3RR8 A;  1C0U A;  1EX4 A;  3QIP A;  3AO3 A;  1NK8 A;  4KTW A;  5HRR A;  1IKV A;  4MQ3 A;  4CJE A;  4FJ8 A;  1SV5 A;  3NBP A;  3B6O A;  4KTZ A;  4DG1 A;  2RPI A;  4I2Q A;  3AVJ A;  1TL1 A;  3O3F A;  4FLT A;  4ELU A;  4GMJ B;  1U48 A;  2JGU A;  3LZJ A;  1C0M A;  3TWH A;  4NCG A;  3PX6 A;  1HQU A;  5I3U A;  3KKR A;  1G15 A;  1IKY A;  1W0H A;  2FBX A;  4FLZ A;  3QNO A;  3O4N A;  1TAU A;  4KPY A;  3VQE A;  4LH4 A;  1QSL A;  5SZT A;  3S3O A;  2PYL A;  1Q8I A;  2A1R A;  2YHB A;  1IKX A;  3WNG A;  1NK4 A;  1VSJ A;  1TL3 A;  4GW6 A;  3K5O A;  3K59 A;  3ZT3 A;  3RMB A;  4BWM A;  3NF9 A;  3AVG A;  4N56 A; 
#chains in the Genus database with same CATH topology
 4JS5 A;  2O4I A;  3G25 A;  4Y0W A;  1ATR A;  4ZTJ A;  3AY9 A;  3OYK A;  3S41 A;  3OBW A;  4LSN A;  1HYS A;  2HND A;  4H5N A;  2FBV A;  4X62 K;  1J5E K;  4DTO A;  2Q0R A;  1LCU A;  3QEX A;  4FLV A;  4WYB A;  4HUF A;  1QQN A;  2G8I A;  3T1A A;  3ZSX A;  4FJG A;  4DSI A;  1E3M A;  4JI0 K;  1MU2 A;  1IKW A;  3CG7 A;  2Q2R A;  2KHO A;  3H1V X;  1LWF A;  1WSJ A;  4CJP A;  3OYE A;  2OTL N;  3ZT0 A;  4MDA A;  4FJI A;  2QTD A;  4RG8 A;  1HKB A;  2HHV A;  3HP6 A;  3LWL A;  3CC2 N;  4OLA A;  3G4S N;  3TSP A;  4BDY A;  4B1Z A;  3AA2 A;  1Q9X A;  1XI1 A;  2RHK A;  3HRG A;  3C0B A;  2F7T A;  4DTX A;  3MX2 A;  3R6M A;  5ADX H;  4KHW A;  2W6L A;  3V4I A;  5CR4 A;  3SPY A;  1T05 A;  4CZL A;  1K9M O;  2X6N A;  1VQN N;  1LOT B;  4E7I A;  1RT2 A;  3OS1 A;  3DLL L;  1TK5 A;  3F2K A;  2ZF5 O;  4E1N A;  4E7K A;  3N4Q A;  1ZBS A;  2E1Z A;  1NGC A;  3EE9 A;  1UAX A;  2Z1H A;  1LAV A;  1Y64 A;  2WTU A;  3CD6 N;  1NJW A;  5AQO A;  4JK8 A;  1QHT A;  1BHL A;  3ZEU B;  1BU6 O;  4IDH A;  3RWU A;  2NRR A;  4DMN A;  3OYB A;  2V52 B;  2OA8 A;  1HPM A;  2P5O A;  4FLX A;  3QEI A;  2NLX A;  2UUC K;  4DR1 K;  4JHD A;  4ICL A;  3BY5 A;  2CGJ A;  3NH1 A;  1BOT O;  5KQD A;  3CJA A;  4JK9 A;  1JJ2 M;  1L5U A;  3H3O B;  5BR8 K;  4RW6 A;  2O8D A;  4HUE A;  4M7Y A;  2OPQ A;  3VTI A;  2A1S A;  4LF9 K;  2Q3S A;  3U4L A;  3AO5 A;  4I6M A;  1SL0 A;  4KKO A;  3WXK A;  1RTH A;  2QW9 A;  4CEC A;  2KFZ A;  5M1K A;  3CCL N;  4AHR A;  4DR5 K;  1JLG A;  2GTD A;  3KLH A;  3V9Z A;  3QEV A;  3O1W A;  3SMS A;  3CCS N;  1GOB A;  1TGO A;  3SI6 A;  5HP1 A;  1OKJ A;  4CES A;  3CJ7 A;  2HHW A;  4QOZ B;  3JYT A;  4LY7 A;  3ID8 A;  4CGD A;  1K6Y A;  3G10 A;  1S3X A;  1D9F A;  5EOY A;  3RMD A;  1F21 A;  3IS9 A;  3DLH A;  1YAG A;  4FWO A;  4JN4 A;  2QM1 A;  4BQL A;  1NK9 A;  1OH6 A;  1XNQ K;  4FJX A;  4Z4I A;  1M90 O;  1U04 A;  2QWL A;  3WXM B;  3MMV A;  3HPO A;  1OH7 A;  3HST B;  3O4Q A;  3AVH A;  2A6A A;  1KD1 O;  4FWL A;  1DEJ A;  1BGX T;  1S9G A;  4NLB A;  4E7H A;  4DR6 K;  5M1N A;  3KK1 A;  4ZTF A;  4W5N A;  1U49 A;  4FWP A;  2HHQ A;  3UKR A;  2AP1 A;  4G9Z A;  4HCB A;  4FL9 A;  2F96 A;  3TAE A;  2X78 A;  1XUP O;  3DLE A;  3SBG A;  4KI4 A;  4UY8 O;  2O8B A;  4B9T A;  2HBJ A;  2QK9 A;  4Q0B A;  3DLG A;  1XMQ K;  1N34 K;  5HLF A;  4WQ5 C;  4A61 A;  2VWK A;  1QVG M;  4AHC A;  1U47 A;  4PL8 A;  4BRE A;  4A2A A;  3CCM N;  4BWJ A;  3N4P A;  4H5R A;  5EU7 A;  3S3M A;  3OVN A;  2DY4 A;  1O1W A;  4J2A A;  2IC3 A;  4IDK A;  3SJH A;  2NRV A;  4Y1C A;  4CHY A;  3AVI A;  1L3T A;  4IBN A;  3D7E O;  3IDH A;  2UUB K;  3SQ4 A;  4HVJ A;  1B9D A;  5JIC A;  2YNH A;  3O5B A;  2RF2 A;  4LFB K;  4ILG B;  5EX5 A;  4XH1 A;  3LZI A;  1R0A A;  2XHB A;  3HL8 A;  3VA3 A;  4C8L A;  1UOC A;  3AO4 A;  3NVM A;  1ASW A;  1ITG A;  4CEQ A;  4BRH A;  4Z94 A;  4BRO A;  4BGA A;  4JAX A;  3C6A A;  2RN2 A;  4KB0 A;  3SUO A;  3SCX A;  3LDP A;  1CLQ A;  1GLF O;  4BQZ A;  3AA4 A;  3PSF A;  2QA4 N;  1SKW A;  3QES A;  4XH5 A;  1K73 O;  4ISE A;  2Z1J A;  1C0T A;  4WE1 A;  3PIP L;  4I9L A;  3SQ1 A;  2BAN A;  4FLY A;  3KD1 E;  3J8A A;  2AA4 A;  5JVG L;  1VQM N;  4I9Q A;  2NRW A;  2GUI A;  3I0S A;  4IJN A;  4DS5 A;  4B3T K;  3DI6 A;  2W41 A;  5FRO A;  5DM6 L;  3F73 A;  1S1U A;  3FE1 A;  3FFI A;  3C6H A;  4ID5 A;  4PA1 A;  4H4O A;  4CHN A;  4M45 A;  3CCV N;  5AR0 A;  2Z1G A;  3LWM A;  4GKJ K;  3Q7B A;  5F1X A;  4CGH A;  4FW1 A;  3T19 A;  3VQ7 A;  2E20 A;  3ENB A;  3FLC O;  4IZ9 A;  3DAW A;  4CZF A;  1ZYQ A;  3ULE A;  3FZH A;  3NF7 A;  4E7J A;  4F9O A;  4JI2 K;  3L0Q A;  1YI2 N;  4DV5 K;  4JKA A;  3VA0 A;  4IKF A;  2ASP A;  1L3U A;  1YF5 L;  3EKU A;  1JL1 A;  3QET A;  1TKT A;  4FWK A;  3L3V A;  4BRN A;  2KQ2 A;  2FF3 B;  5CY4 A;  4KAZ A;  1QS4 A;  3ULE B;  3AO2 A;  4CEE A;  4R79 A;  2QKB A;  4FWM A;  3ZEU A;  4DV2 K;  1LW0 A;  3ZSZ A;  4JRP A;  3L2Q A;  3NFA A;  4NCB A;  3G6E N;  3TTF A;  5A2Q O;  1VHX A;  3TPQ A;  4W5Q A;  2GV9 A;  2HNY A;  3SAF A;  1NJX A;  1VQ8 N;  3CJC A;  5CYQ A;  3H08 A;  4M3R A;  4JI8 K;  1GLA G;  4W5R A;  1C1C A;  4BDZ A;  1WBD A;  4Z4F A;  1JLC A;  1LW2 A;  3KK2 A;  1X9M A;  3WNH A;  4KHY A;  1RCH A;  4NXN K;  4L3Q A;  4BRI A;  4DWI A;  1WSG A;  2VQF K;  3CHW A;  3U3G A;  3HSC A;  4DR7 K;  3OHR A;  3O8M A;  3O3H A;  2B4J A;  3O9U A;  3MXJ A;  4CJW A;  1YVN A;  5AZJ A;  4JS4 A;  2NRX A;  1NM1 A;  1S22 A;  1VSD A;  3QLH A;  1N5Y A;  3T69 A;  4YOT A;  4Z4H A;  2ATQ A;  4CW7 B;  5EVZ A;  4JI7 K;  2O8F A;  4FWR A;  4A2B A;  1S5J A;  2GWJ A;  3LDO A;  2P9I B;  3MCA B;  2VG6 A;  2O8E B;  3CC4 N;  3TU5 A;  4DQI A;  4JKE A;  2Q31 A;  4AM7 A;  4J2B A;  5FPD A;  2Q97 A;  1A5W A;  3T7Z A;  4OKK A;  1TK0 A;  1RFQ A;  3K5N A;  4FM2 A;  1QE1 A;  3OS2 A;  4FVM A;  2YCH A;  4CED A;  4O4G A;  1XC9 A;  3CIP A;  1XWL A;  1YXQ A;  3ZSY A;  2D0O A;  4MLH A;  3M8P A;  3K5M A;  3KLE A;  2CGL A;  1U2V A;  3MCP A;  4JKC A;  1I94 K;  4DSK A;  3GL1 A;  3VQP A;  3SK3 A;  3PX0 A;  3O9R A;  2P5G A;  4YFU A;  3OYH A;  4DFP A;  3A5N C;  4GY2 B;  3RR8 A;  3SPZ A;  1EX4 A;  3MWT A;  4BRA A;  1HR0 K;  2DPN A;  4MQ3 A;  4YOU A;  3NBP A;  4RTF D;  3LDN A;  4I2Q A;  2O8D B;  2JGU A;  4DB3 A;  2UXD K;  3LZJ A;  3TWH A;  5BRD A;  4B1Y B;  2FBX A;  4FPA A;  3CXC M;  3VF4 A;  3O4N A;  4KPY A;  3C7N A;  4EHT A;  1QSL A;  3S3O A;  3SBT A;  5FPM A;  1VQ5 N;  1RDW X;  1TL3 A;  3K5O A;  4C1N K;  2UXB K;  3ID6 A;  4BDP A;  1I3A A;  1HPZ A;  4W5T A;  3ZT4 A;  4FJ7 A;  1SKR A;  4CF2 A;  4O5B A;  3OY9 A;  1RBT A;  2F4V K;  2FLO A;  1Y97 A;  4B9L A;  2YHW A;  1ZBI A;  1IJJ A;  4OX9 K;  1CXQ A;  1EWR A;  4CGG A;  3SQ2 A;  3VQD A;  1A5X A;  3SUN A;  3DOK A;  4CFA A;  4H4M A;  1YIJ N;  4LFA K;  3TAM A;  2HB5 A;  5J2Q A;  4CEO A;  1ATN A;  3VQC A;  4MDB A;  2O8C A;  1BIZ A;  3G0Z A;  2GEM A;  1DT9 A;  4AF1 A;  4M3Y A;  4QS8 A;  5C2D A;  4BAC A;  3P39 A;  2D5R A;  3D2F B;  4DU4 A;  3CCJ N;  4BR5 A;  3CI5 A;  4JV5 K;  2HF4 A;  2QWO A;  1YJW N;  3CFP A;  4H5W A;  3VQ9 A;  2KW4 A;  2P9I A;  2IIR A;  5FRM A;  4CK1 A;  1KFS A;  3K9J A;  3ZSR A;  1SZ2 A;  2H3G X;  4OKE A;  4OGC A;  3EZ5 A;  5KI6 A;  1QHA A;  1NOY A;  1W9H A;  1WN7 A;  3D2E A;  2EWS A;  4DF8 A;  3VN5 A;  3NF6 A;  4ZHR A;  3J80 O;  3WXL A;  3QIO A;  1NLV A;  4JI1 K;  3NHG A;  1CZA N;  4GVE A;  3VPZ A;  4FXD A;  2HBL A;  4GV6 A;  2ITM A;  4DSL A;  1VQK N;  4JKF A;  1Q82 O;  2OZS A;  4BR0 A;  4LC9 B;  3R9P A;  4E0D A;  1ATS A;  3HBT A;  2DFH A;  4CK2 A;  1RT1 A;  3TAF A;  3RMA A;  4JI3 K;  3ZSW A;  2QEX N;  5M1F A;  3CQX A;  1N32 K;  4CFB A;  1WLJ A;  2HHT A;  2YHA A;  1KQS M;  3CYM A;  4IG0 A;  5LJW A;  2P1J A;  3D45 A;  4RW8 A;  4FVU A;  3PV8 A;  1FKO A;  4NB4 A;  1BQM A;  2ZE2 A;  4K8X A;  4M3W A;  4O0J A;  1EKE A;  1IG8 A;  1B9F A;  3EO3 A;  2HHU A;  1G99 A;  3DMJ A;  3SV4 A;  3AVK A;  4CJS A;  3I56 N;  4JKG A;  3SJJ A;  4E7L A;  4BE0 A;  4DQQ A;  3PO4 A;  3QB0 A;  3OBY A;  1IBK K;  4RW4 A;  3OYD A;  4FZY A;  3AO1 A;  3E9L A;  3CJ1 A;  5M1Q A;  1GLE G;  4DCH A;  3KZB A;  3MAQ A;  4CER A;  4BRP A;  3AAP A;  3ATV A;  2Y1I A;  3RMC A;  3QEW A;  2ZGZ A;  2QWP A;  3FZF A;  3KLI A;  3P38 A;  5AQJ A;  3MEG A;  5LJV A;  3KD5 E;  3ZET A;  1X1P A;  1RT7 A;  4DR3 K;  3THW A;  2E4L A;  3VQ8 A;  2E2P A;  4IFV A;  5AQK A;  4B9Q A;  5AQV A;  1HYZ A;  3VF6 A;  2FXU A;  4OLB A;  3DLR A;  3BZK A;  3OA9 A;  3V1O A;  4CGI A;  4DTJ A;  4XIU A;  3MED A;  5F0X A;  2CH6 A;  1Q18 A;  3DWL A;  3S3N A;  3K5L A;  2G8F A;  2BUP A;  4IO9 L;  3KK3 A;  1S1T A;  2YNG A;  3EKS A;  5FPN A;  1BWF O;  4BY9 C;  4QS9 A;  4B1U B;  1BCM A;  3S9H A;  4AM6 A;  2QI2 A;  3HM8 A;  3K2P A;  3DYA A;  3VEY A;  2YJE A;  4NYF A;  5C12 A;  2B5J A;  3VF2 A;  5J2P A;  5DMR A;  3VEX A;  1REV A;  4H0P A;  1RDA A;  3AGR A;  3HK2 A;  4CEZ A;  1S6Q A;  3OJS A;  5AQF A;  3MXI A;  1L3V A;  4CIG A;  5EY4 A;  1BCO A;  2E8A A;  3LAM A;  4JD2 A;  2XY7 A;  4YDU C;  2FSK A;  1YIT N;  2PFU A;  5CZ2 A;  3ZT1 A;  3NGI A;  3SV3 A;  3MX5 A;  4H03 B;  4CBW A;  2P9L A;  4DU1 A;  3A5L C;  3FZL A;  3HM9 A;  3VQ5 A;  5BPM A;  4JLH A;  4DTR A;  1NOZ A;  1CXU A;  1HQE A;  3OYF A;  1DKG D;  4MFB A;  3KKS A;  4CFD A;  2XY5 A;  4DQP A;  5K14 A;  1VSM A;  5AQX A;  3MN9 A;  1HNX K;  1DLO A;  2WOM A;  5GIN A;  3V1R A;  3JSM A;  4K41 A;  3NVK A;  1YHQ N;  2D1K A;  2X6S A;  2HOE A;  3HP9 A;  1JLB A;  4RW9 A;  1Z6R A;  5AQH A;  4B8A B;  4BR7 A;  2I7N A;  1SL2 A;  4CCH A;  2BGG A;  1IH7 A;  1RIL A;  4LF4 K;  2GX9 A;  2UYT A;  4B9M A;  3DLB A;  1VK0 A;  1XHZ A;  2HNZ A;  1ZXO A;  3NGZ A;  4DQS A;  4BRD A;  1RT3 A;  4WQ5 A;  3SUP A;  4CHQ A;  4X66 K;  1CZ9 A;  1S6P A;  1IBL K;  4C8K A;  3KIO A;  4V19 S;  4WQ4 C;  3THW B;  4CGF A;  2PBD A;  1NKC A;  3MN7 A;  4CJL A;  4LSL A;  1BO5 O;  3ZSO A;  3I33 A;  2F8T A;  3MXM A;  2P9N B;  1WAJ A;  1J6Z A;  1EO1 A;  1QQO A;  1S1W A;  3HZ6 A;  4YHH K;  5I42 A;  1VQ4 N;  4GV9 A;  3CCE N;  2OAN A;  3D0P A;  4KTQ A;  1WBB A;  2E5L K;  4PUO A;  1GOC A;  3ZLJ A;  3BF1 A;  3NAE A;  4RW7 A;  4CEF A;  5BN8 A;  3SAH A;  4BG8 A;  1QSS A;  1VRT A;  3TTC A;  4KHS A;  2AJQ A;  1D4X A;  3ITH A;  3OYG A;  1OVY A;  1HKG A;  1JXE A;  4O8U A;  4AHU A;  1YT3 A;  4KH6 A;  4EZ6 A;  1TKZ A;  1HJO A;  4AHS A;  2WON A;  3C6U A;  1SS6 A;  2W6K A;  3UKU B;  1IO2 A;  3J7Z O;  5AQY A;  4PY5 A;  5BPN A;  5AQU A;  2OPR A;  1S9E A;  5C10 A;  1TVR A;  5IWA K;  2BE2 A;  3CMA N;  1Z05 A;  2HHS A;  4F3O A;  4FJ5 A;  1T3V A;  3L2R A;  1KLN A;  3HTV A;  4DHY A;  2A40 A;  3I8D A;  3V9S A;  4YOR A;  1HX1 A;  2P9L B;  5J2N A;  1RT5 A;  2IDO A;  3AGK A;  2VWB A;  2IS3 A;  5FRN A;  5AQG A;  1U4B A;  4DV1 K;  2P9U A;  3JXU A;  2OPS A;  4JHD B;  2IVP A;  5FDL A;  4WFN L;  1NGI A;  5C0Y A;  1NKE A;  4DUZ K;  4KFB A;  3V1Q A;  3AA3 A;  1D8Y A;  1BG3 A;  3CER A;  5D3G A;  2F9T A;  2HST A;  3LP0 A;  4CEB A;  4KHN A;  3RRG A;  4CJU A;  2YX6 A;  4YNQ A;  3VQQ A;  4E3S A;  3J81 O;  2P9K B;  4DV0 K;  4JKH A;  4I6M B;  4KHU A;  3QBX A;  3CCU N;  4FLW A;  3THY A;  1VRU A;  4JI6 K;  4OPH A;  3FFK B;  3CFR A;  1TYQ A;  4DSF A;  4LD0 A;  4AH9 A;  4BRQ A;  4CJR A;  1K8A O;  4K42 A;  4AQY K;  4B9U A;  2O8B B;  4FW2 A;  1NGA A;  5HRR A;  1IKV A;  1SV5 A;  4KTZ A;  3B6O A;  4ELU A;  2RPI A;  3FZM A;  3AVJ A;  1TL1 A;  3KWG A;  1U48 A;  5GAD P;  3O80 A;  4NCG A;  3CPE A;  1G15 A;  4FLZ A;  3CF5 L;  2F9W A;  3VQE A;  4LH4 A;  1Q8I A;  5JMV A;  2A1R A;  1NNE A;  1IKX A;  3WNG A;  4OPA A;  1NK4 A;  3ZT3 A;  2QWM A;  4M63 C;  1SQK A;  3JS6 A;  3DOL A;  3ZT2 A;  4I7F A;  4E1M A;  2O8E A;  4F3T A;  3OYN A;  1WSI A;  2OCE A;  1QZ6 A;  3PX4 A;  2D0B A;  3TI0 A;  2BTF A;  5HRP A;  4X64 K;  4OVL A;  4KBO A;  3SYZ A;  2OTJ N;  5B8H A;  1W97 L;  2W42 A;  2HHX A;  3F5T A;  3NE6 A;  4F2R A;  2O8F B;  5M1O A;  3VOV A;  1JKH A;  4WF9 L;  4C8O A;  5GIP A;  4B1W B;  2E1Y A;  2QWN A;  4B08 A;  1OH8 A;  1RDC A;  4JEP A;  3VQ6 A;  4YOV A;  3MEE A;  1VQP N;  5LMN K;  2YKN A;  3V6D A;  4QCL A;  1RT4 A;  2WC9 A;  3DJC A;  1QVF M;  1JLA A;  3LAL A;  3GOI A;  2V51 B;  3FGU A;  3H1Q A;  2FBT A;  4BRF A;  4DSJ A;  1NK5 A;  3LDQ A;  2WFB A;  1TV6 A;  4E1J A;  5KPR A;  1YVU A;  3ISN C;  3MN6 A;  4BR9 A;  2E88 A;  3RSE B;  3I0R A;  2G8W A;  4EP5 A;  3E1Y A;  3NH0 A;  3MDQ A;  1D5A A;  3AAR A;  1KVC A;  2G8V A;  4FYD A;  3RR7 A;  3QFU A;  1K8K B;  3I8B A;  3PO5 A;  1EXQ A;  3SUQ A;  2D0A A;  3C95 A;  2VGN A;  1LWE A;  1HLU A;  4RCH A;  5AQW A;  2Q0U A;  2HMP A;  4FK4 A;  3OYM A;  1NGD A;  1WUA A;  2DFE A;  1W2B M;  3AV9 A;  4DFK A;  4KHP K;  4IXC A;  5TKY A;  4M3U A;  3TTD A;  3CJB A;  2DFF A;  4DV7 K;  1FXX A;  4Y1D A;  3OYI A;  4FK2 A;  1NK7 A;  4FOE A;  1VSH A;  4ILJ A;  4HCC A;  1RTJ A;  5I9E B;  4PKH A;  3HO1 A;  3L4I A;  4UQG A;  4KH4 A;  3UB5 A;  2X74 A;  4CZI A;  4DF4 A;  1C1A A;  2RKI A;  4M41 A;  4WFB L;  3RVC A;  4N76 A;  3U8X A;  3O9S A;  3D2F A;  1KAY A;  1TAQ A;  4IOX A;  4BC3 A;  4BG9 A;  5DK5 A;  1RBU A;  2ZJR L;  4O44 A;  3SQ0 A;  4DSE A;  4KI6 A;  4BRM A;  1GLC G;  1VQ9 N;  2FF6 A;  3C94 A;  4CZH A;  2OYQ A;  2ZD1 A;  2VQE K;  3LP2 A;  1J9A A;  4DLE A;  4H0O A;  4NLC A;  3LAK A;  2KZZ A;  4CIE A;  1BI4 A;  3VGM A;  3GBT A;  4FSV A;  1VSE A;  2E2N A;  2FSJ A;  2VCP A;  4FCY A;  1YJN N;  4CD3 A;  3AVC A;  3WUH A;  3AVB A;  2HVH A;  4J8F A;  3H46 O;  5TKW A;  2VWJ A;  3K58 A;  4AHV A;  4JRQ A;  4LF6 K;  3CQ8 A;  1ASV A;  2GWK A;  3WXJ A;  3OJU A;  4R5P A;  4DTS A;  2KLA A;  4H5T A;  5AQQ A;  4JK7 A;  1RTD A;  1SL1 A;  1ZBF A;  4U7B A;  3BUZ B;  4FPB A;  3O4W A;  3K0S A;  4IJA A;  3QIC A;  1M1K O;  4JKD A;  3ASM A;  3THX A;  4H0Y B;  3TSQ A;  4B9V A;  3BDP A;  4CK3 A;  4CJV A;  5F2R A;  5CHI A;  4DS4 A;  1RBV A;  5LL6 Z;  4DR2 K;  3M8R A;  1TYQ B;  3IUC A;  4N41 A;  3P1G A;  3MWP A;  4NO7 A;  4E19 A;  4BVP A;  2PZS A;  4Z4E A;  4FWQ A;  3UKR B;  1DGK N;  4M3Z A;  1P90 A;  3THY B;  3L6Q A;  3VMF B;  4CF8 A;  5ELZ A;  1UWB A;  5GAG P;  1Z25 A;  4CJ5 A;  3AVF A;  3QDK A;  2G8K A;  1JCE A;  1LAW A;  4IO8 A;  2NUB A;  3W3D A;  3L2V A;  5HBM A;  3U9Z A;  2P9S B;  4EP4 A;  3KJV A;  4KB1 A;  4YOY A;  4FZZ A;  3IRX A;  3MEC A;  2QKK A;  2BDP A;  3LPU A;  3T1Y K;  2ZWH A;  4DFJ A;  5J2M A;  5AQL A;  1S1X A;  1N6Q A;  2P51 A;  3CM6 A;  4M42 A;  5AQP A;  3IMX A;  1RDD A;  3PIO L;  4CBX A;  1WNS A;  3IAY A;  5AQR A;  1NWK A;  3NF8 A;  3HVT A;  4K0K K;  1BI4 B;  1MDU B;  2A41 A;  2IVN A;  4H0T B;  2PYJ A;  4B9N A;  3PLA A;  1NGE A;  2JLE A;  1VSK A;  3DRP A;  5C25 A;  2I5J A;  1QQM A;  2YKM A;  3PY8 A;  3V9U A;  1NGF A;  4CJK A;  1EQY A;  4ID1 A;  5H1S Q;  4AHT A;  3R3L A;  3B8A X;  2ETJ A;  5AQS A;  1KSP A;  1H1V A;  5MLC Q;  1GLD G;  4O0I A;  4FJJ A;  1RBR A;  4J2E A;  3KVG A;  2WBN A;  1RDU A;  3C65 A;  3O9T A;  4B1V A;  3HVR A;  1B92 A;  4CZG A;  4LF8 K;  1BQN A;  2CH5 A;  5CZ1 A;  1QSY A;  1KLM A;  3HT3 A;  4BE1 A;  1NK6 A;  2V7Y A;  3VEO A;  4N5S A;  4L8R B;  1ZBL A;  4I2P A;  1EET A;  1Q81 O;  2PY5 A;  2XY6 A;  2F8S A;  1W7A A;  4BR4 A;  3RRH A;  3VQA A;  1XHX A;  4JKG B;  4BC2 A;  4YOX A;  3KLG A;  4M3X A;  1VSL A;  3TSU A;  1NBW A;  2ZM6 K;  3O1B A;  3EE8 A;  1NMD A;  4CHO A;  4FJL A;  1KXP A;  1N33 K;  3IKM A;  4IWV A;  4HTL A;  3C7N B;  3FR0 A;  3VQB A;  4FJM A;  1VQ6 N;  1GOA A;  2P9S A;  1X3M A;  3M8S A;  3P4I A;  4BRC A;  2RE2 A;  2QWR A;  4FM0 A;  3ZX0 A;  5CYM A;  1XNR K;  1U6Z A;  4FJK A;  4CF0 A;  3HI0 A;  1YJ9 N;  3RSE A;  1CZB A;  5KRS A;  5AZI B;  1RBS A;  1NKB A;  3ALY A;  1YTU A;  3VTH A;  5HOO A;  5KGW A;  2ZJQ L;  3SAG A;  2ZJP L;  4DLG A;  1VQ7 N;  4J2D A;  4F8R A;  2NZT A;  3NMU A;  1HRH A;  2I7P A;  3BGR A;  4N47 A;  4FZX C;  5AJ3 K;  4DQR A;  3UKU A;  1QZ5 A;  3CM5 A;  4PKG A;  4DTM A;  1FW6 A;  2B6A A;  2KZM A;  4K43 A;  4X65 K;  3ZSQ A;  5KRT A;  3TAQ A;  5C42 A;  1BIU A;  1IV0 A;  5FLX O;  1S1V A;  4Z0U A;  4C1N I;  3FZK A;  4KRE A;  2VG5 A;  3TAP A;  3LDL A;  1HNW K;  1X3N A;  1MWM A;  2ASO A;  2D0P A;  4HWI A;  2HW3 A;  3EEQ A;  4KRF A;  5KTQ A;  4B3O A;  4KV8 A;  4CHZ A;  2HVI A;  1K8K A;  4O55 A;  3E66 A;  1RDB A;  1U45 A;  2HMI A;  1Q86 O;  3HXM A;  3ULD A;  3VGL A;  2OPP A;  1ZBU A;  2P9N A;  4DU3 A;  3R1X A;  4A57 A;  3OYL A;  4FLU A;  5JLH A;  5HL7 L;  3T1H K;  1VSI A;  4EFH A;  1KRP A;  2EHG A;  2NRH A;  3EL2 A;  3U6F A;  1LV5 A;  5AQN A;  4DFM A;  3VGK A;  2Q1N A;  4GNI A;  4NYN A;  4JI5 K;  1HJR A;  3V9W A;  4GVM A;  4B9S A;  1NK0 A;  5SWM A;  4CJT A;  5AZJ B;  2G8H A;  2A5X A;  1C0G A;  4DV6 K;  3EYZ A;  3P31 A;  5J1E A;  1JLQ A;  5AZI A;  3HPG A;  4C8N A;  5HRN A;  5GAE P;  3WNF A;  4OPJ A;  3TAB A;  3LP3 A;  1J5O A;  1ASU A;  1RGI A;  1VSF A;  1BDG A;  4KTW A;  2E2O A;  4FJ8 A;  4FLT A;  4YDU A;  1TUU A;  1C0M A;  3PX6 A;  1HQU A;  3WQT A;  1W0H A;  3F9M A;  1TAU A;  4MO5 A;  4JD2 B;  2PYL A;  3DXK B;  1NMN A;  5AQM A;  2YHB A;  3RMB A;  4GW6 A;  4BWM A;  3AVG A;  4YY3 K;  4N56 A;  4B3R K;  3VER A;  4C23 A;  5AFU A;  4FWS A;  3E01 A;  4B8C A;  5C24 A;  4LH5 A;  5T7B A;  4IEI A;  4H0X B;  4MO4 A;  3VET A;  3WQU A;  2E6M A;  4PKI A;  5BN9 A;  5KPZ A;  1IBM K;  1V4S A;  3DRR A;  4W5O A;  2YNF A;  1O13 A;  2GBZ A;  3NGY A;  1R59 O;  5FPE A;  4LF7 K;  2V7Z A;  1FKP A;  4QAG A;  4DTP A;  3SLC A;  5JS2 A;  4Q5V A;  1LWC A;  4O8K A;  2EX3 A;  3MK6 A;  1BA0 A;  3IG1 A;  4BRL A;  2KFN A;  2WUS A;  3BP8 A;  1QTM A;  3VEZ A;  2P9P B;  3AA5 X;  3ZYY X;  1KVB A;  2YHY A;  1E4G T;  3J7A P;  4G1Q A;  4OJR A;  3VEV A;  1UA1 A;  5AQZ A;  4FWN A;  5C15 A;  1I39 A;  1KCF A;  2YHX A;  4H8K A;  4B3M K;  1NU0 A;  3KK7 A;  3MN5 A;  3QIN A;  4CVN E;  1X9J A;  2XY8 A;  3J7Y P;  2KTQ A;  2CGK A;  3KWI A;  1T6D A;  2E6L A;  3M8Q A;  4FK0 A;  3A2F A;  3L3U A;  3JAM O;  3SNN A;  2VYP A;  4LF5 K;  3GE1 A;  4CE9 A;  3O9Q A;  1SAZ A;  2A3Z A;  1XMO K;  4NCA A;  1VQL N;  5JS1 A;  1WSE A;  4CF1 A;  1JLE A;  3B6P A;  4IOA L;  2IVO A;  4BRK A;  2NRZ A;  2XRI A;  3SZ2 A;  4BRG A;  4ISF A;  1IG9 A;  4EAH D;  3D2E B;  4CEA A;  3A5O C;  3R8E A;  3AVA A;  3L4Q A;  3UIQ A;  5BRH A;  2IAJ A;  4KO0 A;  1SUQ A;  1HMV A;  2Y1J A;  3ZCM A;  1JL2 A;  4DUY K;  4C8M A;  3OW2 M;  1NGH A;  1ZBH A;  1KAZ A;  1YUW A;  4CJ7 A;  4XEI A;  4IFY A;  2FBY A;  2Z1I A;  1C6V A;  2YI1 A;  1T03 A;  1U2V B;  3CME N;  4CFC A;  5GAH P;  1JCG A;  3ENH A;  3W0L A;  3HOS A;  1MA9 B;  3CFO A;  2HBM A;  4A62 A;  1TUY A;  2G8U A;  4A5A A;  3NCI A;  3BZC A;  3WEE B;  2O4G A;  4JKB A;  1NGB A;  4OO1 J;  4KH5 A;  4IEE A;  3P83 D;  1SKS A;  3T3F A;  4H5V A;  2W40 A;  1ILY A;  4FOI A;  5AQI A;  4BR2 A;  2DTU A;  1TKD A;  1J53 A;  2JWK A;  3GDQ A;  1NGJ A;  3CET A;  5ADX A;  3BF3 A;  4CZE A;  3LM9 A;  3K9K A;  4FJH A;  1P8Z A;  2A42 A;  3V81 A;  3SMP A;  4IOC L;  3C6T A;  3QFP A;  1EP4 A;  4BGB A;  1J54 A;  3PUF A;  5GIO A;  4JNE A;  5EXW A;  4CZM A;  4CIF A;  2D4W A;  4HUG A;  2P9U B;  1KTQ A;  2FC0 A;  4OGE A;  1WOQ A;  4BVO A;  3K57 A;  3D6R A;  3KTQ A;  3CCR N;  1NJI O;  3A0I X;  5KPT A;  1S72 N;  4EZ9 A;  2YNI A;  1T44 A;  1ZC6 A;  1TK8 A;  4CBU A;  1BUP A;  3RTV A;  1X9W A;  2ZQB A;  4BE2 A;  4BC5 A;  2JWL A;  2Q36 A;  5AFU H;  4F4K A;  3U9D A;  3AVM A;  4ILH A;  3P5J A;  4WQ4 A;  1T6C A;  4PWD A;  2HF3 A;  1Z26 A;  2O8C B;  3LPT A;  3V9X A;  3CQY A;  4DKW A;  3O6W A;  1RNH A;  4CHP A;  3QNN A;  1JXB A;  1N36 K;  4ISG A;  2P9K A;  1A5V A;  1NJY A;  3ZET B;  1ESV A;  4CJQ A;  3TAR A;  3KLF A;  4LFC K;  1C0F A;  4Z4C A;  2GUP A;  3AAQ A;  1MWK A;  4BC4 A;  3LDS A;  3QEP A;  3BEX A;  3ZX3 A;  4KHQ A;  1KVA A;  3IFR A;  2NRT A;  3HPH A;  3EN9 A;  2ITG A;  4M3T A;  3EY1 A;  3TR8 A;  3AVN A;  4PQU A;  3H6E A;  4JYA K;  3DXM A;  5KQ8 A;  2IGI A;  5BRE A;  3QML A;  2NNW A;  2LSN A;  2UUA K;  1VAZ A;  2ASM A;  3QER A;  3CC7 N;  3UE5 A;  1Q7Y O;  1XQS C;  4DTN A;  3G71 N;  4O5F A;  4DV3 K;  4EHU A;  2UXC K;  2HHH K;  3VEW A;  2BH1 A;  1GLJ O;  3ZSV A;  1L3S A;  1KC8 O;  1NJZ A;  1NG9 A;  4DQ8 A;  3U3Y A;  3OYA A;  4CZJ A;  2GEL A;  2ZGY A;  3L2U A;  3M1F A;  1RTI A;  3F9K A;  5M1P A;  5C2F A;  5BR9 A;  5CE3 A;  3QO9 A;  3E9P A;  1OVQ A;  1HNV A;  4CD1 A;  4DV4 K;  1GLL O;  1WSH A;  3A8Y A;  3VEN A;  1JCF A;  1YTA A;  4XH4 A;  4PHT X;  2PAV A;  4A59 A;  5HRS A;  5LMU K;  4CI6 A;  4CGJ A;  2E2Q A;  4B1X B;  1N8R O;  4K25 A;  1WB9 A;  4IFE A;  3WT0 A;  5JVH L;  4CJ3 A;  4MLE A;  1UA0 A;  1DTQ A;  3NDK A;  3CPW M;  5IT9 O;  3AVL A;  1BA1 A;  2R7Y A;  3DLK A;  4U67 L;  2D0C A;  4FM1 A;  1FJG K;  1C1B A;  4TSX A;  3M6G A;  3VQ4 A;  3H3N O;  2KKZ A;  5HRO A;  1BL3 A;  3TAG A;  4EIA A;  4DTU A;  1DTT A;  2VGM A;  4HTU A;  3DRS A;  4IG3 A;  4Z4G A;  1WSF A;  3ATU A;  1HNI A;  1Q9Y A;  3THV A;  2UU9 K;  1WAF A;  5BPL A;  2P9P A;  3CJ9 A;  3O3G A;  3OYJ A;  3WXI A;  4ELT A;  1HUX A;  4OKJ A;  5AQT A;  4DR4 K;  1HNZ K;  3NH2 A;  1KFD A;  4CZK A;  2QWQ A;  2YJF A;  3HOT A;  2J4R A;  5LY3 A;  2YV0 X;  2VG7 A;  3LAN A;  1XC3 A;  1GLB G;  4CJ4 A;  3PSI A;  4ELV A;  5DM7 L;  3LM2 A;  3ZX2 A;  5E41 A;  3M5R A;  2QXF A;  3WNE A;  1JLF A;  4CJF A;  5KGX A;  4FO0 A;  3OTO K;  5E26 A;  1QQC A;  1KAX A;  2FSN A;  3LL3 A;  3DXM B;  3LP1 A;  1OH5 A;  1TKX A;  1VQO N;  1RT6 A;  4B3S K;  3OS0 A;  3H45 C;  4YOW A;  3L2W A;  1E4F T;  1V4T A;  2IOC A;  1HYV A;  3CCQ N;  1BIS A;  3TAN A;  4RWT A;  1NGG A;  3I55 N;  1T8E A;  3DM2 A;  2QXL A;  4HHT A;  2XO7 A;  1X9S A;  4K8Z A;  1D9D A;  4FJN A;  3KHY A;  3L8B A;  4OPK A;  3GG4 A;  4WCE L;  3DXK A;  3HYF A;  4NXM K;  4FJ9 A;  2HBK A;  3HJF A;  3WEE A;  2OZM A;  1T7P A;  4H0V B;  4AIL C;  3A5M C;  3OYC A;  3QBW A;  4QS7 A;  1HKC A;  4E89 A;  5BRF A;  3O08 A;  4F2S A;  3M3Z A;  3E9O A;  4CF9 A;  3THX B;  1FK9 A;  5E84 A;  1C0U A;  3QIP A;  3AO3 A;  1NK8 A;  4PL7 A;  3VES A;  3ENO A;  4CJE A;  4DG1 A;  3O3F A;  4GMJ B;  3EZW A;  4A5B A;  1EWQ A;  5JLF A;  5I3U A;  3KKR A;  1IKY A;  4GV3 A;  4GKK K;  3QNO A;  5SZT A;  4M7X A;  4JI4 K;  4WFA L;  1VSJ A;  3K59 A;  3NF9 A;  3Q7C A; 
#chains in the Genus database with same CATH homology
 4JS5 A;  3DOL A;  2O4I A;  4BDP A;  3ZT2 A;  4I7F A;  4E1M A;  1I3A A;  4F3T A;  1HPZ A;  3OYN A;  4ZTJ A;  4W5T A;  1WSI A;  3E01 A;  3ZT4 A;  4B8C A;  3OYK A;  5C24 A;  4LH5 A;  4LSN A;  5T7B A;  4FJ7 A;  3PX4 A;  1SKR A;  2D0B A;  2HND A;  4CF2 A;  1HYS A;  4O5B A;  3OY9 A;  3TI0 A;  5HRP A;  2E6M A;  4OVL A;  1RBT A;  2FBV A;  1Y97 A;  3SYZ A;  4B9L A;  4DTO A;  3QEX A;  4FLV A;  1YTU A;  1ZBI A;  3DRR A;  4W5O A;  4HUF A;  2G8I A;  2W42 A;  2YNF A;  2HHX A;  2GBZ A;  3T1A A;  1CXQ A;  3NGY A;  3ZSX A;  4CGG A;  3NE6 A;  4DSI A;  4FJG A;  3SQ2 A;  4F2R A;  3VQD A;  1A5X A;  1FKP A;  4QAG A;  3SUN A;  4DTP A;  3DOK A;  1MU2 A;  4H4M A;  5JS2 A;  4CFA A;  4Q5V A;  1IKW A;  1LWC A;  1JKH A;  3CG7 A;  4C8O A;  3TAM A;  2EX3 A;  2HB5 A;  5J2Q A;  4CEO A;  1LWF A;  1WSJ A;  4CJP A;  3OYE A;  3IG1 A;  3ZT0 A;  3VQC A;  4B08 A;  4FJI A;  2KFN A;  4RG8 A;  1RDC A;  3VQ6 A;  1QTM A;  2HHV A;  3AA5 X;  1KVB A;  1BIZ A;  3HP6 A;  3MEE A;  4G1Q A;  3LWL A;  3G0Z A;  4OLA A;  2YKN A;  4OJR A;  1UA1 A;  3V6D A;  4BDY A;  1I39 A;  4QCL A;  1KCF A;  4H8K A;  4M3Y A;  1RT4 A;  3AA2 A;  1Q9X A;  1XI1 A;  1JLA A;  4BAC A;  3QIN A;  3LAL A;  4DTX A;  2XY8 A;  2D5R A;  4KHW A;  2KTQ A;  4DU4 A;  2FBT A;  3V4I A;  3SPY A;  4DSJ A;  1T05 A;  2E6L A;  1NK5 A;  3M8Q A;  4FK0 A;  2X6N A;  3A2F A;  1TV6 A;  3L3U A;  3CFP A;  3SNN A;  3VQ9 A;  1YVU A;  2KW4 A;  1RT2 A;  3ISN C;  4E7I A;  5FRM A;  3OS1 A;  4CK1 A;  1TK5 A;  1KFS A;  3I0R A;  2G8W A;  3ZSR A;  4CE9 A;  4EP5 A;  4OKE A;  4E1N A;  4OGC A;  3NH0 A;  5KI6 A;  3EZ5 A;  4E7K A;  1NOY A;  1W9H A;  1WN7 A;  4NCA A;  5JS1 A;  1D5A A;  1UAX A;  1WSE A;  2Z1H A;  1JLE A;  3B6P A;  4CF1 A;  4DF8 A;  3VN5 A;  1KVC A;  1LAV A;  3NF6 A;  4ZHR A;  2G8V A;  3RR7 A;  4FYD A;  2XRI A;  3QIO A;  1NJW A;  3SZ2 A;  3PO5 A;  1QHT A;  1BHL A;  1EXQ A;  3SUQ A;  2D0A A;  3NHG A;  1IG9 A;  3C95 A;  4CEA A;  3RWU A;  1LWE A;  4FXD A;  4DMN A;  3AVA A;  3OYB A;  2OA8 A;  2P5O A;  3UIQ A;  4FLX A;  4DSL A;  3QEI A;  4FK4 A;  2IAJ A;  3OYM A;  2DFE A;  4ICL A;  3AV9 A;  4DFK A;  4KO0 A;  1SUQ A;  4M3U A;  1HMV A;  2Y1J A;  2OZS A;  3ZCM A;  4E0D A;  3NH1 A;  2DFF A;  2DFH A;  1FXX A;  1JL2 A;  4CK2 A;  4Y1D A;  1RT1 A;  3OYI A;  3TAF A;  4FK2 A;  4C8M A;  1NK7 A;  1ZBH A;  3RMA A;  3ZSW A;  1L5U A;  1VSH A;  4CFB A;  4HCC A;  1WLJ A;  1RTJ A;  4RW6 A;  2YHA A;  4HUE A;  3CYM A;  4IG0 A;  2OPQ A;  2HHT A;  4IFY A;  2FBY A;  2Z1I A;  3HO1 A;  1C6V A;  2P1J A;  1T03 A;  4UQG A;  3D45 A;  4RW8 A;  3PV8 A;  2A1S A;  2X74 A;  1FKO A;  4DF4 A;  1C1A A;  2RKI A;  4M41 A;  4CFC A;  4N76 A;  2Q3S A;  1BQM A;  2ZE2 A;  3AO5 A;  4EZ6 A;  4K8X A;  1SL0 A;  4KKO A;  1TAQ A;  3CFO A;  1RTH A;  4M3W A;  4CEC A;  2G8U A;  2KFZ A;  4O0J A;  5DK5 A;  1EKE A;  1RBU A;  4O44 A;  3SQ0 A;  4AHR A;  3NCI A;  1JLG A;  4DSE A;  1B9F A;  2HHU A;  3KLH A;  3V9Z A;  3QEV A;  4KI6 A;  1GOB A;  1TGO A;  2O4G A;  3DMJ A;  3SV4 A;  3AVK A;  2QK9 A;  3C94 A;  3SI6 A;  5HP1 A;  3P83 D;  1SKS A;  2ZD1 A;  2OYQ A;  4CES A;  3T3F A;  3LP2 A;  4CJS A;  2HHW A;  1J9A A;  4DLE A;  4QOZ B;  3SJJ A;  3JYT A;  4LY7 A;  3LAK A;  4E7L A;  4BE0 A;  4CIE A;  4CGD A;  1J53 A;  1K6Y A;  1BI4 A;  4DQQ A;  1TKD A;  3PO4 A;  3G10 A;  1VSE A;  4RW4 A;  3OYD A;  4FCY A;  4FZY A;  3AO1 A;  1D9F A;  3RMD A;  1F21 A;  4FJH A;  3IS9 A;  3DLH A;  3MAQ A;  4CER A;  2Y1I A;  3V81 A;  3AVC A;  3RMC A;  3QEW A;  3AVB A;  3C6T A;  2HVH A;  3KLI A;  3MEG A;  1NK9 A;  2VWJ A;  1EP4 A;  3K58 A;  3KD5 E;  4AHV A;  4JRQ A;  4FJX A;  1J54 A;  1RT7 A;  1X1P A;  3PUF A;  2E4L A;  3VQ8 A;  3CQ8 A;  1ASV A;  4Z4I A;  2DTU A;  1U04 A;  4IFV A;  3OJU A;  4CIF A;  4R5P A;  4DTS A;  1HYZ A;  4HUG A;  1KTQ A;  2FC0 A;  3HPO A;  3HST B;  4OGE A;  3O4Q A;  4OLB A;  3AVH A;  3DLR A;  3K57 A;  4E7H A;  1BGX T;  1S9G A;  3V1O A;  4CGI A;  4DTJ A;  3KTQ A;  1RTD A;  1SL1 A;  3KK1 A;  4ZTF A;  1ZBF A;  4W5N A;  4XIU A;  3MED A;  1U49 A;  2HHQ A;  4HCB A;  3S3N A;  4EZ9 A;  3K5L A;  2F96 A;  2YNI A;  3TAE A;  2X78 A;  2G8F A;  3ASM A;  3DLE A;  1TK8 A;  4KI4 A;  3RTV A;  4B9T A;  4B9V A;  3BDP A;  4CK3 A;  3KK3 A;  1S1T A;  2ZQB A;  3DLG A;  4CJV A;  4BE2 A;  1X9W A;  2YNG A;  4Q0B A;  4DS4 A;  5HLF A;  1RBV A;  2VWK A;  3M8R A;  4N41 A;  4AHC A;  1U47 A;  3P1G A;  4E19 A;  1BCM A;  2PZS A;  3S9H A;  4Z4E A;  4BWJ A;  4M3Z A;  5EU7 A;  3S3M A;  4F4K A;  3OVN A;  2DY4 A;  1O1W A;  3AVM A;  4J2A A;  2IC3 A;  4IDK A;  3K2P A;  3P5J A;  4CF8 A;  3DYA A;  4Y1C A;  4CHY A;  1UWB A;  3AVI A;  1L3T A;  1Z25 A;  4IBN A;  4CJ5 A;  4PWD A;  4NYF A;  1Z26 A;  3LPT A;  3SQ4 A;  4HVJ A;  1B9D A;  2B5J A;  5J2P A;  3AVF A;  2YNH A;  5DMR A;  2RF2 A;  1REV A;  3V9X A;  1RDA A;  2G8K A;  3HK2 A;  1LAW A;  1S6Q A;  4CEZ A;  3OJS A;  2NUB A;  1RNH A;  3MXI A;  3L2V A;  3LZI A;  1R0A A;  1L3V A;  5HBM A;  4CHP A;  4CIG A;  2XHB A;  3QNN A;  3HL8 A;  4EP4 A;  1BCO A;  3KJV A;  3VA3 A;  4C8L A;  1UOC A;  3AO4 A;  1ASW A;  3LAM A;  2XY7 A;  1JXB A;  4KB1 A;  1ITG A;  5CZ2 A;  3ZT1 A;  4FZZ A;  4CEQ A;  3NGI A;  3IRX A;  1A5V A;  3SV3 A;  3MEC A;  2QKK A;  1NJY A;  2BDP A;  3LPU A;  4DFJ A;  4CJQ A;  5J2M A;  1S1X A;  2RN2 A;  1N6Q A;  2P51 A;  3TAR A;  4KB0 A;  3CM6 A;  3KLF A;  4DU1 A;  3SUO A;  3SCX A;  4M42 A;  3HM9 A;  3VQ5 A;  4Z4C A;  4JLH A;  4DTR A;  1NOZ A;  1RDD A;  1CLQ A;  1WNS A;  1CXU A;  3LDS A;  3QEP A;  3IAY A;  1HQE A;  3OYF A;  3NF8 A;  3AA4 A;  4MFB A;  3KKS A;  1SKW A;  4CFD A;  3HVT A;  4KHQ A;  3QES A;  2XY5 A;  1KVA A;  1BI4 B;  3HPH A;  2ITG A;  4M3T A;  3EY1 A;  2Z1J A;  1C0T A;  3TR8 A;  4WE1 A;  4DQP A;  2PYJ A;  5K14 A;  3AVN A;  4I9L A;  1VSM A;  3SQ1 A;  4B9N A;  4PQU A;  2BAN A;  4FLY A;  2JLE A;  3KD1 E;  1VSK A;  3DRP A;  5C25 A;  4I9Q A;  2GUI A;  2I5J A;  3I0S A;  2IGI A;  2YKM A;  3V9U A;  3PY8 A;  4CJK A;  4DS5 A;  1DLO A;  2WOM A;  4ID1 A;  2KZZ A;  4AHT A;  2LSN A;  3V1R A;  3JSM A;  3DI6 A;  5FRO A;  3F73 A;  2ETJ A;  2X6S A;  1KSP A;  1S1U A;  3QER A;  3FFI A;  3HP9 A;  1JLB A;  4RW9 A;  4B8A B;  4ID5 A;  4PA1 A;  4H4O A;  4DTN A;  4CHN A;  4O0I A;  1SL2 A;  4M45 A;  4CCH A;  4FJJ A;  1RBR A;  2BGG A;  1IH7 A;  4J2E A;  1RIL A;  3ZSV A;  2Z1G A;  3LWM A;  1L3S A;  4B9M A;  3HVR A;  1NJZ A;  3DLB A;  4CGH A;  4FW1 A;  1VK0 A;  3T19 A;  1B92 A;  2HNZ A;  3VQ7 A;  3U3Y A;  1XHZ A;  3NGZ A;  1BQN A;  3OYA A;  5CZ1 A;  4DQS A;  1QSY A;  5D3G A;  3L2U A;  1ZYQ A;  1RTI A;  1KLM A;  3F9K A;  3NF7 A;  3HT3 A;  4BE1 A;  4E7J A;  1NK6 A;  1RT3 A;  3VA0 A;  4IKF A;  3QO9 A;  4N5S A;  4L8R B;  3SUP A;  1ZBL A;  4CHQ A;  4I2P A;  1L3U A;  1CZ9 A;  1EET A;  1S6P A;  1JL1 A;  1HNV A;  2XY6 A;  2PY5 A;  3KIO A;  4C8K A;  2F8S A;  3QET A;  1WSH A;  4CGF A;  3RRH A;  1NKC A;  3VQA A;  1XHX A;  1TKT A;  1YTA A;  4CJL A;  4LSL A;  3ZSO A;  3KLG A;  3L3V A;  5HRS A;  2F8T A;  2KQ2 A;  3MXM A;  5CY4 A;  4CGJ A;  4KAZ A;  1WAJ A;  4M3X A;  1QS4 A;  3AO2 A;  4CEE A;  2QKB A;  1VSL A;  1S1W A;  5I42 A;  4CHO A;  4CJ3 A;  1UA0 A;  1DTQ A;  4FJL A;  3NDK A;  3AVL A;  3D0P A;  4KTQ A;  4PUO A;  2R7Y A;  1GOC A;  1LW0 A;  3VQB A;  3NAE A;  3DLK A;  1GOA A;  4RW7 A;  3ZSZ A;  4CEF A;  4FJM A;  3M8S A;  4JRP A;  3L2Q A;  2D0C A;  4FM1 A;  3NFA A;  1C1B A;  4TSX A;  4NCB A;  3VQ4 A;  4FM0 A;  1QSS A;  5HRO A;  1BL3 A;  5CYM A;  1VRT A;  3TAG A;  4KHS A;  2AJQ A;  4W5Q A;  2GV9 A;  2HNY A;  3ITH A;  3OYG A;  4DTU A;  1NJX A;  1DTT A;  4HTU A;  4FJK A;  4CF0 A;  5CYQ A;  3DRS A;  4IG3 A;  1JXE A;  1CZB A;  3H08 A;  4AHU A;  4Z4G A;  5KRS A;  1RBS A;  1WSF A;  1YT3 A;  4M3R A;  1NKB A;  3ALY A;  1TKZ A;  1HNI A;  1Q9Y A;  3THV A;  4AHS A;  2WON A;  1C1C A;  1WAF A;  4W5R A;  4BDZ A;  3C6U A;  5KGW A;  1JLC A;  4Z4F A;  1LW2 A;  3KK2 A;  1IO2 A;  1X9M A;  3WNH A;  4KHY A;  1RCH A;  4DLG A;  4J2D A;  3O3G A;  4F8R A;  3OYJ A;  4DWI A;  1WSG A;  4PY5 A;  4ELT A;  1HRH A;  2OPR A;  3BGR A;  1S9E A;  4OKJ A;  4N47 A;  3U3G A;  4FZX C;  1TVR A;  4DQR A;  3O3H A;  2B4J A;  3NH2 A;  3MXJ A;  4CJW A;  1KFD A;  2BE2 A;  3CM5 A;  4JS4 A;  4F3O A;  4FJ5 A;  2HHS A;  1VSD A;  3QLH A;  4DTM A;  2B6A A;  2YV0 X;  1N5Y A;  2KZM A;  2VG7 A;  3LAN A;  3L2R A;  1KLN A;  4CJ4 A;  4ELV A;  3ZSQ A;  5KRT A;  3TAQ A;  5C42 A;  1BIU A;  5E41 A;  4Z4H A;  3I8D A;  2ATQ A;  3V9S A;  2QXF A;  1S1V A;  4Z0U A;  1JLF A;  3WNE A;  5J2N A;  4CJF A;  1RT5 A;  5KGX A;  2IDO A;  4KRE A;  2VG5 A;  3TAP A;  2IS3 A;  1S5J A;  1QQC A;  5FRN A;  2HW3 A;  1U4B A;  4KRF A;  2VG6 A;  5KTQ A;  4B3O A;  4KV8 A;  3LP1 A;  1TKX A;  2OPS A;  4CHZ A;  2HVI A;  4DQI A;  4O55 A;  5FDL A;  1RT6 A;  1RDB A;  1U45 A;  3OS0 A;  2HMI A;  3L2W A;  3HXM A;  3ULD A;  1NKE A;  2OPP A;  4KFB A;  3V1Q A;  4J2B A;  2IOC A;  1ZBU A;  1HYV A;  1A5W A;  3AA3 A;  4DU3 A;  1D8Y A;  4FLU A;  3OYL A;  1BIS A;  3TAN A;  4OKK A;  1TK0 A;  3K5N A;  3DM2 A;  4FM2 A;  1T8E A;  1QE1 A;  1VSI A;  3OS2 A;  4FVM A;  4HHT A;  2XO7 A;  2EHG A;  1X9S A;  1KRP A;  4K8Z A;  3U6F A;  1LV5 A;  1D9D A;  4FJN A;  3LP0 A;  4CED A;  4DFM A;  4CEB A;  4O4G A;  4KHN A;  3RRG A;  4CJU A;  1XC9 A;  3L8B A;  1XWL A;  4OPK A;  4YNQ A;  4NYN A;  3ZSY A;  3VQQ A;  4E3S A;  1HJR A;  3V9W A;  4GVM A;  4B9S A;  1NK0 A;  5SWM A;  4CJT A;  4KHU A;  3HYF A;  4FJ9 A;  3M8P A;  3HJF A;  2G8H A;  2OZM A;  3K5M A;  3KLE A;  4FLW A;  1VRU A;  1T7P A;  3EYZ A;  5J1E A;  1JLQ A;  3CFR A;  4AIL C;  3OYC A;  4DSF A;  4LD0 A;  4AH9 A;  4DSK A;  4E89 A;  3VQP A;  4CJR A;  4F2S A;  3HPG A;  4C8N A;  5HRN A;  4OPJ A;  3WNF A;  3PX0 A;  3TAB A;  3LP3 A;  2P5G A;  1J5O A;  4CF9 A;  4YFU A;  3OYH A;  4DFP A;  4B9U A;  4FW2 A;  1ASU A;  1VSF A;  1FK9 A;  3SPZ A;  3RR8 A;  1C0U A;  1EX4 A;  3QIP A;  3AO3 A;  1NK8 A;  4KTW A;  5HRR A;  1IKV A;  4MQ3 A;  4CJE A;  4FJ8 A;  1SV5 A;  3NBP A;  3B6O A;  4KTZ A;  4DG1 A;  2RPI A;  4I2Q A;  3AVJ A;  1TL1 A;  3O3F A;  4FLT A;  4ELU A;  4GMJ B;  1U48 A;  2JGU A;  3LZJ A;  1C0M A;  3TWH A;  4NCG A;  3PX6 A;  1HQU A;  5I3U A;  3KKR A;  1G15 A;  1IKY A;  1W0H A;  2FBX A;  4FLZ A;  3QNO A;  3O4N A;  1TAU A;  4KPY A;  3VQE A;  4LH4 A;  1QSL A;  5SZT A;  3S3O A;  2PYL A;  1Q8I A;  2A1R A;  2YHB A;  1IKX A;  3WNG A;  1NK4 A;  1VSJ A;  1TL3 A;  4GW6 A;  3K5O A;  3K59 A;  3ZT3 A;  3RMB A;  4BWM A;  3NF9 A;  3AVG A;  4N56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...