3ZT4A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
154
structure length
151
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt4A00
4IDKA 1IG9A 1J9AA 4M3RA 3M8SA 4LSLA 4CJLA 2F8SA 4H4OA 2G8WA 3ZT2A 1NOYA 3VQ8A 4N5SA 3RWUA 3ZSYA 4QAGA 5SWMA 2XRIA 3AVGA 4AHUA 2FBTA 3CYMA 3H08A 4FK0A 3V1OA 4DTJA 4KHWA 2VG7A 3ISNC 4FLUA 5FROA 4OVLA 4DFPA 4KHYA 3I0RA 4PY5A 1VSJA 5HLFA 4CJSA 2HHVA 4BDPA 3AA3A 1SUQA 5CZ2A 3CQ8A 1NK6A 4KHNA 1RT3A 3CFPA 2KFZA 3OYCA 4KV8A 2YHAA 4LH5A 3ZSRA 4CJ4A 4CJFA 3HYFA 4DG1A 4R5PA 3LZIA 2GV9A 4AH9A 4CGIA 4M3XA 2Z1IA 4C8KA 4F3TA 4DF4A 4CJRA 3G0ZA 1C1AA 1YT3A 5KRTA 1BCOA 3KJVA 3ZSXA 2JLEA 4C8NA 3RMAA 4FJNA 3K59A 4I2PA 1YTAA 4GW6A 4DQRA 2ZQBA 3QEIA 1RT4A 3F73A 2WONA 1UAXA 1B9FA 3VN5A 4KB0A 1JLGA 4CGDA 4DFMA 2I5JA 4DU1A 1VSMA 1T03A 1L5UA 4I9QA 3NGYA 3TARA 3P5JA 2HHUA 1S6QA 2E6MA 1VSIA 1WAFA 1Y97A 3MXJA 1VRUA 1HQEA 4GVMA 4B8CA 4CEEA 4E7KA 1QSSA 3PX6A 1HYZA 1JLAA 2G8IA 3I8DA 1CZBA 1RBRA 1N6QA 4FJLA 3QEXA 2D0BA 1DLOA 1S1UA 5DK5A 5E41A 2RPIA 4TSXA 4JRPA 3K5MA 3QESA 4CFDA 3DOLA 4FLZA 4N76A 4Z4GA 3TI0A 3P1GA 4F4KA 3LANA 1LWFA 3O4NA 1NK9A 1R0AA 3SI6A 3V1QA 3HPOA 5J2NA 1NKCA 1T7PA 4KRFA 2ZE2A 2D0CA 2WOMA 4B8AB 4IFVA 4HUFA 4FZXC 2YKMA 4BDYA 1HYSA 3OS0A 4DS4A 4AHTA 2X6SA 1WN7A 5C24A 1TL3A 3AO4A 4RW7A 4N56A 3SNNA 3HP6A 1LW0A 5C25A 3THVA 1D8YA 4ELVA 3V1RA 4FLWA 4ELTA 1S9GA 3HP9A 4FLXA 4NYNA 3RRGA 4FZZA 5HP1A 3TAEA 3OYEA 2DTUA 1BIUA 4BWJA 4DTOA 3SCXA 3WNHA 3DRRA 4FW1A 1L3UA 2OZSA 4HTUA 5KI6A 3IG1A 1A5XA 2RN2A 3HPGA 4PA1A 3AVNA 4B9MA 1J54A 4PUOA 1EX4A 5K14A 4CCHA 1WLJA 1SL0A 3LDSA 3AVHA 1UOCA 3ZSWA 3HT3A 3PO5A 3M8RA 3TR8A 2ITGA 3ALYA 3LAMA 4DLGA 3QLHA 1LWCA 4DF8A 5D3GA 3KLEA 1C0MA 4O0JA 3NH2A 3NHGA 3ZSOA 1BI4A 3T19A 4JLHA 3LP0A 1J53A 1GOBA 2YV0X 4ZHRA 4CJKA 3OYKA 3VQAA 4FYDA 1LWEA 3DLEA 3L2UA 1ZBLA 3V9XA 4W5TA 3BDPA 3QETA 4DTNA 4FJKA 4M3UA 4PQUA 1VSFA 1ASUA 4W5OA 4E89A 4Z4IA 1JL1A 3V6DA 4BACA 3NBPA 4EP4A 1ASVA 1WSHA 3S9HA 4ID5A 3IRXA 4NYFA 5KGWA 4MQ3A 1REVA 4CFCA 4CFBA 3K58A 1ZBIA 1RBUA 4M41A 4O0IA 4MFBA 2XY6A 2DFFA 1TK0A 1QSLA 4J2AA 3LPUA 3L3UA 3MEGA 1QHTA 4CFAA 3T3FA 4W5RA 3LZJA 3V9WA 3HVRA 4CJ5A 2BE2A 1TKDA 1TAUA 5J2PA 1L3TA 4DSKA 5I42A 1NK7A 4OJRA 3KD1E 4KAZA 3MEEA 1B9DA 3I0SA 3K5OA 1FK9A 4OPKA 3TAGA 3VQ4A 4W5QA 4M3TA 2ATQA 1S1TA 3SPZA 3LP3A 1TK5A 1CXUA 2F96A 4OKEA 4N47A 3WNFA 1W9HA 4LD0A 2DFEA 1HPZA 3NF6A 4FVMA 4AHRA 3CFRA 3KLHA 4FLTA 4E7LA 3LP1A 3VA3A 1T05A 1QE1A 3FFIA 1VSEA 1WSGA 1KFSA 4B9LA 1A5VA 3ZT4A 1SL1A 4BE0A 2NUBA 1KSPA 3VQ7A 1XWLA 3AVBA 4B08A 3KTQA 1W0HA 4CE9A 1XI1A 4CEQA 5FRNA 4PWDA 1RTHA 2YNFA 3QNNA 1L3SA 4E7JA 5CY4A 1LAVA 2X6NA 4OKJA 4CJEA 2IC3A 2OPSA 2VG5A 4OGCA 3OJSA 4C8MA 4CERA 2ETJA 3U3YA 4Q5VA 4FK4A 2LSNA 5FRMA 4FJ7A 4DWIA 4W5NA 2Q3SA 3F9KA 4DQPA 4E0DA 2D5RA 4CHOA 4CF1A 3NH1A 4FJ8A 3MAQA 4HCCA 3L2VA 4IBNA 1Z25A 1RDCA 4CF0A 4CIGA 5JS2A 3LWLA 3EZ5A 4Y1DA 3TAFA 5HRRA 4F2RA 4IKFA 1FKOA 1IKXA 3ZT0A 1GOCA 1VRTA 4CHZA 4AILC 3PV8A 4DLEA 1KRPA 3KD5E 3PUFA 3AA2A 4Z4HA 1D5AA 1XHXA 3WNEA 2HNYA 2XY8A 2G8VA 4FXDA 2HHXA 4L8RB 4KREA 4CECA 3OYFA 3DLKA 3ASMA 3L8BA 1C0TA 2P5GA 2FBXA 3QIPA 2IAJA 2Z1GA 2KQ2A 3C95A 3OYBA 1TKZA 4G1QA 4RW4A 1J5OA 2BDPA 1RDBA 3AO3A 2HVHA 2KW4A 4CEDA 1JXBA 3DLBA 3NF7A 4BWMA 5T7BA 3OS2A 4HHTA 4FZYA 3VQ5A 5J1EA 3OYLA 3L2QA 1DTTA 1RT1A 2GBZA 1TAQA 1XC9A 4DQSA 4Z4FA 4KI4A 3LAKA 3V9SA 4DSJA 4OLBA 2E6LA 3ZSQA 3KKSA 3ZT3A 4CJUA 4Y1CA 5CYMA 3OYIA 3L2WA 4DTRA 3RMDA 4NCAA 1BHLA 1TGOA 4B9SA 1S1VA 2OPQA 3K5NA 1JL2A 4CGHA 4C8OA 1NK0A 1WSJA 3KK3A 3TAMA 4KHQA 3O4QA 1HQUA 4CJ3A 1A5WA 3C6UA 2A1SA 2VG6A 3CFOA 3AVAA 1RCHA 3HSTB 3DM2A 2YHBA 4NCGA 3VQBA 4E19A 3O3HA 3DOKA 1X9MA 1CXQA 1KCFA 3NGIA 3SUQA 1UA0A 2DY4A 2HNZA 1JXEA 3HK2A 4CEAA 3DRPA 2KZZA 1RNHA 3P83D 4M42A 1NJXA 4E7IA 1BISA 1HMVA 1U45A 3LWMA 4FM2A 1YTUA 4CK3A 4KO0A 4CEOA 3V4IA 1F21A 4CJPA 1S9EA 3AVFA 1QS4A 4O44A 4RW9A 5HRPA 3S3NA 1BI4B 2HB5A 1WNSA 3JSMA 3PY8A 2O4GA 1RTIA 1YVUA 3AO5A 3ZT1A 1SKWA 4FJMA 1IKYA 1HNVA 3DLHA 1JKHA 2JGUA 3SZ2A 1G15A 3V9ZA 4DTXA 1VK0A 1RBTA 1KVBA 4FJ9A 3K2PA 4DMNA 4HUGA 1BGXT 3OY9A 2KFNA 1NK8A 3A2FA 4CEFA 3SUPA 1WSFA 4CIEA 4RG8A 1NOZA 4FLVA 3KIOA 3OJUA 4H4MA 4RW8A 3TAPA 4DTSA 3HXMA 4OGEA 3RR7A 4OLAA 4DTMA 1BL3A 3MXMA 3S3MA 1SKSA 4N41A 3EYZA 3KLFA 4CEBA 3SQ1A 3QIOA 4CESA 3SV4A 1X9SA 1T8EA 1RILA 3OS1A 3QEVA 4DSIA 1U04A 4FLYA 2OA8A 3SUOA 3HO1A 3E01A 2R7YA 2KZMA 2B5JA 3MECA 2IOCA 2YNIA 3U3GA 2PYJA 1S1WA 2HNDA 4CHPA 4C8LA 3IAYA 5EU7A 2HHQA 4DQIA 4E3SA 4KPYA 3VQDA 3OYAA 4ID1A 3NGZA 3V9UA 4GMJB 4Q0BA 3AV9A 4K8ZA 1I39A 4E1MA 1NJWA 1RDAA 1VSKA 4AHCA 4KKOA 4FCYA 3QEPA 3AA4A 3OYGA 4IFYA 3KLGA 1TKTA 1X1PA 3VQCA 3RR8A 4CJTA 2W42A 2OZMA 4CJWA 1JLQA 4QOZB 4F2SA 3QERA 1BIZA 1NKEA 4CHYA 3RRHA 3K5LA 2BANA 2OPPA 2DFHA 2B6AA 4CF2A 1VSDA 1O1WA 5FDLA 1BQMA 1TK8A 4EZ9A 3TABA 4KFBA 1KLMA 2VWJA 4YNQA 1WSEA 4J2BA 3NCIA 4Z4EA 1KLNA 4KTQA 3L3VA 3BGRA 5SZTA 1D9FA 2YNGA 3NDKA 5C42A 3CM6A 4J2EA 1HYVA 3QINA 2HHSA 1NJYA 2VWKA 4LSNA 3ITHA 1IKWA 2FC0A 3WNGA 4JS5A 3LALA 1RTDA 1ITGA 5CZ1A 1C6VA 2E4LA 4CEZA 4DSFA 4IG0A 3OVNA 1CZ9A 3VQEA 5I3UA 2G8UA 2OYQA 1B92A 1QQCA 1NKBA 4B9TA 1RBSA 3ZSVA 3VQQA 1RT5A 2AJQA 2QKBA 3TANA 1RDDA 4CHNA 4CHQA 3S3OA 3SQ0A 3HM9A 3NE6A 4XIUA 3OYJA 1SV5A 3DYAA 5HRNA 3CM5A 3L2RA 3AA5X 4CK1A 2XY5A 1HRHA 1LAWA 3SQ4A 2QK9A 4F3OA 1IH7A 3AVCA 4LY7A 3KK2A 4UQGA 3V81A 1Q9XA 4HCBA 1ZBFA 2B4JA 4NCBA 2ZD1A 3LP2A 3HL8A 4O5BA 2EHGA 4CF8A 5KRSA 3U6FA 1LV5A 4FW2A 3OYNA 1KVAA 2YKNA 2Y1JA 2G8KA 4F8RA 4ICLA 4B3OA 1EKEA 3KLIA 2PYLA 4CK2A 4DU3A 1TVRA 2FBYA 1LW2A 1JLFA 4JS4A 3NAEA 2PZSA 3JYTA 3NH0A 4FM0A 1WAJA 1ZYQA 2Z1HA 1K6YA 3VQPA 3KK1A 3D0PA 4J2DA 4B9UA 1TKXA 1VSLA 2YNHA 5HBMA 2O4IA 3KKRA 1WSIA 3AO1A 1U49A 1QSYA 4I2QA 1IKVA 3AVMA 4CGGA 1EXQA 3TAQA 3DLGA 4OPJA 2GUIA 4OKKA 4E1NA 1Q8IA 4LH4A 2HHWA 3OYDA 4DSEA 1X9WA 2HW3A 1QTMA 2HHTA 1KFDA 3OYHA 2RKIA 4DTUA 4ELUA 2PY5A 5HRSA 3LPTA 4E7HA 1NK5A 4H8KA 5JS1A 1SL2A 1S1XA 2RF2A 3VQ9A 1ZBHA 4BDZA 1Z26A 4IG3A 4ZTFA 1D9DA 3SQ2A 3PO4A 3HJFA 4I9LA 1TL1A 2EX3A 3DRSA 3SYZA 3IS9A 2Y1IA 2BGGA 4Z0UA 3MXIA 2QKKA 1NK4A 4CIFA 4CGJA 3SUNA 1JLEA 3OYMA 1EP4A 4M45A 2XO7A 4ZTJA 4FJ5A 2FBVA 4RW6A 3HVTA 5HROA 4CGFA 4I7FA 3O3FA 3QEWA 4O4GA 1EETA 2P51A 1UWBA 4DTPA 4QCLA 3AO2A 3AVLA 1RT6A 5KTQA 1KTQA 4JRQA 3VQ6A 3T1AA 3K57A 2IDOA 1Q9YA 2P5OA 4YFUA 4FJHA 4M3WA 4HUEA 1JLCA 4CJQA 5J2QA 3RMBA 1UA1A 4HVJA 3UIQA 4FJXA 4DFKA 2OPRA 3RTVA 4M3YA 1BCMA 1RT7A 2QXFA 1I3AA 2D0AA 3CG7A 5KGXA 2IGIA 1FKPA 1IO2A 1C0UA 3DI6A 4Z4CA 3EY1A 1L3VA 3PX0A 1U47A 1U48A 4DFJA 1NJZA 4KI6A 4FM1A 3PX4A 3ZCMA 2F8TA 4FK2A 4KHSA 3DMJA 2X78A 3RMCA 4DU4A 3SPYA 4CJVA 4K8XA 4DS5A 4B9NA 3QO9A 1S5JA 3O3GA 1MU2A 2XHBA 4KHUA 1VSHA 3VA0A 1RT2A 1HNIA 2G8HA 3NF9A 4FJJA 1CLQA 2A1RA 3M8QA 4CF9A 3AVJA 2G8FA 3ZSZA 2HVIA 1GOAA 1RTJA 4FJIA 1SKRA 3NFAA 1DTQA 4O55A 3AVIA 4DQQA 1HJRA 3SJJA 4FJGA 1BQNA 4WE1A 3G10A 2X74A 3B6OA 3C6TA 1ASWA 1FXXA 3SV3A 1U4BA 2Z1JA 3M8PA 5J2MA 4KB1A 1C1CA 1JLBA 1KVCA 5DMRA 4DSLA 4KTZA 3TWHA 1ZBUA 3MEDA 3D45A 3QNOA 1N5YA 2XY7A 3NF8A 3DLRA 3HPHA 4EP5A 3ULDA 3B6PA 5CYQA 4BE2A 2HMIA 4EZ6A 3AVKA 1S6PA 4AHVA 1C1BA 4AHSA 4BE1A 4KTWA 4B9VA 4M3ZA 2KTQA 3C94A 2P1JA 1XHZA 2IS3A 1TV6A 1RBVA
chains in the Genus database with same CATH superfamily
4M3RA 3E66A 4BR7A 2F8SA 4H4OA 1NOYA 4N5SA 1Q7YO 4ISGA 2P9NB 4GNIA 4BROA 4AHUA 3H08A 4FK0A 4OVLA 2QWMA 4PY5A 5HLFA 2HHVA 2FF6A 3VF2A 5AQHA 2O8BA 3OYCA 5AQXA 2YHAA 4LH5A 4CJFA 3HYFA 1T44A 2Z1IA 4C8KA 4A2AA 3DWLA 3LM2A 3MK6A 1YT3A 1BCOA 5M1KA 3RMAA 2ZQBA 3F73A 1UAXA 4JHDA 2I5JA 4I9QA 3TARA 2HHUA 4CEEA 1ATSA 3WXJA 1VRUA 1HYZA 1JLAA 3OTOK 4BGBA 4BRHA 4JEPA 3DAWA 3CJCA 4FLZA 4Z4GA 3P1GA 1LWFA 1R0AA 1NKCA 4KRFA 3BEXA 4B8AB 4FZXC 4DS4A 2VGNA 1WN7A 3I33A 5BRHA 4LF5K 4B1YB 3VEWA 3HP6A 3G4SN 3A0IX 3V1RA 3EKSA 4ELTA 2O8DA 3HP9A 3O1BA 1YAGA 2E8AA 3VOVA 4FLXA 5B8HA 4ISFA 2DTUA 4BWJA 1VQON 1L3UA 2BH1A 3N4QA 1YHQN 5AQSA 4PA1A 3AVNA 1EX4A 1M1KO 3LDSA 3T69A 2HSTA 5HL7L 3LAMA 1HLUA 3QLHA 1C0MA 2UYTA 4O0JA 3NH2A 3NHGA 3ZSOA 3VQAA 1XUPO 4FYDA 1ZBLA 4M3UA 1ASUA 1KD1O 4Z4IA 1WSHA 2A41A 4CFCA 4MQ3A 5AQUA 4LF7K 1ZBIA 1RBUA 1QSLA 4NLCA 4MFBA 4J2AA 3L3UA 3MEGA 2YHXA 4CZFA 5BREA 4W5RA 3V9WA 1EO1A 3HVRA 2BE2A 1YJNN 1TAUA 5J2PA 3CXCM 5I42A 3KD1E 2HBJA 4OPKA 3THXA 3OBYA 1CXUA 2Q97A 3KWIA 2GX9A 3P4IA 4OKEA 4AHRA 1HX1A 2QEXN 3FFIA 1WSGA 1A5VA 2PFUA 1SL1A 4BE0A 3CC2N 3AVBA 4B08A 2Q1NA 2YNFA 5CY4A 4CZJA 4CJEA 2IC3A 3CCUN 2VG5A 4OGCA 3OJSA 1VQLN 4C8MA 4CERA 2ETJA 4FK4A 4JI7K 4FJ7A 4QS8A 3UE5A 2P9SB 3DJCA 4FJ8A 4HCCA 1Z25A 2WUSA 3G25A 2E2QA 4B3RK 3TAFA 1LOTB 3ZT0A 3KD5E 3P38A 2XY8A 4XH1A 2G8VA 4CECA 1YUWA 1BG3A 4LFBK 2VYPA 1J5OA 3OYBA 5FLXO 3AO3A 2KW4A 2UXCK 1K9MO 2KHOA 3TU5A 4HHTA 4FZYA 3VQ5A 5TKYA 1GLAG 4KI4A 5C2DA 2P9IB 1BU6O 3MMVA 5GAHP 4MO4A 3KKSA 3ZT3A 3RMDA 3L2WA 1BHLA 3D2FB 4PHTX 3K5NA 5BN9A 4DV7K 4KHQA 3O4QA 2QXLA 3C6UA 4BC2A 3VQBA 3O3HA 1RCHA 3RSEA 2HNZA 1JXEA 2O8CA 2KZZA 1RNHA 4IZ9A 5AQRA 1BISA 2O8EA 1YTUA 1F21A 5HRPA 4WQ5A 3S3NA 1WNSA 3PY8A 1SKWA 3ZT1A 1BUPA 3CCLN 4G9ZA 3SK3A 3A2FA 4CEFA 4CIEA 4FLVA 3OJUA 4H4MA 4RW8A 3RR7A 4OLAA 4DTMA 4B1ZA 4C23A 4KH4A 2V51B 3HOSA 3MCAB 4CESA 1RILA 5AQQA 4FLYA 1NLVA 3J7ZO 2KZMA 2IOCA 2YNIA 3U3GA 4DUYK 2PYJA 2HNDA 4C8LA 4JI2K 3OYAA 3V9UA 1I39A 4JN4A 3QEPA 3ULEB 3AA4A 1NGDA 4CJTA 2OZMA 4CJWA 3S41A 2UU9K 3HBTA 3H1VX 3QERA 4CHYA 3K5LA 1ATNA 2DFHA 3A5LC 1VSDA 3IDHA 4EZ9A 4KFBA 5F2RA 1KLMA 3CHWA 5SZTA 2E2NA 4J2EA 3QMLA 4LSNA 3ITHA 4HWIA 2FC0A 1C6VA 4IG0A 2OYQA 1NKBA 4B9TA 1RBSA 3SLCA 3VQQA 4JKCA 3UKRB 2QKBA 1RDDA 1NGAA 4CHQA 2VQEK 1OH7A 5HRNA 3DYAA 4I6MA 4FWLA 3AA5X 3SQ4A 2QK9A 2P9NA 3J8AA 3SJHA 1Q9XA 1HKCA 1R59O 1MA9B 4CF8A 2EHGA 5AQYA 3OYNA 3ZX0A 2Y1JA 4ICLA 1WUAA 4BRMA 4DU3A 4JS4A 3JYTA 1QQMA 2D1KA 3KK1A 1JCFA 1QVGM 3R8EA 4B9UA 4J2DA 2NRTA 3ZX3A 1HR0K 3AVMA 4CGGA 1IBMK 1GLDG 2GUIA 4OKKA 1Q8IA 4LH4A 2HHWA 4H0XB 2HW3A 4PL8A 3WEEA 1ZBSA 2RKIA 4A5AA 2PY5A 1X3MA 5GIOA 1SL2A 3CCQN 1QHAA 1NGEA 4I9LA 2EX3A 4Z0UA 2QKKA 1SS6A 3C6HA 2GTDA 1C0FA 4DKWA 1JLEA 2RHKA 1EP4A 2IVPA 3I8BA 3SBTA 4FJ5A 3HVTA 3THYA 3D2EB 4RWTA 3QEWA 4O4GA 1EETA 3AARA 3EEQA 1KTQA 3L0QA 4CJQA 3ZETA 3RMBA 4HVJA 3UIQA 4FJXA 2OPRA 3SAHA 4DR1K 4JI8K 2D0AA 2UUAK 5KGXA 1N32K 3VGLA 2IGIA 4MLHA 4EHTA 1C0UA 4JK7A 1S22A 2V7ZA 1L3VA 1U47A 3ZYYX 1NJZA 1S3XA 1VQ8N 3VESA 4OO1J 3ZCMA 2YHWA 5EXWA 4KHUA 3VA0A 4K0KK 3D2FA 2NRXA 3AVJA 4DCHA 1RTJA 1SKRA 2JWKA 3MWPA 2J4RA 1ASWA 5AQTA 3R9PA 3BP8A 3CCEN 3EE8A 1KVCA 1W97L 5DMRA 3MEDA 3O9TA 3LDNA 2UXDK 1N5YA 4JI1K 1KAXA 3HPHA 3NF8A 4BE2A 3BUZB 5AQJA 2HMIA 3LDLA 4KTWA 5C12A 3C94A 3GE1A 4DSKA 1IG9A 1J9AA 3HZ6A 4LSLA 4CJLA 3VGKA 3VQ8A 4DQ8A 4QAGA 3AVGA 4FPAA 2FBTA 4BRNA 1NWKA 3V1OA 4FLUA 4DFPA 4U67L 4FSVA 4BR4A 1SUQA 4FO0A 4PKHA 4OX9K 1RT3A 4B1VA 1EWRA 4CJ4A 1EWQA 3LZIA 2GV9A 4AH9A 4NXMK 1MWKA 2VCPA 1T6CA 3QB0A 2JLEA 5ADXH 4DQRA 5MLCQ 4IO8A 1RT4A 3QFPA 2WONA 5KPZA 3CI5A 4DU1A 1KAZA 4GV9A 3ZEUB 4GVMA 4E7KA 1HQEA 5DM6L 1CZBA 2VQFK 2IIRA 5TKWA 4FJLA 3QEXA 2D0BA 2ZJRL 3W3DA 1S1UA 4BC3A 1OH5A 2RPIA 4V19S 4TSXA 2GELA 3DOLA 3QFUA 4F4KA 3DLLL 1VQ7N 3V1QA 1GLBG 1T7PA 2ZE2A 2D0CA 2WOMA 3HOTA 4IFVA 4HUFA 3CJ1A 4BDYA 1N36K 1FW6A 4N56A 1NBWA 3WXIA 5HP1A 3TAEA 1BIUA 2P9KB 4DTOA 3SCXA 1WB9A 2FXUA 1A5XA 1J54A 1SQKA 1WLJA 4DV6K 3AVHA 1NGCA 3PO5A 1CZAN 4DF8A 3MCPA 4BREA 3LP0A 1J53A 1GOBA 2YV0X 2VGMA 1NNEA 3SMPA 1LWEA 3CD6N 3BDPA 3QETA 4PQUA 3ENBA 4W5OA 4E89A 4BACA 2D0PA 4EP4A 1ASVA 3S9HA 4CFBA 3K58A 4M41A 2XY6A 2UUBK 2P9UA 2FSKA 1KAYA 3KWGA 4KH6A 4WQ5C 3DXMA 4BQZA 4OJRA 3MEEA 2O8FB 1DEJA 3I0SA 1VAZA 4O5FA 3H3OB 4DV0K 4LC9B 2F96A 2NRRA 3WNFA 4N47A 4KHWA 3T1YK 4FLTA 1T05A 2Q0RA 3LP1A 1QE1A 1VSEA 4BG9A 4DR7K 2NUBA 1KXPA 3NVMA 1KSPA 1XWLA 1W0HA 4O8KA 4CEQA 1YXQA 1L3SA 5F1XA 4OPHA 2O8FA 4WF9L 2OPSA 1ZXOA 4X64K 3JXUA 3U3YA 4Q5VA 4EIAA 5FRMA 4RTFD 4DWIA 2Q3SA 4DQPA 4E0DA 5M1QA 4CHOA 3MAQA 3L2VA 1X3NA 2KKZA 1VQPN 5ADXA 4CF0A 4CIGA 3OHRA 3EZ5A 4Y1DA 4F2RA 3UKUA 3O8MA 4EFHA 1VRTA 2NLXA 4DB3A 1KRPA 3PUFA 3AA2A 3ATVA 4Z4HA 1XHXA 2OTJN 4IEIA 2HHXA 3Q7BA 4L8RB 3DLKA 3ASMA 3L8BA 4LF9K 1C0TA 1GLLO 3R1XA 2IAJA 2Z1GA 1NGBA 1TKZA 2OCEA 3DLBA 5T7BA 1YJWN 5J1EA 3OYLA 2W6KA 1DTTA 2GBZA 4WQ4C 1TAQA 3QBXA 1IBLK 5IWAK 4BRQA 5AJ3K 3ZSQA 3ID6A 4Y1CA 5CYMA 5EVZA 4B9SA 1S1VA 1JL2A 2NRVA 3KK3A 2P9SA 2A1SA 1A5WA 1C0GA 1U2VB 4BQLA 2VG6A 3CFOA 3HSTB 4NCGA 2YHYA 3DOKA 4BC5A 3NGIA 3U9ZA 1UA0A 3P83D 1NJXA 3IFRA 4E7IA 1U45A 1P8ZA 3FZKA 3LWMA 4FM2A 4CK3A 4KO0A 4CEOA 4CJPA 1S9EA 1WOQA 1BI4B 2HB5A 2V52B 5LY3A 4NLBA 3H3NO 2O4GA 1XNRK 1YVUA 4FJMA 2ITMA 3ENHA 1IKYA 3KK7A 5I9EB 5FPEA 1JKHA 4B9QA 1G15A 3V9ZA 2QWPA 2HBMA 1KVBA 4FJ9A 3K2PA 2A5XA 3OY9A 2KFNA 3CJ7A 1WSFA 3E1YA 3TAPA 4DTSA 4OGEA 3VTHA 4BR9A 4BRLA 3EYZA 4CEBA 3SQ1A 1X9SA 1T8EA 1QVFM 4DSIA 1BO5O 3TSUA 3SUOA 3FE1A 2OANA 1TUYA 3VPZA 2ZJQL 3IAYA 5EU7A 2HHQA 4E3SA 4ILHA 4YOUA 4ID1A 4K8ZA 1RDAA 1VSKA 4JKGA 4AHCA 1RGIA 4KKOA 4R79A 5AQMA 5BR8K 4IFYA 1X1PA 4NO7A 3RR8A 2W42A 4CZEA 1JLQA 4QOZB 3I56N 5FDLA 1BQMA 4YNQA 1WSEA 4KTQA 3H6EA 3L3VA 1D9FA 5JVHL 3SAFA 4FL9A 4JAXA 3WNGA 5FPDA 1RTDA 4CEZA 3VQEA 4HTLA 1B92A 3TANA 4CHNA 3S3OA 3OYJA 3VMFB 4YOYA 1LAWA 3FR0A 1NJIO 3AGKA 1IH7A 4CZLA 4HCBA 4UQGA 1ZBFA 3LP2A 4O5BA 3HL8A 4FW2A 2G8KA 2PYLA 2VWBA 1TVRA 2FBYA 3TPQA 1LW2A 4CW7B 3NAEA 2PZSA 4FM0A 2F9WA 1WAJA 2QWLA 3VQPA 4H0OA 1Z6RA 1TKXA 2O4IA 3O9QA 5HBMA 1GLFO 2P9KA 3KKRA 1WSIA 3AO1A 1U49A 1QSYA 1K8KB 1IKVA 1HNXK 4YHHK 1EXQA 3C65A 2QW9A 4E1NA 3OYDA 1X9WA 2ASMA 2H3GX 4DTUA 3OYHA 4ELUA 4DV1K 3D7EO 5JS1A 4JI4K 1ZBHA 3RSEB 5AZIB 1D9DA 3SQ2A 3PO4A 3HJFA 4UY8O 3A5MC 2FSNA 3FGUA 4AM6A 5JICA 3MXIA 4CIFA 4JKBA 3SUNA 4JV5K 1NMDA 4M45A 2XO7A 4ZTJA 3FZHA 5GADP 2QWRA 4I7FA 1UWBA 1Q9YA 3T1AA 4FJHA 2F4VK 1JLCA 5GIPA 5J2QA 1UA1A 1Q82O 4DFKA 4WFBL 1BCMA 2QXFA 4U7BA 1I3AA 3KVGA 4H5NA 3CPEA 3KHYA 3DI6A 3EY1A 3PX0A 1VHXA 4FM1A 2BTFA 4MO5A 2O8BB 1N8RO 3CQXA 5JVGL 4DU4A 3SPYA 2IVOA 3MN6A 4QS9A 4BRCA 2XHBA 1VSHA 2JWLA 1RT2A 1O13A 2A42A 2RE2A 4B3TK 4BG8A 4FWMA 2A1RA 1YF5L 1HPMA 4A59A 3ZSZA 2ZJPL 1NM1A 4FJIA 3GOIA 3PSFA 4DQQA 2ZWHA 1HJRA 3SJJA 4FJGA 1BQNA 4WE1A 3G10A 3J7AP 3SV3A 1U4BA 1FXXA 2Z1JA 4RCHA 3BZKA 3M8PA 5FPMA 4JI6K 1JLBA 2DPNA 4KTZA 2XY7A 1MDUB 4EP5A 4WFAL 3AVKA 5BPMA 4AHSA 2WFBA 3ENOA 4B9VA 2KTQA 4B1UB 3FZLA 5LMNK 1RBVA 3O5BA 3ZT2A 4IJAA 4CZHA 2A6AA 3ZSYA 5SWMA 2XRIA 3AY9A 2ZM6K 3SAGA 4DTJA 2VG7A 1HNWK 3CCRN 5M1OA 4IO9L 1VSJA 4CJSA 4J8FA 3IMXA 3CQ8A 4KHNA 3CFPA 2KFZA 1N33K 3ZSRA 1YJ9N 4IOAL 4DG1A 3GDQA 2Q0UA 1T3VA 4F3TA 4I6MB 4CBUA 1RDWX 3G0ZA 5KRTA 5JMVA 1V4TA 4C8NA 1U2VA 1YTAA 4GW6A 3QEIA 2D0OA 3EE9A 2F9TA 3VN5A 4CGDA 4DFMA 1L5UA 1S6QA 2E6MA 1WAFA 1VSIA 2P9LB 4B8CA 1QSSA 2YX6A 3WXLA 3PX6A 3I8DA 1N6QA 3O08A 5BRDA 1VQ6N 4CBWA 3TI0A 3O4NA 1NK9A 2W40A 2ASPA 4DV2K 1Q86O 4IEEA 4DV3K 1HYSA 4L3QA 5C24A 4ELVA 1D8YA 4CI6A 3CCMN 4FLWA 4CVNE 4EHUA 1S9GA 3RRGA 4FZZA 2Q31A 3M6GA 5AQFA 3VF4A 4FW1A 5KI6A 3HSCA 3IG1A 1VQMN 3BZCA 3HPGA 4PUOA 5K14A 2HF3A 1KQSM 5EOYA 3HRGA 5DM7L 2GEMA 3TR8A 4DLGA 1HJOA 5D3GA 2QWQA 1LWCA 5KPTA 3HM8A 3M5RA 4JLHA 1XNQK 2P9LA 4ZHRA 3OYKA 2A40A 5JLHA 3DXMB 5E84A 2AP1A 5BRFA 4FJKA 4PKGA 3O80A 3V6DA 4H5RA 4FOIA 3FZFA 4MLEA 1K73O 3OBWA 3IRXA 5KGWA 2HBLA 3FLCO 3K9KA 4O0IA 4JD2B 2DFFA 4DR5K 1TK0A 3LPUA 3W0LA 1EQYA 1YI2N 3TTFA 3WT0A 2NNWA 3LZJA 4GV6A 2Q36A 1TKDA 1L3TA 4KAZA 3K5OA 4AF1A 5IT9O 3SPZA 1S1TA 1TK5A 3LP3A 1ATRA 3SYZA 3VTIA 4LD0A 2DFEA 4FVMA 3LDPA 3CFRA 4DQSA 2OZSA 3KLHA 4E7LA 4YDUC 1RDUA 4B9LA 3VQ7A 4K43A 4PWDA 1XI1A 1RTHA 2V7YA 4X65K 3M3ZA 3QNNA 1WBBA 4X62K 1LAVA 2X6NA 5AQVA 1TUUA 3T7ZA 5EY4A 2CGKA 1IV0A 3WUHA 4B3SK 2AA4A 2D5RA 4CD1A 3NH1A 3G6EN 1RDCA 1TYQA 3LWLA 1NGFA 4IKFA 4CZGA 1FKOA 1IKXA 3CCVN 3PV8A 4CHZA 4DLEA 3EKUA 1D5AA 3WNEA 4BR0A 4FWRA 2WBNA 4KREA 3OYFA 1DT9A 3CC7N 2P5GA 2FBXA 1M90O 3C95A 2QA4N 4RW4A 2BDPA 3E9OA 2HVHA 4CEDA 1JXBA 1E4FT 3P39A 3NF7A 4BWMA 5JLFA 4E1JA 1RT1A 1XC9A 4Z4FA 3ZLJA 3V9SA 4DSJA 3B8AX 4OLBA 4CJUA 2E5LK 4LF6K 5AQPA 5GAEP 1TGOA 2D4WA 1NK0A 1WSJA 3HI0A 3VENA 4E19A 2YHBA 4IOXA 1CXQA 1KCFA 3H45C 2YCHA 3DRPA 1Q81O 1U6ZA 2E20A 4YY3K 4GKJK 3V4IA 1QS4A 4M63C 4O44A 1RTIA 3AO5A 3KZBA 1HNVA 4OPAA 3SZ2A 3TSQA 3CIPA 2E1ZA 1VK0A 1RBTA 2GUPA 3QBWA 4HUGA 5AQKA 3SUPA 4PL7A 1NOZA 2W41A 3KIOA 3HXMA 2CH6A 1RFQA 4ISEA 1BL3A 2ASOA 3CMEN 3MXMA 3S3MA 4N41A 5F0XA 3KLFA 3QIOA 3OS1A 3QEVA 4DR4K 3NMUA 1GLEG 2OA8A 3HO1A 3E01A 3MECA 4H5VA 1S1WA 4CHPA 4DQIA 3F9MA 4KPYA 4FWOA 4Q0BA 3FZMA 1Q18A 4E1MA 3WQUA 4FCYA 3CCSN 3OYGA 2I7NA 3VQCA 3AAQA 3ATUA 4F2SA 3CJAA 1BIZA 3C6AA 1YIJN 3RRHA 2BANA 2OPPA 2B6AA 1OH6A 4F9OA 3O9SA 2EWSA 1J5EK 1O1WA 1TK8A 3TABA 2VWJA 4JKFA 3CCJN 4J2BA 3NCIA 4H0TB 4Z4EA 4JI0K 2YNGA 4H0VB 4YDUA 1NJYA 2VWKA 1HNZK 1ILYA 1IKWA 4JS5A 4IFEA 3LALA 4DSFA 4A2BA 4A61A 1QQCA 3ZSVA 1RT5A 4A5BA 2AJQA 3NE6A 4XIUA 2XY5A 1SV5A 4JNEA 3J7YP 3L2RA 1HRHA 4BVPA 5BPLA 3THWB 2E88A 3AVCA 3GL1A 4NCBA 3V81A 1FJGK 2B4JA 5EX5A 2ZD1A 3U6FA 1LV5A 5KRSA 1X9JA 3C0BA 5H1SQ 3FFKB 3R6MA 1EKEA 2YJFA 3KLIA 4CK2A 4KHPK 5GINA 4WYBA 3ZEUA 3U4LA 4PKIA 2Z1HA 5AZJB 3RVCA 3D0PA 3CC4N 1XMOK 1NMNA 4I2QA 1E4GT 3TAQA 5FPNA 4FWNA 1G99A 4DSEA 3T1HK 3A8YA 3PIPL 3CPWM 4BRIA 2HHTA 5HRSA 4E7HA 1NK5A 3CJBA 1S1XA 2RF2A 3VQ9A 4BDZA 1Z26A 4IG3A 4ZTFA 3PSIA 4LF4K 1NK4A 3PIOL 1SZ2A 1GLCG 3OYMA 3I55N 2CGLA 3VEYA 4GKKK 2FBVA 1YVNA 3JS6A 4IWVA 4CZIA 2P51A 3C7NA 3AO2A 3AVLA 1VQ9N 5KTQA 2WTUA 4JRQA 3E9LA 3VQ6A 3K57A 2P5OA 2IDOA 3RTVA 4JKEA 4CJ7A 3M1FA 1RT7A 3BF1A 3O9RA 3CG7A 3VETA 1BA1A 3L4IA 4BRGA 4DFJA 2P9UB 4KI6A 3PX4A 4H5WA 2X78A 2GWKA 3LDOA 4B9NA 3QO9A 4DUZK 1BDGA 4FJJA 1HNIA 2G8HA 3NF9A 3VEXA 3QDKA 3WXKA 3M8QA 1BWFO 4CF9A 2G8FA 2HVIA 3NFAA 3DXKB 1VQ4N 1GLJO 4H0PA 3C6TA 4K25A 5M1PA 4WCEL 3MN7A 1JCGA 1K8KA 4DSLA 1NU0A 4FWSA 3TWHA 5AQWA 3D45A 3QNOA 4KBOA 4JHDB 1OVYA 3THYB 4EAHD 4CD3A 1S6PA 1K8AO 1P90A 4BE1A 3E9PA 4M3ZA 2ZGYA 2CH5A 4IDKA 4H0YB 3M8SA 2OTLN 2G8WA 3RWUA 2PBDA 3QICA 3CYMA 1HUXA 3VF6A 3NVKA 3ISNC 5FROA 1ESVA 4KHYA 3I0RA 4BDPA 3AA3A 5CZ2A 1NK6A 5AQIA 3HTVA 4MDAA 3IKMA 4KV8A 4R5PA 3MDQA 4M3XA 4CGIA 1V4SA 4DF4A 4CJRA 1C1AA 3KJVA 3ZSXA 4FJNA 3K59A 4I2PA 3WXMB 4WFNL 1VQ5N 4JD2A 1B9FA 4KB0A 1JLGA 3OW2M 1VSMA 1T03A 3NGYA 3P5JA 4X66K 3MXJA 1QQOA 1Y97A 4JI5K 4K42A 2F7TA 1OVQA 2BUPA 3D2EA 3MN5A 2G8IA 4BR5A 1RBRA 1D4XA 2FLOA 1DLOA 3EO3A 5E41A 2IVNA 5DK5A 2YI1A 4JRPA 3K5MA 3QESA 4CFDA 4DR2K 4N76A 3MX5A 3LANA 1QQNA 3ID8A 1OKJA 3SI6A 3HPOA 5J2NA 3CF5L 5AQZA 2YKMA 5AFUA 2NRWA 3OS0A 4AHTA 2X6SA 1TL3A 3AO4A 4RW7A 5CHIA 3SNNA 1LW0A 5C25A 3THVA 5AQLA 1DGKN 4DV4K 4NYNA 4FPBA 5AQNA 3OYEA 3CMAN 3WNHA 2E1YA 2QTDA 3DRRA 4XH5A 4HTUA 1W7AA 2RN2A 4B9MA 5M1FA 2HF4A 4CCHA 1SL0A 2UXBK 4JKDA 5KPRA 1UOCA 3ZSWA 3HT3A 4IDHA 4B3MK 3M8RA 5AZJA 2ITGA 3ALYA 3LDQA 3KLEA 5C15A 1BI4A 3T19A 4CJKA 5ELZA 1W2BM 3DLEA 3Q7CA 3L2UA 4BGAA 3V9XA 4W5TA 4DTNA 4H5TA 1VSFA 2ZGZA 3CJ9A 1JL1A 3MN9A 4A62A 3NBPA 1VQNN 2HBKA 4ID5A 4NYFA 1VQKN 3D6RA 1REVA 2HOEA 1QHTA 4C1NK 4CFAA 3T3FA 2UUCK 4JK8A 1HKGA 4CJ5A 2NRZA 1QZ6A 1NK7A 3AAPA 1B9DA 3N4PA 1FK9A 3TAGA 5AQOA 3VQ4A 4W5QA 4JI3K 2ATQA 4M3TA 4JYAK 2O8EB 4B1XB 1W9HA 4F3OA 1HPZA 3NF6A 2W6LA 3VA3A 1KFSA 3G71N 3ZT4A 1H1VA 5C10A 3KTQA 3LL3A 4CE9A 5FRNA 2QWOA 3VEVA 3BF3A 4OKJA 4BRFA 1NG9A 3MX2A 3MWTA 2LSNA 4W5NA 3GG4A 3F9KA 5M1NA 4YOVA 1LCUA 4CF1A 4IBNA 4XH4A 4ILGB 5JS2A 5AFUH 5HRRA 2E2OA 1GOCA 3GBTA 5AZIA 4AILC 2HNYA 4FWPA 4FXDA 3AGRA 4YOXA 5KQ8A 5LJWA 2HMPA 2KLAA 3QIPA 5BN8A 4FVUA 2KQ2A 4G1QA 1RDBA 2QM1A 2FF3B 5CE3A 5C2FA 3WQTA 3C7NB 3OS2A 4Y0WA 3L2QA 1JJ2M 4AQYK 2NZTA 1J6ZA 1E3MA 3LAKA 2E6LA 4DTRA 3OYIA 4FWQA 4NCAA 4GV3A 3BY5A 1KC8O 2OPQA 3CERA 3H1QA 4CBXA 4CGHA 4C8OA 3SBGA 3O1WA 3TAMA 1Z05A 1HQUA 4CJ3A 5AR0A 4E7JA 3AVAA 4BY9C 3DM2A 4MDBA 1X9MA 3SUQA 2E2PA 2DY4A 3DXKA 3HK2A 1YITN 3F5TA 4CEAA 4M42A 1HMVA 3O9UA 4CZKA 3EN9A 3TTCA 4LFAK 3AVFA 3F2KA 3O6WA 2I7PA 4RW9A 4M7XA 4XEIA 3JSMA 4FWKA 3H46O 3DLHA 2JGUA 2P9PA 4DTXA 2PAVA 2ZF5O 4DMNA 1BGXT 1NK8A 2Q2RA 3PLAA 4RG8A 4BRKA 1OH8A 1NGJA 1SKSA 4YORA 4K41A 3JAMO 3SV4A 4M7YA 1U04A 1XMQK 4LFCK 2R7YA 2B5JA 5E26A 4YOTA 4GY2B 4BC4A 3VQDA 3NGZA 4GMJB 3AV9A 1NJWA 4JKAA 4YOWA 3KLGA 1TKTA 3IUCA 3L4QA 4JKGB 4C1NI 2O8CB 1NKEA 4JK9A 1TYQB 3O4WA 3CETA 3EL2A 4CF2A 4BRDA 3TTDA 5HOOA 3LM9A 2CGJA 1KLNA 2A3ZA 5BR9A 3BGRA 1WBDA 1T6DA 3NDKA 5C42A 3L6QA 3UB5A 3ULEA 3CM6A 1HYVA 3QINA 2HHSA 4AM7A 1NGGA 3UKUB 5A2QO 4BVOA 1ITGA 5CZ1A 2E4LA 4GVEA 3OVNA 3VGMA 1CZ9A 4B1WB 3U8XA 5I3UA 2G8UA 3THWA 5CR4A 4NXNK 1DKGD 4O8UA 3SQ0A 3HM9A 3P31A 3CM5A 4CK1A 3J80O 3THXB 4Z94A 4LY7A 3KK2A 1BOTO 4IXCA 4BR2A 1KVAA 2YKNA 4F8RA 4JKHA 4B3OA 2NRHA 5KQDA 1IG8A 1JLFA 1SAZA 4CZMA 1K6YA 1ZYQA 3ZETB 1VSLA 2YNHA 1NGHA 3OA9A 4BRPA 4BRAA 5LL6Z 5AQGA 3DLGA 3TSPA 4OPJA 3VEOA 1QTMA 1KFDA 3LPTA 4ILJA 4H8KA 1Y64A 5C0YA 4DV5K 4IOCL 1N34K 1XC3A 3K9JA 3ZX2A 1IBKK 1TL1A 3DRSA 3IS9A 2Y1IA 2BGGA 4WQ4A 2YJEA 4CGJA 2HHHK 1XQSC 3WEEB 3CQYA 4RW6A 4A57A 5HROA 4CGFA 3A5OC 4KH5A 3O3FA 4DTPA 4QCLA 4FOEA 1RT6A 4M3WA 3K0SA 2P9IA 2QWNA 4YFUA 4DR6K 4HUEA 3SMSA 3J81O 5GAGP 4H03B 5LJVA 3UKRA 4LF8K 4M3YA 4DHYA 1IJJA 1I94K 1FKPA 1IO2A 2FSJA 4Z4CA 4QS7A 1U48A 1S72N 2F8TA 4FK2A 4KHSA 1BA0A 3DMJA 3R3LA 3RMCA 4K8XA 4CJVA 1MWMA 4DS5A 1S5JA 3A5NC 2QI2A 3O3GA 1MU2A 3EZWA 1ZC6A 1JCEA 1CLQA 3VERA 4DR3K 3VEZA 1GOAA 1QZ5A 5BPNA 1DTQA 4O55A 3AVIA 4NB4A 2X74A 3B6OA 1NGIA 2GWJA 5J2MA 4KB1A 1C1CA 1HKBA 1ZBUA 3DLRA 4IJNA 3ULDA 3B6PA 5CYQA 4EZ6A 4AHVA 1C1BA 2P9PB 3U9DA 5LMUK 2O8DB 2P1JA 1XHZA 2IS3A 2WC9A 1TV6A 3NH0A
chains in the Genus database with same CATH topology
4IDKA 1IG9A 1J9AA 4M3RA 3M8SA 4LSLA 4CJLA 2F8SA 4H4OA 2G8WA 3ZT2A 1NOYA 3VQ8A 4N5SA 3RWUA 3ZSYA 4QAGA 5SWMA 2XRIA 3AVGA 4AHUA 2FBTA 3CYMA 3H08A 4FK0A 3V1OA 4DTJA 4KHWA 2VG7A 3ISNC 4FLUA 5FROA 4OVLA 4DFPA 4KHYA 3I0RA 4PY5A 1VSJA 5HLFA 4CJSA 2HHVA 4BDPA 3AA3A 1SUQA 5CZ2A 3CQ8A 1NK6A 4KHNA 1RT3A 3CFPA 2KFZA 3OYCA 4KV8A 2YHAA 4LH5A 3ZSRA 4CJ4A 4CJFA 3HYFA 4DG1A 4R5PA 3LZIA 2GV9A 4AH9A 4CGIA 4M3XA 2Z1IA 4C8KA 4F3TA 4DF4A 4CJRA 3G0ZA 1C1AA 1YT3A 5KRTA 1BCOA 3KJVA 3ZSXA 2JLEA 4C8NA 3RMAA 4FJNA 3K59A 4I2PA 1YTAA 4GW6A 4DQRA 2ZQBA 3QEIA 1RT4A 3F73A 2WONA 1UAXA 1B9FA 3VN5A 4KB0A 1JLGA 4CGDA 4DFMA 2I5JA 4DU1A 1VSMA 1T03A 1L5UA 4I9QA 3NGYA 3TARA 3P5JA 2HHUA 1S6QA 2E6MA 1VSIA 1WAFA 1Y97A 3MXJA 1VRUA 1HQEA 4GVMA 4B8CA 4CEEA 4E7KA 1QSSA 3PX6A 1HYZA 1JLAA 2G8IA 3I8DA 1CZBA 1RBRA 1N6QA 4FJLA 3QEXA 2D0BA 1DLOA 1S1UA 5DK5A 5E41A 2RPIA 4TSXA 4JRPA 3K5MA 3QESA 4CFDA 3DOLA 4FLZA 4N76A 4Z4GA 3TI0A 3P1GA 4F4KA 3LANA 1LWFA 3O4NA 1NK9A 1R0AA 3SI6A 3V1QA 3HPOA 5J2NA 1NKCA 1T7PA 4KRFA 2ZE2A 2D0CA 2WOMA 4B8AB 4IFVA 4HUFA 4FZXC 2YKMA 4BDYA 1HYSA 3OS0A 4DS4A 4AHTA 2X6SA 1WN7A 5C24A 1TL3A 3AO4A 4RW7A 4N56A 3SNNA 3HP6A 1LW0A 5C25A 3THVA 1D8YA 4ELVA 3V1RA 4FLWA 4ELTA 1S9GA 3HP9A 4FLXA 4NYNA 3RRGA 4FZZA 5HP1A 3TAEA 3OYEA 2DTUA 1BIUA 4BWJA 4DTOA 3SCXA 3WNHA 3DRRA 4FW1A 1L3UA 2OZSA 4HTUA 5KI6A 3IG1A 1A5XA 2RN2A 3HPGA 4PA1A 3AVNA 4B9MA 1J54A 4PUOA 1EX4A 5K14A 4CCHA 1WLJA 1SL0A 3LDSA 3AVHA 1UOCA 3ZSWA 3HT3A 3PO5A 3M8RA 3TR8A 2ITGA 3ALYA 3LAMA 4DLGA 3QLHA 1LWCA 4DF8A 5D3GA 3KLEA 1C0MA 4O0JA 3NH2A 3NHGA 3ZSOA 1BI4A 3T19A 4JLHA 3LP0A 1J53A 1GOBA 2YV0X 4ZHRA 4CJKA 3OYKA 3VQAA 4FYDA 1LWEA 3DLEA 3L2UA 1ZBLA 3V9XA 4W5TA 3BDPA 3QETA 4DTNA 4FJKA 4M3UA 4PQUA 1VSFA 1ASUA 4W5OA 4E89A 4Z4IA 1JL1A 3V6DA 4BACA 3NBPA 4EP4A 1ASVA 1WSHA 3S9HA 4ID5A 3IRXA 4NYFA 5KGWA 4MQ3A 1REVA 4CFCA 4CFBA 3K58A 1ZBIA 1RBUA 4M41A 4O0IA 4MFBA 2XY6A 2DFFA 1TK0A 1QSLA 4J2AA 3LPUA 3L3UA 3MEGA 1QHTA 4CFAA 3T3FA 4W5RA 3LZJA 3V9WA 3HVRA 4CJ5A 2BE2A 1TKDA 1TAUA 5J2PA 1L3TA 4DSKA 5I42A 1NK7A 4OJRA 3KD1E 4KAZA 3MEEA 1B9DA 3I0SA 3K5OA 1FK9A 4OPKA 3TAGA 3VQ4A 4W5QA 4M3TA 2ATQA 1S1TA 3SPZA 3LP3A 1TK5A 1CXUA 2F96A 4OKEA 4N47A 3WNFA 1W9HA 4LD0A 2DFEA 1HPZA 3NF6A 4FVMA 4AHRA 3CFRA 3KLHA 4FLTA 4E7LA 3LP1A 3VA3A 1T05A 1QE1A 3FFIA 1VSEA 1WSGA 1KFSA 4B9LA 1A5VA 3ZT4A 1SL1A 4BE0A 2NUBA 1KSPA 3VQ7A 1XWLA 3AVBA 4B08A 3KTQA 1W0HA 4CE9A 1XI1A 4CEQA 5FRNA 4PWDA 1RTHA 2YNFA 3QNNA 1L3SA 4E7JA 5CY4A 1LAVA 2X6NA 4OKJA 4CJEA 2IC3A 2OPSA 2VG5A 4OGCA 3OJSA 4C8MA 4CERA 2ETJA 3U3YA 4Q5VA 4FK4A 2LSNA 5FRMA 4FJ7A 4DWIA 4W5NA 2Q3SA 3F9KA 4DQPA 4E0DA 2D5RA 4CHOA 4CF1A 3NH1A 4FJ8A 3MAQA 4HCCA 3L2VA 4IBNA 1Z25A 1RDCA 4CF0A 4CIGA 5JS2A 3LWLA 3EZ5A 4Y1DA 3TAFA 5HRRA 4F2RA 4IKFA 1FKOA 1IKXA 3ZT0A 1GOCA 1VRTA 4CHZA 4AILC 3PV8A 4DLEA 1KRPA 3KD5E 3PUFA 3AA2A 4Z4HA 1D5AA 1XHXA 3WNEA 2HNYA 2XY8A 2G8VA 4FXDA 2HHXA 4L8RB 4KREA 4CECA 3OYFA 3DLKA 3ASMA 3L8BA 1C0TA 2P5GA 2FBXA 3QIPA 2IAJA 2Z1GA 2KQ2A 3C95A 3OYBA 1TKZA 4G1QA 4RW4A 1J5OA 2BDPA 1RDBA 3AO3A 2HVHA 2KW4A 4CEDA 1JXBA 3DLBA 3NF7A 4BWMA 5T7BA 3OS2A 4HHTA 4FZYA 3VQ5A 5J1EA 3OYLA 3L2QA 1DTTA 1RT1A 2GBZA 1TAQA 1XC9A 4DQSA 4Z4FA 4KI4A 3LAKA 3V9SA 4DSJA 4OLBA 2E6LA 3ZSQA 3KKSA 3ZT3A 4CJUA 4Y1CA 5CYMA 3OYIA 3L2WA 4DTRA 3RMDA 4NCAA 1BHLA 1TGOA 4B9SA 1S1VA 2OPQA 3K5NA 1JL2A 4CGHA 4C8OA 1NK0A 1WSJA 3KK3A 3TAMA 4KHQA 3O4QA 1HQUA 4CJ3A 1A5WA 3C6UA 2A1SA 2VG6A 3CFOA 3AVAA 1RCHA 3HSTB 3DM2A 2YHBA 4NCGA 3VQBA 4E19A 3O3HA 3DOKA 1X9MA 1CXQA 1KCFA 3NGIA 3SUQA 1UA0A 2DY4A 2HNZA 1JXEA 3HK2A 4CEAA 3DRPA 2KZZA 1RNHA 3P83D 4M42A 1NJXA 4E7IA 1BISA 1HMVA 1U45A 3LWMA 4FM2A 1YTUA 4CK3A 4KO0A 4CEOA 3V4IA 1F21A 4CJPA 1S9EA 3AVFA 1QS4A 4O44A 4RW9A 5HRPA 3S3NA 1BI4B 2HB5A 1WNSA 3JSMA 3PY8A 2O4GA 1RTIA 1YVUA 3AO5A 3ZT1A 1SKWA 4FJMA 1IKYA 1HNVA 3DLHA 1JKHA 2JGUA 3SZ2A 1G15A 3V9ZA 4DTXA 1VK0A 1RBTA 1KVBA 4FJ9A 3K2PA 4DMNA 4HUGA 1BGXT 3OY9A 2KFNA 1NK8A 3A2FA 4CEFA 3SUPA 1WSFA 4CIEA 4RG8A 1NOZA 4FLVA 3KIOA 3OJUA 4H4MA 4RW8A 3TAPA 4DTSA 3HXMA 4OGEA 3RR7A 4OLAA 4DTMA 1BL3A 3MXMA 3S3MA 1SKSA 4N41A 3EYZA 3KLFA 4CEBA 3SQ1A 3QIOA 4CESA 3SV4A 1X9SA 1T8EA 1RILA 3OS1A 3QEVA 4DSIA 1U04A 4FLYA 2OA8A 3SUOA 3HO1A 3E01A 2R7YA 2KZMA 2B5JA 3MECA 2IOCA 2YNIA 3U3GA 2PYJA 1S1WA 2HNDA 4CHPA 4C8LA 3IAYA 5EU7A 2HHQA 4DQIA 4E3SA 4KPYA 3VQDA 3OYAA 4ID1A 3NGZA 3V9UA 4GMJB 4Q0BA 3AV9A 4K8ZA 1I39A 4E1MA 1NJWA 1RDAA 1VSKA 4AHCA 4KKOA 4FCYA 3QEPA 3AA4A 3OYGA 4IFYA 3KLGA 1TKTA 1X1PA 3VQCA 3RR8A 4CJTA 2W42A 2OZMA 4CJWA 1JLQA 4QOZB 4F2SA 3QERA 1BIZA 1NKEA 4CHYA 3RRHA 3K5LA 2BANA 2OPPA 2DFHA 2B6AA 4CF2A 1VSDA 1O1WA 5FDLA 1BQMA 1TK8A 4EZ9A 3TABA 4KFBA 1KLMA 2VWJA 4YNQA 1WSEA 4J2BA 3NCIA 4Z4EA 1KLNA 4KTQA 3L3VA 3BGRA 5SZTA 1D9FA 2YNGA 3NDKA 5C42A 3CM6A 4J2EA 1HYVA 3QINA 2HHSA 1NJYA 2VWKA 4LSNA 3ITHA 1IKWA 2FC0A 3WNGA 4JS5A 3LALA 1RTDA 1ITGA 5CZ1A 1C6VA 2E4LA 4CEZA 4DSFA 4IG0A 3OVNA 1CZ9A 3VQEA 5I3UA 2G8UA 2OYQA 1B92A 1QQCA 1NKBA 4B9TA 1RBSA 3ZSVA 3VQQA 1RT5A 2AJQA 2QKBA 3TANA 1RDDA 4CHNA 4CHQA 3S3OA 3SQ0A 3HM9A 3NE6A 4XIUA 3OYJA 1SV5A 3DYAA 5HRNA 3CM5A 3L2RA 3AA5X 4CK1A 2XY5A 1HRHA 1LAWA 3SQ4A 2QK9A 4F3OA 1IH7A 3AVCA 4LY7A 3KK2A 4UQGA 3V81A 1Q9XA 4HCBA 1ZBFA 2B4JA 4NCBA 2ZD1A 3LP2A 3HL8A 4O5BA 2EHGA 4CF8A 5KRSA 3U6FA 1LV5A 4FW2A 3OYNA 1KVAA 2YKNA 2Y1JA 2G8KA 4F8RA 4ICLA 4B3OA 1EKEA 3KLIA 2PYLA 4CK2A 4DU3A 1TVRA 2FBYA 1LW2A 1JLFA 4JS4A 3NAEA 2PZSA 3JYTA 3NH0A 4FM0A 1WAJA 1ZYQA 2Z1HA 1K6YA 3VQPA 3KK1A 3D0PA 4J2DA 4B9UA 1TKXA 1VSLA 2YNHA 5HBMA 2O4IA 3KKRA 1WSIA 3AO1A 1U49A 1QSYA 4I2QA 1IKVA 3AVMA 4CGGA 1EXQA 3TAQA 3DLGA 4OPJA 2GUIA 4OKKA 4E1NA 1Q8IA 4LH4A 2HHWA 3OYDA 4DSEA 1X9WA 2HW3A 1QTMA 2HHTA 1KFDA 3OYHA 2RKIA 4DTUA 4ELUA 2PY5A 5HRSA 3LPTA 4E7HA 1NK5A 4H8KA 5JS1A 1SL2A 1S1XA 2RF2A 3VQ9A 1ZBHA 4BDZA 1Z26A 4IG3A 4ZTFA 1D9DA 3SQ2A 3PO4A 3HJFA 4I9LA 1TL1A 2EX3A 3DRSA 3SYZA 3IS9A 2Y1IA 2BGGA 4Z0UA 3MXIA 2QKKA 1NK4A 4CIFA 4CGJA 3SUNA 1JLEA 3OYMA 1EP4A 4M45A 2XO7A 4ZTJA 4FJ5A 2FBVA 4RW6A 3HVTA 5HROA 4CGFA 4I7FA 3O3FA 3QEWA 4O4GA 1EETA 2P51A 1UWBA 4DTPA 4QCLA 3AO2A 3AVLA 1RT6A 5KTQA 1KTQA 4JRQA 3VQ6A 3T1AA 3K57A 2IDOA 1Q9YA 2P5OA 4YFUA 4FJHA 4M3WA 4HUEA 1JLCA 4CJQA 5J2QA 3RMBA 1UA1A 4HVJA 3UIQA 4FJXA 4DFKA 2OPRA 3RTVA 4M3YA 1BCMA 1RT7A 2QXFA 1I3AA 2D0AA 3CG7A 5KGXA 2IGIA 1FKPA 1IO2A 1C0UA 3DI6A 4Z4CA 3EY1A 1L3VA 3PX0A 1U47A 1U48A 4DFJA 1NJZA 4KI6A 4FM1A 3PX4A 3ZCMA 2F8TA 4FK2A 4KHSA 3DMJA 2X78A 3RMCA 4DU4A 3SPYA 4CJVA 4K8XA 4DS5A 4B9NA 3QO9A 1S5JA 3O3GA 1MU2A 2XHBA 4KHUA 1VSHA 3VA0A 1RT2A 1HNIA 2G8HA 3NF9A 4FJJA 1CLQA 2A1RA 3M8QA 4CF9A 3AVJA 2G8FA 3ZSZA 2HVIA 1GOAA 1RTJA 4FJIA 1SKRA 3NFAA 1DTQA 4O55A 3AVIA 4DQQA 1HJRA 3SJJA 4FJGA 1BQNA 4WE1A 3G10A 2X74A 3B6OA 3C6TA 1ASWA 1FXXA 3SV3A 1U4BA 2Z1JA 3M8PA 5J2MA 4KB1A 1C1CA 1JLBA 1KVCA 5DMRA 4DSLA 4KTZA 3TWHA 1ZBUA 3MEDA 3D45A 3QNOA 1N5YA 2XY7A 3NF8A 3DLRA 3HPHA 4EP5A 3ULDA 3B6PA 5CYQA 4BE2A 2HMIA 4EZ6A 3AVKA 1S6PA 4AHVA 1C1BA 4AHSA 4BE1A 4KTWA 4B9VA 4M3ZA 2KTQA 3C94A 2P1JA 1XHZA 2IS3A 1TV6A 1RBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDK A;  1IG9 A;  1J9A A;  4M3R A;  3M8S A;  4LSL A;  4CJL A;  2F8S A;  4H4O A;  2G8W A;  3ZT2 A;  1NOY A;  3VQ8 A;  4N5S A;  3RWU A;  3ZSY A;  4QAG A;  5SWM A;  2XRI A;  3AVG A;  4AHU A;  2FBT A;  3CYM A;  3H08 A;  4FK0 A;  3V1O A;  4DTJ A;  4KHW A;  2VG7 A;  3ISN C;  4FLU A;  5FRO A;  4OVL A;  4DFP A;  4KHY A;  3I0R A;  4PY5 A;  1VSJ A;  5HLF A;  4CJS A;  2HHV A;  4BDP A;  3AA3 A;  1SUQ A;  5CZ2 A;  3CQ8 A;  1NK6 A;  4KHN A;  1RT3 A;  3CFP A;  2KFZ A;  3OYC A;  4KV8 A;  2YHA A;  4LH5 A;  3ZSR A;  4CJ4 A;  4CJF A;  3HYF A;  4DG1 A;  4R5P A;  3LZI A;  2GV9 A;  4AH9 A;  4CGI A;  4M3X A;  2Z1I A;  4C8K A;  4F3T A;  4DF4 A;  4CJR A;  3G0Z A;  1C1A A;  1YT3 A;  5KRT A;  1BCO A;  3KJV A;  3ZSX A;  2JLE A;  4C8N A;  3RMA A;  4FJN A;  3K59 A;  4I2P A;  1YTA A;  4GW6 A;  4DQR A;  2ZQB A;  3QEI A;  1RT4 A;  3F73 A;  2WON A;  1UAX A;  1B9F A;  3VN5 A;  4KB0 A;  1JLG A;  4CGD A;  4DFM A;  2I5J A;  4DU1 A;  1VSM A;  1T03 A;  1L5U A;  4I9Q A;  3NGY A;  3TAR A;  3P5J A;  2HHU A;  1S6Q A;  2E6M A;  1VSI A;  1WAF A;  1Y97 A;  3MXJ A;  1VRU A;  1HQE A;  4GVM A;  4B8C A;  4CEE A;  4E7K A;  1QSS A;  3PX6 A;  1HYZ A;  1JLA A;  2G8I A;  3I8D A;  1CZB A;  1RBR A;  1N6Q A;  4FJL A;  3QEX A;  2D0B A;  1DLO A;  1S1U A;  5DK5 A;  5E41 A;  2RPI A;  4TSX A;  4JRP A;  3K5M A;  3QES A;  4CFD A;  3DOL A;  4FLZ A;  4N76 A;  4Z4G A;  3TI0 A;  3P1G A;  4F4K A;  3LAN A;  1LWF A;  3O4N A;  1NK9 A;  1R0A A;  3SI6 A;  3V1Q A;  3HPO A;  5J2N A;  1NKC A;  1T7P A;  4KRF A;  2ZE2 A;  2D0C A;  2WOM A;  4B8A B;  4IFV A;  4HUF A;  4FZX C;  2YKM A;  4BDY A;  1HYS A;  3OS0 A;  4DS4 A;  4AHT A;  2X6S A;  1WN7 A;  5C24 A;  1TL3 A;  3AO4 A;  4RW7 A;  4N56 A;  3SNN A;  3HP6 A;  1LW0 A;  5C25 A;  3THV A;  1D8Y A;  4ELV A;  3V1R A;  4FLW A;  4ELT A;  1S9G A;  3HP9 A;  4FLX A;  4NYN A;  3RRG A;  4FZZ A;  5HP1 A;  3TAE A;  3OYE A;  2DTU A;  1BIU A;  4BWJ A;  4DTO A;  3SCX A;  3WNH A;  3DRR A;  4FW1 A;  1L3U A;  2OZS A;  4HTU A;  5KI6 A;  3IG1 A;  1A5X A;  2RN2 A;  3HPG A;  4PA1 A;  3AVN A;  4B9M A;  1J54 A;  4PUO A;  1EX4 A;  5K14 A;  4CCH A;  1WLJ A;  1SL0 A;  3LDS A;  3AVH A;  1UOC A;  3ZSW A;  3HT3 A;  3PO5 A;  3M8R A;  3TR8 A;  2ITG A;  3ALY A;  3LAM A;  4DLG A;  3QLH A;  1LWC A;  4DF8 A;  5D3G A;  3KLE A;  1C0M A;  4O0J A;  3NH2 A;  3NHG A;  3ZSO A;  1BI4 A;  3T19 A;  4JLH A;  3LP0 A;  1J53 A;  1GOB A;  2YV0 X;  4ZHR A;  4CJK A;  3OYK A;  3VQA A;  4FYD A;  1LWE A;  3DLE A;  3L2U A;  1ZBL A;  3V9X A;  4W5T A;  3BDP A;  3QET A;  4DTN A;  4FJK A;  4M3U A;  4PQU A;  1VSF A;  1ASU A;  4W5O A;  4E89 A;  4Z4I A;  1JL1 A;  3V6D A;  4BAC A;  3NBP A;  4EP4 A;  1ASV A;  1WSH A;  3S9H A;  4ID5 A;  3IRX A;  4NYF A;  5KGW A;  4MQ3 A;  1REV A;  4CFC A;  4CFB A;  3K58 A;  1ZBI A;  1RBU A;  4M41 A;  4O0I A;  4MFB A;  2XY6 A;  2DFF A;  1TK0 A;  1QSL A;  4J2A A;  3LPU A;  3L3U A;  3MEG A;  1QHT A;  4CFA A;  3T3F A;  4W5R A;  3LZJ A;  3V9W A;  3HVR A;  4CJ5 A;  2BE2 A;  1TKD A;  1TAU A;  5J2P A;  1L3T A;  4DSK A;  5I42 A;  1NK7 A;  4OJR A;  3KD1 E;  4KAZ A;  3MEE A;  1B9D A;  3I0S A;  3K5O A;  1FK9 A;  4OPK A;  3TAG A;  3VQ4 A;  4W5Q A;  4M3T A;  2ATQ A;  1S1T A;  3SPZ A;  3LP3 A;  1TK5 A;  1CXU A;  2F96 A;  4OKE A;  4N47 A;  3WNF A;  1W9H A;  4LD0 A;  2DFE A;  1HPZ A;  3NF6 A;  4FVM A;  4AHR A;  3CFR A;  3KLH A;  4FLT A;  4E7L A;  3LP1 A;  3VA3 A;  1T05 A;  1QE1 A;  3FFI A;  1VSE A;  1WSG A;  1KFS A;  4B9L A;  1A5V A;  3ZT4 A;  1SL1 A;  4BE0 A;  2NUB A;  1KSP A;  3VQ7 A;  1XWL A;  3AVB A;  4B08 A;  3KTQ A;  1W0H A;  4CE9 A;  1XI1 A;  4CEQ A;  5FRN A;  4PWD A;  1RTH A;  2YNF A;  3QNN A;  1L3S A;  4E7J A;  5CY4 A;  1LAV A;  2X6N A;  4OKJ A;  4CJE A;  2IC3 A;  2OPS A;  2VG5 A;  4OGC A;  3OJS A;  4C8M A;  4CER A;  2ETJ A;  3U3Y A;  4Q5V A;  4FK4 A;  2LSN A;  5FRM A;  4FJ7 A;  4DWI A;  4W5N A;  2Q3S A;  3F9K A;  4DQP A;  4E0D A;  2D5R A;  4CHO A;  4CF1 A;  3NH1 A;  4FJ8 A;  3MAQ A;  4HCC A;  3L2V A;  4IBN A;  1Z25 A;  1RDC A;  4CF0 A;  4CIG A;  5JS2 A;  3LWL A;  3EZ5 A;  4Y1D A;  3TAF A;  5HRR A;  4F2R A;  4IKF A;  1FKO A;  1IKX A;  3ZT0 A;  1GOC A;  1VRT A;  4CHZ A;  4AIL C;  3PV8 A;  4DLE A;  1KRP A;  3KD5 E;  3PUF A;  3AA2 A;  4Z4H A;  1D5A A;  1XHX A;  3WNE A;  2HNY A;  2XY8 A;  2G8V A;  4FXD A;  2HHX A;  4L8R B;  4KRE A;  4CEC A;  3OYF A;  3DLK A;  3ASM A;  3L8B A;  1C0T A;  2P5G A;  2FBX A;  3QIP A;  2IAJ A;  2Z1G A;  2KQ2 A;  3C95 A;  3OYB A;  1TKZ A;  4G1Q A;  4RW4 A;  1J5O A;  2BDP A;  1RDB A;  3AO3 A;  2HVH A;  2KW4 A;  4CED A;  1JXB A;  3DLB A;  3NF7 A;  4BWM A;  5T7B A;  3OS2 A;  4HHT A;  4FZY A;  3VQ5 A;  5J1E A;  3OYL A;  3L2Q A;  1DTT A;  1RT1 A;  2GBZ A;  1TAQ A;  1XC9 A;  4DQS A;  4Z4F A;  4KI4 A;  3LAK A;  3V9S A;  4DSJ A;  4OLB A;  2E6L A;  3ZSQ A;  3KKS A;  3ZT3 A;  4CJU A;  4Y1C A;  5CYM A;  3OYI A;  3L2W A;  4DTR A;  3RMD A;  4NCA A;  1BHL A;  1TGO A;  4B9S A;  1S1V A;  2OPQ A;  3K5N A;  1JL2 A;  4CGH A;  4C8O A;  1NK0 A;  1WSJ A;  3KK3 A;  3TAM A;  4KHQ A;  3O4Q A;  1HQU A;  4CJ3 A;  1A5W A;  3C6U A;  2A1S A;  2VG6 A;  3CFO A;  3AVA A;  1RCH A;  3HST B;  3DM2 A;  2YHB A;  4NCG A;  3VQB A;  4E19 A;  3O3H A;  3DOK A;  1X9M A;  1CXQ A;  1KCF A;  3NGI A;  3SUQ A;  1UA0 A;  2DY4 A;  2HNZ A;  1JXE A;  3HK2 A;  4CEA A;  3DRP A;  2KZZ A;  1RNH A;  3P83 D;  4M42 A;  1NJX A;  4E7I A;  1BIS A;  1HMV A;  1U45 A;  3LWM A;  4FM2 A;  1YTU A;  4CK3 A;  4KO0 A;  4CEO A;  3V4I A;  1F21 A;  4CJP A;  1S9E A;  3AVF A;  1QS4 A;  4O44 A;  4RW9 A;  5HRP A;  3S3N A;  1BI4 B;  2HB5 A;  1WNS A;  3JSM A;  3PY8 A;  2O4G A;  1RTI A;  1YVU A;  3AO5 A;  3ZT1 A;  1SKW A;  4FJM A;  1IKY A;  1HNV A;  3DLH A;  1JKH A;  2JGU A;  3SZ2 A;  1G15 A;  3V9Z A;  4DTX A;  1VK0 A;  1RBT A;  1KVB A;  4FJ9 A;  3K2P A;  4DMN A;  4HUG A;  1BGX T;  3OY9 A;  2KFN A;  1NK8 A;  3A2F A;  4CEF A;  3SUP A;  1WSF A;  4CIE A;  4RG8 A;  1NOZ A;  4FLV A;  3KIO A;  3OJU A;  4H4M A;  4RW8 A;  3TAP A;  4DTS A;  3HXM A;  4OGE A;  3RR7 A;  4OLA A;  4DTM A;  1BL3 A;  3MXM A;  3S3M A;  1SKS A;  4N41 A;  3EYZ A;  3KLF A;  4CEB A;  3SQ1 A;  3QIO A;  4CES A;  3SV4 A;  1X9S A;  1T8E A;  1RIL A;  3OS1 A;  3QEV A;  4DSI A;  1U04 A;  4FLY A;  2OA8 A;  3SUO A;  3HO1 A;  3E01 A;  2R7Y A;  2KZM A;  2B5J A;  3MEC A;  2IOC A;  2YNI A;  3U3G A;  2PYJ A;  1S1W A;  2HND A;  4CHP A;  4C8L A;  3IAY A;  5EU7 A;  2HHQ A;  4DQI A;  4E3S A;  4KPY A;  3VQD A;  3OYA A;  4ID1 A;  3NGZ A;  3V9U A;  4GMJ B;  4Q0B A;  3AV9 A;  4K8Z A;  1I39 A;  4E1M A;  1NJW A;  1RDA A;  1VSK A;  4AHC A;  4KKO A;  4FCY A;  3QEP A;  3AA4 A;  3OYG A;  4IFY A;  3KLG A;  1TKT A;  1X1P A;  3VQC A;  3RR8 A;  4CJT A;  2W42 A;  2OZM A;  4CJW A;  1JLQ A;  4QOZ B;  4F2S A;  3QER A;  1BIZ A;  1NKE A;  4CHY A;  3RRH A;  3K5L A;  2BAN A;  2OPP A;  2DFH A;  2B6A A;  4CF2 A;  1VSD A;  1O1W A;  5FDL A;  1BQM A;  1TK8 A;  4EZ9 A;  3TAB A;  4KFB A;  1KLM A;  2VWJ A;  4YNQ A;  1WSE A;  4J2B A;  3NCI A;  4Z4E A;  1KLN A;  4KTQ A;  3L3V A;  3BGR A;  5SZT A;  1D9F A;  2YNG A;  3NDK A;  5C42 A;  3CM6 A;  4J2E A;  1HYV A;  3QIN A;  2HHS A;  1NJY A;  2VWK A;  4LSN A;  3ITH A;  1IKW A;  2FC0 A;  3WNG A;  4JS5 A;  3LAL A;  1RTD A;  1ITG A;  5CZ1 A;  1C6V A;  2E4L A;  4CEZ A;  4DSF A;  4IG0 A;  3OVN A;  1CZ9 A;  3VQE A;  5I3U A;  2G8U A;  2OYQ A;  1B92 A;  1QQC A;  1NKB A;  4B9T A;  1RBS A;  3ZSV A;  3VQQ A;  1RT5 A;  2AJQ A;  2QKB A;  3TAN A;  1RDD A;  4CHN A;  4CHQ A;  3S3O A;  3SQ0 A;  3HM9 A;  3NE6 A;  4XIU A;  3OYJ A;  1SV5 A;  3DYA A;  5HRN A;  3CM5 A;  3L2R A;  3AA5 X;  4CK1 A;  2XY5 A;  1HRH A;  1LAW A;  3SQ4 A;  2QK9 A;  4F3O A;  1IH7 A;  3AVC A;  4LY7 A;  3KK2 A;  4UQG A;  3V81 A;  1Q9X A;  4HCB A;  1ZBF A;  2B4J A;  4NCB A;  2ZD1 A;  3LP2 A;  3HL8 A;  4O5B A;  2EHG A;  4CF8 A;  5KRS A;  3U6F A;  1LV5 A;  4FW2 A;  3OYN A;  1KVA A;  2YKN A;  2Y1J A;  2G8K A;  4F8R A;  4ICL A;  4B3O A;  1EKE A;  3KLI A;  2PYL A;  4CK2 A;  4DU3 A;  1TVR A;  2FBY A;  1LW2 A;  1JLF A;  4JS4 A;  3NAE A;  2PZS A;  3JYT A;  3NH0 A;  4FM0 A;  1WAJ A;  1ZYQ A;  2Z1H A;  1K6Y A;  3VQP A;  3KK1 A;  3D0P A;  4J2D A;  4B9U A;  1TKX A;  1VSL A;  2YNH A;  5HBM A;  2O4I A;  3KKR A;  1WSI A;  3AO1 A;  1U49 A;  1QSY A;  4I2Q A;  1IKV A;  3AVM A;  4CGG A;  1EXQ A;  3TAQ A;  3DLG A;  4OPJ A;  2GUI A;  4OKK A;  4E1N A;  1Q8I A;  4LH4 A;  2HHW A;  3OYD A;  4DSE A;  1X9W A;  2HW3 A;  1QTM A;  2HHT A;  1KFD A;  3OYH A;  2RKI A;  4DTU A;  4ELU A;  2PY5 A;  5HRS A;  3LPT A;  4E7H A;  1NK5 A;  4H8K A;  5JS1 A;  1SL2 A;  1S1X A;  2RF2 A;  3VQ9 A;  1ZBH A;  4BDZ A;  1Z26 A;  4IG3 A;  4ZTF A;  1D9D A;  3SQ2 A;  3PO4 A;  3HJF A;  4I9L A;  1TL1 A;  2EX3 A;  3DRS A;  3SYZ A;  3IS9 A;  2Y1I A;  2BGG A;  4Z0U A;  3MXI A;  2QKK A;  1NK4 A;  4CIF A;  4CGJ A;  3SUN A;  1JLE A;  3OYM A;  1EP4 A;  4M45 A;  2XO7 A;  4ZTJ A;  4FJ5 A;  2FBV A;  4RW6 A;  3HVT A;  5HRO A;  4CGF A;  4I7F A;  3O3F A;  3QEW A;  4O4G A;  1EET A;  2P51 A;  1UWB A;  4DTP A;  4QCL A;  3AO2 A;  3AVL A;  1RT6 A;  5KTQ A;  1KTQ A;  4JRQ A;  3VQ6 A;  3T1A A;  3K57 A;  2IDO A;  1Q9Y A;  2P5O A;  4YFU A;  4FJH A;  4M3W A;  4HUE A;  1JLC A;  4CJQ A;  5J2Q A;  3RMB A;  1UA1 A;  4HVJ A;  3UIQ A;  4FJX A;  4DFK A;  2OPR A;  3RTV A;  4M3Y A;  1BCM A;  1RT7 A;  2QXF A;  1I3A A;  2D0A A;  3CG7 A;  5KGX A;  2IGI A;  1FKP A;  1IO2 A;  1C0U A;  3DI6 A;  4Z4C A;  3EY1 A;  1L3V A;  3PX0 A;  1U47 A;  1U48 A;  4DFJ A;  1NJZ A;  4KI6 A;  4FM1 A;  3PX4 A;  3ZCM A;  2F8T A;  4FK2 A;  4KHS A;  3DMJ A;  2X78 A;  3RMC A;  4DU4 A;  3SPY A;  4CJV A;  4K8X A;  4DS5 A;  4B9N A;  3QO9 A;  1S5J A;  3O3G A;  1MU2 A;  2XHB A;  4KHU A;  1VSH A;  3VA0 A;  1RT2 A;  1HNI A;  2G8H A;  3NF9 A;  4FJJ A;  1CLQ A;  2A1R A;  3M8Q A;  4CF9 A;  3AVJ A;  2G8F A;  3ZSZ A;  2HVI A;  1GOA A;  1RTJ A;  4FJI A;  1SKR A;  3NFA A;  1DTQ A;  4O55 A;  3AVI A;  4DQQ A;  1HJR A;  3SJJ A;  4FJG A;  1BQN A;  4WE1 A;  3G10 A;  2X74 A;  3B6O A;  3C6T A;  1ASW A;  1FXX A;  3SV3 A;  1U4B A;  2Z1J A;  3M8P A;  5J2M A;  4KB1 A;  1C1C A;  1JLB A;  1KVC A;  5DMR A;  4DSL A;  4KTZ A;  3TWH A;  1ZBU A;  3MED A;  3D45 A;  3QNO A;  1N5Y A;  2XY7 A;  3NF8 A;  3DLR A;  3HPH A;  4EP5 A;  3ULD A;  3B6P A;  5CYQ A;  4BE2 A;  2HMI A;  4EZ6 A;  3AVK A;  1S6P A;  4AHV A;  1C1B A;  4AHS A;  4BE1 A;  4KTW A;  4B9V A;  4M3Z A;  2KTQ A;  3C94 A;  2P1J A;  1XHZ A;  2IS3 A;  1TV6 A;  1RBV A; 
#chains in the Genus database with same CATH topology
 4M3R A;  3E66 A;  4BR7 A;  2F8S A;  4H4O A;  1NOY A;  4N5S A;  1Q7Y O;  4ISG A;  2P9N B;  4GNI A;  4BRO A;  4AHU A;  3H08 A;  4FK0 A;  4OVL A;  2QWM A;  4PY5 A;  5HLF A;  2HHV A;  2FF6 A;  3VF2 A;  5AQH A;  2O8B A;  3OYC A;  5AQX A;  2YHA A;  4LH5 A;  4CJF A;  3HYF A;  1T44 A;  2Z1I A;  4C8K A;  4A2A A;  3DWL A;  3LM2 A;  3MK6 A;  1YT3 A;  1BCO A;  5M1K A;  3RMA A;  2ZQB A;  3F73 A;  1UAX A;  4JHD A;  2I5J A;  4I9Q A;  3TAR A;  2HHU A;  4CEE A;  1ATS A;  3WXJ A;  1VRU A;  1HYZ A;  1JLA A;  3OTO K;  4BGB A;  4BRH A;  4JEP A;  3DAW A;  3CJC A;  4FLZ A;  4Z4G A;  3P1G A;  1LWF A;  1R0A A;  1NKC A;  4KRF A;  3BEX A;  4B8A B;  4FZX C;  4DS4 A;  2VGN A;  1WN7 A;  3I33 A;  5BRH A;  4LF5 K;  4B1Y B;  3VEW A;  3HP6 A;  3G4S N;  3A0I X;  3V1R A;  3EKS A;  4ELT A;  2O8D A;  3HP9 A;  3O1B A;  1YAG A;  2E8A A;  3VOV A;  4FLX A;  5B8H A;  4ISF A;  2DTU A;  4BWJ A;  1VQO N;  1L3U A;  2BH1 A;  3N4Q A;  1YHQ N;  5AQS A;  4PA1 A;  3AVN A;  1EX4 A;  1M1K O;  3LDS A;  3T69 A;  2HST A;  5HL7 L;  3LAM A;  1HLU A;  3QLH A;  1C0M A;  2UYT A;  4O0J A;  3NH2 A;  3NHG A;  3ZSO A;  3VQA A;  1XUP O;  4FYD A;  1ZBL A;  4M3U A;  1ASU A;  1KD1 O;  4Z4I A;  1WSH A;  2A41 A;  4CFC A;  4MQ3 A;  5AQU A;  4LF7 K;  1ZBI A;  1RBU A;  1QSL A;  4NLC A;  4MFB A;  4J2A A;  3L3U A;  3MEG A;  2YHX A;  4CZF A;  5BRE A;  4W5R A;  3V9W A;  1EO1 A;  3HVR A;  2BE2 A;  1YJN N;  1TAU A;  5J2P A;  3CXC M;  5I42 A;  3KD1 E;  2HBJ A;  4OPK A;  3THX A;  3OBY A;  1CXU A;  2Q97 A;  3KWI A;  2GX9 A;  3P4I A;  4OKE A;  4AHR A;  1HX1 A;  2QEX N;  3FFI A;  1WSG A;  1A5V A;  2PFU A;  1SL1 A;  4BE0 A;  3CC2 N;  3AVB A;  4B08 A;  2Q1N A;  2YNF A;  5CY4 A;  4CZJ A;  4CJE A;  2IC3 A;  3CCU N;  2VG5 A;  4OGC A;  3OJS A;  1VQL N;  4C8M A;  4CER A;  2ETJ A;  4FK4 A;  4JI7 K;  4FJ7 A;  4QS8 A;  3UE5 A;  2P9S B;  3DJC A;  4FJ8 A;  4HCC A;  1Z25 A;  2WUS A;  3G25 A;  2E2Q A;  4B3R K;  3TAF A;  1LOT B;  3ZT0 A;  3KD5 E;  3P38 A;  2XY8 A;  4XH1 A;  2G8V A;  4CEC A;  1YUW A;  1BG3 A;  4LFB K;  2VYP A;  1J5O A;  3OYB A;  5FLX O;  3AO3 A;  2KW4 A;  2UXC K;  1K9M O;  2KHO A;  3TU5 A;  4HHT A;  4FZY A;  3VQ5 A;  5TKY A;  1GLA G;  4KI4 A;  5C2D A;  2P9I B;  1BU6 O;  3MMV A;  5GAH P;  4MO4 A;  3KKS A;  3ZT3 A;  3RMD A;  3L2W A;  1BHL A;  3D2F B;  4PHT X;  3K5N A;  5BN9 A;  4DV7 K;  4KHQ A;  3O4Q A;  2QXL A;  3C6U A;  4BC2 A;  3VQB A;  3O3H A;  1RCH A;  3RSE A;  2HNZ A;  1JXE A;  2O8C A;  2KZZ A;  1RNH A;  4IZ9 A;  5AQR A;  1BIS A;  2O8E A;  1YTU A;  1F21 A;  5HRP A;  4WQ5 A;  3S3N A;  1WNS A;  3PY8 A;  1SKW A;  3ZT1 A;  1BUP A;  3CCL N;  4G9Z A;  3SK3 A;  3A2F A;  4CEF A;  4CIE A;  4FLV A;  3OJU A;  4H4M A;  4RW8 A;  3RR7 A;  4OLA A;  4DTM A;  4B1Z A;  4C23 A;  4KH4 A;  2V51 B;  3HOS A;  3MCA B;  4CES A;  1RIL A;  5AQQ A;  4FLY A;  1NLV A;  3J7Z O;  2KZM A;  2IOC A;  2YNI A;  3U3G A;  4DUY K;  2PYJ A;  2HND A;  4C8L A;  4JI2 K;  3OYA A;  3V9U A;  1I39 A;  4JN4 A;  3QEP A;  3ULE B;  3AA4 A;  1NGD A;  4CJT A;  2OZM A;  4CJW A;  3S41 A;  2UU9 K;  3HBT A;  3H1V X;  3QER A;  4CHY A;  3K5L A;  1ATN A;  2DFH A;  3A5L C;  1VSD A;  3IDH A;  4EZ9 A;  4KFB A;  5F2R A;  1KLM A;  3CHW A;  5SZT A;  2E2N A;  4J2E A;  3QML A;  4LSN A;  3ITH A;  4HWI A;  2FC0 A;  1C6V A;  4IG0 A;  2OYQ A;  1NKB A;  4B9T A;  1RBS A;  3SLC A;  3VQQ A;  4JKC A;  3UKR B;  2QKB A;  1RDD A;  1NGA A;  4CHQ A;  2VQE K;  1OH7 A;  5HRN A;  3DYA A;  4I6M A;  4FWL A;  3AA5 X;  3SQ4 A;  2QK9 A;  2P9N A;  3J8A A;  3SJH A;  1Q9X A;  1HKC A;  1R59 O;  1MA9 B;  4CF8 A;  2EHG A;  5AQY A;  3OYN A;  3ZX0 A;  2Y1J A;  4ICL A;  1WUA A;  4BRM A;  4DU3 A;  4JS4 A;  3JYT A;  1QQM A;  2D1K A;  3KK1 A;  1JCF A;  1QVG M;  3R8E A;  4B9U A;  4J2D A;  2NRT A;  3ZX3 A;  1HR0 K;  3AVM A;  4CGG A;  1IBM K;  1GLD G;  2GUI A;  4OKK A;  1Q8I A;  4LH4 A;  2HHW A;  4H0X B;  2HW3 A;  4PL8 A;  3WEE A;  1ZBS A;  2RKI A;  4A5A A;  2PY5 A;  1X3M A;  5GIO A;  1SL2 A;  3CCQ N;  1QHA A;  1NGE A;  4I9L A;  2EX3 A;  4Z0U A;  2QKK A;  1SS6 A;  3C6H A;  2GTD A;  1C0F A;  4DKW A;  1JLE A;  2RHK A;  1EP4 A;  2IVP A;  3I8B A;  3SBT A;  4FJ5 A;  3HVT A;  3THY A;  3D2E B;  4RWT A;  3QEW A;  4O4G A;  1EET A;  3AAR A;  3EEQ A;  1KTQ A;  3L0Q A;  4CJQ A;  3ZET A;  3RMB A;  4HVJ A;  3UIQ A;  4FJX A;  2OPR A;  3SAH A;  4DR1 K;  4JI8 K;  2D0A A;  2UUA K;  5KGX A;  1N32 K;  3VGL A;  2IGI A;  4MLH A;  4EHT A;  1C0U A;  4JK7 A;  1S22 A;  2V7Z A;  1L3V A;  1U47 A;  3ZYY X;  1NJZ A;  1S3X A;  1VQ8 N;  3VES A;  4OO1 J;  3ZCM A;  2YHW A;  5EXW A;  4KHU A;  3VA0 A;  4K0K K;  3D2F A;  2NRX A;  3AVJ A;  4DCH A;  1RTJ A;  1SKR A;  2JWK A;  3MWP A;  2J4R A;  1ASW A;  5AQT A;  3R9P A;  3BP8 A;  3CCE N;  3EE8 A;  1KVC A;  1W97 L;  5DMR A;  3MED A;  3O9T A;  3LDN A;  2UXD K;  1N5Y A;  4JI1 K;  1KAX A;  3HPH A;  3NF8 A;  4BE2 A;  3BUZ B;  5AQJ A;  2HMI A;  3LDL A;  4KTW A;  5C12 A;  3C94 A;  3GE1 A;  4DSK A;  1IG9 A;  1J9A A;  3HZ6 A;  4LSL A;  4CJL A;  3VGK A;  3VQ8 A;  4DQ8 A;  4QAG A;  3AVG A;  4FPA A;  2FBT A;  4BRN A;  1NWK A;  3V1O A;  4FLU A;  4DFP A;  4U67 L;  4FSV A;  4BR4 A;  1SUQ A;  4FO0 A;  4PKH A;  4OX9 K;  1RT3 A;  4B1V A;  1EWR A;  4CJ4 A;  1EWQ A;  3LZI A;  2GV9 A;  4AH9 A;  4NXM K;  1MWK A;  2VCP A;  1T6C A;  3QB0 A;  2JLE A;  5ADX H;  4DQR A;  5MLC Q;  4IO8 A;  1RT4 A;  3QFP A;  2WON A;  5KPZ A;  3CI5 A;  4DU1 A;  1KAZ A;  4GV9 A;  3ZEU B;  4GVM A;  4E7K A;  1HQE A;  5DM6 L;  1CZB A;  2VQF K;  2IIR A;  5TKW A;  4FJL A;  3QEX A;  2D0B A;  2ZJR L;  3W3D A;  1S1U A;  4BC3 A;  1OH5 A;  2RPI A;  4V19 S;  4TSX A;  2GEL A;  3DOL A;  3QFU A;  4F4K A;  3DLL L;  1VQ7 N;  3V1Q A;  1GLB G;  1T7P A;  2ZE2 A;  2D0C A;  2WOM A;  3HOT A;  4IFV A;  4HUF A;  3CJ1 A;  4BDY A;  1N36 K;  1FW6 A;  4N56 A;  1NBW A;  3WXI A;  5HP1 A;  3TAE A;  1BIU A;  2P9K B;  4DTO A;  3SCX A;  1WB9 A;  2FXU A;  1A5X A;  1J54 A;  1SQK A;  1WLJ A;  4DV6 K;  3AVH A;  1NGC A;  3PO5 A;  1CZA N;  4DF8 A;  3MCP A;  4BRE A;  3LP0 A;  1J53 A;  1GOB A;  2YV0 X;  2VGM A;  1NNE A;  3SMP A;  1LWE A;  3CD6 N;  3BDP A;  3QET A;  4PQU A;  3ENB A;  4W5O A;  4E89 A;  4BAC A;  2D0P A;  4EP4 A;  1ASV A;  3S9H A;  4CFB A;  3K58 A;  4M41 A;  2XY6 A;  2UUB K;  2P9U A;  2FSK A;  1KAY A;  3KWG A;  4KH6 A;  4WQ5 C;  3DXM A;  4BQZ A;  4OJR A;  3MEE A;  2O8F B;  1DEJ A;  3I0S A;  1VAZ A;  4O5F A;  3H3O B;  4DV0 K;  4LC9 B;  2F96 A;  2NRR A;  3WNF A;  4N47 A;  4KHW A;  3T1Y K;  4FLT A;  1T05 A;  2Q0R A;  3LP1 A;  1QE1 A;  1VSE A;  4BG9 A;  4DR7 K;  2NUB A;  1KXP A;  3NVM A;  1KSP A;  1XWL A;  1W0H A;  4O8K A;  4CEQ A;  1YXQ A;  1L3S A;  5F1X A;  4OPH A;  2O8F A;  4WF9 L;  2OPS A;  1ZXO A;  4X64 K;  3JXU A;  3U3Y A;  4Q5V A;  4EIA A;  5FRM A;  4RTF D;  4DWI A;  2Q3S A;  4DQP A;  4E0D A;  5M1Q A;  4CHO A;  3MAQ A;  3L2V A;  1X3N A;  2KKZ A;  1VQP N;  5ADX A;  4CF0 A;  4CIG A;  3OHR A;  3EZ5 A;  4Y1D A;  4F2R A;  3UKU A;  3O8M A;  4EFH A;  1VRT A;  2NLX A;  4DB3 A;  1KRP A;  3PUF A;  3AA2 A;  3ATV A;  4Z4H A;  1XHX A;  2OTJ N;  4IEI A;  2HHX A;  3Q7B A;  4L8R B;  3DLK A;  3ASM A;  3L8B A;  4LF9 K;  1C0T A;  1GLL O;  3R1X A;  2IAJ A;  2Z1G A;  1NGB A;  1TKZ A;  2OCE A;  3DLB A;  5T7B A;  1YJW N;  5J1E A;  3OYL A;  2W6K A;  1DTT A;  2GBZ A;  4WQ4 C;  1TAQ A;  3QBX A;  1IBL K;  5IWA K;  4BRQ A;  5AJ3 K;  3ZSQ A;  3ID6 A;  4Y1C A;  5CYM A;  5EVZ A;  4B9S A;  1S1V A;  1JL2 A;  2NRV A;  3KK3 A;  2P9S A;  2A1S A;  1A5W A;  1C0G A;  1U2V B;  4BQL A;  2VG6 A;  3CFO A;  3HST B;  4NCG A;  2YHY A;  3DOK A;  4BC5 A;  3NGI A;  3U9Z A;  1UA0 A;  3P83 D;  1NJX A;  3IFR A;  4E7I A;  1U45 A;  1P8Z A;  3FZK A;  3LWM A;  4FM2 A;  4CK3 A;  4KO0 A;  4CEO A;  4CJP A;  1S9E A;  1WOQ A;  1BI4 B;  2HB5 A;  2V52 B;  5LY3 A;  4NLB A;  3H3N O;  2O4G A;  1XNR K;  1YVU A;  4FJM A;  2ITM A;  3ENH A;  1IKY A;  3KK7 A;  5I9E B;  5FPE A;  1JKH A;  4B9Q A;  1G15 A;  3V9Z A;  2QWP A;  2HBM A;  1KVB A;  4FJ9 A;  3K2P A;  2A5X A;  3OY9 A;  2KFN A;  3CJ7 A;  1WSF A;  3E1Y A;  3TAP A;  4DTS A;  4OGE A;  3VTH A;  4BR9 A;  4BRL A;  3EYZ A;  4CEB A;  3SQ1 A;  1X9S A;  1T8E A;  1QVF M;  4DSI A;  1BO5 O;  3TSU A;  3SUO A;  3FE1 A;  2OAN A;  1TUY A;  3VPZ A;  2ZJQ L;  3IAY A;  5EU7 A;  2HHQ A;  4E3S A;  4ILH A;  4YOU A;  4ID1 A;  4K8Z A;  1RDA A;  1VSK A;  4JKG A;  4AHC A;  1RGI A;  4KKO A;  4R79 A;  5AQM A;  5BR8 K;  4IFY A;  1X1P A;  4NO7 A;  3RR8 A;  2W42 A;  4CZE A;  1JLQ A;  4QOZ B;  3I56 N;  5FDL A;  1BQM A;  4YNQ A;  1WSE A;  4KTQ A;  3H6E A;  3L3V A;  1D9F A;  5JVH L;  3SAF A;  4FL9 A;  4JAX A;  3WNG A;  5FPD A;  1RTD A;  4CEZ A;  3VQE A;  4HTL A;  1B92 A;  3TAN A;  4CHN A;  3S3O A;  3OYJ A;  3VMF B;  4YOY A;  1LAW A;  3FR0 A;  1NJI O;  3AGK A;  1IH7 A;  4CZL A;  4HCB A;  4UQG A;  1ZBF A;  3LP2 A;  4O5B A;  3HL8 A;  4FW2 A;  2G8K A;  2PYL A;  2VWB A;  1TVR A;  2FBY A;  3TPQ A;  1LW2 A;  4CW7 B;  3NAE A;  2PZS A;  4FM0 A;  2F9W A;  1WAJ A;  2QWL A;  3VQP A;  4H0O A;  1Z6R A;  1TKX A;  2O4I A;  3O9Q A;  5HBM A;  1GLF O;  2P9K A;  3KKR A;  1WSI A;  3AO1 A;  1U49 A;  1QSY A;  1K8K B;  1IKV A;  1HNX K;  4YHH K;  1EXQ A;  3C65 A;  2QW9 A;  4E1N A;  3OYD A;  1X9W A;  2ASM A;  2H3G X;  4DTU A;  3OYH A;  4ELU A;  4DV1 K;  3D7E O;  5JS1 A;  4JI4 K;  1ZBH A;  3RSE B;  5AZI B;  1D9D A;  3SQ2 A;  3PO4 A;  3HJF A;  4UY8 O;  3A5M C;  2FSN A;  3FGU A;  4AM6 A;  5JIC A;  3MXI A;  4CIF A;  4JKB A;  3SUN A;  4JV5 K;  1NMD A;  4M45 A;  2XO7 A;  4ZTJ A;  3FZH A;  5GAD P;  2QWR A;  4I7F A;  1UWB A;  1Q9Y A;  3T1A A;  4FJH A;  2F4V K;  1JLC A;  5GIP A;  5J2Q A;  1UA1 A;  1Q82 O;  4DFK A;  4WFB L;  1BCM A;  2QXF A;  4U7B A;  1I3A A;  3KVG A;  4H5N A;  3CPE A;  3KHY A;  3DI6 A;  3EY1 A;  3PX0 A;  1VHX A;  4FM1 A;  2BTF A;  4MO5 A;  2O8B B;  1N8R O;  3CQX A;  5JVG L;  4DU4 A;  3SPY A;  2IVO A;  3MN6 A;  4QS9 A;  4BRC A;  2XHB A;  1VSH A;  2JWL A;  1RT2 A;  1O13 A;  2A42 A;  2RE2 A;  4B3T K;  4BG8 A;  4FWM A;  2A1R A;  1YF5 L;  1HPM A;  4A59 A;  3ZSZ A;  2ZJP L;  1NM1 A;  4FJI A;  3GOI A;  3PSF A;  4DQQ A;  2ZWH A;  1HJR A;  3SJJ A;  4FJG A;  1BQN A;  4WE1 A;  3G10 A;  3J7A P;  3SV3 A;  1U4B A;  1FXX A;  2Z1J A;  4RCH A;  3BZK A;  3M8P A;  5FPM A;  4JI6 K;  1JLB A;  2DPN A;  4KTZ A;  2XY7 A;  1MDU B;  4EP5 A;  4WFA L;  3AVK A;  5BPM A;  4AHS A;  2WFB A;  3ENO A;  4B9V A;  2KTQ A;  4B1U B;  3FZL A;  5LMN K;  1RBV A;  3O5B A;  3ZT2 A;  4IJA A;  4CZH A;  2A6A A;  3ZSY A;  5SWM A;  2XRI A;  3AY9 A;  2ZM6 K;  3SAG A;  4DTJ A;  2VG7 A;  1HNW K;  3CCR N;  5M1O A;  4IO9 L;  1VSJ A;  4CJS A;  4J8F A;  3IMX A;  3CQ8 A;  4KHN A;  3CFP A;  2KFZ A;  1N33 K;  3ZSR A;  1YJ9 N;  4IOA L;  4DG1 A;  3GDQ A;  2Q0U A;  1T3V A;  4F3T A;  4I6M B;  4CBU A;  1RDW X;  3G0Z A;  5KRT A;  5JMV A;  1V4T A;  4C8N A;  1U2V A;  1YTA A;  4GW6 A;  3QEI A;  2D0O A;  3EE9 A;  2F9T A;  3VN5 A;  4CGD A;  4DFM A;  1L5U A;  1S6Q A;  2E6M A;  1WAF A;  1VSI A;  2P9L B;  4B8C A;  1QSS A;  2YX6 A;  3WXL A;  3PX6 A;  3I8D A;  1N6Q A;  3O08 A;  5BRD A;  1VQ6 N;  4CBW A;  3TI0 A;  3O4N A;  1NK9 A;  2W40 A;  2ASP A;  4DV2 K;  1Q86 O;  4IEE A;  4DV3 K;  1HYS A;  4L3Q A;  5C24 A;  4ELV A;  1D8Y A;  4CI6 A;  3CCM N;  4FLW A;  4CVN E;  4EHU A;  1S9G A;  3RRG A;  4FZZ A;  2Q31 A;  3M6G A;  5AQF A;  3VF4 A;  4FW1 A;  5KI6 A;  3HSC A;  3IG1 A;  1VQM N;  3BZC A;  3HPG A;  4PUO A;  5K14 A;  2HF3 A;  1KQS M;  5EOY A;  3HRG A;  5DM7 L;  2GEM A;  3TR8 A;  4DLG A;  1HJO A;  5D3G A;  2QWQ A;  1LWC A;  5KPT A;  3HM8 A;  3M5R A;  4JLH A;  1XNQ K;  2P9L A;  4ZHR A;  3OYK A;  2A40 A;  5JLH A;  3DXM B;  5E84 A;  2AP1 A;  5BRF A;  4FJK A;  4PKG A;  3O80 A;  3V6D A;  4H5R A;  4FOI A;  3FZF A;  4MLE A;  1K73 O;  3OBW A;  3IRX A;  5KGW A;  2HBL A;  3FLC O;  3K9K A;  4O0I A;  4JD2 B;  2DFF A;  4DR5 K;  1TK0 A;  3LPU A;  3W0L A;  1EQY A;  1YI2 N;  3TTF A;  3WT0 A;  2NNW A;  3LZJ A;  4GV6 A;  2Q36 A;  1TKD A;  1L3T A;  4KAZ A;  3K5O A;  4AF1 A;  5IT9 O;  3SPZ A;  1S1T A;  1TK5 A;  3LP3 A;  1ATR A;  3SYZ A;  3VTI A;  4LD0 A;  2DFE A;  4FVM A;  3LDP A;  3CFR A;  4DQS A;  2OZS A;  3KLH A;  4E7L A;  4YDU C;  1RDU A;  4B9L A;  3VQ7 A;  4K43 A;  4PWD A;  1XI1 A;  1RTH A;  2V7Y A;  4X65 K;  3M3Z A;  3QNN A;  1WBB A;  4X62 K;  1LAV A;  2X6N A;  5AQV A;  1TUU A;  3T7Z A;  5EY4 A;  2CGK A;  1IV0 A;  3WUH A;  4B3S K;  2AA4 A;  2D5R A;  4CD1 A;  3NH1 A;  3G6E N;  1RDC A;  1TYQ A;  3LWL A;  1NGF A;  4IKF A;  4CZG A;  1FKO A;  1IKX A;  3CCV N;  3PV8 A;  4CHZ A;  4DLE A;  3EKU A;  1D5A A;  3WNE A;  4BR0 A;  4FWR A;  2WBN A;  4KRE A;  3OYF A;  1DT9 A;  3CC7 N;  2P5G A;  2FBX A;  1M90 O;  3C95 A;  2QA4 N;  4RW4 A;  2BDP A;  3E9O A;  2HVH A;  4CED A;  1JXB A;  1E4F T;  3P39 A;  3NF7 A;  4BWM A;  5JLF A;  4E1J A;  1RT1 A;  1XC9 A;  4Z4F A;  3ZLJ A;  3V9S A;  4DSJ A;  3B8A X;  4OLB A;  4CJU A;  2E5L K;  4LF6 K;  5AQP A;  5GAE P;  1TGO A;  2D4W A;  1NK0 A;  1WSJ A;  3HI0 A;  3VEN A;  4E19 A;  2YHB A;  4IOX A;  1CXQ A;  1KCF A;  3H45 C;  2YCH A;  3DRP A;  1Q81 O;  1U6Z A;  2E20 A;  4YY3 K;  4GKJ K;  3V4I A;  1QS4 A;  4M63 C;  4O44 A;  1RTI A;  3AO5 A;  3KZB A;  1HNV A;  4OPA A;  3SZ2 A;  3TSQ A;  3CIP A;  2E1Z A;  1VK0 A;  1RBT A;  2GUP A;  3QBW A;  4HUG A;  5AQK A;  3SUP A;  4PL7 A;  1NOZ A;  2W41 A;  3KIO A;  3HXM A;  2CH6 A;  1RFQ A;  4ISE A;  1BL3 A;  2ASO A;  3CME N;  3MXM A;  3S3M A;  4N41 A;  5F0X A;  3KLF A;  3QIO A;  3OS1 A;  3QEV A;  4DR4 K;  3NMU A;  1GLE G;  2OA8 A;  3HO1 A;  3E01 A;  3MEC A;  4H5V A;  1S1W A;  4CHP A;  4DQI A;  3F9M A;  4KPY A;  4FWO A;  4Q0B A;  3FZM A;  1Q18 A;  4E1M A;  3WQU A;  4FCY A;  3CCS N;  3OYG A;  2I7N A;  3VQC A;  3AAQ A;  3ATU A;  4F2S A;  3CJA A;  1BIZ A;  3C6A A;  1YIJ N;  3RRH A;  2BAN A;  2OPP A;  2B6A A;  1OH6 A;  4F9O A;  3O9S A;  2EWS A;  1J5E K;  1O1W A;  1TK8 A;  3TAB A;  2VWJ A;  4JKF A;  3CCJ N;  4J2B A;  3NCI A;  4H0T B;  4Z4E A;  4JI0 K;  2YNG A;  4H0V B;  4YDU A;  1NJY A;  2VWK A;  1HNZ K;  1ILY A;  1IKW A;  4JS5 A;  4IFE A;  3LAL A;  4DSF A;  4A2B A;  4A61 A;  1QQC A;  3ZSV A;  1RT5 A;  4A5B A;  2AJQ A;  3NE6 A;  4XIU A;  2XY5 A;  1SV5 A;  4JNE A;  3J7Y P;  3L2R A;  1HRH A;  4BVP A;  5BPL A;  3THW B;  2E88 A;  3AVC A;  3GL1 A;  4NCB A;  3V81 A;  1FJG K;  2B4J A;  5EX5 A;  2ZD1 A;  3U6F A;  1LV5 A;  5KRS A;  1X9J A;  3C0B A;  5H1S Q;  3FFK B;  3R6M A;  1EKE A;  2YJF A;  3KLI A;  4CK2 A;  4KHP K;  5GIN A;  4WYB A;  3ZEU A;  3U4L A;  4PKI A;  2Z1H A;  5AZJ B;  3RVC A;  3D0P A;  3CC4 N;  1XMO K;  1NMN A;  4I2Q A;  1E4G T;  3TAQ A;  5FPN A;  4FWN A;  1G99 A;  4DSE A;  3T1H K;  3A8Y A;  3PIP L;  3CPW M;  4BRI A;  2HHT A;  5HRS A;  4E7H A;  1NK5 A;  3CJB A;  1S1X A;  2RF2 A;  3VQ9 A;  4BDZ A;  1Z26 A;  4IG3 A;  4ZTF A;  3PSI A;  4LF4 K;  1NK4 A;  3PIO L;  1SZ2 A;  1GLC G;  3OYM A;  3I55 N;  2CGL A;  3VEY A;  4GKK K;  2FBV A;  1YVN A;  3JS6 A;  4IWV A;  4CZI A;  2P51 A;  3C7N A;  3AO2 A;  3AVL A;  1VQ9 N;  5KTQ A;  2WTU A;  4JRQ A;  3E9L A;  3VQ6 A;  3K57 A;  2P5O A;  2IDO A;  3RTV A;  4JKE A;  4CJ7 A;  3M1F A;  1RT7 A;  3BF1 A;  3O9R A;  3CG7 A;  3VET A;  1BA1 A;  3L4I A;  4BRG A;  4DFJ A;  2P9U B;  4KI6 A;  3PX4 A;  4H5W A;  2X78 A;  2GWK A;  3LDO A;  4B9N A;  3QO9 A;  4DUZ K;  1BDG A;  4FJJ A;  1HNI A;  2G8H A;  3NF9 A;  3VEX A;  3QDK A;  3WXK A;  3M8Q A;  1BWF O;  4CF9 A;  2G8F A;  2HVI A;  3NFA A;  3DXK B;  1VQ4 N;  1GLJ O;  4H0P A;  3C6T A;  4K25 A;  5M1P A;  4WCE L;  3MN7 A;  1JCG A;  1K8K A;  4DSL A;  1NU0 A;  4FWS A;  3TWH A;  5AQW A;  3D45 A;  3QNO A;  4KBO A;  4JHD B;  1OVY A;  3THY B;  4EAH D;  4CD3 A;  1S6P A;  1K8A O;  1P90 A;  4BE1 A;  3E9P A;  4M3Z A;  2ZGY A;  2CH5 A;  4IDK A;  4H0Y B;  3M8S A;  2OTL N;  2G8W A;  3RWU A;  2PBD A;  3QIC A;  3CYM A;  1HUX A;  3VF6 A;  3NVK A;  3ISN C;  5FRO A;  1ESV A;  4KHY A;  3I0R A;  4BDP A;  3AA3 A;  5CZ2 A;  1NK6 A;  5AQI A;  3HTV A;  4MDA A;  3IKM A;  4KV8 A;  4R5P A;  3MDQ A;  4M3X A;  4CGI A;  1V4S A;  4DF4 A;  4CJR A;  1C1A A;  3KJV A;  3ZSX A;  4FJN A;  3K59 A;  4I2P A;  3WXM B;  4WFN L;  1VQ5 N;  4JD2 A;  1B9F A;  4KB0 A;  1JLG A;  3OW2 M;  1VSM A;  1T03 A;  3NGY A;  3P5J A;  4X66 K;  3MXJ A;  1QQO A;  1Y97 A;  4JI5 K;  4K42 A;  2F7T A;  1OVQ A;  2BUP A;  3D2E A;  3MN5 A;  2G8I A;  4BR5 A;  1RBR A;  1D4X A;  2FLO A;  1DLO A;  3EO3 A;  5E41 A;  2IVN A;  5DK5 A;  2YI1 A;  4JRP A;  3K5M A;  3QES A;  4CFD A;  4DR2 K;  4N76 A;  3MX5 A;  3LAN A;  1QQN A;  3ID8 A;  1OKJ A;  3SI6 A;  3HPO A;  5J2N A;  3CF5 L;  5AQZ A;  2YKM A;  5AFU A;  2NRW A;  3OS0 A;  4AHT A;  2X6S A;  1TL3 A;  3AO4 A;  4RW7 A;  5CHI A;  3SNN A;  1LW0 A;  5C25 A;  3THV A;  5AQL A;  1DGK N;  4DV4 K;  4NYN A;  4FPB A;  5AQN A;  3OYE A;  3CMA N;  3WNH A;  2E1Y A;  2QTD A;  3DRR A;  4XH5 A;  4HTU A;  1W7A A;  2RN2 A;  4B9M A;  5M1F A;  2HF4 A;  4CCH A;  1SL0 A;  2UXB K;  4JKD A;  5KPR A;  1UOC A;  3ZSW A;  3HT3 A;  4IDH A;  4B3M K;  3M8R A;  5AZJ A;  2ITG A;  3ALY A;  3LDQ A;  3KLE A;  5C15 A;  1BI4 A;  3T19 A;  4CJK A;  5ELZ A;  1W2B M;  3DLE A;  3Q7C A;  3L2U A;  4BGA A;  3V9X A;  4W5T A;  4DTN A;  4H5T A;  1VSF A;  2ZGZ A;  3CJ9 A;  1JL1 A;  3MN9 A;  4A62 A;  3NBP A;  1VQN N;  2HBK A;  4ID5 A;  4NYF A;  1VQK N;  3D6R A;  1REV A;  2HOE A;  1QHT A;  4C1N K;  4CFA A;  3T3F A;  2UUC K;  4JK8 A;  1HKG A;  4CJ5 A;  2NRZ A;  1QZ6 A;  1NK7 A;  3AAP A;  1B9D A;  3N4P A;  1FK9 A;  3TAG A;  5AQO A;  3VQ4 A;  4W5Q A;  4JI3 K;  2ATQ A;  4M3T A;  4JYA K;  2O8E B;  4B1X B;  1W9H A;  4F3O A;  1HPZ A;  3NF6 A;  2W6L A;  3VA3 A;  1KFS A;  3G71 N;  3ZT4 A;  1H1V A;  5C10 A;  3KTQ A;  3LL3 A;  4CE9 A;  5FRN A;  2QWO A;  3VEV A;  3BF3 A;  4OKJ A;  4BRF A;  1NG9 A;  3MX2 A;  3MWT A;  2LSN A;  4W5N A;  3GG4 A;  3F9K A;  5M1N A;  4YOV A;  1LCU A;  4CF1 A;  4IBN A;  4XH4 A;  4ILG B;  5JS2 A;  5AFU H;  5HRR A;  2E2O A;  1GOC A;  3GBT A;  5AZI A;  4AIL C;  2HNY A;  4FWP A;  4FXD A;  3AGR A;  4YOX A;  5KQ8 A;  5LJW A;  2HMP A;  2KLA A;  3QIP A;  5BN8 A;  4FVU A;  2KQ2 A;  4G1Q A;  1RDB A;  2QM1 A;  2FF3 B;  5CE3 A;  5C2F A;  3WQT A;  3C7N B;  3OS2 A;  4Y0W A;  3L2Q A;  1JJ2 M;  4AQY K;  2NZT A;  1J6Z A;  1E3M A;  3LAK A;  2E6L A;  4DTR A;  3OYI A;  4FWQ A;  4NCA A;  4GV3 A;  3BY5 A;  1KC8 O;  2OPQ A;  3CER A;  3H1Q A;  4CBX A;  4CGH A;  4C8O A;  3SBG A;  3O1W A;  3TAM A;  1Z05 A;  1HQU A;  4CJ3 A;  5AR0 A;  4E7J A;  3AVA A;  4BY9 C;  3DM2 A;  4MDB A;  1X9M A;  3SUQ A;  2E2P A;  2DY4 A;  3DXK A;  3HK2 A;  1YIT N;  3F5T A;  4CEA A;  4M42 A;  1HMV A;  3O9U A;  4CZK A;  3EN9 A;  3TTC A;  4LFA K;  3AVF A;  3F2K A;  3O6W A;  2I7P A;  4RW9 A;  4M7X A;  4XEI A;  3JSM A;  4FWK A;  3H46 O;  3DLH A;  2JGU A;  2P9P A;  4DTX A;  2PAV A;  2ZF5 O;  4DMN A;  1BGX T;  1NK8 A;  2Q2R A;  3PLA A;  4RG8 A;  4BRK A;  1OH8 A;  1NGJ A;  1SKS A;  4YOR A;  4K41 A;  3JAM O;  3SV4 A;  4M7Y A;  1U04 A;  1XMQ K;  4LFC K;  2R7Y A;  2B5J A;  5E26 A;  4YOT A;  4GY2 B;  4BC4 A;  3VQD A;  3NGZ A;  4GMJ B;  3AV9 A;  1NJW A;  4JKA A;  4YOW A;  3KLG A;  1TKT A;  3IUC A;  3L4Q A;  4JKG B;  4C1N I;  2O8C B;  1NKE A;  4JK9 A;  1TYQ B;  3O4W A;  3CET A;  3EL2 A;  4CF2 A;  4BRD A;  3TTD A;  5HOO A;  3LM9 A;  2CGJ A;  1KLN A;  2A3Z A;  5BR9 A;  3BGR A;  1WBD A;  1T6D A;  3NDK A;  5C42 A;  3L6Q A;  3UB5 A;  3ULE A;  3CM6 A;  1HYV A;  3QIN A;  2HHS A;  4AM7 A;  1NGG A;  3UKU B;  5A2Q O;  4BVO A;  1ITG A;  5CZ1 A;  2E4L A;  4GVE A;  3OVN A;  3VGM A;  1CZ9 A;  4B1W B;  3U8X A;  5I3U A;  2G8U A;  3THW A;  5CR4 A;  4NXN K;  1DKG D;  4O8U A;  3SQ0 A;  3HM9 A;  3P31 A;  3CM5 A;  4CK1 A;  3J80 O;  3THX B;  4Z94 A;  4LY7 A;  3KK2 A;  1BOT O;  4IXC A;  4BR2 A;  1KVA A;  2YKN A;  4F8R A;  4JKH A;  4B3O A;  2NRH A;  5KQD A;  1IG8 A;  1JLF A;  1SAZ A;  4CZM A;  1K6Y A;  1ZYQ A;  3ZET B;  1VSL A;  2YNH A;  1NGH A;  3OA9 A;  4BRP A;  4BRA A;  5LL6 Z;  5AQG A;  3DLG A;  3TSP A;  4OPJ A;  3VEO A;  1QTM A;  1KFD A;  3LPT A;  4ILJ A;  4H8K A;  1Y64 A;  5C0Y A;  4DV5 K;  4IOC L;  1N34 K;  1XC3 A;  3K9J A;  3ZX2 A;  1IBK K;  1TL1 A;  3DRS A;  3IS9 A;  2Y1I A;  2BGG A;  4WQ4 A;  2YJE A;  4CGJ A;  2HHH K;  1XQS C;  3WEE B;  3CQY A;  4RW6 A;  4A57 A;  5HRO A;  4CGF A;  3A5O C;  4KH5 A;  3O3F A;  4DTP A;  4QCL A;  4FOE A;  1RT6 A;  4M3W A;  3K0S A;  2P9I A;  2QWN A;  4YFU A;  4DR6 K;  4HUE A;  3SMS A;  3J81 O;  5GAG P;  4H03 B;  5LJV A;  3UKR A;  4LF8 K;  4M3Y A;  4DHY A;  1IJJ A;  1I94 K;  1FKP A;  1IO2 A;  2FSJ A;  4Z4C A;  4QS7 A;  1U48 A;  1S72 N;  2F8T A;  4FK2 A;  4KHS A;  1BA0 A;  3DMJ A;  3R3L A;  3RMC A;  4K8X A;  4CJV A;  1MWM A;  4DS5 A;  1S5J A;  3A5N C;  2QI2 A;  3O3G A;  1MU2 A;  3EZW A;  1ZC6 A;  1JCE A;  1CLQ A;  3VER A;  4DR3 K;  3VEZ A;  1GOA A;  1QZ5 A;  5BPN A;  1DTQ A;  4O55 A;  3AVI A;  4NB4 A;  2X74 A;  3B6O A;  1NGI A;  2GWJ A;  5J2M A;  4KB1 A;  1C1C A;  1HKB A;  1ZBU A;  3DLR A;  4IJN A;  3ULD A;  3B6P A;  5CYQ A;  4EZ6 A;  4AHV A;  1C1B A;  2P9P B;  3U9D A;  5LMU K;  2O8D B;  2P1J A;  1XHZ A;  2IS3 A;  2WC9 A;  1TV6 A;  3NH0 A; 
#chains in the Genus database with same CATH homology
 4IDK A;  1IG9 A;  1J9A A;  4M3R A;  3M8S A;  4LSL A;  4CJL A;  2F8S A;  4H4O A;  2G8W A;  3ZT2 A;  1NOY A;  3VQ8 A;  4N5S A;  3RWU A;  3ZSY A;  4QAG A;  5SWM A;  2XRI A;  3AVG A;  4AHU A;  2FBT A;  3CYM A;  3H08 A;  4FK0 A;  3V1O A;  4DTJ A;  4KHW A;  2VG7 A;  3ISN C;  4FLU A;  5FRO A;  4OVL A;  4DFP A;  4KHY A;  3I0R A;  4PY5 A;  1VSJ A;  5HLF A;  4CJS A;  2HHV A;  4BDP A;  3AA3 A;  1SUQ A;  5CZ2 A;  3CQ8 A;  1NK6 A;  4KHN A;  1RT3 A;  3CFP A;  2KFZ A;  3OYC A;  4KV8 A;  2YHA A;  4LH5 A;  3ZSR A;  4CJ4 A;  4CJF A;  3HYF A;  4DG1 A;  4R5P A;  3LZI A;  2GV9 A;  4AH9 A;  4CGI A;  4M3X A;  2Z1I A;  4C8K A;  4F3T A;  4DF4 A;  4CJR A;  3G0Z A;  1C1A A;  1YT3 A;  5KRT A;  1BCO A;  3KJV A;  3ZSX A;  2JLE A;  4C8N A;  3RMA A;  4FJN A;  3K59 A;  4I2P A;  1YTA A;  4GW6 A;  4DQR A;  2ZQB A;  3QEI A;  1RT4 A;  3F73 A;  2WON A;  1UAX A;  1B9F A;  3VN5 A;  4KB0 A;  1JLG A;  4CGD A;  4DFM A;  2I5J A;  4DU1 A;  1VSM A;  1T03 A;  1L5U A;  4I9Q A;  3NGY A;  3TAR A;  3P5J A;  2HHU A;  1S6Q A;  2E6M A;  1VSI A;  1WAF A;  1Y97 A;  3MXJ A;  1VRU A;  1HQE A;  4GVM A;  4B8C A;  4CEE A;  4E7K A;  1QSS A;  3PX6 A;  1HYZ A;  1JLA A;  2G8I A;  3I8D A;  1CZB A;  1RBR A;  1N6Q A;  4FJL A;  3QEX A;  2D0B A;  1DLO A;  1S1U A;  5DK5 A;  5E41 A;  2RPI A;  4TSX A;  4JRP A;  3K5M A;  3QES A;  4CFD A;  3DOL A;  4FLZ A;  4N76 A;  4Z4G A;  3TI0 A;  3P1G A;  4F4K A;  3LAN A;  1LWF A;  3O4N A;  1NK9 A;  1R0A A;  3SI6 A;  3V1Q A;  3HPO A;  5J2N A;  1NKC A;  1T7P A;  4KRF A;  2ZE2 A;  2D0C A;  2WOM A;  4B8A B;  4IFV A;  4HUF A;  4FZX C;  2YKM A;  4BDY A;  1HYS A;  3OS0 A;  4DS4 A;  4AHT A;  2X6S A;  1WN7 A;  5C24 A;  1TL3 A;  3AO4 A;  4RW7 A;  4N56 A;  3SNN A;  3HP6 A;  1LW0 A;  5C25 A;  3THV A;  1D8Y A;  4ELV A;  3V1R A;  4FLW A;  4ELT A;  1S9G A;  3HP9 A;  4FLX A;  4NYN A;  3RRG A;  4FZZ A;  5HP1 A;  3TAE A;  3OYE A;  2DTU A;  1BIU A;  4BWJ A;  4DTO A;  3SCX A;  3WNH A;  3DRR A;  4FW1 A;  1L3U A;  2OZS A;  4HTU A;  5KI6 A;  3IG1 A;  1A5X A;  2RN2 A;  3HPG A;  4PA1 A;  3AVN A;  4B9M A;  1J54 A;  4PUO A;  1EX4 A;  5K14 A;  4CCH A;  1WLJ A;  1SL0 A;  3LDS A;  3AVH A;  1UOC A;  3ZSW A;  3HT3 A;  3PO5 A;  3M8R A;  3TR8 A;  2ITG A;  3ALY A;  3LAM A;  4DLG A;  3QLH A;  1LWC A;  4DF8 A;  5D3G A;  3KLE A;  1C0M A;  4O0J A;  3NH2 A;  3NHG A;  3ZSO A;  1BI4 A;  3T19 A;  4JLH A;  3LP0 A;  1J53 A;  1GOB A;  2YV0 X;  4ZHR A;  4CJK A;  3OYK A;  3VQA A;  4FYD A;  1LWE A;  3DLE A;  3L2U A;  1ZBL A;  3V9X A;  4W5T A;  3BDP A;  3QET A;  4DTN A;  4FJK A;  4M3U A;  4PQU A;  1VSF A;  1ASU A;  4W5O A;  4E89 A;  4Z4I A;  1JL1 A;  3V6D A;  4BAC A;  3NBP A;  4EP4 A;  1ASV A;  1WSH A;  3S9H A;  4ID5 A;  3IRX A;  4NYF A;  5KGW A;  4MQ3 A;  1REV A;  4CFC A;  4CFB A;  3K58 A;  1ZBI A;  1RBU A;  4M41 A;  4O0I A;  4MFB A;  2XY6 A;  2DFF A;  1TK0 A;  1QSL A;  4J2A A;  3LPU A;  3L3U A;  3MEG A;  1QHT A;  4CFA A;  3T3F A;  4W5R A;  3LZJ A;  3V9W A;  3HVR A;  4CJ5 A;  2BE2 A;  1TKD A;  1TAU A;  5J2P A;  1L3T A;  4DSK A;  5I42 A;  1NK7 A;  4OJR A;  3KD1 E;  4KAZ A;  3MEE A;  1B9D A;  3I0S A;  3K5O A;  1FK9 A;  4OPK A;  3TAG A;  3VQ4 A;  4W5Q A;  4M3T A;  2ATQ A;  1S1T A;  3SPZ A;  3LP3 A;  1TK5 A;  1CXU A;  2F96 A;  4OKE A;  4N47 A;  3WNF A;  1W9H A;  4LD0 A;  2DFE A;  1HPZ A;  3NF6 A;  4FVM A;  4AHR A;  3CFR A;  3KLH A;  4FLT A;  4E7L A;  3LP1 A;  3VA3 A;  1T05 A;  1QE1 A;  3FFI A;  1VSE A;  1WSG A;  1KFS A;  4B9L A;  1A5V A;  3ZT4 A;  1SL1 A;  4BE0 A;  2NUB A;  1KSP A;  3VQ7 A;  1XWL A;  3AVB A;  4B08 A;  3KTQ A;  1W0H A;  4CE9 A;  1XI1 A;  4CEQ A;  5FRN A;  4PWD A;  1RTH A;  2YNF A;  3QNN A;  1L3S A;  4E7J A;  5CY4 A;  1LAV A;  2X6N A;  4OKJ A;  4CJE A;  2IC3 A;  2OPS A;  2VG5 A;  4OGC A;  3OJS A;  4C8M A;  4CER A;  2ETJ A;  3U3Y A;  4Q5V A;  4FK4 A;  2LSN A;  5FRM A;  4FJ7 A;  4DWI A;  4W5N A;  2Q3S A;  3F9K A;  4DQP A;  4E0D A;  2D5R A;  4CHO A;  4CF1 A;  3NH1 A;  4FJ8 A;  3MAQ A;  4HCC A;  3L2V A;  4IBN A;  1Z25 A;  1RDC A;  4CF0 A;  4CIG A;  5JS2 A;  3LWL A;  3EZ5 A;  4Y1D A;  3TAF A;  5HRR A;  4F2R A;  4IKF A;  1FKO A;  1IKX A;  3ZT0 A;  1GOC A;  1VRT A;  4CHZ A;  4AIL C;  3PV8 A;  4DLE A;  1KRP A;  3KD5 E;  3PUF A;  3AA2 A;  4Z4H A;  1D5A A;  1XHX A;  3WNE A;  2HNY A;  2XY8 A;  2G8V A;  4FXD A;  2HHX A;  4L8R B;  4KRE A;  4CEC A;  3OYF A;  3DLK A;  3ASM A;  3L8B A;  1C0T A;  2P5G A;  2FBX A;  3QIP A;  2IAJ A;  2Z1G A;  2KQ2 A;  3C95 A;  3OYB A;  1TKZ A;  4G1Q A;  4RW4 A;  1J5O A;  2BDP A;  1RDB A;  3AO3 A;  2HVH A;  2KW4 A;  4CED A;  1JXB A;  3DLB A;  3NF7 A;  4BWM A;  5T7B A;  3OS2 A;  4HHT A;  4FZY A;  3VQ5 A;  5J1E A;  3OYL A;  3L2Q A;  1DTT A;  1RT1 A;  2GBZ A;  1TAQ A;  1XC9 A;  4DQS A;  4Z4F A;  4KI4 A;  3LAK A;  3V9S A;  4DSJ A;  4OLB A;  2E6L A;  3ZSQ A;  3KKS A;  3ZT3 A;  4CJU A;  4Y1C A;  5CYM A;  3OYI A;  3L2W A;  4DTR A;  3RMD A;  4NCA A;  1BHL A;  1TGO A;  4B9S A;  1S1V A;  2OPQ A;  3K5N A;  1JL2 A;  4CGH A;  4C8O A;  1NK0 A;  1WSJ A;  3KK3 A;  3TAM A;  4KHQ A;  3O4Q A;  1HQU A;  4CJ3 A;  1A5W A;  3C6U A;  2A1S A;  2VG6 A;  3CFO A;  3AVA A;  1RCH A;  3HST B;  3DM2 A;  2YHB A;  4NCG A;  3VQB A;  4E19 A;  3O3H A;  3DOK A;  1X9M A;  1CXQ A;  1KCF A;  3NGI A;  3SUQ A;  1UA0 A;  2DY4 A;  2HNZ A;  1JXE A;  3HK2 A;  4CEA A;  3DRP A;  2KZZ A;  1RNH A;  3P83 D;  4M42 A;  1NJX A;  4E7I A;  1BIS A;  1HMV A;  1U45 A;  3LWM A;  4FM2 A;  1YTU A;  4CK3 A;  4KO0 A;  4CEO A;  3V4I A;  1F21 A;  4CJP A;  1S9E A;  3AVF A;  1QS4 A;  4O44 A;  4RW9 A;  5HRP A;  3S3N A;  1BI4 B;  2HB5 A;  1WNS A;  3JSM A;  3PY8 A;  2O4G A;  1RTI A;  1YVU A;  3AO5 A;  3ZT1 A;  1SKW A;  4FJM A;  1IKY A;  1HNV A;  3DLH A;  1JKH A;  2JGU A;  3SZ2 A;  1G15 A;  3V9Z A;  4DTX A;  1VK0 A;  1RBT A;  1KVB A;  4FJ9 A;  3K2P A;  4DMN A;  4HUG A;  1BGX T;  3OY9 A;  2KFN A;  1NK8 A;  3A2F A;  4CEF A;  3SUP A;  1WSF A;  4CIE A;  4RG8 A;  1NOZ A;  4FLV A;  3KIO A;  3OJU A;  4H4M A;  4RW8 A;  3TAP A;  4DTS A;  3HXM A;  4OGE A;  3RR7 A;  4OLA A;  4DTM A;  1BL3 A;  3MXM A;  3S3M A;  1SKS A;  4N41 A;  3EYZ A;  3KLF A;  4CEB A;  3SQ1 A;  3QIO A;  4CES A;  3SV4 A;  1X9S A;  1T8E A;  1RIL A;  3OS1 A;  3QEV A;  4DSI A;  1U04 A;  4FLY A;  2OA8 A;  3SUO A;  3HO1 A;  3E01 A;  2R7Y A;  2KZM A;  2B5J A;  3MEC A;  2IOC A;  2YNI A;  3U3G A;  2PYJ A;  1S1W A;  2HND A;  4CHP A;  4C8L A;  3IAY A;  5EU7 A;  2HHQ A;  4DQI A;  4E3S A;  4KPY A;  3VQD A;  3OYA A;  4ID1 A;  3NGZ A;  3V9U A;  4GMJ B;  4Q0B A;  3AV9 A;  4K8Z A;  1I39 A;  4E1M A;  1NJW A;  1RDA A;  1VSK A;  4AHC A;  4KKO A;  4FCY A;  3QEP A;  3AA4 A;  3OYG A;  4IFY A;  3KLG A;  1TKT A;  1X1P A;  3VQC A;  3RR8 A;  4CJT A;  2W42 A;  2OZM A;  4CJW A;  1JLQ A;  4QOZ B;  4F2S A;  3QER A;  1BIZ A;  1NKE A;  4CHY A;  3RRH A;  3K5L A;  2BAN A;  2OPP A;  2DFH A;  2B6A A;  4CF2 A;  1VSD A;  1O1W A;  5FDL A;  1BQM A;  1TK8 A;  4EZ9 A;  3TAB A;  4KFB A;  1KLM A;  2VWJ A;  4YNQ A;  1WSE A;  4J2B A;  3NCI A;  4Z4E A;  1KLN A;  4KTQ A;  3L3V A;  3BGR A;  5SZT A;  1D9F A;  2YNG A;  3NDK A;  5C42 A;  3CM6 A;  4J2E A;  1HYV A;  3QIN A;  2HHS A;  1NJY A;  2VWK A;  4LSN A;  3ITH A;  1IKW A;  2FC0 A;  3WNG A;  4JS5 A;  3LAL A;  1RTD A;  1ITG A;  5CZ1 A;  1C6V A;  2E4L A;  4CEZ A;  4DSF A;  4IG0 A;  3OVN A;  1CZ9 A;  3VQE A;  5I3U A;  2G8U A;  2OYQ A;  1B92 A;  1QQC A;  1NKB A;  4B9T A;  1RBS A;  3ZSV A;  3VQQ A;  1RT5 A;  2AJQ A;  2QKB A;  3TAN A;  1RDD A;  4CHN A;  4CHQ A;  3S3O A;  3SQ0 A;  3HM9 A;  3NE6 A;  4XIU A;  3OYJ A;  1SV5 A;  3DYA A;  5HRN A;  3CM5 A;  3L2R A;  3AA5 X;  4CK1 A;  2XY5 A;  1HRH A;  1LAW A;  3SQ4 A;  2QK9 A;  4F3O A;  1IH7 A;  3AVC A;  4LY7 A;  3KK2 A;  4UQG A;  3V81 A;  1Q9X A;  4HCB A;  1ZBF A;  2B4J A;  4NCB A;  2ZD1 A;  3LP2 A;  3HL8 A;  4O5B A;  2EHG A;  4CF8 A;  5KRS A;  3U6F A;  1LV5 A;  4FW2 A;  3OYN A;  1KVA A;  2YKN A;  2Y1J A;  2G8K A;  4F8R A;  4ICL A;  4B3O A;  1EKE A;  3KLI A;  2PYL A;  4CK2 A;  4DU3 A;  1TVR A;  2FBY A;  1LW2 A;  1JLF A;  4JS4 A;  3NAE A;  2PZS A;  3JYT A;  3NH0 A;  4FM0 A;  1WAJ A;  1ZYQ A;  2Z1H A;  1K6Y A;  3VQP A;  3KK1 A;  3D0P A;  4J2D A;  4B9U A;  1TKX A;  1VSL A;  2YNH A;  5HBM A;  2O4I A;  3KKR A;  1WSI A;  3AO1 A;  1U49 A;  1QSY A;  4I2Q A;  1IKV A;  3AVM A;  4CGG A;  1EXQ A;  3TAQ A;  3DLG A;  4OPJ A;  2GUI A;  4OKK A;  4E1N A;  1Q8I A;  4LH4 A;  2HHW A;  3OYD A;  4DSE A;  1X9W A;  2HW3 A;  1QTM A;  2HHT A;  1KFD A;  3OYH A;  2RKI A;  4DTU A;  4ELU A;  2PY5 A;  5HRS A;  3LPT A;  4E7H A;  1NK5 A;  4H8K A;  5JS1 A;  1SL2 A;  1S1X A;  2RF2 A;  3VQ9 A;  1ZBH A;  4BDZ A;  1Z26 A;  4IG3 A;  4ZTF A;  1D9D A;  3SQ2 A;  3PO4 A;  3HJF A;  4I9L A;  1TL1 A;  2EX3 A;  3DRS A;  3SYZ A;  3IS9 A;  2Y1I A;  2BGG A;  4Z0U A;  3MXI A;  2QKK A;  1NK4 A;  4CIF A;  4CGJ A;  3SUN A;  1JLE A;  3OYM A;  1EP4 A;  4M45 A;  2XO7 A;  4ZTJ A;  4FJ5 A;  2FBV A;  4RW6 A;  3HVT A;  5HRO A;  4CGF A;  4I7F A;  3O3F A;  3QEW A;  4O4G A;  1EET A;  2P51 A;  1UWB A;  4DTP A;  4QCL A;  3AO2 A;  3AVL A;  1RT6 A;  5KTQ A;  1KTQ A;  4JRQ A;  3VQ6 A;  3T1A A;  3K57 A;  2IDO A;  1Q9Y A;  2P5O A;  4YFU A;  4FJH A;  4M3W A;  4HUE A;  1JLC A;  4CJQ A;  5J2Q A;  3RMB A;  1UA1 A;  4HVJ A;  3UIQ A;  4FJX A;  4DFK A;  2OPR A;  3RTV A;  4M3Y A;  1BCM A;  1RT7 A;  2QXF A;  1I3A A;  2D0A A;  3CG7 A;  5KGX A;  2IGI A;  1FKP A;  1IO2 A;  1C0U A;  3DI6 A;  4Z4C A;  3EY1 A;  1L3V A;  3PX0 A;  1U47 A;  1U48 A;  4DFJ A;  1NJZ A;  4KI6 A;  4FM1 A;  3PX4 A;  3ZCM A;  2F8T A;  4FK2 A;  4KHS A;  3DMJ A;  2X78 A;  3RMC A;  4DU4 A;  3SPY A;  4CJV A;  4K8X A;  4DS5 A;  4B9N A;  3QO9 A;  1S5J A;  3O3G A;  1MU2 A;  2XHB A;  4KHU A;  1VSH A;  3VA0 A;  1RT2 A;  1HNI A;  2G8H A;  3NF9 A;  4FJJ A;  1CLQ A;  2A1R A;  3M8Q A;  4CF9 A;  3AVJ A;  2G8F A;  3ZSZ A;  2HVI A;  1GOA A;  1RTJ A;  4FJI A;  1SKR A;  3NFA A;  1DTQ A;  4O55 A;  3AVI A;  4DQQ A;  1HJR A;  3SJJ A;  4FJG A;  1BQN A;  4WE1 A;  3G10 A;  2X74 A;  3B6O A;  3C6T A;  1ASW A;  1FXX A;  3SV3 A;  1U4B A;  2Z1J A;  3M8P A;  5J2M A;  4KB1 A;  1C1C A;  1JLB A;  1KVC A;  5DMR A;  4DSL A;  4KTZ A;  3TWH A;  1ZBU A;  3MED A;  3D45 A;  3QNO A;  1N5Y A;  2XY7 A;  3NF8 A;  3DLR A;  3HPH A;  4EP5 A;  3ULD A;  3B6P A;  5CYQ A;  4BE2 A;  2HMI A;  4EZ6 A;  3AVK A;  1S6P A;  4AHV A;  1C1B A;  4AHS A;  4BE1 A;  4KTW A;  4B9V A;  4M3Z A;  2KTQ A;  3C94 A;  2P1J A;  1XHZ A;  2IS3 A;  1TV6 A;  1RBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...