3ZT4A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
154
structure length
151
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 57
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt4A00
3OYDA 4NCAA 3ZT0A 4OVLA 4M3YA 3A2FA 4OJRA 4HVJA 3NDKA 4CJPA 3PUFA 3RTVA 3M8RA 2D0CA 3MXMA 3ZSWA 4JRPA 4M45A 4OKKA 4FJMA 3KLFA 3VQEA 1K6YA 4CF0A 1VSLA 5HBMA 1KSPA 3JYTA 1HMVA 4KFBA 3C95A 3HL8A 4CF8A 3HK2A 4E1MA 4C8LA 4FLXA 3D45A 4M41A 3V9XA 4DQRA 3AVKA 4R5PA 3P1GA 1ASVA 3DRRA 3HSTB 3LAKA 4CHQA 3QEPA 2QKBA 5C42A 3G10A 1SL1A 4DSFA 2ZQBA 1TK0A 4M3ZA 5HRPA 3DYAA 4I7FA 1SKRA 2HNZA 2KZMA 4CJEA 4AILC 4GW6A 4DSJA 3KJVA 4OGCA 5CZ2A 1ZBLA 5I42A 3DOKA 3AVJA 3DLBA 1DTTA 4E7JA 2QK9A 4CFDA 3TARA 4CGIA 3TAPA 1YVUA 4ID1A 1TK5A 3KD5E 2FBVA 2P51A 3QLHA 1HPZA 1O1WA 3AA4A 1TKDA 5KI6A 4FJ9A 4ZHRA 3EZ5A 4LD0A 1C0TA 1FKOA 1R0AA 2OPRA 4M3RA 4HUGA 1KVCA 4HCBA 1HNVA 1Y97A 1T7PA 2O4IA 2KW4A 1Q8IA 2RF2A 4Q5VA 3BGRA 1UOCA 3B6OA 3VQ8A 1C1CA 1VK0A 1Z25A 2ZE2A 3OS0A 3V9SA 4B9VA 3SPYA 2OZMA 4DWIA 1EKEA 4AHTA 3MAQA 3HXMA 3ZSQA 5T7BA 4J2BA 3LAMA 4C8NA 3TI0A 5CZ1A 3QESA 4Y1DA 3QEXA 1U48A 4L8RB 2BGGA 4F8RA 3IS9A 3VQ5A 3K59A 2OZSA 3O4NA 1NK9A 2HHQA 1C1BA 3V1QA 1ITGA 4CIGA 4FYDA 1IH7A 4BDZA 1L3SA 2IDOA 4DTOA 4JRQA 5C24A 3LWMA 4O4GA 4CJKA 2Z1JA 3AVGA 5KGXA 4DTSA 3PV8A 4FLTA 1RTIA 1S6QA 4UQGA 3OYBA 3OYIA 3M8SA 3LWLA 4DTXA 1NK7A 1NK4A 3ZSOA 1UA1A 3MEEA 1BI4B 3ISNC 4OKJA 3PX6A 3WNEA 4O0JA 1D9DA 1ZBIA 4EP4A 2YNGA 3VQPA 4FK0A 3LP3A 4DFKA 3NH2A 1JL2A 2E6LA 3AVBA 3KLGA 4DSKA 4B3OA 4FZZA 3SV4A 1I3AA 1U04A 3AA3A 1IKWA 2D0AA 1VRUA 1VSDA 5KTQA 3MXIA 4YNQA 4DTUA 3VQCA 4N41A 4DTPA 1TKTA 3KK3A 3L2VA 3TR8A 1N6QA 1GOCA 1W0HA 3LZJA 2HHSA 1RDCA 4LH5A 3SCXA 5JS1A 2BE2A 1TK8A 4WE1A 4PWDA 1QSYA 1LWEA 1LW2A 1QQCA 4CF1A 5K14A 3ASMA 3L8BA 1HQUA 4CEQA 2F96A 3HVTA 4FJ8A 2GBZA 2XY8A 4DSIA 2FBXA 1WSJA 3M8QA 4J2DA 1U49A 2HHXA 1HNIA 4CJ4A 4GMJB 3T19A 3K2PA 1BHLA 4J2EA 3OY9A 3HP6A 4DS4A 2HHUA 1D9FA 3JSMA 4AHSA 4RW4A 5FROA 1LAWA 2IOCA 5DK5A 1RT4A 4OPJA 3SQ0A 1VSJA 1RT7A 4Z0UA 3O3HA 4G1QA 4CEBA 4FJLA 2X74A 1CZ9A 3DM2A 3AV9A 4CJLA 4Z4IA 5J2PA 3ITHA 1UWBA 3VQ7A 1QE1A 3OYCA 2ATQA 3OYFA 3E01A 3AVHA 3KLIA 1RT3A 5C25A 2G8KA 4FJKA 4JS5A 3CFRA 3HPGA 4KKOA 3T3FA 2Z1GA 4FJJA 4CEFA 3KIOA 1QTMA 4F4KA 4DQSA 2BANA 4BE1A 4FLWA 3TAEA 5FDLA 2Z1IA 1Z26A 4DG1A 2DTUA 4CJRA 2X6SA 2PY5A 4CFAA 5HROA 3PO4A 4E19A 5DMRA 3QNOA 3K5NA 2O4GA 1TV6A 1TVRA 3OYLA 1G15A 1LW0A 4DS5A 1KRPA 4DU1A 3DLKA 3I0RA 3HJFA 2D0BA 2DFEA 3HPHA 3VQAA 4CK2A 2AJQA 3S3NA 3SUQA 2G8HA 3DRPA 3OYHA 1U4BA 2XY7A 1VRTA 1WAJA 3SYZA 4FXDA 2Z1HA 4CJVA 1NK6A 4CERA 5KRTA 4M3XA 1JKHA 1XWLA 2W42A 1B92A 1WSHA 4TSXA 2FC0A 3OYKA 3OS2A 5J2MA 3MEDA 4IFVA 2IGIA 3F9KA 2Y1IA 1NOZA 3O3FA 3ULDA 1DTQA 3PX4A 1A5WA 1C6VA 5D3GA 1REVA 4PA1A 4N47A 3ZT3A 3IG1A 1BIUA 1FKPA 3CFOA 2QXFA 1J54A 3AVAA 3VQQA 3RMAA 3DI6A 3AO5A 3EYZA 4W5OA 4B9UA 1JLGA 3KKRA 4OPKA 3KTQA 3NF6A 5FRNA 2G8IA 3NF7A 1EXQA 1TAQA 1W9HA 4HUFA 2HNYA 4CIFA 4Q0BA 3QIOA 4CEDA 3DOLA 2G8VA 4F2SA 3VQ9A 4ELTA 1CLQA 1J5OA 3TAFA 2OA8A 4H4OA 1RBRA 3SPZA 4B9MA 4ZTFA 3NGIA 4LSLA 1KTQA 3RRGA 5HP1A 4KAZA 4KRFA 4I9LA 1S1TA 2VWJA 5J2NA 4FLUA 4FJXA 4OLBA 4F3TA 4FLYA 3TAGA 2HVIA 1BCOA 4FJGA 4AHRA 3WNHA 4HCCA 3NGZA 2HHTA 4PQUA 4MFBA 3QEWA 2YNHA 4CHZA 1GOBA 1TAUA 1IKXA 2I5JA 1XI1A 4CFCA 3CM6A 3AVIA 4CJQA 1TL1A 2B4JA 1VSIA 3ZT4A 5J2QA 3CM5A 1IG9A 4FJ7A 2F8SA 2E4LA 3AVMA 3OYMA 1D8YA 4KHUA 1WSFA 1TKXA 1HYZA 4CJ5A 1UAXA 3U3GA 4CJWA 3PY8A 4ICLA 1RTDA 1KLMA 3KD1E 4KTWA 4GVMA 1T05A 4O55A 1YTAA 5SWMA 2ITGA 2KQ2A 3AVFA 4M3WA 1T03A 4QAGA 2OPSA 5J1EA 1NJZA 4XIUA 3OVNA 4FCYA 4NYFA 1RCHA 2NUBA 1LAVA 3VQBA 5KGWA 1CXQA 3OYEA 3RMCA 1JXBA 1HQEA 4DF4A 4M3UA 3AA2A 2WONA 3O4QA 3OYGA 1RNHA 3D0PA 4DTJA 3LALA 3V4IA 5JS2A 3IRXA 5CYQA 4KB0A 4DTRA 3CYMA 3VN5A 3ALYA 4CK1A 1RT2A 1RILA 4ID5A 3U6FA 3V9ZA 4PUOA 3EY1A 4OGEA 4E0DA 5KRSA 5CY4A 4DTNA 1JXEA 4CJTA 4DFPA 5HLFA 4N5SA 4KV8A 1NJWA 3LDSA 1ZBUA 3ZCMA 2G8WA 4ELVA 3S3MA 1S1WA 3K57A 4CGJA 2LSNA 2VG7A 4DSEA 1WN7A 3LP0A 5HRNA 3LPUA 2YHAA 4K8XA 3AVCA 1DLOA 3VA3A 1C0UA 1TL3A 2FBYA 3HP9A 1J9AA 3I0SA 4E89A 3TAMA 1BCMA 4CGDA 1B9FA 3DRSA 3NFAA 1NKCA 4FVMA 2HW3A 4CEZA 1NKEA 4RW8A 1XC9A 1FXXA 1XHXA 4LSNA 3OYAA 4FLVA 2JLEA 3SUNA 2IC3A 3ZSRA 3TAQA 4CECA 2HNDA 3CQ8A 4FZXC 4HUEA 3FFIA 4CHOA 4KPYA 1BI4A 1GOAA 2RPIA 4W5RA 1NJXA 3C6TA 3I8DA 4CJFA 1RDBA 3L2RA 3DLGA 1RT6A 1WSIA 1X1PA 3KLEA 1T8EA 1S9GA 2YKNA 3VQ4A 4CIEA 4M3TA 1BQNA 1ZBHA 3DMJA 1RDDA 3QEVA 4O44A 4OKEA 2XY5A 3ZT2A 1LV5A 3LANA 4KHWA 3G0ZA 3AA5X 4LH4A 1JLAA 1S1VA 4KTZA 4O0IA 4M42A 3L3UA 2YV0X 3TABA 4AHUA 1KCFA 4KO0A 4HHTA 1HJRA 1TGOA 3UIQA 4Z4EA 2EHGA 2QKKA 1RBSA 1A5VA 4KI6A 2B5JA 3QNNA 2YKMA 4FZYA 3KLHA 1QHTA 4JS4A 4FJHA 4Z4GA 1WSEA 4E7KA 3C6UA 3HYFA 3QERA 3P83D 3PO5A 4ELUA 2HMIA 2DFFA 3SZ2A 4H8KA 4CK3A 1S9EA 1D5AA 3SQ2A 4RG8A 1RTJA 4FM2A 4DMNA 2VWKA 4OLAA 1RTHA 5HRRA 1VSFA 2X78A 4BWMA 4B08A 4CHYA 1VSMA 3SUPA 4FW1A 3OJUA 3SQ1A 1L5UA 4CESA 2VG5A 1BQMA 4CJUA 4DU4A 4EZ6A 1RT5A 3DLEA 1C0MA 3SV3A 4W5NA 3DLRA 2XY6A 2HVHA 1IKYA 3HPOA 3TANA 1NK8A 4B9TA 3DLHA 1YTUA 4NCGA 1HRHA 3QEIA 1MU2A 1LWFA 3V9UA 4DTMA 1SL2A 4NCBA 1RT1A 4E7LA 3SI6A 3KK2A 1VSEA 1WNSA 4KB1A 1Q9YA 1S1XA 4RW6A 3AO4A 3QETA 1WSGA 3NH1A 3TWHA 1X9SA 4CGHA 1IKVA 1I39A 2X6NA 3NF8A 1BGXT 2YNFA 1KFDA 3MECA 3H08A 2IS3A 4YFUA 1NKBA 2F8TA 2P5GA 3QIPA 2PYLA 3K5LA 1UA0A 1S1UA 3QINA 4C8OA 1EP4A 2GUIA 4KHSA 3K5OA 3SQ4A 4KREA 1HYVA 1IO2A 1YT3A 2VG6A 4KI4A 1FK9A 4DFJA 4EZ9A 1J53A 4B8CA 4BACA 4DLGA 4F3OA 2ZD1A 4DQQA 1NOYA 4MQ3A 2PYJA 3OJSA 4B8AB 2A1SA 4BWJA 2B6AA 1ZYQA 2BDPA 4AHCA 1RDAA 5CYMA 3NF9A 3HO1A 2EX3A 1LWCA 2GV9A 4B9LA 3MEGA 4DSLA 1QSSA 3T1AA 1X9MA 4I2PA 2R7YA 5SZTA 1WAFA 2D5RA 1CZBA 3SUOA 2KTQA 1TKZA 1L3VA 4CCHA 4B9NA 3RMDA 4CGFA 4CF2A 4IG0A 3S9HA 3C94A 2RKIA 2Y1JA 4FK4A 4CEEA 4F2RA 3VA0A 3RMBA 2E6MA 2KFZA 2KZZA 1C1AA 2XO7A 3RR8A 3ZT1A 5EU7A 4EP5A 4Z4CA 1VSHA 3AO2A 1ASWA 4BE0A 1SKSA 4FJ5A 3VQ6A 3WNFA 3NCIA 3K5MA 3HT3A 1JL1A 1EETA 4DU3A 3CG7A 4JLHA 4LY7A 4Z4HA 3OYJA 3LP1A 2DY4A 4W5QA 4E1NA 4E3SA 1L3UA 1ZBFA 1BISA 5FRMA 4FM0A 2XRIA 1L3TA 1QSLA 4BDPA 1F21A 1WLJA 2OPPA 4O5BA 3BDPA 4J2AA 3ZSYA 3WNGA 1NK0A 1S5JA 3L3VA 3MXJA 4DLEA 1QS4A 1BIZA 3S3OA 1X9WA 2KFNA 4CJ3A 1Q9XA 1SUQA 3KK1A 3HVRA 3AVLA 3U3YA 4CEOA 4PY5A 3CFPA 2YNIA 1SV5A 4ZTJA 3M8PA 4N56A 3VQDA 2Q3SA 3RRHA 3SJJA 3OS1A 3QO9A 2IAJA 4AHVA 4KHNA 3L2UA 3V1OA 3O3GA 1U45A 3AVNA 3ZSXA 1NJYA 1ASUA 1KFSA 3THVA 3ZSZA 4CGGA 3NAEA 4Z4FA 4FW2A 3L2QA 4IG3A 4KTQA 3LP2A 4CHNA 4QOZB 4I2QA 5E41A 4BE2A 1RBTA 3OYNA 3V6DA 3HM9A 2HB5A 3K58A 3V1RA 4BDYA 2P5OA 4K8ZA 4QCLA 4CHPA 2P1JA 4CJSA 2XHBA 4FM1A 1RBUA 5I3UA 2A1RA 1JLFA 4DFMA 4IBNA 1CXUA 1JLEA 1KLNA 1JLBA 1XHZA 4RW7A 2RN2A 3ZSVA 3RR7A 4RW9A 3V81A 1EX4A 3LZIA 1JLQA 4IKFA 1U47A 2HHVA 4I9QA 3KKSA 1SL0A 4B9SA 4C8KA 1KVBA 1B9DA 1SKWA 2OYQA 1VSKA 3LPTA 4H4MA 4E7IA 4DQIA 1NK5A 4FJNA 4FK2A 4W5TA 2ETJA 3NBPA 4KHYA 4DF8A 2PZSA 4IFYA 3V9WA 2HHWA 1RBVA 4N76A 4IDKA 4CF9A 3PX0A 1A5XA 3NGYA 4NYNA 3NH0A 2JGUA 4HTUA 4DQPA 1HYSA 3RWUA 3P5JA 1KVAA 1JLCA 1S6PA 2FBTA 3L2WA 3NHGA 2DFHA 3AO1A 1N5YA 3F73A 4C8MA 4CEAA 3B6PA 3NE6A 5HRSA 4AH9A 4E7HA 4CFBA 2OPQA 3AO3A 4CE9A 1BL3A 3IAYA 3SNNA 4KHQA 4FLZA 4FJIA 2WOMA 2G8FA 2YHBA 4Y1CA 2G8UA
chains in the Genus database with same CATH superfamily
3OYDA 1HKCA 4GKKK 1ZXOA 3CJBA 4DR1K 3TU5A 3MXMA 3C65A 1E4GT 4I6MB 3E66A 1HMVA 4B3RK 4A2AA 4CZIA 3VEZA 3GL1A 4R5PA 3P1GA 3DRRA 4FPBA 5C2DA 3G10A 2ZQBA 1TK0A 5HRPA 1OVQA 2GTDA 4EHUA 2HOEA 4KH6A 4NXMK 4AILC 4DSJA 4OGCA 4IEIA 2V52B 4JK7A 4E7JA 2QWPA 3TARA 1YVUA 4ID1A 4CZFA 3EKSA 1O1WA 3QBXA 2OPRA 3CC2N 4HCBA 1T7PA 3B8AX 5JLHA 4Q5VA 1NGAA 1UOCA 3OS0A 1Z25A 2ZE2A 2OZMA 2HHQA 4B9VA 3SPYA 4IDHA 4YORA 3MAQA 3LAMA 4C8NA 3TI0A 4JD2B 2OZSA 4K25A 4FYDA 1Q18A 3CCEN 4BGBA 1VQ5N 4DTSA 3OYBA 1NK7A 3ZSOA 5FPMA 3ISNC 4OKJA 2O8CB 4M7YA 1D9DA 1ZBIA 4FK0A 1NGCA 4DFKA 1XC3A 2NRZA 2YJFA 3D6RA 4K41A 4B3OA 1I3AA 2D0AA 4BY9C 1YAGA 3VQCA 4JK9A 1GOCA 3SCXA 1MWKA 2BE2A 3NVMA 4WE1A 1QQCA 3SMSA 4CF1A 3ASMA 3CXCM 3WQTA 2F9TA 4DQ8A 2W40A 2FBXA 3MWTA 4CJ4A 1E3MA 4LFCK 5AJ3K 3HP6A 4DS4A 2RHKA 3O4WA 5GINA 2HHUA 3HOSA 3FE1A 5DK5A 1RT4A 4OPJA 4GV9A 3J7AP 5DM6L 4Z0UA 5JMVA 3LDNA 4OO1J 1HNZK 1QE1A 3MMVA 4B1WB 1ATRA 4FJKA 4JS5A 5AQHA 4KKOA 4JI2K 2Z1GA 1RDWX 5IT9O 1QTMA 4DQSA 2BANA 2ZGZA 1XQSC 1VAZA 2GUPA 4DG1A 2DTUA 2X6SA 4BG9A 4E19A 1TV6A 1YIJN 4J8FA 4JI8K 4DS5A 3O80A 2D0BA 3VQAA 2AJQA 3SUQA 4MLHA 2E5LK 1U4BA 2XY7A 1VRTA 5GAHP 1NK6A 4CERA 1QQOA 4DV4K 1B92A 1WSHA 4TSXA 5J2MA 2QWMA 3OS2A 4IFVA 5AQIA 2IGIA 2O8BB 3CCRN 5D3GA 2Q97A 4GVEA 3ZT3A 1RGIA 3RSEB 3IUCA 1J54A 2P9KB 3RMAA 3O1BA 4B9UA 1JLGA 3KKRA 5CHIA 3KTQA 2G8IA 4ISGA 4BRGA 4HUFA 1QVGM 1GLDG 3SPZA 4ZTFA 3EL2A 4KAZA 4RWTA 4KRFA 1YJWN 3O9TA 2HVIA 1BCOA 4FWOA 1C0FA 2P9SA 3NGZA 3ENOA 1VQ8N 4MFBA 2YNHA 3CJ7A 3ZEUB 1IKXA 4BRFA 3ZLJA 1K8KB 1C0GA 4CJQA 1VSIA 2D0OA 2F9WA 1HYZA 3U3GA 1V4SA 4ICLA 1ESVA 3KD1E 4GVMA 4O55A 1YTAA 4JI4K 5H1SQ 4M3WA 2ZWHA 3FZFA 2NUBA 1LAVA 1N36K 3C6HA 3NMUA 5KGWA 1WBBA 4IEEA 3RMCA 3T1HK 3O9QA 4DF4A 5AQJA 1RNHA 5JS2A 3F5TA 3IRXA 4PL8A 3ZETA 5C2FA 4JV5K 2EWSA 3ALYA 1RILA 4C23A 3BF1A 4PKIA 1V4TA 3AGRA 4BC2A 4OGEA 5KRSA 2JWKA 4DTNA 3HOTA 4XH4A 2VG7A 5LMUK 3LP0A 5HRNA 5E84A 3VA3A 1C0UA 3TTFA 1TL3A 5F0XA 2FBYA 1WOQA 2VCPA 3HP9A 3I0SA 3LDQA 4BR4A 1KD1O 1B9FA 4DV0K 4FL9A 2FLOA 3DRSA 3CCSN 1NKCA 5AQNA 4CEZA 3OYAA 2JLEA 3ZSRA 4CECA 2HNDA 4A5AA 4CHOA 2W6LA 4KPYA 1RDBA 3DLGA 4CW7B 1S9GA 2O8DA 4YOXA 1RDDA 3ZT2A 1LV5A 3I56N 1JLAA 1S1VA 3L3UA 3G6EN 4O5FA 1TGOA 3SAHA 3QNNA 2YKMA 4YOVA 1QHTA 4JS4A 2QXLA 1IJJA 3HYFA 3QERA 2HBMA 4H8KA 4RG8A 2VWKA 4OLAA 4QS7A 4EAHD 2X78A 5KQDA 4B08A 4FW1A 3C0BA 3J7YP 1BG3A 3OJUA 4CESA 4DU4A 3R8EA 4B1ZA 1RT5A 3SV3A 3DLRA 4MDBA 5AFUH 3J8AA 3QEIA 3FR0A 2HBLA 3V9UA 3QBWA 4DTMA 1KAXA 4NCBA 2KKZA 2IVPA 4FOIA 3SI6A 4BG8A 1WNSA 1Q9YA 3TWHA 5KPTA 4JI1K 1BGXT 1XMQK 3MECA 2YJEA 2PAVA 3H08A 4YFUA 1NKBA 5TKYA 4KHSA 1HYVA 2VG6A 5FPNA 5BRHA 2A5XA 4YOTA 1TUUA 5AQZA 4DLGA 1NOYA 4B8AB 1HNXK 2FF6A 2BDPA 2KHOA 2VGNA 1LWCA 3MEGA 4DSLA 2R7YA 4JAXA 4RTFD 3CCLN 2OCEA 3S9HA 3C94A 2E1YA 4CZGA 1S3XA 3VA0A 3RMBA 2XO7A 5EU7A 4BRDA 3WNFA 3H1QA 5LY3A 1I94K 3EEQA 4DU3A 3HI0A 3OYJA 3LP1A 2DY4A 4E1NA 1BISA 4BRCA 3S41A 3A5OC 2QWNA 3IDHA 1F21A 1WLJA 2VWBA 5EX5A 2ZJPL 1NK0A 2NRHA 3MXJA 1BIZA 2KFNA 1NNEA 5AQSA 4CEOA 3CFPA 3OS1A 4KHNA 1JCGA 3L2UA 1W97L 4YDUC 1KFSA 3AVNA 1ASUA 3VPZA 5AQMA 3ZSZA 3QB0A 1E4FT 4EIAA 1YUWA 4IG3A 3LP2A 4CHNA 4I2QA 2P5OA 4FWLA 4CI6A 4K8ZA 1DT9A 3RVCA 4A57A 2P1JA 5BRFA 4FM1A 2PYLA 4IBNA 1KLNA 3O9UA 2ASOA 3RR7A 4I9QA 2NRTA 1KVBA 1B9DA 1K8AO 2ETJA 4DUZK 5LJVA 4DF8A 4N76A 4CF9A 3L0QA 4NYNA 2P9SB 4HTUA 3P5JA 1JLCA 3FZHA 3NHGA 4OPAA 3THXA 2UU9K 2W6KA 2UUCK 3IAYA 5BN9A 3SNNA 4FLZA 4FJIA 4DR2K 4B8CA 2G8FA 4Y1CA 1QHAA 4OVLA 4M3YA 4HVJA 3NDKA 4B3MK 2ZF5O 5KPRA 4JRPA 3KLFA 1KSPA 3O1WA 4DB3A 4E1MA 4C8LA 1MA9B 4R79A 4FLXA 3KWIA 5CR4A 3HSTB 4CHQA 3P39A 5AQLA 4M3ZA 4I7FA 2WBNA 1SKRA 2HNZA 3BP8A 2E1ZA 4CJEA 3LL3A 5CZ2A 1QQMA 3ZETB 5I42A 4WQ5A 2QK9A 4CGIA 3KD5E 4DR3K 1HPZA 3AA4A 1TKDA 5KI6A 1Q7YO 4LF9K 4ZHRA 3U4LA 3H1VX 1T6DA 3AAQA 1R0AA 3BF3A 1HNVA 1Y97A 3FLCO 3B6OA 4F2SA 1C1CA 1IBKK 4H5NA 5T7BA 4J2BA 4ILJA 1NMDA 4Y1DA 5FPEA 3H3OB 3VEOA 4IOAL 1HNWK 1C1BA 3K0SA 3ZX0A 4CIGA 1IH7A 4A61A 5AQTA 4JI6K 3SK3A 4JRQA 4CJKA 3VF6A 4DUYK 3PV8A 3OYIA 1VQ4N 3PSFA 5BR9A 3T1YK 3PX6A 4O0JA 5EVZA 3PLAA 3CIPA 2W41A 2O8DB 1QZ5A 5BPLA 1NLVA 4DSKA 1U04A 3AA3A 1IKWA 3GE1A 5KTQA 4YNQA 3O6WA 3KK3A 1N6QA 1RDCA 4LH5A 2YHYA 4DV2K 4PWDA 5K14A 4CEQA 1P90A 3HVTA 4FJ8A 2GBZA 1IG8A 2NLXA 3M8QA 3WQUA 1U49A 4J2DA 2HHXA 1HNIA 3T19A 5M1FA 2NRWA 4J2EA 3DXMA 4KH4A 3OY9A 4LF7K 4H03B 4JHDA 1VQON 1VQMN 4AHSA 4RW4A 4E1JA 5M1KA 3H45C 4FJLA 2X74A 1CZ9A 4O8UA 2YCHA 3AV9A 3OYCA 3GOIA 3R6MA 1NU0A 4FJJA 2BTFA 3TAEA 1IV0A 5FDLA 3M1FA 1BA0A 2PY5A 3PO4A 3O8MA 3LM9A 3K5NA 2O4GA 3CHWA 1LW0A 4DU1A 3DLKA 2ASMA 3DRPA 3OYHA 1WAJA 3SYZA 4NO7A 4CJVA 3CETA 3WXIA 1LOTB 3WXKA 4BRQA 1XWLA 2W42A 2FC0A 1N32K 1U6ZA 2Y1IA 3BZKA 2UXCK 4GV6A 1REVA 4JKFA 2QXFA 4BQZA 3VQQA 3EYZA 4IOCL 4LFBK 3TTCA 5BPNA 1EXQA 4Q0BA 2G8VA 3TAFA 2OA8A 3D2FA 5M1QA 1RBRA 4BRPA 3EZWA 3E1YA 3MN5A 1S1TA 4FLUA 4F3TA 4FLYA 4FJGA 2NRXA 5JLFA 2HHTA 3QEWA 1P8ZA 3VESA 4CHZA 1GOBA 3VETA 1TAUA 1XI1A 3W0LA 4JI3K 5J2QA 1SAZA 2E88A 3CM5A 2AA4A 3OYMA 2Q0UA 1Z6RA 4CJ5A 1UAXA 4CJWA 2O8FA 1FJGK 1KLMA 2KLAA 2ITGA 3AVFA 4QAGA 1NJZA 5J1EA 4XIUA 3OVNA 4NYFA 5FLXO 4BR0A 5KPZA 1CXQA 3AA2A 2QI2A 3SBTA 1VQ6N 1NGEA 3LALA 5CYQA 4KB0A 1JCEA 5ELZA 3CYMA 3THXB 4B1VA 4PUOA 3V9ZA 1R59O 4LF4K 3AARA 4RCHA 3PIOL 3R3LA 5CY4A 4CJTA 1TUYA 4N5SA 1NJWA 5C0YA 3ZCMA 2G8WA 4ELVA 3S3MA 3K57A 2QW9A 1DLOA 3TPQA 4E89A 1J9AA 1DEJA 1J5EK 3NFAA 4FVMA 3SMPA 1NKEA 3L6QA 4RW8A 1XHXA 4FLVA 5AQFA 3WXJA 2IC3A 3TAQA 3CQ8A 2VQFK 2AP1A 3FFIA 4K42A 1BI4A 4W5RA 1NJXA 2H3GX 4IO8A 3C6TA 3I8DA 1RT6A 1WSIA 5BREA 1T8EA 3MCAB 4WFNL 3VQ4A 3QEVA 4BRMA 3FFKB 4QS8A 3MCPA 3G0ZA 4LH4A 4O0IA 3J80O 4M42A 4HHTA 5GIPA 5MLCQ 1HJRA 2EHGA 2QKKA 1RBSA 5LL6Z 4KI6A 3A8YA 5AZJA 4FJHA 4E7KA 3P83D 2ZM6K 2HMIA 3SQ2A 1D5AA 5ADXH 3O08A 1YF5L 5HRRA 4X64K 1VSMA 1ATSA 2VG5A 1BQMA 3DLEA 4XH5A 4W5NA 1GLCG 3TANA 2P9PA 4H0YB 1HRHA 1DKGD 4DKWA 1SL2A 4FSVA 3VOVA 3NH1A 1X9SA 4CGHA 2WTUA 1I39A 4BR5A 1KFDA 3QFUA 3WXLA 2F8TA 3CJ9A 1S1UA 3QINA 2GUIA 4KREA 1YT3A 3ENBA 1FK9A 4H5VA 2E20A 4F3OA 4GKJK 2B6AA 3DXMB 2RE2A 4JHDB 1QSSA 1HKBA 3T1AA 3BEXA 5SZTA 2D5RA 1CZBA 2KTQA 1TKZA 1OVYA 4V19S 4CGFA 4CF2A 4IG0A 4F9OA 3N4PA 2HMPA 3ID8A 4H5WA 4GY2B 2E6MA 2KFZA 2KZZA 2FSJA 3ZT1A 1M90O 3AO2A 2Q2RA 3UKUA 3AAPA 3NCIA 2E2NA 4JLHA 2VQEK 3EE8A 1L3UA 4E3SA 2GX9A 1ZBFA 3ENHA 3CCVN 4FWKA 3TTDA 3WEEA 3O9RA 2FSNA 5FRMA 2XRIA 3VEVA 4BDPA 2OPPA 4O5BA 4EHTA 1Q9XA 1SUQA 3AVLA 3VQDA 5EXWA 3SJJA 2IAJA 2HBKA 2Q1NA 2CH6A 2P9NA 4BRKA 3G71N 2OTLN 4QS9A 2Q0RA 2NNWA 5E41A 3V6DA 2A42A 3V1RA 3E9OA 4QCLA 4DV3K 1JLFA 3I55N 1JLBA 1VQPN 3ZSVA 2RN2A 5C12A 3V81A 4H0TB 3CMEN 1RDUA 2HHVA 1SL0A 4B9SA 3D2FB 4JKGA 4JK8A 1SKWA 3VEXA 1EWQA 4FJNA 4H4MA 4CZHA 3ULEA 3M3ZA 3ATVA 4IFYA 2HHWA 3E9LA 1GLEG 1A5XA 4DV1K 4IJAA 3NH0A 1HYSA 3L2WA 3F73A 3PSIA 4C8MA 3B6PA 1GLLO 5EOYA 4IOXA 4CE9A 1BL3A 3VERA 4KHQA 4H0OA 3CQYA 2WOMA 2G8UA 2E2QA 4NCAA 3ZT0A 2HSTA 2O8FB 4OJRA 4DHYA 3M8RA 2D0CA 4M45A 3VQEA 1K6YA 1N8RO 1VSLA 2OTJN 4WFAL 3FZKA 4HWIA 4M41A 4DQRA 1BWFO 1GLAG 3AVKA 1OH5A 4YOYA 5C42A 3O5BA 4DSFA 1SL1A 3DYAA 2P9UA 4AQYK 4GW6A 4DR5K 3KJVA 4YHHK 3FZMA 3DOKA 3AVJA 3DLBA 4CFDA 3TAPA 2FBVA 2P51A 3CC7N 3CCMN 3EZ5A 1FKOA 3JXUA 4HUGA 3A5MC 4M3RA 1KVCA 5DM7L 3MX5A 3VGLA 2O4IA 4PHTX 5AQGA 1Q8IA 3EE9A 3BGRA 3VQ8A 3V9SA 1W7AA 1EKEA 4AHTA 1Q86O 1KAZA 3ZSQA 5CZ1A 2ZJQL 3QEXA 2BGGA 3K59A 1YITN 3O4NA 1NK9A 4FVUA 1ITGA 4OPHA 1WB9A 2BH1A 2IDOA 1L3SA 4DTOA 5C24A 4O4GA 3AVGA 5KGXA 3J7ZO 2V51B 1RTIA 1S6QA 3M8SA 3CMAN 4FLTA 1X3MA 3LWLA 1NK4A 1UA1A 1BI4B 3MK6A 3QDKA 3WNEA 3WUHA 4DV6K 2YNGA 3LP3A 3NH2A 1JL2A 1CZAN 2E6LA 2PFUA 3AVBA 3KLGA 4FZZA 1VSDA 1QZ6A 4DTUA 4DTPA 1TKTA 3CC4N 2HHSA 1W0HA 3LZJA 5JS1A 5AZJB 5BN8A 3OA9A 5AQOA 1VQLN 1QSYA 1LWEA 2GWKA 1HQUA 2XY8A 4DSIA 5AQWA 4GMJB 3K2PA 1BHLA 3VF2A 4DCHA 5LMNK 1GLJO 3J81O 2IOCA 3MN6A 2P9PB 1Q81O 3A5LC 4BR7A 3O3HA 2WUSA 3CQXA 3SAGA 2NZTA 4JNEA 2A3ZA 4Z4IA 5J2PA 1UWBA 3VQ7A 2ATQA 3E01A 5C25A 3EN9A 1S22A 3T3FA 1BDGA 5JVGL 1NGFA 3KIOA 1OH6A 4FLWA 4JI5K 1KC8O 2Z1IA 1Z26A 4CJRA 4CFAA 5DMRA 5B8HA 4BC4A 3OYLA 1G15A 4WQ4C 4CK2A 3HTVA 4JYAK 4FXDA 2Z1HA 5KRTA 4M3XA 2ZGYA 3MEDA 3F9KA 1NOZA 3O3FA 3ULDA 3PX4A 1A5WA 1C6VA 4PA1A 4N47A 5GAEP 3IG1A 5HOOA 4DV7K 1FKPA 3HRGA 3AVAA 4LF8K 3UKUB 4W5OA 5FRNA 3NF6A 1T6CA 1TAQA 2HNYA 4CIFA 1NGJA 3VQ9A 1CLQA 1NGBA 3WEEB 1YHQN 1KTQA 5TKWA 2QA4N 5HP1A 2PBDA 3RRGA 4I9LA 4FJXA 4H5RA 4AHRA 3WNHA 1U2VA 3R1XA 3U9DA 3A0IX 2I5JA 3OBWA 2P9NB 3CM6A 2IIRA 3AVIA 1TL1A 3ZT4A 1IG9A 4FJ7A 2YHXA 2F8SA 3AVMA 3SAFA 4NB4A 4KHUA 3C6AA 2QEXN 3PY8A 1RTDA 5SWMA 2KQ2A 1XNQK 2OPSA 2WC9A 4FCYA 1RCHA 4JKGB 3ULEB 3GBTA 1VQKN 3CCQN 1JXBA 3O4QA 4CZLA 1JJ2M 3L4QA 1HPMA 2NRRA 4DTJA 3V4IA 3CPWM 3D2EA 1RT2A 4JKDA 2D1KA 3EY1A 4E0DA 1HJOA 5HLFA 2WFBA 3HSCA 1ZBUA 2D0PA 1S1WA 4DSEA 1WN7A 2YHAA 4K8XA 2A40A 3HZ6A 4YOUA 4C1NI 1GLBG 1BUPA 2D4WA 3VTIA 5KQ8A 4CBWA 4A5BA 4CD1A 2HW3A 3VEWA 4LSNA 2HHHK 2P9UB 5F1XA 4OX9K 1TYQA 4FOEA 1GOAA 4MDAA 1YXQA 3L2RA 3Q7CA 3KLEA 2YKNA 3TSUA 4CIEA 4BC3A 1BQNA 5BR8K 1J6ZA 3H6EA 4OKEA 2XY5A 3LANA 4KHWA 3AA5X 3TABA 4AHUA 1KCFA 4KO0A 3OTOK 4Z4EA 1A5VA 2B5JA 3IKMA 1GLFO 2CGLA 3KLHA 1WSEA 1XMOK 3PO5A 4ELUA 2VGMA 3SZ2A 1S9EA 4FM2A 4NLCA 3TSPA 1EWRA 4BWMA 4CHYA 3SUPA 4X65K 1X9JA 1L5UA 4WCEL 2HVHA 3HPOA 4IO9L 1NK8A 4NCGA 3WT0A 1MU2A 4B3TK 2V7ZA 1YVNA 4C1NK 4ILGB 4DR4K 1VSEA 4H0PA 4KB1A 1S1XA 1NGIA 3C7NA 3QETA 1WSGA 3UE5A 1NG9A 2X6NA 3NF8A 2YNFA 3BUZB 2E2PA 1ZBSA 2IS3A 5AQUA 4A2BA 4JN4A 1KXPA 4CZEA 3K5LA 1UA0A 5AQPA 4JEPA 3VMFB 5BPMA 1OKJA 3SQ4A 1IO2A 1WUAA 4KI4A 3CJ1A 1J53A 3MX2A 5FPDA 5GIOA 2FXUA 1ZC6A 2ZD1A 4DQQA 4MQ3A 2PYJA 3OJSA 2A1SA 4BWJA 1JCFA 3M6GA 2GV9A 1Q82O 1WAFA 1L3VA 3SJHA 5A2QO 3E9PA 4BVOA 1W2BM 4FK4A 4CEEA 2O8EA 4F2RA 2UUBK 3RR8A 4KHPK 4EP5A 4Z4CA 4BE0A 1EO1A 4JI0K 3K9KA 1SKSA 3FGUA 3VQ6A 1HR0K 4MO4A 3ATUA 1ATNA 1JL1A 4BC5A 1NBWA 3CG7A 5AFUA 4W5QA 2QWOA 3MN7A 5M1NA 3U9ZA 4BREA 1SQKA 2E2OA 4FM0A 3AY9A 5C15A 4J2AA 2ZJRL 3ZSYA 1H1VA 1S5JA 3L3VA 4JKCA 4DLEA 1OH8A 1QS4A 4H0XB 3A5NC 1BO5O 1NGGA 3HVRA 4MLEA 2YNIA 1SV5A 3M8PA 4N56A 3VEYA 3RRHA 3N4QA 2CGJA 4AHVA 4B1XB 3UB5A 3V1OA 3O3GA 1U45A 1NJYA 4CBXA 4B9NA 3THVA 4HTLA 3NAEA 4Z4FA 4FW2A 3OYNA 4BDYA 2A6AA 2XHBA 2A1RA 1RBUA 5I3UA 4DFMA 4RW9A 1EX4A 3LZIA 4ISEA 1JLQA 4IKFA 1HKGA 4Y0WA 5M1PA 4C8KA 4FWMA 3JAMO 4E7IA 1NK5A 3NBPA 3H3NO 3UKRA 4IDKA 3PX0A 3KZBA 3VGKA 3NGYA 1U2VB 3R9PA 3QMLA 3IFRA 1N5YA 3NE6A 1HLUA 5HRSA 4LFAK 4G9ZA 4AH9A 4CZKA 3AO3A 3ZX3A 1O13A 1D8YA 2YHBA 5GADP 3A2FA 4CJPA 3PUFA 4CBUA 3RTVA 4IZ9A 4L3QA 3ZSWA 4FJMA 4KH5A 4OKKA 4CF0A 4Z94A 5HBMA 3JYTA 4KFBA 3C95A 3HL8A 4CF8A 3HK2A 3VF4A 3F2KA 3D45A 2QWQA 3V9XA 4K0KK 5EY4A 1ASVA 3LAKA 3QEPA 2QKBA 3LM2A 2CH5A 4AF1A 2KZMA 3MDQA 5GAGP 3OW2M 1ZBLA 1OH7A 1DTTA 5AQVA 1TK5A 3D2EB 3QLHA 4CD3A 4FJ9A 1IBLK 3F9MA 1NGDA 4LD0A 1C0TA 3EO3A 3KWGA 2JWLA 2KW4A 4DV5K 2HF3A 2RF2A 3GDQA 1VK0A 4DWIA 3HXMA 2GEMA 3VGMA 3QESA 1U48A 2DPNA 4L8RB 4F8RA 3IS9A 1VHXA 3VQ5A 5HL7L 4GV3A 3V1QA 4FPAA 4NXNK 4JKBA 4BDZA 3ZX2A 3LDPA 2UXDK 5JVHL 1N33K 2I7NA 3LWMA 2Z1JA 5AQKA 5AQXA 4UQGA 3DLLL 4DTXA 1TYQB 3MEEA 2QWLA 4FO0A 3JS6A 4K43A 4BROA 4GNIA 3CCUN 5AQRA 5F2RA 4IJNA 4EP4A 3VQPA 4JKEA 3QFPA 3G4SN 3O9SA 3LDLA 4JI7K 3SV4A 3EKUA 3MXIA 3OBYA 1VRUA 4PL7A 4N41A 3L2VA 3TR8A 4XH1A 1BOTO 1TK8A 1RFQA 1LW2A 1KQSM 3L8BA 4BRAA 3DWLA 2F96A 1WSJA 1WBDA 4DR6K 3THYA 2J4RA 2E8AA 3CERA 4IFEA 1D9FA 3JSMA 1N34K 5FROA 1LAWA 1G99A 5AQQA 2P9LA 3I33A 3SQ0A 5AZIA 1VSJA 1RT7A 4G1QA 4CEBA 3DM2A 4CJLA 3ITHA 3I8BA 3OYFA 3C7NB 3AVHA 3K9JA 1RT3A 3DXKA 3KLIA 2G8KA 3CFRA 3HPGA 4A62A 4CEFA 4F4KA 4LF6K 4BE1A 3CCJN 2BUPA 5HROA 3QNOA 1BA1A 1TVRA 1KAYA 1KRPA 3D7EO 3QICA 3I0RA 3HJFA 2DFEA 3HPHA 5JICA 3CI5A 4B9QA 3S3NA 1LCUA 1NGHA 3P38A 5AQYA 3TSQA 1NMNA 2HF4A 1JKHA 5AR0A 3OYKA 1MDUB 2O8EB 3WXMB 1M1KO 4O8KA 1DTQA 1FW6A 4FWNA 1BIUA 3CFOA 3DI6A 3AO5A 3P4IA 4OPKA 4AM7A 3NF7A 1W9HA 4X66K 2P9IA 3QIOA 3DOLA 3W3DA 4BGAA 4CEDA 3THWA 1YJNN 4ELTA 1J5OA 3BY5A 4H4OA 4B9MA 3DAWA 3MWPA 3NGIA 4LSLA 5J2NA 2VWJA 4OLBA 3CJAA 3TAGA 5IWAK 4BRLA 4HCCA 3P31A 4PQUA 4WQ5C 3ID6A 4B1UB 4CJ7A 3DJCA 4CFCA 2B4JA 2E4LA 1VQ9N 1WSFA 3ZYYX 4XEIA 1TKXA 4BRIA 3FZLA 3U8XA 2NRVA 4CZMA 4KTWA 1NWKA 1T05A 4I6MA 3H46O 1T03A 2GELA 2FF3B 1HUXA 4FWPA 2UUAK 3CD6N 3VQBA 4AM6A 4PKGA 3OYEA 1YI2N 1HQEA 4PKHA 4M3UA 3KK7A 2WONA 3UKRB 3OYGA 2HBJA 3D0PA 2OANA 4DTRA 1BU6O 2I7PA 3SLCA 4DR7K 3VN5A 4U7BA 2Q36A 4BR2A 4CK1A 3NVKA 4ID5A 3U6FA 3G25A 1MWMA 3Q7BA 1JXEA 4DFPA 1K73O 4KV8A 3M5RA 1T44A 3LDSA 4CGJA 2LSNA 1XUPO 3LPUA 4JD2A 1XNRK 3AVCA 4ILHA 3TAMA 4IWVA 1BCMA 2FSKA 4CGDA 3HM8A 4LC9B 4YY3K 2A41A 1FXXA 4B1YB 1XC9A 3SUNA 4FZXC 4HUEA 2Q31A 2RPIA 4CJFA 2O8CA 3CJCA 1X1PA 2V7YA 2ASPA 4M3TA 1ZBHA 3DMJA 4JKAA 4O44A 4WFBL 4LF5K 1T3VA 2UYTA 3AGKA 4KTZA 2YV0X 1Z05A 1EQYA 4FWQA 3KVGA 4A59A 3UIQA 1X3NA 4FZYA 4WF9L 4Z4GA 3C6UA 1NJIO 2QM1A 1Y64A 2DFFA 3HBTA 4CK3A 1RTJA 4DMNA 3BZCA 1RTHA 3VTHA 1VSFA 4UY8O 4BRHA 3SQ1A 4CJUA 4EZ6A 1C0MA 3VENA 4U67L 2XY6A 1IKYA 4B9TA 3DLHA 3KHYA 1YTUA 2F4VK 1LWFA 1RT1A 2QTDA 4E7LA 3KK2A 4BVPA 3IMXA 4FWRA 4RW6A 3AO4A 4X62K 4YOWA 3T69A 1D4XA 1IKVA 1SZ2A 1YJ9N 2F7TA 2P5GA 3QIPA 5LJWA 4C8OA 3LDOA 4WYBA 3SBGA 1EP4A 3K5OA 4KBOA 4M63C 4FWSA 4DFJA 4EZ9A 4BACA 3THYB 3OHRA 1ZYQA 5M1OA 4AHCA 1RDAA 5CYMA 3NF9A 3HO1A 2EX3A 4B9LA 4M7XA 1X9MA 4I2PA 3SUOA 4CZJA 5C10A 2P9LB 4CCHA 3RMDA 2GWJA 4CVNE 1S72N 4JKHA 5AZIB 1QQNA 2RKIA 2Y1JA 5I9EB 4BR9A 2O8BA 5ADXA 1SS6A 1C1AA 3GG4A 1NM1A 1K9MO 1VSHA 1ASWA 3DXKB 1DGKN 3RSEA 4FJ5A 2P9KA 3K5MA 3HT3A 1EETA 4LY7A 4Z4HA 2ITMA 3L4IA 4YDUA 1ILYA 2YI1A 1L3TA 1QSLA 5BRDA 3BDPA 3WNGA 3S3OA 1X9WA 3T7ZA 4CJ3A 3KK1A 3U3YA 4PY5A 5CE3A 2YX6A 4ZTJA 2Q3SA 3QO9A 1HX1A 3ZEUA 1IBMK 2G8HA 3ZSXA 1K8KA 2UXBK 4CGGA 3L2QA 4KTQA 4QOZB 4BE2A 1RBTA 3HM9A 2HB5A 3K58A 4NLBA 4MO5A 2CGKA 4CJSA 4CHPA 1VQ7N 1CXUA 1JLEA 1XHZA 4RW7A 4B3SK 2P9IB 2YHWA 3THWB 1U47A 4BQLA 3KKSA 5E26A 2OYQA 1VSKA 3LPTA 4FK2A 4DQIA 4W5TA 3CPEA 4KHYA 2PZSA 3PIPL 3V9WA 1RBVA 4H0VB 4IXCA 2QWRA 4WQ4A 4EFHA 1QVFM 2JGUA 4BRNA 4DQPA 3RWUA 1KVAA 1S6PA 2FBTA 2DFHA 2IVNA 4ISFA 3AO1A 1VQNN 3CF5L 4H5TA 4CEAA 2VYPA 4E7HA 4CFBA 2OPQA 3MN9A 2IVOA
chains in the Genus database with same CATH topology
3OYDA 4NCAA 3ZT0A 4OVLA 4M3YA 3A2FA 4OJRA 4HVJA 3NDKA 4CJPA 3PUFA 3RTVA 3M8RA 2D0CA 3MXMA 3ZSWA 4JRPA 4M45A 4OKKA 4FJMA 3KLFA 3VQEA 1K6YA 4CF0A 1VSLA 5HBMA 1KSPA 3JYTA 1HMVA 4KFBA 3C95A 3HL8A 4CF8A 3HK2A 4E1MA 4C8LA 4FLXA 3D45A 4M41A 3V9XA 4DQRA 3AVKA 4R5PA 3P1GA 1ASVA 3DRRA 3HSTB 3LAKA 4CHQA 3QEPA 2QKBA 5C42A 3G10A 1SL1A 4DSFA 2ZQBA 1TK0A 4M3ZA 5HRPA 3DYAA 4I7FA 1SKRA 2HNZA 2KZMA 4CJEA 4AILC 4GW6A 4DSJA 3KJVA 4OGCA 5CZ2A 1ZBLA 5I42A 3DOKA 3AVJA 3DLBA 1DTTA 4E7JA 2QK9A 4CFDA 3TARA 4CGIA 3TAPA 1YVUA 4ID1A 1TK5A 3KD5E 2FBVA 2P51A 3QLHA 1HPZA 1O1WA 3AA4A 1TKDA 5KI6A 4FJ9A 4ZHRA 3EZ5A 4LD0A 1C0TA 1FKOA 1R0AA 2OPRA 4M3RA 4HUGA 1KVCA 4HCBA 1HNVA 1Y97A 1T7PA 2O4IA 2KW4A 1Q8IA 2RF2A 4Q5VA 3BGRA 1UOCA 3B6OA 3VQ8A 1C1CA 1VK0A 1Z25A 2ZE2A 3OS0A 3V9SA 4B9VA 3SPYA 2OZMA 4DWIA 1EKEA 4AHTA 3MAQA 3HXMA 3ZSQA 5T7BA 4J2BA 3LAMA 4C8NA 3TI0A 5CZ1A 3QESA 4Y1DA 3QEXA 1U48A 4L8RB 2BGGA 4F8RA 3IS9A 3VQ5A 3K59A 2OZSA 3O4NA 1NK9A 2HHQA 1C1BA 3V1QA 1ITGA 4CIGA 4FYDA 1IH7A 4BDZA 1L3SA 2IDOA 4DTOA 4JRQA 5C24A 3LWMA 4O4GA 4CJKA 2Z1JA 3AVGA 5KGXA 4DTSA 3PV8A 4FLTA 1RTIA 1S6QA 4UQGA 3OYBA 3OYIA 3M8SA 3LWLA 4DTXA 1NK7A 1NK4A 3ZSOA 1UA1A 3MEEA 1BI4B 3ISNC 4OKJA 3PX6A 3WNEA 4O0JA 1D9DA 1ZBIA 4EP4A 2YNGA 3VQPA 4FK0A 3LP3A 4DFKA 3NH2A 1JL2A 2E6LA 3AVBA 3KLGA 4DSKA 4B3OA 4FZZA 3SV4A 1I3AA 1U04A 3AA3A 1IKWA 2D0AA 1VRUA 1VSDA 5KTQA 3MXIA 4YNQA 4DTUA 3VQCA 4N41A 4DTPA 1TKTA 3KK3A 3L2VA 3TR8A 1N6QA 1GOCA 1W0HA 3LZJA 2HHSA 1RDCA 4LH5A 3SCXA 5JS1A 2BE2A 1TK8A 4WE1A 4PWDA 1QSYA 1LWEA 1LW2A 1QQCA 4CF1A 5K14A 3ASMA 3L8BA 1HQUA 4CEQA 2F96A 3HVTA 4FJ8A 2GBZA 2XY8A 4DSIA 2FBXA 1WSJA 3M8QA 4J2DA 1U49A 2HHXA 1HNIA 4CJ4A 4GMJB 3T19A 3K2PA 1BHLA 4J2EA 3OY9A 3HP6A 4DS4A 2HHUA 1D9FA 3JSMA 4AHSA 4RW4A 5FROA 1LAWA 2IOCA 5DK5A 1RT4A 4OPJA 3SQ0A 1VSJA 1RT7A 4Z0UA 3O3HA 4G1QA 4CEBA 4FJLA 2X74A 1CZ9A 3DM2A 3AV9A 4CJLA 4Z4IA 5J2PA 3ITHA 1UWBA 3VQ7A 1QE1A 3OYCA 2ATQA 3OYFA 3E01A 3AVHA 3KLIA 1RT3A 5C25A 2G8KA 4FJKA 4JS5A 3CFRA 3HPGA 4KKOA 3T3FA 2Z1GA 4FJJA 4CEFA 3KIOA 1QTMA 4F4KA 4DQSA 2BANA 4BE1A 4FLWA 3TAEA 5FDLA 2Z1IA 1Z26A 4DG1A 2DTUA 4CJRA 2X6SA 2PY5A 4CFAA 5HROA 3PO4A 4E19A 5DMRA 3QNOA 3K5NA 2O4GA 1TV6A 1TVRA 3OYLA 1G15A 1LW0A 4DS5A 1KRPA 4DU1A 3DLKA 3I0RA 3HJFA 2D0BA 2DFEA 3HPHA 3VQAA 4CK2A 2AJQA 3S3NA 3SUQA 2G8HA 3DRPA 3OYHA 1U4BA 2XY7A 1VRTA 1WAJA 3SYZA 4FXDA 2Z1HA 4CJVA 1NK6A 4CERA 5KRTA 4M3XA 1JKHA 1XWLA 2W42A 1B92A 1WSHA 4TSXA 2FC0A 3OYKA 3OS2A 5J2MA 3MEDA 4IFVA 2IGIA 3F9KA 2Y1IA 1NOZA 3O3FA 3ULDA 1DTQA 3PX4A 1A5WA 1C6VA 5D3GA 1REVA 4PA1A 4N47A 3ZT3A 3IG1A 1BIUA 1FKPA 3CFOA 2QXFA 1J54A 3AVAA 3VQQA 3RMAA 3DI6A 3AO5A 3EYZA 4W5OA 4B9UA 1JLGA 3KKRA 4OPKA 3KTQA 3NF6A 5FRNA 2G8IA 3NF7A 1EXQA 1TAQA 1W9HA 4HUFA 2HNYA 4CIFA 4Q0BA 3QIOA 4CEDA 3DOLA 2G8VA 4F2SA 3VQ9A 4ELTA 1CLQA 1J5OA 3TAFA 2OA8A 4H4OA 1RBRA 3SPZA 4B9MA 4ZTFA 3NGIA 4LSLA 1KTQA 3RRGA 5HP1A 4KAZA 4KRFA 4I9LA 1S1TA 2VWJA 5J2NA 4FLUA 4FJXA 4OLBA 4F3TA 4FLYA 3TAGA 2HVIA 1BCOA 4FJGA 4AHRA 3WNHA 4HCCA 3NGZA 2HHTA 4PQUA 4MFBA 3QEWA 2YNHA 4CHZA 1GOBA 1TAUA 1IKXA 2I5JA 1XI1A 4CFCA 3CM6A 3AVIA 4CJQA 1TL1A 2B4JA 1VSIA 3ZT4A 5J2QA 3CM5A 1IG9A 4FJ7A 2F8SA 2E4LA 3AVMA 3OYMA 1D8YA 4KHUA 1WSFA 1TKXA 1HYZA 4CJ5A 1UAXA 3U3GA 4CJWA 3PY8A 4ICLA 1RTDA 1KLMA 3KD1E 4KTWA 4GVMA 1T05A 4O55A 1YTAA 5SWMA 2ITGA 2KQ2A 3AVFA 4M3WA 1T03A 4QAGA 2OPSA 5J1EA 1NJZA 4XIUA 3OVNA 4FCYA 4NYFA 1RCHA 2NUBA 1LAVA 3VQBA 5KGWA 1CXQA 3OYEA 3RMCA 1JXBA 1HQEA 4DF4A 4M3UA 3AA2A 2WONA 3O4QA 3OYGA 1RNHA 3D0PA 4DTJA 3LALA 3V4IA 5JS2A 3IRXA 5CYQA 4KB0A 4DTRA 3CYMA 3VN5A 3ALYA 4CK1A 1RT2A 1RILA 4ID5A 3U6FA 3V9ZA 4PUOA 3EY1A 4OGEA 4E0DA 5KRSA 5CY4A 4DTNA 1JXEA 4CJTA 4DFPA 5HLFA 4N5SA 4KV8A 1NJWA 3LDSA 1ZBUA 3ZCMA 2G8WA 4ELVA 3S3MA 1S1WA 3K57A 4CGJA 2LSNA 2VG7A 4DSEA 1WN7A 3LP0A 5HRNA 3LPUA 2YHAA 4K8XA 3AVCA 1DLOA 3VA3A 1C0UA 1TL3A 2FBYA 3HP9A 1J9AA 3I0SA 4E89A 3TAMA 1BCMA 4CGDA 1B9FA 3DRSA 3NFAA 1NKCA 4FVMA 2HW3A 4CEZA 1NKEA 4RW8A 1XC9A 1FXXA 1XHXA 4LSNA 3OYAA 4FLVA 2JLEA 3SUNA 2IC3A 3ZSRA 3TAQA 4CECA 2HNDA 3CQ8A 4FZXC 4HUEA 3FFIA 4CHOA 4KPYA 1BI4A 1GOAA 2RPIA 4W5RA 1NJXA 3C6TA 3I8DA 4CJFA 1RDBA 3L2RA 3DLGA 1RT6A 1WSIA 1X1PA 3KLEA 1T8EA 1S9GA 2YKNA 3VQ4A 4CIEA 4M3TA 1BQNA 1ZBHA 3DMJA 1RDDA 3QEVA 4O44A 4OKEA 2XY5A 3ZT2A 1LV5A 3LANA 4KHWA 3G0ZA 3AA5X 4LH4A 1JLAA 1S1VA 4KTZA 4O0IA 4M42A 3L3UA 2YV0X 3TABA 4AHUA 1KCFA 4KO0A 4HHTA 1HJRA 1TGOA 3UIQA 4Z4EA 2EHGA 2QKKA 1RBSA 1A5VA 4KI6A 2B5JA 3QNNA 2YKMA 4FZYA 3KLHA 1QHTA 4JS4A 4FJHA 4Z4GA 1WSEA 4E7KA 3C6UA 3HYFA 3QERA 3P83D 3PO5A 4ELUA 2HMIA 2DFFA 3SZ2A 4H8KA 4CK3A 1S9EA 1D5AA 3SQ2A 4RG8A 1RTJA 4FM2A 4DMNA 2VWKA 4OLAA 1RTHA 5HRRA 1VSFA 2X78A 4BWMA 4B08A 4CHYA 1VSMA 3SUPA 4FW1A 3OJUA 3SQ1A 1L5UA 4CESA 2VG5A 1BQMA 4CJUA 4DU4A 4EZ6A 1RT5A 3DLEA 1C0MA 3SV3A 4W5NA 3DLRA 2XY6A 2HVHA 1IKYA 3HPOA 3TANA 1NK8A 4B9TA 3DLHA 1YTUA 4NCGA 1HRHA 3QEIA 1MU2A 1LWFA 3V9UA 4DTMA 1SL2A 4NCBA 1RT1A 4E7LA 3SI6A 3KK2A 1VSEA 1WNSA 4KB1A 1Q9YA 1S1XA 4RW6A 3AO4A 3QETA 1WSGA 3NH1A 3TWHA 1X9SA 4CGHA 1IKVA 1I39A 2X6NA 3NF8A 1BGXT 2YNFA 1KFDA 3MECA 3H08A 2IS3A 4YFUA 1NKBA 2F8TA 2P5GA 3QIPA 2PYLA 3K5LA 1UA0A 1S1UA 3QINA 4C8OA 1EP4A 2GUIA 4KHSA 3K5OA 3SQ4A 4KREA 1HYVA 1IO2A 1YT3A 2VG6A 4KI4A 1FK9A 4DFJA 4EZ9A 1J53A 4B8CA 4BACA 4DLGA 4F3OA 2ZD1A 4DQQA 1NOYA 4MQ3A 2PYJA 3OJSA 4B8AB 2A1SA 4BWJA 2B6AA 1ZYQA 2BDPA 4AHCA 1RDAA 5CYMA 3NF9A 3HO1A 2EX3A 1LWCA 2GV9A 4B9LA 3MEGA 4DSLA 1QSSA 3T1AA 1X9MA 4I2PA 2R7YA 5SZTA 1WAFA 2D5RA 1CZBA 3SUOA 2KTQA 1TKZA 1L3VA 4CCHA 4B9NA 3RMDA 4CGFA 4CF2A 4IG0A 3S9HA 3C94A 2RKIA 2Y1JA 4FK4A 4CEEA 4F2RA 3VA0A 3RMBA 2E6MA 2KFZA 2KZZA 1C1AA 2XO7A 3RR8A 3ZT1A 5EU7A 4EP5A 4Z4CA 1VSHA 3AO2A 1ASWA 4BE0A 1SKSA 4FJ5A 3VQ6A 3WNFA 3NCIA 3K5MA 3HT3A 1JL1A 1EETA 4DU3A 3CG7A 4JLHA 4LY7A 4Z4HA 3OYJA 3LP1A 2DY4A 4W5QA 4E1NA 4E3SA 1L3UA 1ZBFA 1BISA 5FRMA 4FM0A 2XRIA 1L3TA 1QSLA 4BDPA 1F21A 1WLJA 2OPPA 4O5BA 3BDPA 4J2AA 3ZSYA 3WNGA 1NK0A 1S5JA 3L3VA 3MXJA 4DLEA 1QS4A 1BIZA 3S3OA 1X9WA 2KFNA 4CJ3A 1Q9XA 1SUQA 3KK1A 3HVRA 3AVLA 3U3YA 4CEOA 4PY5A 3CFPA 2YNIA 1SV5A 4ZTJA 3M8PA 4N56A 3VQDA 2Q3SA 3RRHA 3SJJA 3OS1A 3QO9A 2IAJA 4AHVA 4KHNA 3L2UA 3V1OA 3O3GA 1U45A 3AVNA 3ZSXA 1NJYA 1ASUA 1KFSA 3THVA 3ZSZA 4CGGA 3NAEA 4Z4FA 4FW2A 3L2QA 4IG3A 4KTQA 3LP2A 4CHNA 4QOZB 4I2QA 5E41A 4BE2A 1RBTA 3OYNA 3V6DA 3HM9A 2HB5A 3K58A 3V1RA 4BDYA 2P5OA 4K8ZA 4QCLA 4CHPA 2P1JA 4CJSA 2XHBA 4FM1A 1RBUA 5I3UA 2A1RA 1JLFA 4DFMA 4IBNA 1CXUA 1JLEA 1KLNA 1JLBA 1XHZA 4RW7A 2RN2A 3ZSVA 3RR7A 4RW9A 3V81A 1EX4A 3LZIA 1JLQA 4IKFA 1U47A 2HHVA 4I9QA 3KKSA 1SL0A 4B9SA 4C8KA 1KVBA 1B9DA 1SKWA 2OYQA 1VSKA 3LPTA 4H4MA 4E7IA 4DQIA 1NK5A 4FJNA 4FK2A 4W5TA 2ETJA 3NBPA 4KHYA 4DF8A 2PZSA 4IFYA 3V9WA 2HHWA 1RBVA 4N76A 4IDKA 4CF9A 3PX0A 1A5XA 3NGYA 4NYNA 3NH0A 2JGUA 4HTUA 4DQPA 1HYSA 3RWUA 3P5JA 1KVAA 1JLCA 1S6PA 2FBTA 3L2WA 3NHGA 2DFHA 3AO1A 1N5YA 3F73A 4C8MA 4CEAA 3B6PA 3NE6A 5HRSA 4AH9A 4E7HA 4CFBA 2OPQA 3AO3A 4CE9A 1BL3A 3IAYA 3SNNA 4KHQA 4FLZA 4FJIA 2WOMA 2G8FA 2YHBA 4Y1CA 2G8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYD A;  4NCA A;  3ZT0 A;  4OVL A;  4M3Y A;  3A2F A;  4OJR A;  4HVJ A;  3NDK A;  4CJP A;  3PUF A;  3RTV A;  3M8R A;  2D0C A;  3MXM A;  3ZSW A;  4JRP A;  4M45 A;  4OKK A;  4FJM A;  3KLF A;  3VQE A;  1K6Y A;  4CF0 A;  1VSL A;  5HBM A;  1KSP A;  3JYT A;  1HMV A;  4KFB A;  3C95 A;  3HL8 A;  4CF8 A;  3HK2 A;  4E1M A;  4C8L A;  4FLX A;  3D45 A;  4M41 A;  3V9X A;  4DQR A;  3AVK A;  4R5P A;  3P1G A;  1ASV A;  3DRR A;  3HST B;  3LAK A;  4CHQ A;  3QEP A;  2QKB A;  5C42 A;  3G10 A;  1SL1 A;  4DSF A;  2ZQB A;  1TK0 A;  4M3Z A;  5HRP A;  3DYA A;  4I7F A;  1SKR A;  2HNZ A;  2KZM A;  4CJE A;  4AIL C;  4GW6 A;  4DSJ A;  3KJV A;  4OGC A;  5CZ2 A;  1ZBL A;  5I42 A;  3DOK A;  3AVJ A;  3DLB A;  1DTT A;  4E7J A;  2QK9 A;  4CFD A;  3TAR A;  4CGI A;  3TAP A;  1YVU A;  4ID1 A;  1TK5 A;  3KD5 E;  2FBV A;  2P51 A;  3QLH A;  1HPZ A;  1O1W A;  3AA4 A;  1TKD A;  5KI6 A;  4FJ9 A;  4ZHR A;  3EZ5 A;  4LD0 A;  1C0T A;  1FKO A;  1R0A A;  2OPR A;  4M3R A;  4HUG A;  1KVC A;  4HCB A;  1HNV A;  1Y97 A;  1T7P A;  2O4I A;  2KW4 A;  1Q8I A;  2RF2 A;  4Q5V A;  3BGR A;  1UOC A;  3B6O A;  3VQ8 A;  1C1C A;  1VK0 A;  1Z25 A;  2ZE2 A;  3OS0 A;  3V9S A;  4B9V A;  3SPY A;  2OZM A;  4DWI A;  1EKE A;  4AHT A;  3MAQ A;  3HXM A;  3ZSQ A;  5T7B A;  4J2B A;  3LAM A;  4C8N A;  3TI0 A;  5CZ1 A;  3QES A;  4Y1D A;  3QEX A;  1U48 A;  4L8R B;  2BGG A;  4F8R A;  3IS9 A;  3VQ5 A;  3K59 A;  2OZS A;  3O4N A;  1NK9 A;  2HHQ A;  1C1B A;  3V1Q A;  1ITG A;  4CIG A;  4FYD A;  1IH7 A;  4BDZ A;  1L3S A;  2IDO A;  4DTO A;  4JRQ A;  5C24 A;  3LWM A;  4O4G A;  4CJK A;  2Z1J A;  3AVG A;  5KGX A;  4DTS A;  3PV8 A;  4FLT A;  1RTI A;  1S6Q A;  4UQG A;  3OYB A;  3OYI A;  3M8S A;  3LWL A;  4DTX A;  1NK7 A;  1NK4 A;  3ZSO A;  1UA1 A;  3MEE A;  1BI4 B;  3ISN C;  4OKJ A;  3PX6 A;  3WNE A;  4O0J A;  1D9D A;  1ZBI A;  4EP4 A;  2YNG A;  3VQP A;  4FK0 A;  3LP3 A;  4DFK A;  3NH2 A;  1JL2 A;  2E6L A;  3AVB A;  3KLG A;  4DSK A;  4B3O A;  4FZZ A;  3SV4 A;  1I3A A;  1U04 A;  3AA3 A;  1IKW A;  2D0A A;  1VRU A;  1VSD A;  5KTQ A;  3MXI A;  4YNQ A;  4DTU A;  3VQC A;  4N41 A;  4DTP A;  1TKT A;  3KK3 A;  3L2V A;  3TR8 A;  1N6Q A;  1GOC A;  1W0H A;  3LZJ A;  2HHS A;  1RDC A;  4LH5 A;  3SCX A;  5JS1 A;  2BE2 A;  1TK8 A;  4WE1 A;  4PWD A;  1QSY A;  1LWE A;  1LW2 A;  1QQC A;  4CF1 A;  5K14 A;  3ASM A;  3L8B A;  1HQU A;  4CEQ A;  2F96 A;  3HVT A;  4FJ8 A;  2GBZ A;  2XY8 A;  4DSI A;  2FBX A;  1WSJ A;  3M8Q A;  4J2D A;  1U49 A;  2HHX A;  1HNI A;  4CJ4 A;  4GMJ B;  3T19 A;  3K2P A;  1BHL A;  4J2E A;  3OY9 A;  3HP6 A;  4DS4 A;  2HHU A;  1D9F A;  3JSM A;  4AHS A;  4RW4 A;  5FRO A;  1LAW A;  2IOC A;  5DK5 A;  1RT4 A;  4OPJ A;  3SQ0 A;  1VSJ A;  1RT7 A;  4Z0U A;  3O3H A;  4G1Q A;  4CEB A;  4FJL A;  2X74 A;  1CZ9 A;  3DM2 A;  3AV9 A;  4CJL A;  4Z4I A;  5J2P A;  3ITH A;  1UWB A;  3VQ7 A;  1QE1 A;  3OYC A;  2ATQ A;  3OYF A;  3E01 A;  3AVH A;  3KLI A;  1RT3 A;  5C25 A;  2G8K A;  4FJK A;  4JS5 A;  3CFR A;  3HPG A;  4KKO A;  3T3F A;  2Z1G A;  4FJJ A;  4CEF A;  3KIO A;  1QTM A;  4F4K A;  4DQS A;  2BAN A;  4BE1 A;  4FLW A;  3TAE A;  5FDL A;  2Z1I A;  1Z26 A;  4DG1 A;  2DTU A;  4CJR A;  2X6S A;  2PY5 A;  4CFA A;  5HRO A;  3PO4 A;  4E19 A;  5DMR A;  3QNO A;  3K5N A;  2O4G A;  1TV6 A;  1TVR A;  3OYL A;  1G15 A;  1LW0 A;  4DS5 A;  1KRP A;  4DU1 A;  3DLK A;  3I0R A;  3HJF A;  2D0B A;  2DFE A;  3HPH A;  3VQA A;  4CK2 A;  2AJQ A;  3S3N A;  3SUQ A;  2G8H A;  3DRP A;  3OYH A;  1U4B A;  2XY7 A;  1VRT A;  1WAJ A;  3SYZ A;  4FXD A;  2Z1H A;  4CJV A;  1NK6 A;  4CER A;  5KRT A;  4M3X A;  1JKH A;  1XWL A;  2W42 A;  1B92 A;  1WSH A;  4TSX A;  2FC0 A;  3OYK A;  3OS2 A;  5J2M A;  3MED A;  4IFV A;  2IGI A;  3F9K A;  2Y1I A;  1NOZ A;  3O3F A;  3ULD A;  1DTQ A;  3PX4 A;  1A5W A;  1C6V A;  5D3G A;  1REV A;  4PA1 A;  4N47 A;  3ZT3 A;  3IG1 A;  1BIU A;  1FKP A;  3CFO A;  2QXF A;  1J54 A;  3AVA A;  3VQQ A;  3RMA A;  3DI6 A;  3AO5 A;  3EYZ A;  4W5O A;  4B9U A;  1JLG A;  3KKR A;  4OPK A;  3KTQ A;  3NF6 A;  5FRN A;  2G8I A;  3NF7 A;  1EXQ A;  1TAQ A;  1W9H A;  4HUF A;  2HNY A;  4CIF A;  4Q0B A;  3QIO A;  4CED A;  3DOL A;  2G8V A;  4F2S A;  3VQ9 A;  4ELT A;  1CLQ A;  1J5O A;  3TAF A;  2OA8 A;  4H4O A;  1RBR A;  3SPZ A;  4B9M A;  4ZTF A;  3NGI A;  4LSL A;  1KTQ A;  3RRG A;  5HP1 A;  4KAZ A;  4KRF A;  4I9L A;  1S1T A;  2VWJ A;  5J2N A;  4FLU A;  4FJX A;  4OLB A;  4F3T A;  4FLY A;  3TAG A;  2HVI A;  1BCO A;  4FJG A;  4AHR A;  3WNH A;  4HCC A;  3NGZ A;  2HHT A;  4PQU A;  4MFB A;  3QEW A;  2YNH A;  4CHZ A;  1GOB A;  1TAU A;  1IKX A;  2I5J A;  1XI1 A;  4CFC A;  3CM6 A;  3AVI A;  4CJQ A;  1TL1 A;  2B4J A;  1VSI A;  3ZT4 A;  5J2Q A;  3CM5 A;  1IG9 A;  4FJ7 A;  2F8S A;  2E4L A;  3AVM A;  3OYM A;  1D8Y A;  4KHU A;  1WSF A;  1TKX A;  1HYZ A;  4CJ5 A;  1UAX A;  3U3G A;  4CJW A;  3PY8 A;  4ICL A;  1RTD A;  1KLM A;  3KD1 E;  4KTW A;  4GVM A;  1T05 A;  4O55 A;  1YTA A;  5SWM A;  2ITG A;  2KQ2 A;  3AVF A;  4M3W A;  1T03 A;  4QAG A;  2OPS A;  5J1E A;  1NJZ A;  4XIU A;  3OVN A;  4FCY A;  4NYF A;  1RCH A;  2NUB A;  1LAV A;  3VQB A;  5KGW A;  1CXQ A;  3OYE A;  3RMC A;  1JXB A;  1HQE A;  4DF4 A;  4M3U A;  3AA2 A;  2WON A;  3O4Q A;  3OYG A;  1RNH A;  3D0P A;  4DTJ A;  3LAL A;  3V4I A;  5JS2 A;  3IRX A;  5CYQ A;  4KB0 A;  4DTR A;  3CYM A;  3VN5 A;  3ALY A;  4CK1 A;  1RT2 A;  1RIL A;  4ID5 A;  3U6F A;  3V9Z A;  4PUO A;  3EY1 A;  4OGE A;  4E0D A;  5KRS A;  5CY4 A;  4DTN A;  1JXE A;  4CJT A;  4DFP A;  5HLF A;  4N5S A;  4KV8 A;  1NJW A;  3LDS A;  1ZBU A;  3ZCM A;  2G8W A;  4ELV A;  3S3M A;  1S1W A;  3K57 A;  4CGJ A;  2LSN A;  2VG7 A;  4DSE A;  1WN7 A;  3LP0 A;  5HRN A;  3LPU A;  2YHA A;  4K8X A;  3AVC A;  1DLO A;  3VA3 A;  1C0U A;  1TL3 A;  2FBY A;  3HP9 A;  1J9A A;  3I0S A;  4E89 A;  3TAM A;  1BCM A;  4CGD A;  1B9F A;  3DRS A;  3NFA A;  1NKC A;  4FVM A;  2HW3 A;  4CEZ A;  1NKE A;  4RW8 A;  1XC9 A;  1FXX A;  1XHX A;  4LSN A;  3OYA A;  4FLV A;  2JLE A;  3SUN A;  2IC3 A;  3ZSR A;  3TAQ A;  4CEC A;  2HND A;  3CQ8 A;  4FZX C;  4HUE A;  3FFI A;  4CHO A;  4KPY A;  1BI4 A;  1GOA A;  2RPI A;  4W5R A;  1NJX A;  3C6T A;  3I8D A;  4CJF A;  1RDB A;  3L2R A;  3DLG A;  1RT6 A;  1WSI A;  1X1P A;  3KLE A;  1T8E A;  1S9G A;  2YKN A;  3VQ4 A;  4CIE A;  4M3T A;  1BQN A;  1ZBH A;  3DMJ A;  1RDD A;  3QEV A;  4O44 A;  4OKE A;  2XY5 A;  3ZT2 A;  1LV5 A;  3LAN A;  4KHW A;  3G0Z A;  3AA5 X;  4LH4 A;  1JLA A;  1S1V A;  4KTZ A;  4O0I A;  4M42 A;  3L3U A;  2YV0 X;  3TAB A;  4AHU A;  1KCF A;  4KO0 A;  4HHT A;  1HJR A;  1TGO A;  3UIQ A;  4Z4E A;  2EHG A;  2QKK A;  1RBS A;  1A5V A;  4KI6 A;  2B5J A;  3QNN A;  2YKM A;  4FZY A;  3KLH A;  1QHT A;  4JS4 A;  4FJH A;  4Z4G A;  1WSE A;  4E7K A;  3C6U A;  3HYF A;  3QER A;  3P83 D;  3PO5 A;  4ELU A;  2HMI A;  2DFF A;  3SZ2 A;  4H8K A;  4CK3 A;  1S9E A;  1D5A A;  3SQ2 A;  4RG8 A;  1RTJ A;  4FM2 A;  4DMN A;  2VWK A;  4OLA A;  1RTH A;  5HRR A;  1VSF A;  2X78 A;  4BWM A;  4B08 A;  4CHY A;  1VSM A;  3SUP A;  4FW1 A;  3OJU A;  3SQ1 A;  1L5U A;  4CES A;  2VG5 A;  1BQM A;  4CJU A;  4DU4 A;  4EZ6 A;  1RT5 A;  3DLE A;  1C0M A;  3SV3 A;  4W5N A;  3DLR A;  2XY6 A;  2HVH A;  1IKY A;  3HPO A;  3TAN A;  1NK8 A;  4B9T A;  3DLH A;  1YTU A;  4NCG A;  1HRH A;  3QEI A;  1MU2 A;  1LWF A;  3V9U A;  4DTM A;  1SL2 A;  4NCB A;  1RT1 A;  4E7L A;  3SI6 A;  3KK2 A;  1VSE A;  1WNS A;  4KB1 A;  1Q9Y A;  1S1X A;  4RW6 A;  3AO4 A;  3QET A;  1WSG A;  3NH1 A;  3TWH A;  1X9S A;  4CGH A;  1IKV A;  1I39 A;  2X6N A;  3NF8 A;  1BGX T;  2YNF A;  1KFD A;  3MEC A;  3H08 A;  2IS3 A;  4YFU A;  1NKB A;  2F8T A;  2P5G A;  3QIP A;  2PYL A;  3K5L A;  1UA0 A;  1S1U A;  3QIN A;  4C8O A;  1EP4 A;  2GUI A;  4KHS A;  3K5O A;  3SQ4 A;  4KRE A;  1HYV A;  1IO2 A;  1YT3 A;  2VG6 A;  4KI4 A;  1FK9 A;  4DFJ A;  4EZ9 A;  1J53 A;  4B8C A;  4BAC A;  4DLG A;  4F3O A;  2ZD1 A;  4DQQ A;  1NOY A;  4MQ3 A;  2PYJ A;  3OJS A;  4B8A B;  2A1S A;  4BWJ A;  2B6A A;  1ZYQ A;  2BDP A;  4AHC A;  1RDA A;  5CYM A;  3NF9 A;  3HO1 A;  2EX3 A;  1LWC A;  2GV9 A;  4B9L A;  3MEG A;  4DSL A;  1QSS A;  3T1A A;  1X9M A;  4I2P A;  2R7Y A;  5SZT A;  1WAF A;  2D5R A;  1CZB A;  3SUO A;  2KTQ A;  1TKZ A;  1L3V A;  4CCH A;  4B9N A;  3RMD A;  4CGF A;  4CF2 A;  4IG0 A;  3S9H A;  3C94 A;  2RKI A;  2Y1J A;  4FK4 A;  4CEE A;  4F2R A;  3VA0 A;  3RMB A;  2E6M A;  2KFZ A;  2KZZ A;  1C1A A;  2XO7 A;  3RR8 A;  3ZT1 A;  5EU7 A;  4EP5 A;  4Z4C A;  1VSH A;  3AO2 A;  1ASW A;  4BE0 A;  1SKS A;  4FJ5 A;  3VQ6 A;  3WNF A;  3NCI A;  3K5M A;  3HT3 A;  1JL1 A;  1EET A;  4DU3 A;  3CG7 A;  4JLH A;  4LY7 A;  4Z4H A;  3OYJ A;  3LP1 A;  2DY4 A;  4W5Q A;  4E1N A;  4E3S A;  1L3U A;  1ZBF A;  1BIS A;  5FRM A;  4FM0 A;  2XRI A;  1L3T A;  1QSL A;  4BDP A;  1F21 A;  1WLJ A;  2OPP A;  4O5B A;  3BDP A;  4J2A A;  3ZSY A;  3WNG A;  1NK0 A;  1S5J A;  3L3V A;  3MXJ A;  4DLE A;  1QS4 A;  1BIZ A;  3S3O A;  1X9W A;  2KFN A;  4CJ3 A;  1Q9X A;  1SUQ A;  3KK1 A;  3HVR A;  3AVL A;  3U3Y A;  4CEO A;  4PY5 A;  3CFP A;  2YNI A;  1SV5 A;  4ZTJ A;  3M8P A;  4N56 A;  3VQD A;  2Q3S A;  3RRH A;  3SJJ A;  3OS1 A;  3QO9 A;  2IAJ A;  4AHV A;  4KHN A;  3L2U A;  3V1O A;  3O3G A;  1U45 A;  3AVN A;  3ZSX A;  1NJY A;  1ASU A;  1KFS A;  3THV A;  3ZSZ A;  4CGG A;  3NAE A;  4Z4F A;  4FW2 A;  3L2Q A;  4IG3 A;  4KTQ A;  3LP2 A;  4CHN A;  4QOZ B;  4I2Q A;  5E41 A;  4BE2 A;  1RBT A;  3OYN A;  3V6D A;  3HM9 A;  2HB5 A;  3K58 A;  3V1R A;  4BDY A;  2P5O A;  4K8Z A;  4QCL A;  4CHP A;  2P1J A;  4CJS A;  2XHB A;  4FM1 A;  1RBU A;  5I3U A;  2A1R A;  1JLF A;  4DFM A;  4IBN A;  1CXU A;  1JLE A;  1KLN A;  1JLB A;  1XHZ A;  4RW7 A;  2RN2 A;  3ZSV A;  3RR7 A;  4RW9 A;  3V81 A;  1EX4 A;  3LZI A;  1JLQ A;  4IKF A;  1U47 A;  2HHV A;  4I9Q A;  3KKS A;  1SL0 A;  4B9S A;  4C8K A;  1KVB A;  1B9D A;  1SKW A;  2OYQ A;  1VSK A;  3LPT A;  4H4M A;  4E7I A;  4DQI A;  1NK5 A;  4FJN A;  4FK2 A;  4W5T A;  2ETJ A;  3NBP A;  4KHY A;  4DF8 A;  2PZS A;  4IFY A;  3V9W A;  2HHW A;  1RBV A;  4N76 A;  4IDK A;  4CF9 A;  3PX0 A;  1A5X A;  3NGY A;  4NYN A;  3NH0 A;  2JGU A;  4HTU A;  4DQP A;  1HYS A;  3RWU A;  3P5J A;  1KVA A;  1JLC A;  1S6P A;  2FBT A;  3L2W A;  3NHG A;  2DFH A;  3AO1 A;  1N5Y A;  3F73 A;  4C8M A;  4CEA A;  3B6P A;  3NE6 A;  5HRS A;  4AH9 A;  4E7H A;  4CFB A;  2OPQ A;  3AO3 A;  4CE9 A;  1BL3 A;  3IAY A;  3SNN A;  4KHQ A;  4FLZ A;  4FJI A;  2WOM A;  2G8F A;  2YHB A;  4Y1C A;  2G8U A; 
#chains in the Genus database with same CATH topology
 3OYD A;  1HKC A;  4GKK K;  1ZXO A;  3CJB A;  4DR1 K;  3TU5 A;  3MXM A;  3C65 A;  1E4G T;  4I6M B;  3E66 A;  1HMV A;  4B3R K;  4A2A A;  4CZI A;  3VEZ A;  3GL1 A;  4R5P A;  3P1G A;  3DRR A;  4FPB A;  5C2D A;  3G10 A;  2ZQB A;  1TK0 A;  5HRP A;  1OVQ A;  2GTD A;  4EHU A;  2HOE A;  4KH6 A;  4NXM K;  4AIL C;  4DSJ A;  4OGC A;  4IEI A;  2V52 B;  4JK7 A;  4E7J A;  2QWP A;  3TAR A;  1YVU A;  4ID1 A;  4CZF A;  3EKS A;  1O1W A;  3QBX A;  2OPR A;  3CC2 N;  4HCB A;  1T7P A;  3B8A X;  5JLH A;  4Q5V A;  1NGA A;  1UOC A;  3OS0 A;  1Z25 A;  2ZE2 A;  2OZM A;  2HHQ A;  4B9V A;  3SPY A;  4IDH A;  4YOR A;  3MAQ A;  3LAM A;  4C8N A;  3TI0 A;  4JD2 B;  2OZS A;  4K25 A;  4FYD A;  1Q18 A;  3CCE N;  4BGB A;  1VQ5 N;  4DTS A;  3OYB A;  1NK7 A;  3ZSO A;  5FPM A;  3ISN C;  4OKJ A;  2O8C B;  4M7Y A;  1D9D A;  1ZBI A;  4FK0 A;  1NGC A;  4DFK A;  1XC3 A;  2NRZ A;  2YJF A;  3D6R A;  4K41 A;  4B3O A;  1I3A A;  2D0A A;  4BY9 C;  1YAG A;  3VQC A;  4JK9 A;  1GOC A;  3SCX A;  1MWK A;  2BE2 A;  3NVM A;  4WE1 A;  1QQC A;  3SMS A;  4CF1 A;  3ASM A;  3CXC M;  3WQT A;  2F9T A;  4DQ8 A;  2W40 A;  2FBX A;  3MWT A;  4CJ4 A;  1E3M A;  4LFC K;  5AJ3 K;  3HP6 A;  4DS4 A;  2RHK A;  3O4W A;  5GIN A;  2HHU A;  3HOS A;  3FE1 A;  5DK5 A;  1RT4 A;  4OPJ A;  4GV9 A;  3J7A P;  5DM6 L;  4Z0U A;  5JMV A;  3LDN A;  4OO1 J;  1HNZ K;  1QE1 A;  3MMV A;  4B1W B;  1ATR A;  4FJK A;  4JS5 A;  5AQH A;  4KKO A;  4JI2 K;  2Z1G A;  1RDW X;  5IT9 O;  1QTM A;  4DQS A;  2BAN A;  2ZGZ A;  1XQS C;  1VAZ A;  2GUP A;  4DG1 A;  2DTU A;  2X6S A;  4BG9 A;  4E19 A;  1TV6 A;  1YIJ N;  4J8F A;  4JI8 K;  4DS5 A;  3O80 A;  2D0B A;  3VQA A;  2AJQ A;  3SUQ A;  4MLH A;  2E5L K;  1U4B A;  2XY7 A;  1VRT A;  5GAH P;  1NK6 A;  4CER A;  1QQO A;  4DV4 K;  1B92 A;  1WSH A;  4TSX A;  5J2M A;  2QWM A;  3OS2 A;  4IFV A;  5AQI A;  2IGI A;  2O8B B;  3CCR N;  5D3G A;  2Q97 A;  4GVE A;  3ZT3 A;  1RGI A;  3RSE B;  3IUC A;  1J54 A;  2P9K B;  3RMA A;  3O1B A;  4B9U A;  1JLG A;  3KKR A;  5CHI A;  3KTQ A;  2G8I A;  4ISG A;  4BRG A;  4HUF A;  1QVG M;  1GLD G;  3SPZ A;  4ZTF A;  3EL2 A;  4KAZ A;  4RWT A;  4KRF A;  1YJW N;  3O9T A;  2HVI A;  1BCO A;  4FWO A;  1C0F A;  2P9S A;  3NGZ A;  3ENO A;  1VQ8 N;  4MFB A;  2YNH A;  3CJ7 A;  3ZEU B;  1IKX A;  4BRF A;  3ZLJ A;  1K8K B;  1C0G A;  4CJQ A;  1VSI A;  2D0O A;  2F9W A;  1HYZ A;  3U3G A;  1V4S A;  4ICL A;  1ESV A;  3KD1 E;  4GVM A;  4O55 A;  1YTA A;  4JI4 K;  5H1S Q;  4M3W A;  2ZWH A;  3FZF A;  2NUB A;  1LAV A;  1N36 K;  3C6H A;  3NMU A;  5KGW A;  1WBB A;  4IEE A;  3RMC A;  3T1H K;  3O9Q A;  4DF4 A;  5AQJ A;  1RNH A;  5JS2 A;  3F5T A;  3IRX A;  4PL8 A;  3ZET A;  5C2F A;  4JV5 K;  2EWS A;  3ALY A;  1RIL A;  4C23 A;  3BF1 A;  4PKI A;  1V4T A;  3AGR A;  4BC2 A;  4OGE A;  5KRS A;  2JWK A;  4DTN A;  3HOT A;  4XH4 A;  2VG7 A;  5LMU K;  3LP0 A;  5HRN A;  5E84 A;  3VA3 A;  1C0U A;  3TTF A;  1TL3 A;  5F0X A;  2FBY A;  1WOQ A;  2VCP A;  3HP9 A;  3I0S A;  3LDQ A;  4BR4 A;  1KD1 O;  1B9F A;  4DV0 K;  4FL9 A;  2FLO A;  3DRS A;  3CCS N;  1NKC A;  5AQN A;  4CEZ A;  3OYA A;  2JLE A;  3ZSR A;  4CEC A;  2HND A;  4A5A A;  4CHO A;  2W6L A;  4KPY A;  1RDB A;  3DLG A;  4CW7 B;  1S9G A;  2O8D A;  4YOX A;  1RDD A;  3ZT2 A;  1LV5 A;  3I56 N;  1JLA A;  1S1V A;  3L3U A;  3G6E N;  4O5F A;  1TGO A;  3SAH A;  3QNN A;  2YKM A;  4YOV A;  1QHT A;  4JS4 A;  2QXL A;  1IJJ A;  3HYF A;  3QER A;  2HBM A;  4H8K A;  4RG8 A;  2VWK A;  4OLA A;  4QS7 A;  4EAH D;  2X78 A;  5KQD A;  4B08 A;  4FW1 A;  3C0B A;  3J7Y P;  1BG3 A;  3OJU A;  4CES A;  4DU4 A;  3R8E A;  4B1Z A;  1RT5 A;  3SV3 A;  3DLR A;  4MDB A;  5AFU H;  3J8A A;  3QEI A;  3FR0 A;  2HBL A;  3V9U A;  3QBW A;  4DTM A;  1KAX A;  4NCB A;  2KKZ A;  2IVP A;  4FOI A;  3SI6 A;  4BG8 A;  1WNS A;  1Q9Y A;  3TWH A;  5KPT A;  4JI1 K;  1BGX T;  1XMQ K;  3MEC A;  2YJE A;  2PAV A;  3H08 A;  4YFU A;  1NKB A;  5TKY A;  4KHS A;  1HYV A;  2VG6 A;  5FPN A;  5BRH A;  2A5X A;  4YOT A;  1TUU A;  5AQZ A;  4DLG A;  1NOY A;  4B8A B;  1HNX K;  2FF6 A;  2BDP A;  2KHO A;  2VGN A;  1LWC A;  3MEG A;  4DSL A;  2R7Y A;  4JAX A;  4RTF D;  3CCL N;  2OCE A;  3S9H A;  3C94 A;  2E1Y A;  4CZG A;  1S3X A;  3VA0 A;  3RMB A;  2XO7 A;  5EU7 A;  4BRD A;  3WNF A;  3H1Q A;  5LY3 A;  1I94 K;  3EEQ A;  4DU3 A;  3HI0 A;  3OYJ A;  3LP1 A;  2DY4 A;  4E1N A;  1BIS A;  4BRC A;  3S41 A;  3A5O C;  2QWN A;  3IDH A;  1F21 A;  1WLJ A;  2VWB A;  5EX5 A;  2ZJP L;  1NK0 A;  2NRH A;  3MXJ A;  1BIZ A;  2KFN A;  1NNE A;  5AQS A;  4CEO A;  3CFP A;  3OS1 A;  4KHN A;  1JCG A;  3L2U A;  1W97 L;  4YDU C;  1KFS A;  3AVN A;  1ASU A;  3VPZ A;  5AQM A;  3ZSZ A;  3QB0 A;  1E4F T;  4EIA A;  1YUW A;  4IG3 A;  3LP2 A;  4CHN A;  4I2Q A;  2P5O A;  4FWL A;  4CI6 A;  4K8Z A;  1DT9 A;  3RVC A;  4A57 A;  2P1J A;  5BRF A;  4FM1 A;  2PYL A;  4IBN A;  1KLN A;  3O9U A;  2ASO A;  3RR7 A;  4I9Q A;  2NRT A;  1KVB A;  1B9D A;  1K8A O;  2ETJ A;  4DUZ K;  5LJV A;  4DF8 A;  4N76 A;  4CF9 A;  3L0Q A;  4NYN A;  2P9S B;  4HTU A;  3P5J A;  1JLC A;  3FZH A;  3NHG A;  4OPA A;  3THX A;  2UU9 K;  2W6K A;  2UUC K;  3IAY A;  5BN9 A;  3SNN A;  4FLZ A;  4FJI A;  4DR2 K;  4B8C A;  2G8F A;  4Y1C A;  1QHA A;  4OVL A;  4M3Y A;  4HVJ A;  3NDK A;  4B3M K;  2ZF5 O;  5KPR A;  4JRP A;  3KLF A;  1KSP A;  3O1W A;  4DB3 A;  4E1M A;  4C8L A;  1MA9 B;  4R79 A;  4FLX A;  3KWI A;  5CR4 A;  3HST B;  4CHQ A;  3P39 A;  5AQL A;  4M3Z A;  4I7F A;  2WBN A;  1SKR A;  2HNZ A;  3BP8 A;  2E1Z A;  4CJE A;  3LL3 A;  5CZ2 A;  1QQM A;  3ZET B;  5I42 A;  4WQ5 A;  2QK9 A;  4CGI A;  3KD5 E;  4DR3 K;  1HPZ A;  3AA4 A;  1TKD A;  5KI6 A;  1Q7Y O;  4LF9 K;  4ZHR A;  3U4L A;  3H1V X;  1T6D A;  3AAQ A;  1R0A A;  3BF3 A;  1HNV A;  1Y97 A;  3FLC O;  3B6O A;  4F2S A;  1C1C A;  1IBK K;  4H5N A;  5T7B A;  4J2B A;  4ILJ A;  1NMD A;  4Y1D A;  5FPE A;  3H3O B;  3VEO A;  4IOA L;  1HNW K;  1C1B A;  3K0S A;  3ZX0 A;  4CIG A;  1IH7 A;  4A61 A;  5AQT A;  4JI6 K;  3SK3 A;  4JRQ A;  4CJK A;  3VF6 A;  4DUY K;  3PV8 A;  3OYI A;  1VQ4 N;  3PSF A;  5BR9 A;  3T1Y K;  3PX6 A;  4O0J A;  5EVZ A;  3PLA A;  3CIP A;  2W41 A;  2O8D B;  1QZ5 A;  5BPL A;  1NLV A;  4DSK A;  1U04 A;  3AA3 A;  1IKW A;  3GE1 A;  5KTQ A;  4YNQ A;  3O6W A;  3KK3 A;  1N6Q A;  1RDC A;  4LH5 A;  2YHY A;  4DV2 K;  4PWD A;  5K14 A;  4CEQ A;  1P90 A;  3HVT A;  4FJ8 A;  2GBZ A;  1IG8 A;  2NLX A;  3M8Q A;  3WQU A;  1U49 A;  4J2D A;  2HHX A;  1HNI A;  3T19 A;  5M1F A;  2NRW A;  4J2E A;  3DXM A;  4KH4 A;  3OY9 A;  4LF7 K;  4H03 B;  4JHD A;  1VQO N;  1VQM N;  4AHS A;  4RW4 A;  4E1J A;  5M1K A;  3H45 C;  4FJL A;  2X74 A;  1CZ9 A;  4O8U A;  2YCH A;  3AV9 A;  3OYC A;  3GOI A;  3R6M A;  1NU0 A;  4FJJ A;  2BTF A;  3TAE A;  1IV0 A;  5FDL A;  3M1F A;  1BA0 A;  2PY5 A;  3PO4 A;  3O8M A;  3LM9 A;  3K5N A;  2O4G A;  3CHW A;  1LW0 A;  4DU1 A;  3DLK A;  2ASM A;  3DRP A;  3OYH A;  1WAJ A;  3SYZ A;  4NO7 A;  4CJV A;  3CET A;  3WXI A;  1LOT B;  3WXK A;  4BRQ A;  1XWL A;  2W42 A;  2FC0 A;  1N32 K;  1U6Z A;  2Y1I A;  3BZK A;  2UXC K;  4GV6 A;  1REV A;  4JKF A;  2QXF A;  4BQZ A;  3VQQ A;  3EYZ A;  4IOC L;  4LFB K;  3TTC A;  5BPN A;  1EXQ A;  4Q0B A;  2G8V A;  3TAF A;  2OA8 A;  3D2F A;  5M1Q A;  1RBR A;  4BRP A;  3EZW A;  3E1Y A;  3MN5 A;  1S1T A;  4FLU A;  4F3T A;  4FLY A;  4FJG A;  2NRX A;  5JLF A;  2HHT A;  3QEW A;  1P8Z A;  3VES A;  4CHZ A;  1GOB A;  3VET A;  1TAU A;  1XI1 A;  3W0L A;  4JI3 K;  5J2Q A;  1SAZ A;  2E88 A;  3CM5 A;  2AA4 A;  3OYM A;  2Q0U A;  1Z6R A;  4CJ5 A;  1UAX A;  4CJW A;  2O8F A;  1FJG K;  1KLM A;  2KLA A;  2ITG A;  3AVF A;  4QAG A;  1NJZ A;  5J1E A;  4XIU A;  3OVN A;  4NYF A;  5FLX O;  4BR0 A;  5KPZ A;  1CXQ A;  3AA2 A;  2QI2 A;  3SBT A;  1VQ6 N;  1NGE A;  3LAL A;  5CYQ A;  4KB0 A;  1JCE A;  5ELZ A;  3CYM A;  3THX B;  4B1V A;  4PUO A;  3V9Z A;  1R59 O;  4LF4 K;  3AAR A;  4RCH A;  3PIO L;  3R3L A;  5CY4 A;  4CJT A;  1TUY A;  4N5S A;  1NJW A;  5C0Y A;  3ZCM A;  2G8W A;  4ELV A;  3S3M A;  3K57 A;  2QW9 A;  1DLO A;  3TPQ A;  4E89 A;  1J9A A;  1DEJ A;  1J5E K;  3NFA A;  4FVM A;  3SMP A;  1NKE A;  3L6Q A;  4RW8 A;  1XHX A;  4FLV A;  5AQF A;  3WXJ A;  2IC3 A;  3TAQ A;  3CQ8 A;  2VQF K;  2AP1 A;  3FFI A;  4K42 A;  1BI4 A;  4W5R A;  1NJX A;  2H3G X;  4IO8 A;  3C6T A;  3I8D A;  1RT6 A;  1WSI A;  5BRE A;  1T8E A;  3MCA B;  4WFN L;  3VQ4 A;  3QEV A;  4BRM A;  3FFK B;  4QS8 A;  3MCP A;  3G0Z A;  4LH4 A;  4O0I A;  3J80 O;  4M42 A;  4HHT A;  5GIP A;  5MLC Q;  1HJR A;  2EHG A;  2QKK A;  1RBS A;  5LL6 Z;  4KI6 A;  3A8Y A;  5AZJ A;  4FJH A;  4E7K A;  3P83 D;  2ZM6 K;  2HMI A;  3SQ2 A;  1D5A A;  5ADX H;  3O08 A;  1YF5 L;  5HRR A;  4X64 K;  1VSM A;  1ATS A;  2VG5 A;  1BQM A;  3DLE A;  4XH5 A;  4W5N A;  1GLC G;  3TAN A;  2P9P A;  4H0Y B;  1HRH A;  1DKG D;  4DKW A;  1SL2 A;  4FSV A;  3VOV A;  3NH1 A;  1X9S A;  4CGH A;  2WTU A;  1I39 A;  4BR5 A;  1KFD A;  3QFU A;  3WXL A;  2F8T A;  3CJ9 A;  1S1U A;  3QIN A;  2GUI A;  4KRE A;  1YT3 A;  3ENB A;  1FK9 A;  4H5V A;  2E20 A;  4F3O A;  4GKJ K;  2B6A A;  3DXM B;  2RE2 A;  4JHD B;  1QSS A;  1HKB A;  3T1A A;  3BEX A;  5SZT A;  2D5R A;  1CZB A;  2KTQ A;  1TKZ A;  1OVY A;  4V19 S;  4CGF A;  4CF2 A;  4IG0 A;  4F9O A;  3N4P A;  2HMP A;  3ID8 A;  4H5W A;  4GY2 B;  2E6M A;  2KFZ A;  2KZZ A;  2FSJ A;  3ZT1 A;  1M90 O;  3AO2 A;  2Q2R A;  3UKU A;  3AAP A;  3NCI A;  2E2N A;  4JLH A;  2VQE K;  3EE8 A;  1L3U A;  4E3S A;  2GX9 A;  1ZBF A;  3ENH A;  3CCV N;  4FWK A;  3TTD A;  3WEE A;  3O9R A;  2FSN A;  5FRM A;  2XRI A;  3VEV A;  4BDP A;  2OPP A;  4O5B A;  4EHT A;  1Q9X A;  1SUQ A;  3AVL A;  3VQD A;  5EXW A;  3SJJ A;  2IAJ A;  2HBK A;  2Q1N A;  2CH6 A;  2P9N A;  4BRK A;  3G71 N;  2OTL N;  4QS9 A;  2Q0R A;  2NNW A;  5E41 A;  3V6D A;  2A42 A;  3V1R A;  3E9O A;  4QCL A;  4DV3 K;  1JLF A;  3I55 N;  1JLB A;  1VQP N;  3ZSV A;  2RN2 A;  5C12 A;  3V81 A;  4H0T B;  3CME N;  1RDU A;  2HHV A;  1SL0 A;  4B9S A;  3D2F B;  4JKG A;  4JK8 A;  1SKW A;  3VEX A;  1EWQ A;  4FJN A;  4H4M A;  4CZH A;  3ULE A;  3M3Z A;  3ATV A;  4IFY A;  2HHW A;  3E9L A;  1GLE G;  1A5X A;  4DV1 K;  4IJA A;  3NH0 A;  1HYS A;  3L2W A;  3F73 A;  3PSI A;  4C8M A;  3B6P A;  1GLL O;  5EOY A;  4IOX A;  4CE9 A;  1BL3 A;  3VER A;  4KHQ A;  4H0O A;  3CQY A;  2WOM A;  2G8U A;  2E2Q A;  4NCA A;  3ZT0 A;  2HST A;  2O8F B;  4OJR A;  4DHY A;  3M8R A;  2D0C A;  4M45 A;  3VQE A;  1K6Y A;  1N8R O;  1VSL A;  2OTJ N;  4WFA L;  3FZK A;  4HWI A;  4M41 A;  4DQR A;  1BWF O;  1GLA G;  3AVK A;  1OH5 A;  4YOY A;  5C42 A;  3O5B A;  4DSF A;  1SL1 A;  3DYA A;  2P9U A;  4AQY K;  4GW6 A;  4DR5 K;  3KJV A;  4YHH K;  3FZM A;  3DOK A;  3AVJ A;  3DLB A;  4CFD A;  3TAP A;  2FBV A;  2P51 A;  3CC7 N;  3CCM N;  3EZ5 A;  1FKO A;  3JXU A;  4HUG A;  3A5M C;  4M3R A;  1KVC A;  5DM7 L;  3MX5 A;  3VGL A;  2O4I A;  4PHT X;  5AQG A;  1Q8I A;  3EE9 A;  3BGR A;  3VQ8 A;  3V9S A;  1W7A A;  1EKE A;  4AHT A;  1Q86 O;  1KAZ A;  3ZSQ A;  5CZ1 A;  2ZJQ L;  3QEX A;  2BGG A;  3K59 A;  1YIT N;  3O4N A;  1NK9 A;  4FVU A;  1ITG A;  4OPH A;  1WB9 A;  2BH1 A;  2IDO A;  1L3S A;  4DTO A;  5C24 A;  4O4G A;  3AVG A;  5KGX A;  3J7Z O;  2V51 B;  1RTI A;  1S6Q A;  3M8S A;  3CMA N;  4FLT A;  1X3M A;  3LWL A;  1NK4 A;  1UA1 A;  1BI4 B;  3MK6 A;  3QDK A;  3WNE A;  3WUH A;  4DV6 K;  2YNG A;  3LP3 A;  3NH2 A;  1JL2 A;  1CZA N;  2E6L A;  2PFU A;  3AVB A;  3KLG A;  4FZZ A;  1VSD A;  1QZ6 A;  4DTU A;  4DTP A;  1TKT A;  3CC4 N;  2HHS A;  1W0H A;  3LZJ A;  5JS1 A;  5AZJ B;  5BN8 A;  3OA9 A;  5AQO A;  1VQL N;  1QSY A;  1LWE A;  2GWK A;  1HQU A;  2XY8 A;  4DSI A;  5AQW A;  4GMJ B;  3K2P A;  1BHL A;  3VF2 A;  4DCH A;  5LMN K;  1GLJ O;  3J81 O;  2IOC A;  3MN6 A;  2P9P B;  1Q81 O;  3A5L C;  4BR7 A;  3O3H A;  2WUS A;  3CQX A;  3SAG A;  2NZT A;  4JNE A;  2A3Z A;  4Z4I A;  5J2P A;  1UWB A;  3VQ7 A;  2ATQ A;  3E01 A;  5C25 A;  3EN9 A;  1S22 A;  3T3F A;  1BDG A;  5JVG L;  1NGF A;  3KIO A;  1OH6 A;  4FLW A;  4JI5 K;  1KC8 O;  2Z1I A;  1Z26 A;  4CJR A;  4CFA A;  5DMR A;  5B8H A;  4BC4 A;  3OYL A;  1G15 A;  4WQ4 C;  4CK2 A;  3HTV A;  4JYA K;  4FXD A;  2Z1H A;  5KRT A;  4M3X A;  2ZGY A;  3MED A;  3F9K A;  1NOZ A;  3O3F A;  3ULD A;  3PX4 A;  1A5W A;  1C6V A;  4PA1 A;  4N47 A;  5GAE P;  3IG1 A;  5HOO A;  4DV7 K;  1FKP A;  3HRG A;  3AVA A;  4LF8 K;  3UKU B;  4W5O A;  5FRN A;  3NF6 A;  1T6C A;  1TAQ A;  2HNY A;  4CIF A;  1NGJ A;  3VQ9 A;  1CLQ A;  1NGB A;  3WEE B;  1YHQ N;  1KTQ A;  5TKW A;  2QA4 N;  5HP1 A;  2PBD A;  3RRG A;  4I9L A;  4FJX A;  4H5R A;  4AHR A;  3WNH A;  1U2V A;  3R1X A;  3U9D A;  3A0I X;  2I5J A;  3OBW A;  2P9N B;  3CM6 A;  2IIR A;  3AVI A;  1TL1 A;  3ZT4 A;  1IG9 A;  4FJ7 A;  2YHX A;  2F8S A;  3AVM A;  3SAF A;  4NB4 A;  4KHU A;  3C6A A;  2QEX N;  3PY8 A;  1RTD A;  5SWM A;  2KQ2 A;  1XNQ K;  2OPS A;  2WC9 A;  4FCY A;  1RCH A;  4JKG B;  3ULE B;  3GBT A;  1VQK N;  3CCQ N;  1JXB A;  3O4Q A;  4CZL A;  1JJ2 M;  3L4Q A;  1HPM A;  2NRR A;  4DTJ A;  3V4I A;  3CPW M;  3D2E A;  1RT2 A;  4JKD A;  2D1K A;  3EY1 A;  4E0D A;  1HJO A;  5HLF A;  2WFB A;  3HSC A;  1ZBU A;  2D0P A;  1S1W A;  4DSE A;  1WN7 A;  2YHA A;  4K8X A;  2A40 A;  3HZ6 A;  4YOU A;  4C1N I;  1GLB G;  1BUP A;  2D4W A;  3VTI A;  5KQ8 A;  4CBW A;  4A5B A;  4CD1 A;  2HW3 A;  3VEW A;  4LSN A;  2HHH K;  2P9U B;  5F1X A;  4OX9 K;  1TYQ A;  4FOE A;  1GOA A;  4MDA A;  1YXQ A;  3L2R A;  3Q7C A;  3KLE A;  2YKN A;  3TSU A;  4CIE A;  4BC3 A;  1BQN A;  5BR8 K;  1J6Z A;  3H6E A;  4OKE A;  2XY5 A;  3LAN A;  4KHW A;  3AA5 X;  3TAB A;  4AHU A;  1KCF A;  4KO0 A;  3OTO K;  4Z4E A;  1A5V A;  2B5J A;  3IKM A;  1GLF O;  2CGL A;  3KLH A;  1WSE A;  1XMO K;  3PO5 A;  4ELU A;  2VGM A;  3SZ2 A;  1S9E A;  4FM2 A;  4NLC A;  3TSP A;  1EWR A;  4BWM A;  4CHY A;  3SUP A;  4X65 K;  1X9J A;  1L5U A;  4WCE L;  2HVH A;  3HPO A;  4IO9 L;  1NK8 A;  4NCG A;  3WT0 A;  1MU2 A;  4B3T K;  2V7Z A;  1YVN A;  4C1N K;  4ILG B;  4DR4 K;  1VSE A;  4H0P A;  4KB1 A;  1S1X A;  1NGI A;  3C7N A;  3QET A;  1WSG A;  3UE5 A;  1NG9 A;  2X6N A;  3NF8 A;  2YNF A;  3BUZ B;  2E2P A;  1ZBS A;  2IS3 A;  5AQU A;  4A2B A;  4JN4 A;  1KXP A;  4CZE A;  3K5L A;  1UA0 A;  5AQP A;  4JEP A;  3VMF B;  5BPM A;  1OKJ A;  3SQ4 A;  1IO2 A;  1WUA A;  4KI4 A;  3CJ1 A;  1J53 A;  3MX2 A;  5FPD A;  5GIO A;  2FXU A;  1ZC6 A;  2ZD1 A;  4DQQ A;  4MQ3 A;  2PYJ A;  3OJS A;  2A1S A;  4BWJ A;  1JCF A;  3M6G A;  2GV9 A;  1Q82 O;  1WAF A;  1L3V A;  3SJH A;  5A2Q O;  3E9P A;  4BVO A;  1W2B M;  4FK4 A;  4CEE A;  2O8E A;  4F2R A;  2UUB K;  3RR8 A;  4KHP K;  4EP5 A;  4Z4C A;  4BE0 A;  1EO1 A;  4JI0 K;  3K9K A;  1SKS A;  3FGU A;  3VQ6 A;  1HR0 K;  4MO4 A;  3ATU A;  1ATN A;  1JL1 A;  4BC5 A;  1NBW A;  3CG7 A;  5AFU A;  4W5Q A;  2QWO A;  3MN7 A;  5M1N A;  3U9Z A;  4BRE A;  1SQK A;  2E2O A;  4FM0 A;  3AY9 A;  5C15 A;  4J2A A;  2ZJR L;  3ZSY A;  1H1V A;  1S5J A;  3L3V A;  4JKC A;  4DLE A;  1OH8 A;  1QS4 A;  4H0X B;  3A5N C;  1BO5 O;  1NGG A;  3HVR A;  4MLE A;  2YNI A;  1SV5 A;  3M8P A;  4N56 A;  3VEY A;  3RRH A;  3N4Q A;  2CGJ A;  4AHV A;  4B1X B;  3UB5 A;  3V1O A;  3O3G A;  1U45 A;  1NJY A;  4CBX A;  4B9N A;  3THV A;  4HTL A;  3NAE A;  4Z4F A;  4FW2 A;  3OYN A;  4BDY A;  2A6A A;  2XHB A;  2A1R A;  1RBU A;  5I3U A;  4DFM A;  4RW9 A;  1EX4 A;  3LZI A;  4ISE A;  1JLQ A;  4IKF A;  1HKG A;  4Y0W A;  5M1P A;  4C8K A;  4FWM A;  3JAM O;  4E7I A;  1NK5 A;  3NBP A;  3H3N O;  3UKR A;  4IDK A;  3PX0 A;  3KZB A;  3VGK A;  3NGY A;  1U2V B;  3R9P A;  3QML A;  3IFR A;  1N5Y A;  3NE6 A;  1HLU A;  5HRS A;  4LFA K;  4G9Z A;  4AH9 A;  4CZK A;  3AO3 A;  3ZX3 A;  1O13 A;  1D8Y A;  2YHB A;  5GAD P;  3A2F A;  4CJP A;  3PUF A;  4CBU A;  3RTV A;  4IZ9 A;  4L3Q A;  3ZSW A;  4FJM A;  4KH5 A;  4OKK A;  4CF0 A;  4Z94 A;  5HBM A;  3JYT A;  4KFB A;  3C95 A;  3HL8 A;  4CF8 A;  3HK2 A;  3VF4 A;  3F2K A;  3D45 A;  2QWQ A;  3V9X A;  4K0K K;  5EY4 A;  1ASV A;  3LAK A;  3QEP A;  2QKB A;  3LM2 A;  2CH5 A;  4AF1 A;  2KZM A;  3MDQ A;  5GAG P;  3OW2 M;  1ZBL A;  1OH7 A;  1DTT A;  5AQV A;  1TK5 A;  3D2E B;  3QLH A;  4CD3 A;  4FJ9 A;  1IBL K;  3F9M A;  1NGD A;  4LD0 A;  1C0T A;  3EO3 A;  3KWG A;  2JWL A;  2KW4 A;  4DV5 K;  2HF3 A;  2RF2 A;  3GDQ A;  1VK0 A;  4DWI A;  3HXM A;  2GEM A;  3VGM A;  3QES A;  1U48 A;  2DPN A;  4L8R B;  4F8R A;  3IS9 A;  1VHX A;  3VQ5 A;  5HL7 L;  4GV3 A;  3V1Q A;  4FPA A;  4NXN K;  4JKB A;  4BDZ A;  3ZX2 A;  3LDP A;  2UXD K;  5JVH L;  1N33 K;  2I7N A;  3LWM A;  2Z1J A;  5AQK A;  5AQX A;  4UQG A;  3DLL L;  4DTX A;  1TYQ B;  3MEE A;  2QWL A;  4FO0 A;  3JS6 A;  4K43 A;  4BRO A;  4GNI A;  3CCU N;  5AQR A;  5F2R A;  4IJN A;  4EP4 A;  3VQP A;  4JKE A;  3QFP A;  3G4S N;  3O9S A;  3LDL A;  4JI7 K;  3SV4 A;  3EKU A;  3MXI A;  3OBY A;  1VRU A;  4PL7 A;  4N41 A;  3L2V A;  3TR8 A;  4XH1 A;  1BOT O;  1TK8 A;  1RFQ A;  1LW2 A;  1KQS M;  3L8B A;  4BRA A;  3DWL A;  2F96 A;  1WSJ A;  1WBD A;  4DR6 K;  3THY A;  2J4R A;  2E8A A;  3CER A;  4IFE A;  1D9F A;  3JSM A;  1N34 K;  5FRO A;  1LAW A;  1G99 A;  5AQQ A;  2P9L A;  3I33 A;  3SQ0 A;  5AZI A;  1VSJ A;  1RT7 A;  4G1Q A;  4CEB A;  3DM2 A;  4CJL A;  3ITH A;  3I8B A;  3OYF A;  3C7N B;  3AVH A;  3K9J A;  1RT3 A;  3DXK A;  3KLI A;  2G8K A;  3CFR A;  3HPG A;  4A62 A;  4CEF A;  4F4K A;  4LF6 K;  4BE1 A;  3CCJ N;  2BUP A;  5HRO A;  3QNO A;  1BA1 A;  1TVR A;  1KAY A;  1KRP A;  3D7E O;  3QIC A;  3I0R A;  3HJF A;  2DFE A;  3HPH A;  5JIC A;  3CI5 A;  4B9Q A;  3S3N A;  1LCU A;  1NGH A;  3P38 A;  5AQY A;  3TSQ A;  1NMN A;  2HF4 A;  1JKH A;  5AR0 A;  3OYK A;  1MDU B;  2O8E B;  3WXM B;  1M1K O;  4O8K A;  1DTQ A;  1FW6 A;  4FWN A;  1BIU A;  3CFO A;  3DI6 A;  3AO5 A;  3P4I A;  4OPK A;  4AM7 A;  3NF7 A;  1W9H A;  4X66 K;  2P9I A;  3QIO A;  3DOL A;  3W3D A;  4BGA A;  4CED A;  3THW A;  1YJN N;  4ELT A;  1J5O A;  3BY5 A;  4H4O A;  4B9M A;  3DAW A;  3MWP A;  3NGI A;  4LSL A;  5J2N A;  2VWJ A;  4OLB A;  3CJA A;  3TAG A;  5IWA K;  4BRL A;  4HCC A;  3P31 A;  4PQU A;  4WQ5 C;  3ID6 A;  4B1U B;  4CJ7 A;  3DJC A;  4CFC A;  2B4J A;  2E4L A;  1VQ9 N;  1WSF A;  3ZYY X;  4XEI A;  1TKX A;  4BRI A;  3FZL A;  3U8X A;  2NRV A;  4CZM A;  4KTW A;  1NWK A;  1T05 A;  4I6M A;  3H46 O;  1T03 A;  2GEL A;  2FF3 B;  1HUX A;  4FWP A;  2UUA K;  3CD6 N;  3VQB A;  4AM6 A;  4PKG A;  3OYE A;  1YI2 N;  1HQE A;  4PKH A;  4M3U A;  3KK7 A;  2WON A;  3UKR B;  3OYG A;  2HBJ A;  3D0P A;  2OAN A;  4DTR A;  1BU6 O;  2I7P A;  3SLC A;  4DR7 K;  3VN5 A;  4U7B A;  2Q36 A;  4BR2 A;  4CK1 A;  3NVK A;  4ID5 A;  3U6F A;  3G25 A;  1MWM A;  3Q7B A;  1JXE A;  4DFP A;  1K73 O;  4KV8 A;  3M5R A;  1T44 A;  3LDS A;  4CGJ A;  2LSN A;  1XUP O;  3LPU A;  4JD2 A;  1XNR K;  3AVC A;  4ILH A;  3TAM A;  4IWV A;  1BCM A;  2FSK A;  4CGD A;  3HM8 A;  4LC9 B;  4YY3 K;  2A41 A;  1FXX A;  4B1Y B;  1XC9 A;  3SUN A;  4FZX C;  4HUE A;  2Q31 A;  2RPI A;  4CJF A;  2O8C A;  3CJC A;  1X1P A;  2V7Y A;  2ASP A;  4M3T A;  1ZBH A;  3DMJ A;  4JKA A;  4O44 A;  4WFB L;  4LF5 K;  1T3V A;  2UYT A;  3AGK A;  4KTZ A;  2YV0 X;  1Z05 A;  1EQY A;  4FWQ A;  3KVG A;  4A59 A;  3UIQ A;  1X3N A;  4FZY A;  4WF9 L;  4Z4G A;  3C6U A;  1NJI O;  2QM1 A;  1Y64 A;  2DFF A;  3HBT A;  4CK3 A;  1RTJ A;  4DMN A;  3BZC A;  1RTH A;  3VTH A;  1VSF A;  4UY8 O;  4BRH A;  3SQ1 A;  4CJU A;  4EZ6 A;  1C0M A;  3VEN A;  4U67 L;  2XY6 A;  1IKY A;  4B9T A;  3DLH A;  3KHY A;  1YTU A;  2F4V K;  1LWF A;  1RT1 A;  2QTD A;  4E7L A;  3KK2 A;  4BVP A;  3IMX A;  4FWR A;  4RW6 A;  3AO4 A;  4X62 K;  4YOW A;  3T69 A;  1D4X A;  1IKV A;  1SZ2 A;  1YJ9 N;  2F7T A;  2P5G A;  3QIP A;  5LJW A;  4C8O A;  3LDO A;  4WYB A;  3SBG A;  1EP4 A;  3K5O A;  4KBO A;  4M63 C;  4FWS A;  4DFJ A;  4EZ9 A;  4BAC A;  3THY B;  3OHR A;  1ZYQ A;  5M1O A;  4AHC A;  1RDA A;  5CYM A;  3NF9 A;  3HO1 A;  2EX3 A;  4B9L A;  4M7X A;  1X9M A;  4I2P A;  3SUO A;  4CZJ A;  5C10 A;  2P9L B;  4CCH A;  3RMD A;  2GWJ A;  4CVN E;  1S72 N;  4JKH A;  5AZI B;  1QQN A;  2RKI A;  2Y1J A;  5I9E B;  4BR9 A;  2O8B A;  5ADX A;  1SS6 A;  1C1A A;  3GG4 A;  1NM1 A;  1K9M O;  1VSH A;  1ASW A;  3DXK B;  1DGK N;  3RSE A;  4FJ5 A;  2P9K A;  3K5M A;  3HT3 A;  1EET A;  4LY7 A;  4Z4H A;  2ITM A;  3L4I A;  4YDU A;  1ILY A;  2YI1 A;  1L3T A;  1QSL A;  5BRD A;  3BDP A;  3WNG A;  3S3O A;  1X9W A;  3T7Z A;  4CJ3 A;  3KK1 A;  3U3Y A;  4PY5 A;  5CE3 A;  2YX6 A;  4ZTJ A;  2Q3S A;  3QO9 A;  1HX1 A;  3ZEU A;  1IBM K;  2G8H A;  3ZSX A;  1K8K A;  2UXB K;  4CGG A;  3L2Q A;  4KTQ A;  4QOZ B;  4BE2 A;  1RBT A;  3HM9 A;  2HB5 A;  3K58 A;  4NLB A;  4MO5 A;  2CGK A;  4CJS A;  4CHP A;  1VQ7 N;  1CXU A;  1JLE A;  1XHZ A;  4RW7 A;  4B3S K;  2P9I B;  2YHW A;  3THW B;  1U47 A;  4BQL A;  3KKS A;  5E26 A;  2OYQ A;  1VSK A;  3LPT A;  4FK2 A;  4DQI A;  4W5T A;  3CPE A;  4KHY A;  2PZS A;  3PIP L;  3V9W A;  1RBV A;  4H0V B;  4IXC A;  2QWR A;  4WQ4 A;  4EFH A;  1QVF M;  2JGU A;  4BRN A;  4DQP A;  3RWU A;  1KVA A;  1S6P A;  2FBT A;  2DFH A;  2IVN A;  4ISF A;  3AO1 A;  1VQN N;  3CF5 L;  4H5T A;  4CEA A;  2VYP A;  4E7H A;  4CFB A;  2OPQ A;  3MN9 A;  2IVO A; 
#chains in the Genus database with same CATH homology
 3OYD A;  4NCA A;  3ZT0 A;  4OVL A;  4M3Y A;  3A2F A;  4OJR A;  4HVJ A;  3NDK A;  4CJP A;  3PUF A;  3RTV A;  3M8R A;  2D0C A;  3MXM A;  3ZSW A;  4JRP A;  4M45 A;  4OKK A;  4FJM A;  3KLF A;  3VQE A;  1K6Y A;  4CF0 A;  1VSL A;  5HBM A;  1KSP A;  3JYT A;  1HMV A;  4KFB A;  3C95 A;  3HL8 A;  4CF8 A;  3HK2 A;  4E1M A;  4C8L A;  4FLX A;  3D45 A;  4M41 A;  3V9X A;  4DQR A;  3AVK A;  4R5P A;  3P1G A;  1ASV A;  3DRR A;  3HST B;  3LAK A;  4CHQ A;  3QEP A;  2QKB A;  5C42 A;  3G10 A;  1SL1 A;  4DSF A;  2ZQB A;  1TK0 A;  4M3Z A;  5HRP A;  3DYA A;  4I7F A;  1SKR A;  2HNZ A;  2KZM A;  4CJE A;  4AIL C;  4GW6 A;  4DSJ A;  3KJV A;  4OGC A;  5CZ2 A;  1ZBL A;  5I42 A;  3DOK A;  3AVJ A;  3DLB A;  1DTT A;  4E7J A;  2QK9 A;  4CFD A;  3TAR A;  4CGI A;  3TAP A;  1YVU A;  4ID1 A;  1TK5 A;  3KD5 E;  2FBV A;  2P51 A;  3QLH A;  1HPZ A;  1O1W A;  3AA4 A;  1TKD A;  5KI6 A;  4FJ9 A;  4ZHR A;  3EZ5 A;  4LD0 A;  1C0T A;  1FKO A;  1R0A A;  2OPR A;  4M3R A;  4HUG A;  1KVC A;  4HCB A;  1HNV A;  1Y97 A;  1T7P A;  2O4I A;  2KW4 A;  1Q8I A;  2RF2 A;  4Q5V A;  3BGR A;  1UOC A;  3B6O A;  3VQ8 A;  1C1C A;  1VK0 A;  1Z25 A;  2ZE2 A;  3OS0 A;  3V9S A;  4B9V A;  3SPY A;  2OZM A;  4DWI A;  1EKE A;  4AHT A;  3MAQ A;  3HXM A;  3ZSQ A;  5T7B A;  4J2B A;  3LAM A;  4C8N A;  3TI0 A;  5CZ1 A;  3QES A;  4Y1D A;  3QEX A;  1U48 A;  4L8R B;  2BGG A;  4F8R A;  3IS9 A;  3VQ5 A;  3K59 A;  2OZS A;  3O4N A;  1NK9 A;  2HHQ A;  1C1B A;  3V1Q A;  1ITG A;  4CIG A;  4FYD A;  1IH7 A;  4BDZ A;  1L3S A;  2IDO A;  4DTO A;  4JRQ A;  5C24 A;  3LWM A;  4O4G A;  4CJK A;  2Z1J A;  3AVG A;  5KGX A;  4DTS A;  3PV8 A;  4FLT A;  1RTI A;  1S6Q A;  4UQG A;  3OYB A;  3OYI A;  3M8S A;  3LWL A;  4DTX A;  1NK7 A;  1NK4 A;  3ZSO A;  1UA1 A;  3MEE A;  1BI4 B;  3ISN C;  4OKJ A;  3PX6 A;  3WNE A;  4O0J A;  1D9D A;  1ZBI A;  4EP4 A;  2YNG A;  3VQP A;  4FK0 A;  3LP3 A;  4DFK A;  3NH2 A;  1JL2 A;  2E6L A;  3AVB A;  3KLG A;  4DSK A;  4B3O A;  4FZZ A;  3SV4 A;  1I3A A;  1U04 A;  3AA3 A;  1IKW A;  2D0A A;  1VRU A;  1VSD A;  5KTQ A;  3MXI A;  4YNQ A;  4DTU A;  3VQC A;  4N41 A;  4DTP A;  1TKT A;  3KK3 A;  3L2V A;  3TR8 A;  1N6Q A;  1GOC A;  1W0H A;  3LZJ A;  2HHS A;  1RDC A;  4LH5 A;  3SCX A;  5JS1 A;  2BE2 A;  1TK8 A;  4WE1 A;  4PWD A;  1QSY A;  1LWE A;  1LW2 A;  1QQC A;  4CF1 A;  5K14 A;  3ASM A;  3L8B A;  1HQU A;  4CEQ A;  2F96 A;  3HVT A;  4FJ8 A;  2GBZ A;  2XY8 A;  4DSI A;  2FBX A;  1WSJ A;  3M8Q A;  4J2D A;  1U49 A;  2HHX A;  1HNI A;  4CJ4 A;  4GMJ B;  3T19 A;  3K2P A;  1BHL A;  4J2E A;  3OY9 A;  3HP6 A;  4DS4 A;  2HHU A;  1D9F A;  3JSM A;  4AHS A;  4RW4 A;  5FRO A;  1LAW A;  2IOC A;  5DK5 A;  1RT4 A;  4OPJ A;  3SQ0 A;  1VSJ A;  1RT7 A;  4Z0U A;  3O3H A;  4G1Q A;  4CEB A;  4FJL A;  2X74 A;  1CZ9 A;  3DM2 A;  3AV9 A;  4CJL A;  4Z4I A;  5J2P A;  3ITH A;  1UWB A;  3VQ7 A;  1QE1 A;  3OYC A;  2ATQ A;  3OYF A;  3E01 A;  3AVH A;  3KLI A;  1RT3 A;  5C25 A;  2G8K A;  4FJK A;  4JS5 A;  3CFR A;  3HPG A;  4KKO A;  3T3F A;  2Z1G A;  4FJJ A;  4CEF A;  3KIO A;  1QTM A;  4F4K A;  4DQS A;  2BAN A;  4BE1 A;  4FLW A;  3TAE A;  5FDL A;  2Z1I A;  1Z26 A;  4DG1 A;  2DTU A;  4CJR A;  2X6S A;  2PY5 A;  4CFA A;  5HRO A;  3PO4 A;  4E19 A;  5DMR A;  3QNO A;  3K5N A;  2O4G A;  1TV6 A;  1TVR A;  3OYL A;  1G15 A;  1LW0 A;  4DS5 A;  1KRP A;  4DU1 A;  3DLK A;  3I0R A;  3HJF A;  2D0B A;  2DFE A;  3HPH A;  3VQA A;  4CK2 A;  2AJQ A;  3S3N A;  3SUQ A;  2G8H A;  3DRP A;  3OYH A;  1U4B A;  2XY7 A;  1VRT A;  1WAJ A;  3SYZ A;  4FXD A;  2Z1H A;  4CJV A;  1NK6 A;  4CER A;  5KRT A;  4M3X A;  1JKH A;  1XWL A;  2W42 A;  1B92 A;  1WSH A;  4TSX A;  2FC0 A;  3OYK A;  3OS2 A;  5J2M A;  3MED A;  4IFV A;  2IGI A;  3F9K A;  2Y1I A;  1NOZ A;  3O3F A;  3ULD A;  1DTQ A;  3PX4 A;  1A5W A;  1C6V A;  5D3G A;  1REV A;  4PA1 A;  4N47 A;  3ZT3 A;  3IG1 A;  1BIU A;  1FKP A;  3CFO A;  2QXF A;  1J54 A;  3AVA A;  3VQQ A;  3RMA A;  3DI6 A;  3AO5 A;  3EYZ A;  4W5O A;  4B9U A;  1JLG A;  3KKR A;  4OPK A;  3KTQ A;  3NF6 A;  5FRN A;  2G8I A;  3NF7 A;  1EXQ A;  1TAQ A;  1W9H A;  4HUF A;  2HNY A;  4CIF A;  4Q0B A;  3QIO A;  4CED A;  3DOL A;  2G8V A;  4F2S A;  3VQ9 A;  4ELT A;  1CLQ A;  1J5O A;  3TAF A;  2OA8 A;  4H4O A;  1RBR A;  3SPZ A;  4B9M A;  4ZTF A;  3NGI A;  4LSL A;  1KTQ A;  3RRG A;  5HP1 A;  4KAZ A;  4KRF A;  4I9L A;  1S1T A;  2VWJ A;  5J2N A;  4FLU A;  4FJX A;  4OLB A;  4F3T A;  4FLY A;  3TAG A;  2HVI A;  1BCO A;  4FJG A;  4AHR A;  3WNH A;  4HCC A;  3NGZ A;  2HHT A;  4PQU A;  4MFB A;  3QEW A;  2YNH A;  4CHZ A;  1GOB A;  1TAU A;  1IKX A;  2I5J A;  1XI1 A;  4CFC A;  3CM6 A;  3AVI A;  4CJQ A;  1TL1 A;  2B4J A;  1VSI A;  3ZT4 A;  5J2Q A;  3CM5 A;  1IG9 A;  4FJ7 A;  2F8S A;  2E4L A;  3AVM A;  3OYM A;  1D8Y A;  4KHU A;  1WSF A;  1TKX A;  1HYZ A;  4CJ5 A;  1UAX A;  3U3G A;  4CJW A;  3PY8 A;  4ICL A;  1RTD A;  1KLM A;  3KD1 E;  4KTW A;  4GVM A;  1T05 A;  4O55 A;  1YTA A;  5SWM A;  2ITG A;  2KQ2 A;  3AVF A;  4M3W A;  1T03 A;  4QAG A;  2OPS A;  5J1E A;  1NJZ A;  4XIU A;  3OVN A;  4FCY A;  4NYF A;  1RCH A;  2NUB A;  1LAV A;  3VQB A;  5KGW A;  1CXQ A;  3OYE A;  3RMC A;  1JXB A;  1HQE A;  4DF4 A;  4M3U A;  3AA2 A;  2WON A;  3O4Q A;  3OYG A;  1RNH A;  3D0P A;  4DTJ A;  3LAL A;  3V4I A;  5JS2 A;  3IRX A;  5CYQ A;  4KB0 A;  4DTR A;  3CYM A;  3VN5 A;  3ALY A;  4CK1 A;  1RT2 A;  1RIL A;  4ID5 A;  3U6F A;  3V9Z A;  4PUO A;  3EY1 A;  4OGE A;  4E0D A;  5KRS A;  5CY4 A;  4DTN A;  1JXE A;  4CJT A;  4DFP A;  5HLF A;  4N5S A;  4KV8 A;  1NJW A;  3LDS A;  1ZBU A;  3ZCM A;  2G8W A;  4ELV A;  3S3M A;  1S1W A;  3K57 A;  4CGJ A;  2LSN A;  2VG7 A;  4DSE A;  1WN7 A;  3LP0 A;  5HRN A;  3LPU A;  2YHA A;  4K8X A;  3AVC A;  1DLO A;  3VA3 A;  1C0U A;  1TL3 A;  2FBY A;  3HP9 A;  1J9A A;  3I0S A;  4E89 A;  3TAM A;  1BCM A;  4CGD A;  1B9F A;  3DRS A;  3NFA A;  1NKC A;  4FVM A;  2HW3 A;  4CEZ A;  1NKE A;  4RW8 A;  1XC9 A;  1FXX A;  1XHX A;  4LSN A;  3OYA A;  4FLV A;  2JLE A;  3SUN A;  2IC3 A;  3ZSR A;  3TAQ A;  4CEC A;  2HND A;  3CQ8 A;  4FZX C;  4HUE A;  3FFI A;  4CHO A;  4KPY A;  1BI4 A;  1GOA A;  2RPI A;  4W5R A;  1NJX A;  3C6T A;  3I8D A;  4CJF A;  1RDB A;  3L2R A;  3DLG A;  1RT6 A;  1WSI A;  1X1P A;  3KLE A;  1T8E A;  1S9G A;  2YKN A;  3VQ4 A;  4CIE A;  4M3T A;  1BQN A;  1ZBH A;  3DMJ A;  1RDD A;  3QEV A;  4O44 A;  4OKE A;  2XY5 A;  3ZT2 A;  1LV5 A;  3LAN A;  4KHW A;  3G0Z A;  3AA5 X;  4LH4 A;  1JLA A;  1S1V A;  4KTZ A;  4O0I A;  4M42 A;  3L3U A;  2YV0 X;  3TAB A;  4AHU A;  1KCF A;  4KO0 A;  4HHT A;  1HJR A;  1TGO A;  3UIQ A;  4Z4E A;  2EHG A;  2QKK A;  1RBS A;  1A5V A;  4KI6 A;  2B5J A;  3QNN A;  2YKM A;  4FZY A;  3KLH A;  1QHT A;  4JS4 A;  4FJH A;  4Z4G A;  1WSE A;  4E7K A;  3C6U A;  3HYF A;  3QER A;  3P83 D;  3PO5 A;  4ELU A;  2HMI A;  2DFF A;  3SZ2 A;  4H8K A;  4CK3 A;  1S9E A;  1D5A A;  3SQ2 A;  4RG8 A;  1RTJ A;  4FM2 A;  4DMN A;  2VWK A;  4OLA A;  1RTH A;  5HRR A;  1VSF A;  2X78 A;  4BWM A;  4B08 A;  4CHY A;  1VSM A;  3SUP A;  4FW1 A;  3OJU A;  3SQ1 A;  1L5U A;  4CES A;  2VG5 A;  1BQM A;  4CJU A;  4DU4 A;  4EZ6 A;  1RT5 A;  3DLE A;  1C0M A;  3SV3 A;  4W5N A;  3DLR A;  2XY6 A;  2HVH A;  1IKY A;  3HPO A;  3TAN A;  1NK8 A;  4B9T A;  3DLH A;  1YTU A;  4NCG A;  1HRH A;  3QEI A;  1MU2 A;  1LWF A;  3V9U A;  4DTM A;  1SL2 A;  4NCB A;  1RT1 A;  4E7L A;  3SI6 A;  3KK2 A;  1VSE A;  1WNS A;  4KB1 A;  1Q9Y A;  1S1X A;  4RW6 A;  3AO4 A;  3QET A;  1WSG A;  3NH1 A;  3TWH A;  1X9S A;  4CGH A;  1IKV A;  1I39 A;  2X6N A;  3NF8 A;  1BGX T;  2YNF A;  1KFD A;  3MEC A;  3H08 A;  2IS3 A;  4YFU A;  1NKB A;  2F8T A;  2P5G A;  3QIP A;  2PYL A;  3K5L A;  1UA0 A;  1S1U A;  3QIN A;  4C8O A;  1EP4 A;  2GUI A;  4KHS A;  3K5O A;  3SQ4 A;  4KRE A;  1HYV A;  1IO2 A;  1YT3 A;  2VG6 A;  4KI4 A;  1FK9 A;  4DFJ A;  4EZ9 A;  1J53 A;  4B8C A;  4BAC A;  4DLG A;  4F3O A;  2ZD1 A;  4DQQ A;  1NOY A;  4MQ3 A;  2PYJ A;  3OJS A;  4B8A B;  2A1S A;  4BWJ A;  2B6A A;  1ZYQ A;  2BDP A;  4AHC A;  1RDA A;  5CYM A;  3NF9 A;  3HO1 A;  2EX3 A;  1LWC A;  2GV9 A;  4B9L A;  3MEG A;  4DSL A;  1QSS A;  3T1A A;  1X9M A;  4I2P A;  2R7Y A;  5SZT A;  1WAF A;  2D5R A;  1CZB A;  3SUO A;  2KTQ A;  1TKZ A;  1L3V A;  4CCH A;  4B9N A;  3RMD A;  4CGF A;  4CF2 A;  4IG0 A;  3S9H A;  3C94 A;  2RKI A;  2Y1J A;  4FK4 A;  4CEE A;  4F2R A;  3VA0 A;  3RMB A;  2E6M A;  2KFZ A;  2KZZ A;  1C1A A;  2XO7 A;  3RR8 A;  3ZT1 A;  5EU7 A;  4EP5 A;  4Z4C A;  1VSH A;  3AO2 A;  1ASW A;  4BE0 A;  1SKS A;  4FJ5 A;  3VQ6 A;  3WNF A;  3NCI A;  3K5M A;  3HT3 A;  1JL1 A;  1EET A;  4DU3 A;  3CG7 A;  4JLH A;  4LY7 A;  4Z4H A;  3OYJ A;  3LP1 A;  2DY4 A;  4W5Q A;  4E1N A;  4E3S A;  1L3U A;  1ZBF A;  1BIS A;  5FRM A;  4FM0 A;  2XRI A;  1L3T A;  1QSL A;  4BDP A;  1F21 A;  1WLJ A;  2OPP A;  4O5B A;  3BDP A;  4J2A A;  3ZSY A;  3WNG A;  1NK0 A;  1S5J A;  3L3V A;  3MXJ A;  4DLE A;  1QS4 A;  1BIZ A;  3S3O A;  1X9W A;  2KFN A;  4CJ3 A;  1Q9X A;  1SUQ A;  3KK1 A;  3HVR A;  3AVL A;  3U3Y A;  4CEO A;  4PY5 A;  3CFP A;  2YNI A;  1SV5 A;  4ZTJ A;  3M8P A;  4N56 A;  3VQD A;  2Q3S A;  3RRH A;  3SJJ A;  3OS1 A;  3QO9 A;  2IAJ A;  4AHV A;  4KHN A;  3L2U A;  3V1O A;  3O3G A;  1U45 A;  3AVN A;  3ZSX A;  1NJY A;  1ASU A;  1KFS A;  3THV A;  3ZSZ A;  4CGG A;  3NAE A;  4Z4F A;  4FW2 A;  3L2Q A;  4IG3 A;  4KTQ A;  3LP2 A;  4CHN A;  4QOZ B;  4I2Q A;  5E41 A;  4BE2 A;  1RBT A;  3OYN A;  3V6D A;  3HM9 A;  2HB5 A;  3K58 A;  3V1R A;  4BDY A;  2P5O A;  4K8Z A;  4QCL A;  4CHP A;  2P1J A;  4CJS A;  2XHB A;  4FM1 A;  1RBU A;  5I3U A;  2A1R A;  1JLF A;  4DFM A;  4IBN A;  1CXU A;  1JLE A;  1KLN A;  1JLB A;  1XHZ A;  4RW7 A;  2RN2 A;  3ZSV A;  3RR7 A;  4RW9 A;  3V81 A;  1EX4 A;  3LZI A;  1JLQ A;  4IKF A;  1U47 A;  2HHV A;  4I9Q A;  3KKS A;  1SL0 A;  4B9S A;  4C8K A;  1KVB A;  1B9D A;  1SKW A;  2OYQ A;  1VSK A;  3LPT A;  4H4M A;  4E7I A;  4DQI A;  1NK5 A;  4FJN A;  4FK2 A;  4W5T A;  2ETJ A;  3NBP A;  4KHY A;  4DF8 A;  2PZS A;  4IFY A;  3V9W A;  2HHW A;  1RBV A;  4N76 A;  4IDK A;  4CF9 A;  3PX0 A;  1A5X A;  3NGY A;  4NYN A;  3NH0 A;  2JGU A;  4HTU A;  4DQP A;  1HYS A;  3RWU A;  3P5J A;  1KVA A;  1JLC A;  1S6P A;  2FBT A;  3L2W A;  3NHG A;  2DFH A;  3AO1 A;  1N5Y A;  3F73 A;  4C8M A;  4CEA A;  3B6P A;  3NE6 A;  5HRS A;  4AH9 A;  4E7H A;  4CFB A;  2OPQ A;  3AO3 A;  4CE9 A;  1BL3 A;  3IAY A;  3SNN A;  4KHQ A;  4FLZ A;  4FJI A;  2WOM A;  2G8F A;  2YHB A;  4Y1C A;  2G8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...