3ZTBA

The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
113
Chain Sequence
RVPILKVDDYWVVAIEETLHDQSVIQFKEELLHNITGVAGKGLVIDISALEVVDFVTRVLIEISRLAELLGLPFVLTGIKPAVAITLTEMGLDLRGMATALNLQKGLDKLKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-SIGMA-FACTOR ANTAGONIST (STAS) DOMAIN PROTEIN
publication title The Bacterial Stressosome: A Modular System that Has Been Adapted to Control Secondary Messenger Signaling.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Signaling
total genus 30
structure length 113
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3ztbA00
4QTPA 3IH8A 1H4XA 3ZTBA 1BUZA 3IHBA 3IF5A 1TIDB 1THNB 1VC1A 3IH9A 5EUZA 1TH8B 5EUXA 4DGFA 3T6OA 4HYLA 2KA5A 5EUWA 3IHAA 3LLOA 3AGDA 3OIZA 1H4YA 3ZXNA 3OIRA 3MGLA 3AGEA 3NY7A 1TILB 5EUSA 1T6RA 1SBOA 5EUUA 2VY9A 2KLNA 4XS5A 5EZBA 3LKLA 4DGHA 1H4ZA 3F43A 1AUZA
chains in the Genus database with same CATH superfamily
3IH8A 3GK7A 3ZTBA 1FC7A 5EUZA 4HIZA 3V8VA 2KA5A 3D3UA 3LLOA 3AGDA 1H4YA 3OIRA 3MGLA 2OASA 3AGEA 2ZO9B 1HF2A 3GVLA 4QTPA 1FC9A 3EH7A 1H4XA 3DJAA 3GHFA 3IHBA 1N6DA 3IF5A 1TIDB 1TH8B 1V0EA 2ZOAA 4GHNA 3OIZA 3ZXNA 1N6FA 1FCFA 1WXXA 1WXWA 4DMGA 5EUSA 3DUPA 3F43A 1K32A 3C0KA 3LDFA 1BUZA 1N6EA 2DXNA 3IH9A 1VC1A 4DGFA 3T6OA 3D03A 4HYLA 1J7XA 4L1CA 3NY7A 1FC6A 1TILB 1T6RA 3GVKA 3QDQA 5EUUA 2VY9A 3VSEA 3GMFA 4JC0A 2RRLA 5EZBA 3JU4A 3LKLA 2DXLA 2CWWA 1AUZA 3GVJA 4L8KA 4AE2A 3DORA 4AEJA 1THNB 5EUXA 2AS0A 2B78A 5EUWA 3IHAA 1SBOA 1V0FA 3MOGA 3V97A 1BPLA 2KLNA 3K50A 4XS5A 4DGHA 1H4ZA
chains in the Genus database with same CATH topology
4QTPA 3IH8A 1H4XA 3ZTBA 1BUZA 3IHBA 3IF5A 1TIDB 1THNB 1VC1A 3IH9A 5EUZA 1TH8B 5EUXA 4DGFA 3T6OA 4HYLA 2KA5A 5EUWA 3IHAA 3LLOA 3AGDA 3OIZA 1H4YA 3ZXNA 3OIRA 3MGLA 3AGEA 3NY7A 1TILB 5EUSA 1T6RA 1SBOA 5EUUA 2VY9A 2KLNA 4XS5A 5EZBA 3LKLA 4DGHA 1H4ZA 3F43A 1AUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTP A;  3IH8 A;  1H4X A;  3ZTB A;  1BUZ A;  3IHB A;  3IF5 A;  1TID B;  1THN B;  1VC1 A;  3IH9 A;  5EUZ A;  1TH8 B;  5EUX A;  4DGF A;  3T6O A;  4HYL A;  2KA5 A;  5EUW A;  3IHA A;  3LLO A;  3AGD A;  3OIZ A;  1H4Y A;  3ZXN A;  3OIR A;  3MGL A;  3AGE A;  3NY7 A;  1TIL B;  5EUS A;  1T6R A;  1SBO A;  5EUU A;  2VY9 A;  2KLN A;  4XS5 A;  5EZB A;  3LKL A;  4DGH A;  1H4Z A;  3F43 A;  1AUZ A; 
#chains in the Genus database with same CATH topology
 3IH8 A;  3GK7 A;  3ZTB A;  1FC7 A;  5EUZ A;  4HIZ A;  3V8V A;  2KA5 A;  3D3U A;  3LLO A;  3AGD A;  1H4Y A;  3OIR A;  3MGL A;  2OAS A;  3AGE A;  2ZO9 B;  1HF2 A;  3GVL A;  4QTP A;  1FC9 A;  3EH7 A;  1H4X A;  3DJA A;  3GHF A;  3IHB A;  1N6D A;  3IF5 A;  1TID B;  1TH8 B;  1V0E A;  2ZOA A;  4GHN A;  3OIZ A;  3ZXN A;  1N6F A;  1FCF A;  1WXX A;  1WXW A;  4DMG A;  5EUS A;  3DUP A;  3F43 A;  1K32 A;  3C0K A;  3LDF A;  1BUZ A;  1N6E A;  2DXN A;  3IH9 A;  1VC1 A;  4DGF A;  3T6O A;  3D03 A;  4HYL A;  1J7X A;  4L1C A;  3NY7 A;  1FC6 A;  1TIL B;  1T6R A;  3GVK A;  3QDQ A;  5EUU A;  2VY9 A;  3VSE A;  3GMF A;  4JC0 A;  2RRL A;  5EZB A;  3JU4 A;  3LKL A;  2DXL A;  2CWW A;  1AUZ A;  3GVJ A;  4L8K A;  4AE2 A;  3DOR A;  4AEJ A;  1THN B;  5EUX A;  2AS0 A;  2B78 A;  5EUW A;  3IHA A;  1SBO A;  1V0F A;  3MOG A;  3V97 A;  1BPL A;  2KLN A;  3K50 A;  4XS5 A;  4DGH A;  1H4Z A; 
#chains in the Genus database with same CATH homology
 4QTP A;  3IH8 A;  1H4X A;  3ZTB A;  1BUZ A;  3IHB A;  3IF5 A;  1TID B;  1THN B;  1VC1 A;  3IH9 A;  5EUZ A;  1TH8 B;  5EUX A;  4DGF A;  3T6O A;  4HYL A;  2KA5 A;  5EUW A;  3IHA A;  3LLO A;  3AGD A;  3OIZ A;  1H4Y A;  3ZXN A;  3OIR A;  3MGL A;  3AGE A;  3NY7 A;  1TIL B;  5EUS A;  1T6R A;  1SBO A;  5EUU A;  2VY9 A;  2KLN A;  4XS5 A;  5EZB A;  3LKL A;  4DGH A;  1H4Z A;  3F43 A;  1AUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...