3ZTNH

Structure of influenza a neutralizing antibody selected from cultures of single human plasma cells in complex with human h1 influenza haemagglutinin.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
219
structure length
173
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYAMHWVRQAPGKGLEWVAVISYDANYKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSQLRSLLYFEWLSQGYFDYWGQGTLVTVSSASTKGPSCLVKDYFPEPTFPAVLQSSGLYSLSSVVNHKPSNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Neutralizing Antibody Selected from Plasma Cells that Binds to Group 1 and Group 2 Influenza a Hemagglutinins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords HAEMAGGLUTININ
total genus 32
structure length 173
sequence length 219
ec nomenclature
pdb deposition date 2011-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ztnH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ztnH01
3ES6B 4ZFOL 2EZ0C 4NDMB 3SKNA 1Q9WA 4MNGE 1BQLH 5IR1B 1R3HB 3GRWL 5H94A 3O4LB 3EO1B 4XVJH 2FX7L 2Q8AH 1P4LA 3F58L 4PP2B 5HGHA 4A6YA 4J7RA 5C07D 2C7UB 1Q0XH 1DQLL 1F2XK 3SQOL 4MNQA 5FCSH 3S97C 4F7TA 3O6FA 1S7XB 4LAQH 3TIDA 4NNYB 3HB3C 5EOQH 3QWQB 4K8RL 1OW0C 2YRPA 4YHOL 4L4VE 1FGVL 3AM8A 4OCYH 3WNOA 2ORBH 5FGBC 5JDJA 1LDPH 3QEHA 4NZRH 2V2WA 4WU7A 4NRYB 2CQVA 3KPRE 3MLUL 1CF8H 4LLYB 5IMKB 4K7FA 3MRBB 5E5MB 3RHWF 1EK3A 1HWHB 3EW3B 3OBAA 2V17L 2BVTA 4X4XB 4XPTL 3ZE1F 1WBYB 2BNQE 4MCYA 4NWTH 4Z7VA 1RFDH 5I30L 4E0RB 1N59A 3TO4D 1L7TL 1HQRB 3X11A 2GHWB 2X42A 1TCRB 3TYFB 1M7IB 4HS8L 4Y7MA 1INEH 2JCCA 3BPOB 2AQ1A 5E0QA 3FTGA 2NY3B 5CCKH 1X5KA 3MOAL 3PWNB 4MD5A 4Q0XL 5B4MC 3RBSA 5T3XE 3AS3A 1CFSA 1S9XA 2ZOLB 5GJTL 1IQDB 1IGFL 3T65A 4P99A 4Z0XA 5DD3H 4MVBC 1KJ2L 4ONGH 4XMKL 5D1ZC 4KK5C 4F7CB 1ZGLA 4S1DD 2Q76A 2XA8L 4Y1AB 4DGVL 3IFOB 1CXFA 4M9PA 3KGRA 2WWKO 3FO2B 4N9OB 3REVA 5CIPH 4MJ5A 1MFEL 3IDNB 5DHYB 2WUCH 3QA3A 3P40A 1S7SB 4KQ4L 1WFOA 1A6PA 1AD9B 4HH9B 4NNXB 4QRSA 5EZJA 3GSNB 5C07A 4NWUH 5GRUL 1KTKE 1S7TB 5C6TL 1HYSD 3ARQA 3HPLB 4DUWA 1YY8B 5INCB 2VDML 2NY4B 1M05B 5C0DA 5IJVA 4R90L 1MHHB 4JKPH 2NNAB 4Q9CA 1S7VA 2FECL 4OCSH 4AYFA 2IAND 5HGAA 4OZIF 2ENSA 3BESR 4MQXC 2M26A 4LP5A 4ZUWB 3OF6A 5HHQA 4OQTL 5K9QG 4M93C 1C12A 1IAKB 1ACYH 1RHHB 4QHLB 1IGJB 3WUWA 3VWKB 4X7TB 4OTXH 3D85D 3DV4A 2DQIL 4BZ2H 3MJ7A 5TDNB 2KUTA 2YWZA 2GJ6A 1TPXC 5LKNA 5I6XC 3DX7A 4PGCB 4DKAA 3VXPB 2XZCL 4OLXL 4R7NB 2X70A 2FO4A 1JF6A 4C56E 2P48B 3ARFD 1F4YL 3U6RA 2J8UF 4TNWK 4XHJD 5EO0A 1JWUA 1ROWA 4WO4D 1MCFA 2C9AA 2DL2A 2WW8A 2AK4B 4HKXA 5EA0H 1PW3A 4U3XA 1AQDA 1E4XI 3EYUH 1PQZB 3WIFB 5B8CC 4LSSL 3HC3H 2ESVA 3BPCB 3V4VL 1QFWL 4OFPA 4HIEA 4L4VB 2Z93A 4P2QD 2WINB 3BD3A 4YBLB 5IJKA 3HUJA 4Z7UB 3X14A 4X6CB 1TTFA 2F8VA 1W2KT 3ARFA 2V7NA 1MJ7L 3QP3A 1JZ5A 3T1FA 1J1OH 3VFRA 1CT8B 1GVIA 4O58H 3ZE1E 1B0RB 3DUSB 2BOCA 3NN8A 3GJFK 4ZXBC 2VLJB 3SKOB 4Y8AA 4PB9L 4UDUA 3OKDB 2ZNXA 1G7IA 3RJDA 3G9VA 3L3GA 1ZANH 3DSFH 2NXZC 4JFOA 4LVOB 2BSRA 4OBRA 5D71L 5B3JF 2F74A 5HI5C 1IM9A 4PGBB 4XVTL 3OX8A 5GIRB 2A74B 3RTQB 5HHOE 5IK3B 3PP3H 3MV9B 4Y4KD 4YHMH 2FGZA 4PJCE 4I1NB 2XOTA 2KZWA 1INDH 2IFFL 5IBLC 1IAOB 4JEGB 4UU9A 5D5ME 5F6IC 3RZWA 3GHBH 2EYSB 5JHDB 2FRGP 4L9DA 4JVWA 5A2IH 3ARTA 5FYKH 3BKCL 3MROB 1HSBB 5HXMA 3JTTB 2QQNH 1UKQA 2LAAA 3U7YH 6FABL 3MROA 3SCMC 3V8OA 3FO0H 4AM0A 4RIRB 1X44A 2JCCB 4U1KA 1MRCH 2AK1L 3ARWA 4RAHA 3TWCL 1AE6H 1IAOA 4D2NA 1AR1C 3AU1A 3MV8E 4X8JA 4JO3L 5DJ6B 1YYML 3QXDA 4LCIH 5DQJB 3LKRB 1A7BA 3CFKB 4HBCL 4K71B 4P2OC 5FOBA 4AL8H 4QGYA 4WW2B 3U9PL 1KCUH 3QQ9D 3TNMB 5FO7B 2VZOA 1TJGL 1KCKA 3O4OC 3EYQD 5F7EH 4OZGA 4JFFE 2VR5A 1T2JA 4UDUB 1EHNA 3NN8B 5AG8A 3HRPA 3CZJA 1OD9A 4LLVB 4G7YL 5AUMA 2WIIA 1HWGB 4HAGA 3EHBC 3FONA 1OWRM 5GGUA 3RUGE 2V7NB 3RVVD 1IILE 4YFLI 5J7CC 2A38A 4L8BA 1IC5L 5C0JB 4P23B 1KC5L 2C3VB 4M43H 3QDGD 4DGVH 3DPBA 1U3HB 2MHAA 4X6BB 1PKQE 1CDCA 2QHLA 3I75A 1Z0NA 5E5RB 4ONGL 4XMKH 4DFHA 4LHUA 1DQDH 1X3DA 2YD3A 1CFSB 3ES6A 4PB9H 5CUSL 1BD2D 4IRSB 5DUPH 3LS4L 4JM2C 2E5EA 1YJDH 4XZUB 4U6XA 1EJ6A 1NH6A 1AXTL 4DVRH 1M4KA 1GGTA 5D2NB 1K4DB 1JMZA 5C09D 5D7JB 5TH2B 1VDGA 2FX9L 2PUQT 3FN0L 5GGRB 5IOPB 1A64A 3P77B 1CLYH 1HCVA 2FIKA 4E41D 4M6OL 2BVQA 3MXWH 1INEL 2IPKB 2R1XB 4X6EA 4NNPH 4U1IA 2XWJB 4UNVA 4TULH 2DB8A 2FEDC 2GK2A 3D2UD 5JW3L 3QDME 2FO1A 1VFBB 4HWBL 1AP2B 4WU7B 4PRIB 2JCCF 4PY7A 2EDLA 3P4MA 5IG7B 1RMFL 4PJIE 4UTBL 5F1KC 3QIUB 2FYYB 1ZT7B 4Z7NE 4Q9QH 1D9KA 1RIUL 2DYPA 1MHCB 2PR4L 3MCLL 5JW5A 5KZCB 1P69B 3SE8H 1MCWM 1FQ9C 3BKMH 5JXAL 1KB5A 5HHMB 5EWIH 1GZQA 1IBGL 2DS4A 1HI6A 4OJFH 1UGNA 1H8SA 3L6FA 3OJVC 4OLVL 5F7KC 1RUQL 4X7EC 4ODXA 2EC9U 2RGSA 3CSPA 4LHJB 3FMGH 1U8QA 4ENED 4CDGC 5EU4B 3O8XC 4OD1L 4WTZA 4GAJL 1L0XA 3PIQB 4UQ2B 5C6WH 2HKFH 4L9LC 3RGHA 5EORH 5C0AE 4F3FA 3UJTL 3EJYC 4V2BA 2XYCA 1MCOL 4JDVA 1P1ZB 4YDLC 4CVUA 2CKBL 4NO5B 4C57C 3CH1A 1G7PB 1QSEE 4M1DL 4Z7VF 4OV6F 2DQUH 1Z3GL 2R1WA 1DN0B 4JKPL 3IDIB 2OSLB 3RY6C 4X7SL 4YE4L 1Y6NR 3B3IA 3H8NA 3F12A 4MWFB 4F7PB 1FPTL 1KG0A 3RTQC 25C8H 1J8KA 2AV7A 4ZFFA 3N1GC 1QUNA 4RGNC 1FAKT 3TBTA 2CUHA 3LKOB 5E2WL 3MJ9L 1RJYB 1RK1A 4LARH 4R2GC 4PJDE 2IMMA 3GBML 3W39A 4LSQH 1QLRA 3DBXB 4RBPK 4NC2B 2BVOB 4KVNH 3BI9X 1IEAA 4FZ8L 4OKVA 5DJXB 1AGBA 1FYTA 3PDDA 4FZEL 1B4RA 2WUBL 3NFPB 1EJOH 2R39A 4YDJB 4X8JB 3TBYB 5KVEL 1OAXL 1IFHH 2FYYA 1XH3B 1R3LA 3LS5L 5KOVC 5GS0H 5D8JL 4DQOL 4OM0L 1H0DA 3JTTA 1CVSC 5C0AB 4QGTA 5B8CB 2GFBB 3UAJC 4X0KB 2GCYA 4PJXB 4HK3J 4OZIB 4AH2A 4IRJD 1T7XA 1TXKA 1L7TH 1EUUA 3QPQD 3P77A 1IAIM 5J1AB 1EUTA 1HHKA 2QEJA 2ADFL 3T2NL 5BQ7B 5HYJD 4XC3H 4PJGB 1Y6KR 2CRYA 5DRZB 1PG7W 3AXLA 1PX4A 3RIFK 3U7AA 5BW7A 2K3TA 3B6SA 3BQUA 2F9BT 5F7DA 5JMRA 2B2XH 1KTDA 4Y4FA 3QDMB 1WGOA 4FFVD 2VXUH 1I3GH 5BOZG 4ZNCD 3IETB 1IGTB 1T3FA 1ZHLA 5FGRA 5TQ0H 5D2LA 2I9LA 1EVTC 1FDLL 5H37G 4DGYH 1BD2B 3S37X 5HTSA 5C0IB 4MB3A 2KL6A 3ZHDA 1PG7X 1ZT1A 3FN9A 2VL5A 2DBLH 5IKCB 1A3RL 3VXSB 2XY1A 4XCCH 4PLKD 5B38A 3BE1H 5L9DL 2FLRT 2W0LA 1I9RH 4U05A 2ADJA 4Q7DA 1AFVL 4X7DC 3V6FB 3EUUA 4OSUH 3MQIA 2AJZB 4AENA 3H3PL 2A73A 3CFJB 3I02B 2VQTA 4ZFOA 5T1KD 1AO7D 4HK0B 5DJ6A 1JYNA 1LNUB 4KVCL 1R6VA 2IQAB 2IBZY 1MSPA 4G6JH 3KR3L 1NCCH 3GHEH 4LSUH 3FFCB 5BV7C 4J3XA 1WBZA 3RA7H 1CN4A 2R4SH 3SE9L 4QTHA 1LO4L 2J88L 4QOKB 5FIEA 3MJ9H 2OK0L 4U4BA 1ZKAA 1JV5B 4IRJA 3MLWL 3CFCH 3HZKA 4OFYD 2O5XH 1FFRA 4D0CB 5GGQL 3WFEL 4XP1L 4HQQL 1WC7B 1JPFA 4Q6IB 4G8EB 5ICZA 5JOFA 1SJHB 3UYRL 5CGMA 1OGAD 2B0SH 5LGHL 2CXGA 2AEPH 4NQDB 1JZ4A 4LIQE 5BJTB 2VISB 1OARL 4F9LC 3VMNA 1P7KA 5C0GA 4O2EB 1S7SA 3I2CH 3P9MA 3R8QA 2Y25A 3D5OF 5CJOH 3MZTA 1UWEL 1I3GL 4K55A 5KVGH 2NX5D 2YPLA 4HFUL 3KJ4B 4LLWB 2JJTC 3UBXB 3VXUB 1INQA 2Z9TA 4NKIL 1SYSB 3HCVB 4FABL 1UXWA 3KHOA 1T7YA 3DVNA 3G5ZA 4CDHA 1NFDA 2I07B 5DZLA 1U58A 4G7VL 2K7QA 2EIDA 4LLAA 4TYUA 3FFCE 3PWJA 5E56A 4HF5H 3E3QC 3FTGB 2GY7B 4RX4D 5IB4B 3EYFA 4UOW0 5K9JL 4K3EL 3NCEB 1QO3B 1WF5A 2H2PD 3ZTJG 4EN3B 3INUL 5I2IA 4O02L 4RAUB 4P46A 4ZAKA 4GW5B 4MA8L 3TIEB 1SQ2N 2BVPB 1N5YL 3F7PC 3ULUL 3TEUA 3QDJE 1YEIL 4YPJA 1YEDB 2FLBT 3PJSA 2ZSWA 3CSYB 5D9SA 1Q72H 4R7DA 2C1OB 3DV4B 3QUXA 3AAZA 5CZXD 2XQBL 2UWEF 3FO1A 3B5HA 1T0NA 4Z7QF 3FRPA 3UPAA 1QRKA 4P3CH 1YJDL 1H9VA 1CICD 3CDGB 1R5VA 3V5KA 1N0XL 3LMJL 3BUTA 4JE4B 3WXVL 3WO4B 4ONOA 1CD8A 1SM3H 4DEPB 4PP1D 4NZUH 1DLFH 3QIBA 1KN4H 3O3AA 1MFNA 4C83B 3SJVB 1JGDB 1YN7A 1MHHA 3PWUA 2WK2A 5MP6H 1LO0L 4F9LA 5A16B 1OSPL 1KJMA 4HS3A 5I19H 1AHWA 4ELMB 5SX5K 2NW3A 3KLHC 2DQGL 2XZAH 3MRIB 1YEEL 3V2AR 2R29L 3G6JB 3BKJL 3DMMD 4ZFGL 2HJFB 4S1QL 3O11B 1HHIB 5F7EL 1BBJB 4P59L 1F4AA 4GRMA 5DHVB 1A7RH 3P0YH 2WP3T 4HX1A 4Z0XB 3LSOB 1DE4A 1GOHA 4PV9B 3VA6A 3LEYH 1LEIA 5I75C 1WFTA 2VDLH 5HHXL 4APQA 1EXUA 4UT7H 5JW4M 5KSVB 3MRNB 1LP9A 4JFPA 3RWFB 1XGRA 4OJFL 1UXSA 5FFLA 5EO1A 2VB5A 4L3EB 5HYQB 3NA9L 3OHXB 3UDWA 4EDWL 4M48H 5DTFB 3OKMB 4MXWL 3VXSD 3UPRA 1D6VH 4PJ8C 5HDBE 1U8IA 4Z7VB 3PNWB 1A02N 2UZIH 5EIQA 3G6AA 1NMAL 2HT4D 1EEZA 2R0LH 4CL7A 4OZ4A 3RU8H 3QEHB 4PUBH 3QIBC 1PKQA 1CE1L 3KLSA 1I9JL 4TVPL 4UT6H 4JANA 4MA3A 3O2DA 1UKSA 1EGJA 3LDBC 3CFDB 5DMKB 3WN5B 2EDDA 3TO4A 1G7MA 2GK0B 3CCHA 2OL3A 5MERB 1U93B 4OV5B 3H7BB 5F7FA 1FG9C 4PRHB 1J0JA 3H9YA 4N0RA 1A14H 4XVUC 4A6YB 1JTPA 4ZFZB 3FQNB 2R15A 3RVWD 3QT2A 3O9WB 3VFSB 5E2TL 3KPSE 3C5ZD 3EOBA 4XPGL 1PDKA 4PJAB 1IAIH 3O4LA 4K2UL 3O8XA 5CEZE 2R0LL 3V4VH 5KS9F 5CZVH 1M71B 1BVKB 1OAQL 1M6OB 1ZSDB 2OJEA 1GH7A 1CG9B 5DZNA 1FZKA 3K8MA 4KMQA 5GISL 5EOTA 2FNBA 2VXTH 1XF2A 2ZKHL 3U48A 3SCMB 2EYTB 4G7YH 1I8LC 3K4ZA 3ZDZF 4ETQA 1NCBL 1MY7A 3RWDB 3FQWB 4NIKB 2NY0B 5T3XL 4F8QA 3PP3K 3VWJD 3TJHC 2BC4B 3SJVA 3TN0B 3MPCA 1HIMH 2KQNA 1IMHC 1T7VA 4RRPG 4DZ8A 3ARBB 5FV1L 5GS1A 3INUH 1U91A 4YX2L 1K5NB 4N8VA 1A7RL 2VLJD 3WCYA 1RZFL 2A9NL 4JKKA 1EZVX 1S8DB 4QRPB 5HYSG 1BFVH 3LB6C 4HV8B 2JK5B 1WQVT 3U7YL 1HZHL 2EIZB 2DIAA 5JQHC 2LFGA 2IALB 2NXYC 4ONFL 4UV4L 4XC1H 2IH3B 3KPOA 5JDSB 4OIIL 1GGBL 1FV1A 2IQAA 5L2KD 3OTTA 1FAIL 4W70A 3CXHK 4U7MA 1NGQL 5DD5L 2Q7NA 2G9HB 1A8JH 3EYFB 1WV7T 3TVMA 5J13C 4GMSL 2DQJL 4QCIB 2IMNA 1O0VA 2X05A 3VI4E 3ULSB 3PDGA 5H35A 1AQKL 3MV11 4L3EE 5EDXA 3P4NB 3PL6C 1T1ZB 4LBEB 3WKML 3HCVA 1IGIL 4NQEB 3RWCB 3VXUA 4M8VA 1U8OA 5LWYH 1G84A 1PEZA 2B0SL 3K2MC 1MCWW 1F4XH 1A6VH 4P2QA 1HINL 4L1DA 3DXAE 1DP0A 3FHQA 5F7MC 4KTYA 1CDHA 1XIWD 2VERN 3GBLA 3LHPL 4WI7A 2FD6H 4U1SA 3DROA 3P2TA 5MI0C 4XX1G 4WEBL 5J3HD 4MXQD 5FYKE 3W2DL 5A40E 3W9DB 4PJDB 1NL0L 4FZ8H 4KRMB 5IEKB 3ULUC 4Z18A 3WUZA 2IANE 1DL7L 2J6EL 3GMNA 5GZNC 4XNZC 5JIHA 4NQDA 3MYZA 2OK0H 5M94B 1NMCB 3JV4B 3WLWC 1YEHH 1MFAH 1I8IB 5BRZA 4OB5L 1L0YA 4M00A 3B43A 3WDHA 5J0BA 1KJ2A 5KBNC 2YN5A 3U79A 3O6LL 4ZO8A 4ZSOA 4G6MH 4FQPA 3OB0K 2I9TB 4ZPVA 3KYOB 4FXKB 5I0ZA 5JHDD 4JFZL 5K9KA 3AS2A 1A6ZB 1YEFL 3AS0A 4EI5C 2X4SA 1X5JA 2R8SL 4G8FB 5I8CB 2R2HB 1KEGL 2IH1A 3VFOB 4QRPD 5EIIA 4TQEH 5DVMA 1F02I 1Q9OA 1W8OA 5C09A 5E6IC 5C0FA 3WIHA 2HRPL 3KPLA 5JDSA 3L3KA 1R3LB 1I3RA 1TZHA 2AV1B 4A2LA 3TN0D 4TSAL 1UC6A 1UM6H 1FYTB 1QSFA 4OKVB 5DJXA 4G9DB 4HIXH 3B9KA 4TSAH 4GRWB 4LFHD 5JLZB 1YDPA 3OR7A 4PRNB 2OP4H 3BISA 4PJIF 3BEWB 5C8JB 1X6NA 1GC1H 1RJYA 1RUQH 5E9DB 4JY4A 2ZUQC 1EMTH 2ICWI 5DS8A 1HSAB 5DA4A 1A2YA 4ODSL 5I71B 3FQWA 3HE7A 1IAII 5EB9A 1FL5B 3RWDA 5IFJB 4HT1L 1T04B 3M17B 3GHEL 1NGPH 3R06A 1MHEB 3RWHB 3ULVH 3OJ2C 3L3OB 5FKAA 2R2BB 1PLGH 1KTLB 1Z9OA 2CJUH 4Y16C 4NN7B 2QQQA 1WZMA 4NHCL 3UTSB 4FXGB 2OJEB 5DVNA 1KULA 4XI5C 4X6FB 4OCWH 4V1DE 5GS0C 2I60L 5K9QI 1HE7A 5DD6B 3O8XB 5ID0A 3W11C 3MV9D 4HIJB 2HT2D 5KVDL 1Z2KA 2FX9H 3FN0H 4PRPE 3HI1B 1SBSH 4XP9H 5IVXE 3HMWL 3LD8C 4GBXD 1FLRL 1CS6A 2H45A 2IH3A 4F7MA 4RBPH 3FZUD 1N6QH 1CBVH 4QRTB 2CUMA 3CCHB 2A77H 4TVPE 2A6JA 2XT1B 2LABA 4XX1E 5DMYA 5ITBH 2CJUL 4HZLB 1UZ6F 3SKJL 4MB4A 1RAMA 1H5BC 3QR2A 1GZPB 1DBBH 2DMBA 1WEJH 1MEXL 3VGDA 1P7HL 2AJVL 3S35H 1LO2L 4I48A 2YBRA 3PHQA 5EH1A 4PIRF 3TBYA 3BYTA 1ZVYA 3Q48A 4XPAL 2PW2A 2VZSA 4G6FB 3DXAA 2GJ6D 4JZJA 4RWHA 5C0NC 5SWZB 1QLRB 3HNVH 2V5MA 5F9JB 1FVDA 2YHGA 3NCMA 4KMTL 4GBXC 3GMMA 4UAOB 3WLWD 2IPUG 4YEFA 3I3EA 2F54D 2H1PL 2VYRE 1JUFA 2B7DT 2H2SC 2VLKB 3OKEB 3ROOB 5JOPD 3UTSE 4XXCC 1TZIA 3KPMA 4LSTL 1AGEB 4U0QB 4MVBD 2MFNA 3QQ3B 3H9ZA 3D39D 4P4KB 3KAAA 1OGAB 2VITA 3HAEG 2HLFD 4MWFA 1J88A 5D7LE 3VXMD 3B3IB 4AQ1B 2AK1H 5F1NA 3DECA 2XZZA 3FFDB 1LMKA 4JAMB 4NHUB 5C0JA 4M62L 1D5IH 4Z78B 3GIVB 4OF3A 3QFJE 4OCMC 5F6HJ 5FYKL 2R1YA 2X89D 4JPWL 2VLKA 3TYGH 3VD7A 1OGTB 4XMLH 3DX6B 3DARA 4GKSB 4O5LH 4P9HL 5FGBA 2VZUA 3MFGB 4OUOA 4KKLD 5JUEH 1K3ZA 4LOUC 1ADQA 1MFAL 5DK2B 5HHNB 1RMFH 2BFVL 2XG5A 2G60H 4QY8B 1CXIA 3WFCH 1MREL 3FJTA 3IXTA 3G6AB 4S0TD 4L1HA 1TDQA 5FYLL 25C8L 2PXYA 3SGKC 2XPGB 3IU3B 5GGSY 4YHZL 1CD9B 1WCBA 4H25B 3RWEA 3RI5F 1OP3K 4HWEL 2FD6L 1T1YB 4Y2OA 5C0BE 1R24A 1BECA 2Z91A 2WMPA 3O4LD 4K7PH 3T3MF 2CK2A 1WJ3A 1MJUH 2FJHB 3QI9B 4I0PB 2DQUL 4YPGA 3RNQB 1MLBA 3NZ8B 3RKDC 3VGEA 3QDHA 1MRFH 4YBQD 3LKSB 5DJZA 1W72H 1XCTA 3CDCA 2X1OA 4DAGL 2HKFL 3TIEA 4PFEA 3LY6A 3SO3C 4YR6B 4PV9A 4KHXH 4BH7B 3GMLA 4GQ9L 3MRLB 3P30H 2BSED 4XP4L 1I85A 4PB0H 1XGUB 4Y4HD 5ESAB 3LEVH 4MQSB 2ZUUA 4KU1A 5CJQL 2HFEB 1UVQA 5FYJE 3BPNC 4Z78A 5JORB 4TUOA 3L3OA 2VLRD 4QXUH 4POUB 4NN7C 5IM7A 3UJJH 5L2JA 4P4KC 5FYLD 4PJIA 3MNVA 2C3VA 5FUCC 4N0UE 3V5DA 1FL5A 4MAUH 2GJZA 3MO1A 4JFHD 4U1JA 1U41A 5C71A 4TULL 4FQ2L 4KKNA 1NAML 5LVEA 1HSAA 1F4HA 5ALBH 1T83C 1MCCA 4HCRL 5AUMB 1YYMH 4MAYA 4M1CD 4LSDA 4ALAL 5J89A 3GMRB 1ZT4B 5IQ9B 1DANU 1J8HE 3IGAB 5I1EH 1U6AL 2B1AL 3MJ8A 4ELMF 3ZLQC 4RFNB 5IW6A 5GHWH 1CU4H 2OZ4H 3GBNH 2EH7L 3RPIB 3GO1H 1FL6B 4N1EA 1IZJA 1RULL 4TUJA 4EN3C 4X9FA 3RGVA 2YBRB 4KRLB 3KPLB 4KK5D 2BVPA 2ED9A 5DWUL 1NC2A 1RZ7L 2ZOKB 3MNZA 3FOLA 5ESVB 3HG1E 4U1KB 2A1WL 2BZDA 1LO0H 1XF1A 2R23B 7FABL 1KJ3H 3QULA 4IOFD 5GS1C 1RZ7H 4I18C 4GRLB 4K7PX 4DKFL 4QTHB 2PN5A 3QJHB 5IF0A 4JRYD 5CFHA 3LQZA 3FFCA 4S0SD 1CGSH 4NZUL 2EYSA 3B2VL 4AEHL 4JJHA 4QTIL 4UQ3B 1KPRA 5CEXB 3QWRD 5GGSB 1N6QL 1VEMA 4NRXA 1CBVL 2ED7A 4CVXB 1G9EA 2N4IA 4YNYA 2ED8A 1T83A 1OM3L 4HUVB 3BXNA 1Q72L 2Z31A 1A9EB 3HC4L 3WEXB 3DVIA 5F89B 4ODHL 4OFYA 3G08A 4JFOB 3ZDXE 1N5YH 4PD4K 1XMWA 2DLGA 5FA3B 3DROB 4LCIL 1NKRA 1MCHA 3T4AB 4NNXA 4HGMA 3T77B 4NPYB 3VXRA 1BFSA 1QFWH 5EG6C 2BOCB 4KROB 6CGTA 1T66D 4JO2L 2F53D 1WWWX 4KK8C 1LK2A 5E95B 3ZDYE 5HGDB 2YMXH 1R3IL 1F4YH 3ESUF 2OMNA 5E5UB 1LHZA 4XP5H 5C8JA 1KYOK 3K0WA 1NBVL 3L5HA 3T65B 5I6XB 1AQDB 1MQKH 1FN4B 3WIFA 2C3XA 4HWUA 1DVFA 5D7IE 4B5EA 4IRJB 1UEMA 5I76B 2P5EA 4BYHA 1QSZA 3IU4L 3P0VL 5L88L 5CEXA 1PGRB 4U6HA 3RDTD 1OCWL 2D03L 1LGVA 2J8UA 4GG8A 5CD3B 4EBQL 3ARDB 1NJ9B 3ARGB 4FNLH 5C09B 1T5XB 1WISA 4L9LB 4U1MA 4G5ZH 4OD3H 3VFPB 2OTWA 1RQ5A 4LCYB 5DVOA 1MFCH 4P23C 4PLJC 3S35X 3WFEH 3STLA 4I2XA 2ZPKL 1C08A 4PJFB 1I8KB 4AQOA 4FP8H 3GK8H 2WBJC 3VXSA 2E6JA 4WFGD 2JJSA 3V79C 4NBXB 1NAMB 1MI5A 1KFAH 4KKCD 4M6MH 4H8WL 1KNOB 4JR9L 5MI0B 3P11H 2H3NB 3RWIA 2FEEL 1IGTA 3QHZL 4LKXB 2EDEA 4XMLL 1J8HA 1DVFC 5BS0E 3GSOB 1NL0H 3BGFB 5F6HI 1JNHA 5HHOB 3HA0A 2KH2B 1XF5A 1B6DA 2ICCA 1EFXB 4WGWB 5E99L 5H94B 2MOVA 3CVHL 2XN9A 4IDJL 4FFYH 1LP9F 1YMMA 5DJ0B 1M6OA 1ZSDA 4P4RA 1AFVH 5LGKA 4JM2A 3STZB 1XEDA 2YN3A 4Y5VB 5IB3B 4F7CA 1IGIH 1I7RA 3UX9B 4O4YH 3AB0B 1N5AA 1I7TA 3AVEA 4CNIB 1GGCL 4OUUB 1XIWB 2D0GA 3GIZH 1UH3A 4K3EH 4Y5YA 2H1PH 4OCSL 3SY0B 1KLUA 4DGYL 4JDVB 2LTQC 3MLRL 5KN5A 2DWEB 3QQ9C 1PSKL 4PGDB 3D69B 3TC9A 3C6LB 4CRPA 4MDIB 3SOBL 4GRWH 4OIBA 1KXTB 2E9BA 3IS0X 1LDPL 1HHJB 5CHNB 1KF9B 4ODXB 4LCUB 1P4IL 2W65B 5D70H 4JM4L 4E0RA 3NZ8A 1JZ2A 4PJEB 4HFUH 3KNBA 4ZOCA 1N26A 1F6AB 4K7FB 1MHCA 4XC3L 5IBLD 2X4OA 4UOJA 1L9NA 5DD3L 5BS0B 4WFFD 1OPGH 1IM9D 4WV1A 5IVOA 3PQYB 1A6WL 4HGKC 5KSAB 3E8UH 5GJTH 1FZJB 3MLSH 1BQLL 2D7MA 4HMCA 4XP6H 5E1AA 4F9PA 2AGJH 7CGTA 1RPQA 2VLME 5F71A 1LEIB 5TPWL 3KLDA 3F12B 1U2HA 4U0RB 1OAXH 4XNXH 4X4YA 4ZNEE 5EU6A 2Z8RA 3WNLA 2DDQL 4PJ9A 3FQXA 2R1WB 4CUCA 4H0HB 1HHIA 1CG9A 2HJFA 1DCLA 3QDJA 4P2CG 2DLIA 5I71C 2NY6C 1H3PL 3IFLH 5FM5O 1HKFA 4OFVA 5BXFB 5I1JH 4NZTH 3MLUH 1B0GB 5IIEB 4QWWC 1IGCL 4L8DA 1V3LA 2JELH 1K8IA 3MREB 5L7XH 3IXAA 1MLCA 15C8H 4WW1A 3FONB 2NX5B 1WICA 1JGDA 1MPAL 3SQOH 2DTMH 5E1HB 3BPOC 3TP4A 3QIBB 4UNUA 3B5TA 1K3IA 1RHFA 5AZEH 1LK3H 3HC0A 1SVCP 4HPOL 3AFLA 5ECJE 1HHHB 2G2RA 1C5BL 4OZ4B 2CKBH 4AT6A 1XT5A 1A7QH 4XPBL 1OY3B 2Y7QB 1P6AB 3QO1B 1OQXA 5D2NC 4PJBF 5GGTA 1JF5A 3BKYL 1G0YR 1PG7L 3KYMA 1KT2B 2HT2C 1E28A 1T5WB 4KJWD 1AXIB 2XA3A 3Q6GH 5DJCB 1K4DA 2AJYH 1QBBA 4LDLB 2CKBB 5IB4A 4CVWA 2VDPH 4QHUA 3O6LH 4NCDA 2PR4H 3MCLH 5I75B 4JHWL 3DOSA 3TBSB 3H2WA 1TVDA 2AXFA 3QEUB 5CJBA 4KZEL 1VSCA 2HLAB 4J3WA 5HJ3B 3GDBA 5F7UA 3C08L 1I3UA 3UTPE 1Z0MA 1D9KC 4TTDC 2CMRH 3LN4B 3CFBA 3QDGE 4IJ3B 1S7TA 1SBBA 4R96A 4OM1H 1AJ7L 4NO0A 3SDCA 3QEQD 1G7IB 1OP3H 2W91A 4HXBL 4S1QH 1IC4L 3N50A 1V3KA 4GMTL 5FO8A 5LWYL 3MGOB 5FHBH 3BH8B 3E6HB 4PR5B 4PBWD 4X6DE 3T1FB 1LEKB 1T89C 3QDGA 4KJQD 1DQQB 5E8EA 4H8WC 1U8PA 2VC2L 5B4MD 1FC2D 4Q74A 5JA8B 3F7VA 4R3SA 2W9EL 4NYLB 1UM5L 3BEWA 2AVGA 3BGFC 1IC1A 4PBVC 5T1LA 1KC5H 2H32A 5DGQA 3GSQB 2H8PB 4GXVL 1JPST 4PTTB 4PJGF 4JQVA 2H26B 4P49A 1MJJA 4FP8L 5J8OA 1ZHBA 3ALXA 5EO0B 3EZ8A 1GGBH 4ZODA 1YEDA 3FRUA 5TDOB 4OT1H 5EC2A 5JHDA 4PJBA 2YXMA 1EBPA 3MRJB 1PYWA 4OF7A 3PHOA 4NN6B 5TGBB 3QH3B 4RMRA 2OXHA 3O6FD 3P73A 4YUEH 1J1XH 1HEZA 1KB9K 1DBAL 4O02H 1ZA6A 2ZUWA 1NC4A 2IG2H 2OR9L 4LQ1A 5DJDB 4PJ8D 4Y0GA 4TN9A 3T3PE 4NN5B 1VEOA 3N06B 1QVOA 1KJVA 4H5SB 1WLHA 1NGXB 3HPJB 1TNNA 5LCVL 1S7VB 1B0RA 2VDKH 3VMPA 3VDCA 2UUDH 1EHAA 3GMNB 2EDKA 3ULVC 5ALCH 3TH2T 2JJVA 2BMKB 2YRZA 4I4WA 3HUJB 4KPHL 3W9EB 2ARJA 1CDGA 4Q9QL 2WQRA 3SKMA 3IAPA 4NJAL 2CRIA 2BNUB 3EO1A 2LU7A 3BO8B 3IKCA 2NCMA 4XH2B 3VFGL 3BQUB 3QUZD 4AEEA 3J8F7 3VGAB 1A1MB 4RGNE 1HXMB 3AREB 1PZ5B 4B0MM 2R0ZL 3AXLB 1CLOH 4GSDL 5DRWB 1JFQH 5GRXG 3WD5L 3KPPA 1HXYA 1RIHH 3MRLA 1OAZH 3ARYA 3BQUC 3U9UA 1IRAY 2D4DA 3K2UH 5I1HH 3VXPA 2ZOLA 4M93B 3MBEC 1A6UL 3MRFA 4AIOA 2HFTA 3BH9A 3O6FC 1CGSL 1B4JL 3PF2A 1OTUC 3M1BA 5TJWK 1EAPA 2VUYA 5DRXB 4M6NL 3CVHA 4I3RH 3NFPA 4YDJA 4GKNB 3PWLB 1T1YA 1G9NC 3O9WC 1OTUD 3GZKA 1WBYA 1J87A 4OLWL 3IU3A 4X4XA 4G43B 4KTEH 1VKXB 1EFQA 1U91B 4GRLC 5GS1B 1HOCB 4LLYA 4JN1L 5IMKA 5IHUL 3B8SA 3U30C 3IDMA 3KPRB 5C07B 1NCUA 1CLZL 1D5BA 2ZCKH 4HZAA 1EEUA 1OW0A 4PJXE 1YPZA 2VL5B 3WV0A 1U92B 4UUJB 1AI1L 2EEDA 4KJYB 4ALAH 4YGVA 4GKOA 3OPZH 5T5NG 5IV2A 3C5ZC 4PJGE 3G6JE 4HBCH 4AL8L 2BY3A 3RUGB 1KB9J 3FQTB 3GI9H 5ADPL 1J11A 4CNIA 2BSSB 3H9SA 4XVUD 3T2OA 4L3AA 1DN0A 1AO7E 3IB4A 5HVWA 3PWPD 1UFUA 1ZLUH 4RWYL 1G7PA 2PO6D 5IR1A 1K8DB 1VPOH 1ORQA 4XCNB 4JQIH 3STZA 1YECH 3RGVC 5ACZA 3QISA 4XCNA 5FCUL 2GSIA 3QDJB 1B88A 3BJ91 1Q0YL 2E7BA 4OAWB 3S4SB 5DO2C 4RMSA 1LD9B 3MODH 4OLWH 4Y5XB 5E4IA 2O93L 4HC1L 2Z8WC 5DMIL 1IEBA 1H15A 1TETL 3O9WA 1KCRL 2FIRT 3VFSA 4KY1L 1MCSA 1T7WA 3V7AE 4JFYB 4M6ML 2AXGA 1M7IA 4M6NH 5T1DL 3NCFB 5E6ZA 5HGGS 2EYRA 1HI6B 3FQRB 1KLGB 3HHRB 4UIMA 5I17B 5LGJB 4MQ7B 1CFTB 9CGTA 4ZQKB 2JJTA 2OL3L 3NFSL 4YXHH 1DBMH 3CSBA 3NTCL 5A1AA 4QNPF 2V9TA 5F7NC 3IF1B 1RUAL 4YK4C 4YHYB 2IQ9H 5EUKB 4Z76A 4G43A 1VKXA 4Z95L 2BK8A 3KNBB 3QCVH 4U1IB 1AD0B 3BZDA 3CGTA 4MA8H 3PE9A 4M02A 4HWEH 4NKOA 5EZLA 1P84J 1DQJA 4F7TB 4WEMB 1ZA3B 3S3SA 3ARGA 4ZS6C 3QI9C 4Y4FD 4P3WA 2B4CL 3CPLA 3ZYIA 1GJIA 3QRFM 4AMKH 5F70A 1OSZA 4WI8A 5FF6B 2YK1L 3BW9A 2YKLH 2APVA 5T3ZH 2JJUA 4Q9RH 2V17H 1WAAA 4XPTH 4ZFFB 2A9ML 1FFOB 1F90L 2F58L 3JVGA 5HHMD 1URLA 4PPTA 1K8DA 4ONHA 4Y5YB 4QXTB 2EDTA 1ZVSA 4K3JL 1PD6A 4HLZG 3I6LD 1I1FA 3QO0A 4HDIA 1MOEA 3OAYH 4RRPA 2DD8H 2VOTA 3M17A 3ZL4L 5I9QC 1BF2A 2ZG1A 5GGUB 1XFPA 3LH2H 2AJ3A 2DKUA 1CTNA 1CFVL 4JVUA 1JPTL 5K59F 3JWNC 3OAYK 4JY4B 2M1KA 3ILQC 4KMLB 2NW3B 1CGWA 3VCLA 2JLLA 1EDQA 1XGYH 2J4WL 4K9EH 4DUXA 1MPAH 1HOCA 5BV7H 5LQBL 4JO1H 3RKDD 3MLVL 2CK0L 3QUYC 1W72A 4O2FA 2X40A 5BV7B 3O3AB 2JJSC 2H2PC 1NGWB 1UJ3B 3G6JF 2VNCA 4XBPB 5IW1A 1A1OB 2QSCH 3ARFC 3VXUD 3RVXC 1GPOH 1NFDE 3JZ7A 4NRZB 2FBJL 3GNML 4MCZA 4GAGL 4R0LB 4H88L 4JFEB 4KJWC 1J0HA 5I8KH 2BOBA 3LRHA 3S35L 3P4LA 1BWMA 3QJHA 3NMEA 5CLWA 1NCCL 4LSUL 1HSBA 2W07A 4WNQB 3QULB 4HUWB 2EDWA 4J3VA 2CH8A 4ZUSA 5ITBL 3PHOB 4TRPL 5JW3H 2ITDB 1UCTA 4Y5XC 4GW5A 1TMCB 1ULVA 1NJ9A 43CAB 5L8KB 3HI6H 4GG8B 5CD3A 4FQJH 2GITA 1QO3A 4PJ7E 3RTQA 2CDGB 5MENB 5D2LE 1BMGA 5J9PA 2NMSA 3V6ZA 3GSNH 3UJIH 2XZQH 4YAQB 3JVGC 4IIQC 4XP9L 1N7ML 4KK9C 2ZSVB 3NA4A 3R1GH 2CO7B 3QWRA 5ACZB 3PG2A 1KXVC 3E8UL 3MGTB 3UTTD 5FYLE 2DQTL 4M7KH 3P9LB 4MXVF 1BAFL 3LKPA 2H6PB 4NHCH 3DUSA 4L29B 3CZFA 1HILB 4JFHE 3VRIB 1G0XA 3MRCA 3UCRA 3MRPA 5CMAB 3QCTH 4ELME 2BHUA 3L5IA 5CZKA 3GUTB 5DUBA 1O5DT 5DO2D 5ITFB 2FL5A 3EJZC 1E4WL 3T0WA 4EN3D 5ITFA 1V7MH 3UYPA 4GXUN 5EIVA 2L4OA 3WHXB 2X6MA 5FGCB 4ODWB 1JTOA 1I9IH 3EYSH 1QFUH 4WU5B 3TPKA 4HKXB 1Q8MA 3E2HC 4ISVA 1C7SA 4MXQC 4U1LA 4S1RL 3EBAA 3VRLF 4QCIA 3MLVH 1ONQA 3TNNA 1RK0B 5IP4A 3LN4A 1CTOA 2PYFB 2FBOJ 1QFOA 2X89A 1ZVHA 4FQHA 1XZ0B 4UMGA 2E9IA 4S1SL 4HEME 1CR9H 2KQMA 3V9FA 4J6RL 3VFUA 3MRKA 5A3IC 1ZEAH 1U0QA 1QTYT 1TLKA 5FKPB 2PTVA 4M7KL 4YH6A 3CSGA 4PJBB 3X17A 4H26B 3E6FA 1CL7H 1XCTB 3QUMB 1P5UA 3S96A 1J5OL 5D72H 2QADB 1KN2L 3QUKA 4TQEL 5CIPA 2C3GA 2QQNL 3PV6B 3D0LB 2BNQD 2MTPA 1CGYA 3UZVB 5B39A 1ORSA 3MRKB 4TRPH 4ZFOB 4BQ8A 5K59E 3TN0A 1MREH 2HTKD 1EV2E 2IFFH 4GW1B 4YZFF 2PXYB 5CWSA 3V6FA 2F74B 3HPLA 1P2CB 4CN4A 4YBQC 1N3NB 5IBTL 3MBED 3V6OA 1YEHL 1ZT4A 1TJIH 2Z8SA 1SY6L 4WU5A 4HCRA 3BO8A 3IKCB 3SKOA 5CEZD 2B4CH 1BVZA 5FO8B 1FNLA 1DZBA 5HHPB 3LV3B 4K94L 3SE4A 4B50A 3W2DH 5D6DA 2EDOA 4MJ6A 4P5TA 1O7SA 4U1HB 4WUUA 2BJMH 5BOPA 4Y1AA 4OLEA 5E00B 1F4WL 1MJ7H 5GRWA 1Z5LA 3H9HA 3MA7A 3IS1X 4I0PD 1SJEA 4OCXH 1I1FB 4YJZL 3BGMB 2HLAA 3G6DH 5E7FA 4YXHL 4OZHB 2AI0L 4KUZH 2WIMA 2QR0A 2PO6B 3LPWA 4KKAC 4KMTH 4ESKA 3TA3B 3A0OA 1F00I 3TN0C 3MJGX 1RZIA 4RMTA 5A3ID 1OD7A 4PREA 3ROLA 3MCKB 3I9GL 1B2WL 4GBXB 2E7LC 1ZHNB 1UWGH 4FQ1H 4FQQA 4N5ED 1HN1A 4QRRA 1IGYA 2AK4D 1NCWH 4LPXA 1QEWB 4AG4H 4LCCA 3JV6A 1FFNA 4JFQB 4JN2A 4JPIB 4HHAA 1PSKH 5IT2H 4NRYA 3ISWA 4P48A 4WV1B 3DGGB 3TF7C 3PHQB 2GTZB 3QNYA 2DQIH 4BZ2L 1OTTD 2EKJA 3RZCD 5JW4Q 1QOKA 5EC1B 4KKBC 3LZFH 3OQ3B 3DNKA 3OHXA 4BUGA 1BAFH 3U46A 4BKLB 2DM4A 2LQRA 4QHKI 4FRWA 4H25A 4WDIA 3O6FB 3QUYB 3VRLE 5EPMB 4HH8A 3HMWH 1U8PB 3D85B 4D9LH 1WZLA 3MBEB 1YQ2A 5KVDH 5HGHB 1QR1B 2ZCKL 4FG6C 4HGWB 4U6YA 3KDMB 4EUPA 1NLDH 3TO2B 1DE4B 4HX1B 1G9NL 2G5RA 4KK9D 1YEGH 4PS4H 4OZIE 1QQDA 4BH8B 2Y06H 3BOVA 3KYKL 2DWEA 4PGDA 2EDHA 3L9RA 5I1AA 5I73B 3IFOA 3LRGA 2BNRB 1T6WA 2O5YH 5BW7C 2EE3A 3PXHA 1A3LH 1N5AB 1GCFA 3FQXB 4GG6E 3L7FA 5HD8C 4JQVC 3O3UN 1HDMA 3B9KD 4M61A 5FUZL 4EKXA 4ODSH 5E8OA 3ZYZA 2EDYA 4YXLH 3NIDF 4UDTB 1PBYA 2VITB 1CFQA 4NC1C 2EH7H 2OS7A 4DTGL 4HEPG 1KPUA 4NO0D 3SDCD 4NQVA 1OAKH 3PWUB 2WBKA 1GSMA 3MRRB 4P2QE 3DURA 2K9UA 1UWXK 3OZ9H 4XAWH 4EBQH 1DFBH 1IEHA 1FVDB 3SQBA 4GW4B 4HCRH 3U9PH 4IOIB 2NY7H 3TZVA 4XNMB 1KT2A 4ZO9A 5EZLB 1PY9A 1X5AA 4Z7WF 3UROR 3OPZL 1ZHKB 3BX7C 5EN2B 5FM8A 4P9MH 5FUOH 2UVFA 1JWMB 3RRQA 5I30H 1XF3B 3QPXL 1AGCA 5B38G 4WFFE 5A2LH 2XTJE 5CD5D 1VFMA 2XG4A 5D4QA 1CLZH 3B5GA 3DMMB 2R2EB 2FSEA 1CXEA 4LPWA 1ZLUK 1BVLB 3UEZA 4Q97A 4BJLA 3SO3B 3QIWB 3WFBH 4GAYA 3BH9B 3GMQB 4DZBB 2R2HA 3NPSB 4WY7H 2VLLA 4LNRB 1TVBA 4QKXB 5KN5B 2G75A 3VFPA 4YHOH 2P1YA 3VXRD 3K7UA 5K9KB 4YQXL 2C7UA 3EIFA 1G1YA 1AH1A 1QPXA 1QSFD 2J8UB 4V1DD 1XIWA 1IL1A 5EU5B 3QWOA 4JRWA 5JR1L 4APQC 3JXAA 1UEYA 3T0ED 1LO5B 5I74B 3O2VH 2IPTL 1LD9A 3LEYL 4HIJA 1CFBA 4YHPA 5I8EA 5I66B 2Y6SC 1J1XL 5ENWA 1MF2L 5F9OH 1Q9WB 3SKNB 4EOWL 5K93A 1G7QB 3P0YL 3VA2C 5TE7L 3DYMA 3W9DA 2IQ9L 3ZTJH 2FJFB 4PRHD 4YWGH 1S7RA 2X4PA 3JBG7 2WWKT 4LLMA 4TVSa 4HJ0D 4NZDA 4NQDE 2VUOA 2ILLA 2BMKA 1BLNA 5CGYC 5DLML 3Q5YA 3QEQA 3U7WH 4RAVB 5IB2B 4AEIL 3RDTA 5FUZH 1Q9LA 1A2YB 4LSSH 1NAMA 2M8XA 1JPFB 4Q6IA 5DS8B 3TJEH 4NQCA 3NBNA 1A3LL 4Z5RA 4J3TA 1F5WA 3UDWC 3IFPA 2GT9B 3BIAX 1FGNH 4LVEA 4YDIH 3OG6B 3F6LA 3KYKH 5DYOA 1D5ZA 3P3YA 2ZUXA 1BHGA 3C09B 4JQXA 4ODUA 4DW2L 1LEGB 3CXDH 1FZMA 1DQTA 4L5FL 4QXWA 4POZD 2IBZX 3C60B 4UV4H 5DR5H 3RUGF 2XZCH 4C54A 1YYLL 3GJFB 2ZUYA 5C3LD 5F1IA 5J6HB 2C3WA 1Y18B 4U31A 3LQAH 4EZMA 3OJDB 3O41B 4G8GA 5AWNL 3V95A 1Q9KA 5D72L 1GAFL 4YHIA 2F5AL 4KKAD 1Q9OB 1GIGL 3QUZA 4QO1A 5BO1H 2KZ1B 1JCKA 1XAUA 5DEFA 4N0UB 2X4SB 3DETC 5D93B 3P9WB 4R97B 3D18B 2JIXD 3EO9H 3KYNA 3QJFB 3O81A 4JZOA 1QBMH 2PXYC 1NLBL 4HK3N 3SGKA 1F8TL 2YS4A 1J0KA 5JPNB 5JO5B 3F7VB 3K8KA 3T0EB 4XT1C 4XNZB 3RX5A 5CEZH 4WCYH 3V0VB 3SPVA 3JV4A 5C0CD 35C8L 3VXME 1IE5A 3WJLA 5HI3D 1RJCA 3OR6B 4WFHE 4P5TD 2ZJSH 5C0AD 4ETQB 3GMRA 1NKOA 4YHKH 1F13A 1QSEA 1UT9A 4UBDD 2PKDA 5DK0A 1HCFX 4PJXF 5CINL 4P0DA 3G08B 4K2UH 4EIZC 1L7IL 4Z0BH 1OP9A 4LCWD 5IVXA 1EHLL 3SDYH 4HC1A 1M71A 2DYPD 3QDJD 3S88L 3O45B 1GYAA 4MMXC 4NQCD 3HZVA 1JGUH 3SDXE 5HYFA 4HJGA 4LHUG 4JFDE 4PJGA 3BIKA 5BQ7A 3QWOB 2XZQL 4MS8D 2R69H 3ARGC 1QBAA 3X12A 3PABB 1T03L 3KS0J 4IJ3C 3BFOA 2EE9A 5DXWA 4HIHA 5DJCA 4EEEA 1T21B 1MNUL 2X70B 1FRGH 3O2WH 4PJHF 1PLGL 1NGYA 1A4JB 2Z35A 4F80A 1UH4A 2VTFA 2YC1B 1UB6B 2LVEA 1FVCA 1BQUA 5FO9A 3PNWA 3O6KH 4P23D 4X99B 4L4TB 5IB1A 3EFDH 1I4FB 5J06A 4RGMC 4I0PA 3NA9H 5IHLB 3IGAA 3MJ9A 1FIEA 1ZLSL 3LKQB 1KENL 4GKZB 3MV7A 2DI7A 5E2UH 2MCPH 5I73C 1BQHB 3F7QA 3PL6A 4YFEA 1FNGA 2HJKB 2BCKB 3OGCA 1P53A 4KROC 5FYJD 1AKJD 4NC1E 1EZVY 4ODVL 4PJDF 2NR6D 3W11D 3NZHH 1OVZA 3HLAA 2LTQB 3FT2A 3Q5TA 4CJ1A 2FX7H 2Q8AL 4F7PA 3BH8A 2IGFL 1YNKL 2DWDA 2ZCHL 3BP5A 1PJ9A 1JHTA 4GAFB 3BKJH 4BFEA 4GKSA 3DX6A 4Y88A 5F8RC 1BF8A 4QHNB 5ID1B 5KJRL 1KENH 4LF3B 4QRQA 1QBLH 3QZWB 4N8PA 1P1ZA 3ARDC 1A7OH 2Z31B 2FWOB 3VD3A 3CX2A 4PJ9B 4YHPB 5I8EB 3R0NA 1JWSA 1VHPA 2R0WH 3EFDL 5EO9A 3TO4C 2BSTB 3TM6A 1MHPH 4X4YB 5DT1H 2ICEB 4KV5F 4QOKD 4JRYE 4MA7L 1A6AA 1ZOXA 2EH8L 4BFIB 5CEYB 5H8DA 3LD8B 4Q9BA 3PWPB 3BVNA 4OFIA 3WHE0 3PWNA 4FQXB 5F1OB 4HUXB 2GK0A 4PJEE 1GZQB 1DL7H 2J6EH 1EO8L 4LSPH 4H1LH 4WIQA 2ADIA 5DD1H 3U46B 3AY4A 3K74B 1IM3B 2Y36L 2Z8VC 4LSRL 3RWEB 1L6XA 3SDDA 3MV9E 5D93C 2I27N 4OGAD 3I6GA 5ELIA 1AJ7H 3ZDYF 4HHAB 5D6CB 4M8QA 1JGUL 4FQJL 3I6GB 5J13B 3IXTB 1SY6A 2AKRB 4M5YL 1JF1A 1W0WA 3NTCH 3ARSA 2VZTA 1HHJA 5CHNA 2CLZA 2OL3H 5C92A 1U8HA 2DM2A 1L7IH 5ANMB 4RAUA 2Z0BA 4DK3A 2ADIB 4HZLA 2RCSL 3NAAH 4WVRA 5IFAH 1S7XA 5E24E 2DLFL 2AQ3A 5T1DH 1KFAL 4U3HA 5E8DL 1VFUA 2VLKE 1S5IL 3MO1B 4KI5D 4U1JB 1EXUB 4PGJA 3VWKD 3GIVA 4UI2A 4JFDA 3VD9A 2VDQH 3V5DB 3UTZA 3S37H 4UILL 4HUUA 5EU6D 3MODL 4HJGB 3QCUL 3QAZC 4LIQH 1CFNB 5FCUH 3BSZL 3VG0H 3X13B 1N4XL 2AERT 1YMHB 3O6ML 4WW2F 4LMQI 3OKNA 2BNQB 4CVZB 2Q8BL 3QZWA 5T33L 2ID5A 4QRQB 2BNRA 1AGEA 2YPLB 3S5LA 4XWOD 1JUFB 1FYHB 1WBXB 2NX5E 2VLJE 2XNAA 3QAZB 2AJUL 4OF5A 3HR6A 4Y19E 1E4XH 3GI9L 2F54E 2WIIB 2QADC 3BUYA 3F5WA 5E08L 3L1OH 4HPOH 2I5YL 2HMID 2BHYA 5AZEL 5LGHH 4IDLA 5FHAH 2VE6B 3QPQC 5SWZA 5HDOA 3MLYL 3ZL4H 5T3XH 2R0KL 5L2KE 2G5BB 4ORZC 4YDLB 1JF1B 5A16A 1MI5B 5EPMA 5FO7A 3H42H 4PYGA 3RBGA 1YQVH 5DA0B 3SDDB 3N9GH 1C7TA 3MR9A 3Q3GA 4D9RE 3U2SA 1BQHG 4M3KB 1JE6A 1IM3A 2IANB 3LKQA 4H1LA 5E8NB 2HVKB 3KPQB 4JB9L 4G9DA 5IFHL 5F7LB 4N1CA 1IJ9A 1NCAH 2XRAL 2C1OA 4KRNA 4AMKL 4U1MB 1KCLA 2X7LA 1WBZB 1KTRL 2Y07L 4G6AC 4YHIB 4FQXD 2Z4QB 3KJ6H 3V0WH 4FQQB 4WUKH 4BFIA 1X5YA 3OXSA 1Y18A 4GBXA 3D39A 4ELKB 1JPSL 4X6CF 5J57B 3TJHD 4MDIA 5CP7A 1KACB 4M7ZC 4X9GA 1A14L 2FWOA 4C56D 1JRHL 1NUDA 5EZIL 4CADA 2E27L 4Y89A 4LF3A 1U42A 1WT5A 3FB6A 4PJEF 1KJ2B 2FH8A 4IIQB 1FG2A 1LK2B 3O2VL 4XWOC 3MACH 4OZGE 1UXWB 1KBGL 2WV3A 2Q7YA 2RHEA 4DKFH 3FT2B 4ZAKD 5F93C 1UJ3C 1A4KB 3ESVF 2HJLA 4KY1H 4ZAKC 5E9DE 4P2RA 4DKEH 4TPRH 2UWEE 4MD4A 4PJCA 1R0AL 4HG4K 1IGML 3KHQA 2VLRB 1MCNA 4PRNA 4PV8A 4JG1H 2HRLA 2A6IB 3RVWC 2RB8A 1YNLH 1EEQA 2J2ZA 4FQLL 2DTSA 5KTEH 1I4FA 2H2SD 1KSRA 5DRZA 2F5BL 1LO5A 3B9DA 1ZE3C 1E4KC 1VENA 1MAJA 1ITBB 1UYWH 4ZUTB 4MNGB 5CD5C 2FO4B 2MQ3A 1C08B 5JW4N 4FQ2H 3HI5L 4NOFA 3B83A 5HVHB 2LAGB 5B3JE 1CZ8L 2BOBB 1ZLSH 2DIJA 4ZUTA 2YPLE 4OCNC 1IC7H 1NDGA 4G8GB 3DMMA 4N90D 1ZTXH 4ZUWA 5INDB 1NGZA 2E6PA 1S7QB 4OZFA 3U82B 1UA6H 3L3IA 3OXRB 2HAZA 3HI1A 3VGBA 2VXTL 5EN2A 3GSXA 4RFOH 2VLMD 3MV8D 4CU7A 5SV3A 2BVOA 4YDKL 1K5NA 4N8VB 4G42B 1BEYH 1C5CL 3HMXH 3GJFH 3I50H 4JZJC 2O26U 1J0YA 5SX5H 2FGWH 4MJ4A 1YMME 4U1SB 2BC4A 3DURB 4EXPX 5HGDA 4RQQA 3R06B 1RZJL 5C08D 1NLDL 3IDXH 2YXFA 3VFNA 1T04A 3RDTB 4HKZB 4PJ9D 3BP6A 5EZIH 2C1PA 1VGEH 1IC4H 1G7JA 3PQYD 5KSAD 3RHWK 3AUVA 3GUTA 2LU3A 4OD3L 3LQAC 3G9AB 5H35B 3T0VA 4YHLL 1EHLH 1ZVSB 2DMCA 4PLJD 3QDAA 4QWWD 4Y2DC 2EEBA 5F7DB 3L9RB 3VFGH 1X5IA 3CUPB 4WO4A 1UADC 3LOWA 4PGZA 3L5JA 4X6CE 5K9JH 4KI5C 2B8OT 1NSNH 5D7IB 2W0PA 2AABH 3C5JB 1BZ7A 3VE0A 5IEHB 2NPLX 2FX8H 4OLVH 4YQXH 1BD2E 5JMOC 2AXJA 4UQ3A 3OXSB 3IDGA 3ZKSD 1Q9KB 1MIML 2VRAA 3S34H 1HQRA 3X11B 2YD7A 1I7ZB 3C9NA 2VDOH 3QXTA 3SGJA 4OZGF 1NQBA 3DV6B 3VI3F 2QQLL 1E27B 5FGSA 3UTPD 1PZUB 4RGOH 5JW5B 1QLFB 1NSNL 1ZS8B 5E2JA 1R24B 4K7PY 2GT9A 4NCC1 4OTXL 1PVHA 5IMLA 3RGVB 1A6TB 4ZSOB 4LAJH 3JUZA 5D5MB 2MCG1 3D0VB 3WS6C 4PJFF 2I25N 1XR8A 3U4EA 2X4UA 4WTXA 3MJ8B 2NXZD 2XI9A 4FMKA 4KRPD 2UVEA 2JCCE 4JY5L 1OAYH 1C1EH 1BIIB 3IDXL 5C0EB 4DN3L 2P8LB 1IEBB 4G3YH 1JGVL 4PTUB 1AXSB 3TBTB 5GSVB 1DUZB 4JRYA 2FEDD 1LO4H 1ORQB 2J88H 2NTFB 1BEYL 5FM5M 2DAVA 5E8OB 5F72S 4WFGE 4CU8A 5BMFH 3HB3D 3PV7A 2W59A 3ZHLA 3IFLL 1X7QA 3GSWB 5DC0A 4G6AD 2OSLA 4HUUB 4POYA 2Z92A 5C0BD 3LMJH 3UTQB 5DDHA 2J8HA 2R4RL 5DGRA 4U6VH 4HKJB 3ULUE 2EDRA 5T1KA 1FNEB 4IMKA 4H20L 3DIFB 1U6AH 1DUYA 5CSZB 3TCLB 4E42B 5L9DH 3QNXA 3OWEA 1CVRA 1HHGB 5CILL 4NKMA 1PKQB 1DANT 2HYMA 1N3NA 4WI3A 2X7LB 2NZ9D 3RAJH 5AAWA 4OCWL 5KG9B 1AGCB 2NZIA 1H8NA 4WHTA 4ZTOL 3GMPB 5EUOB 1QFPA 2XY2A 1JBJA 1ZHKA 1IKNA 4S1SH 3ECBA 3QI9A 1A7NH 1YNTA 4IOIA 5FEBA 3FO0L 5EC1A 5T3ZE 1BJMA 1S5HB 3U2SB 5GRZA 5D7LA 3DGGA 1WTGT 3TPUA 4D0BB 2N7BA 4POZC 1FH5L 4FQ1L 1QKZH 2X4TB 5L0QC 3OG4B 4QRTA 3EOAB 2YUXA 1QBLL 3E6FB 5J6GA 4YHML 3GKWL 1LO3L 4PJ5E 1A6AB 4HFWB 3D3VE 4XNUL 4XP4H 5JHDE 2QV2A 4GJTB 2CRMA 3FQUA 3NFNA 5CJOL 3SCMA 2GW5A 5KS9A 4HKBA 5KW9H 1FNSH 3U0WH 3DO7A 3TA3A 1S7UA 2VN4A 2PYFA 3VW3H 1IM9B 4PGBA 3O3DB 1OTSC 3IFNL 5EZOL 4NKDA 3WNMA 1H3UA 1RUML 3HZYA 5GJSH 1YC8A 4GLRH 3OKNB 3Q6FB 3L3GB 4WENB 4OCXL 2R56L 3U4BH 4J4PA 2GUOB 2HN7A 2QLVB 1CGUA 3MMEB 4NJ9H 4UINL 5D1XC 2EDJA 2HVJA 1SJEB 4PLOB 4P2RD 4P3DB 2MMXA 1FCGA 4L8BB 3HE7B 3MLWH 2WAHA 4Z8FL 1ZWIB 4PRHA 1R3JB 3TFKC 4OV5A 1QR4A 3QUYA 3HG1D 4WUUB 3CFIC 1SY6H 3VRIA 4XXDA 2HKHL 3PL6B 2Z31C 4LSQL 4ZTPL 1EGJL 4G6ML 4I0KA 1H3PH 1T66C 5ANMA 4YXKL 4JANB 3JWOL 4JGMA 4PRPA 4TNVF 1FE8L 3GNMH 3OSKA 1I8LA 4PRBA 1J05A 5I15H 5BVJA 2E7CA 1CICB 3AAZB 1XR8B 1BOGA 4UB0L 1TZHB 2AV1A 4DCQB 2GITB 2X5PA 5GPRA 3L3KB 3UPRB 1ZHNA 2AGJL 1NGYB 3HZKB 4TVPD 3K4AA 3IDYB 4HIHB 1JV5A 1Z3GH 5IBUG 1J86A 4FQIH 3FRUB 1ACYL 4G5ZL 1C8PA 5SX4H 1BJ8A 4GO6B 1T1XA 1BWWA 3S88H 5KSVA 5F6IB 4QHLA 3WUWB 1FDLH 1AGDA 2JJWA 3DUUB 3IJSB 3H0TA 4H26A 4Z7VE 3L95A 1EPFA 4XNYH 5FUCE 2C5DC 5FKPA 2I07A 3ILQD 5EULV 3ILPA 5KSUA 4IHOB 4WFED 5DC4B 5CJXC 5IVXF 5C6TH 1XZ0A 3WFZA 2PTTA 4JM4H 1SYSA 3OX8B 5C0DB 2AJZA 1G7LA 1HNGA 2VIRA 2XKUA 1BOYA 5TE6H 4JFZH 3QDGB 5B38B 1A1MA 4WCYL 1MHEA 5C0ND 4CMHB 4Y19B 2ZG2A 3WHXA 5T1MA 4RNRB 5D7JC 2H9GA 4OD2A 3RVUC 2MJWA 1KJMB 3CFBB 3HG1A 3HZMA 1C5DB 1JYXA 4J12A 4U6TA 4L8SC 4NQSB 2IBGA 3T4YA 3QFJD 1NBZA 5KAQG 4YBHA 5F96L 2FZ3B 3N1FC 1FLRH 3U0PA 4QXTA 3D18A 1ADQL 5EOCH 1G9ML 4O9HH 1G7HA 1EJOL 3C5ZB 4X80H 5DUPL 4QHUB 1NCBH 5J9PB 1HEZB 5TQ2L 4KVNL 1MIEH 4WJ5B 3BW9B 4XNQB 1S7QA 1J7VR 2EIEA 3BEVA 3WS3B 5C0FB 2ZKHH 3AGVA 3JWOH 3VJ6B 1K2DB 2EH8H 2CIIA 4KHTL 1JJUA 5I8KL 3HKFA 4NZRL 2UY7A 3HNSL 1CQKA 3L5WA 3ARBA 4N8VG 3SGEH 4CJ0A 1JPGA 1ZTXL 4Y4KC 1T89A 4JPKL 5C0CE 2VQ1A 3ARZA 4QT5B 4P5TC 4F37K 1WAAF 2VAAA 1CK0L 4ZQKA 5J1SC 1II4E 1W72B 2VDNL 4O2FB 1INQB 2QL1A 5TDPB 3QXUA 3SDCC 4HJJL 4HIXL 5IEKA 4YBLC 5E8EB 3WSQH 4ZXBD 3VW3L 1UYWL 2P7TB 3LIZL 5CP3A 4PJCB 3GMOB 3Q5OA 1WWBX 3VXTB 5JZ7C 4Y5XA 4MJ5B 2VLRE 4U3CA 2VL4A 2EXWC 1EH9A 1LO3H 1Z9SA 3EAKA 4Y1AD 2WLZA 5BJTA 2Z31D 4L8SA 3CXHJ 2Q76B 5A43C 4YAQA 2EDFA 4UTAL 4IIQA 3WFBL 4LVOC 3NACH 4LRNL 3W82A 3MOQA 1QNZL 3IVKB 5F7YC 4IOFC 4ONHB 5ESQB 2C4FT 1TIUA 4RDQG 1A7NL 3V8CA 4JHZA 2N1KA 1G7MB 4LDOB 5I8OH 1MNUH 2N56A 5DRNB 5FDWA 4Y4KA 4FXLA 3VXUE 4PG9A 2VDLL 5HHXH 5AD0A 1Y0LB 3PHSA 4XPGH 4IRSC 1YPZB 3BIBX 3HRZA 5E2TH 5F3BB 5EBWB 1OB1B 5C0CB 3FAXA 3F65A 2YEZB 1DTUA 2DLTA 5F1IB 1VGEL 3UBXI 1N59B 1ZA3A 1HINH 4HK0A 3C2SA 4KDWA 1S8DA 3MUGA 1QHPA 1OT2A 3BDXA 4WI5A 1E6OH 2IBBA 2YA0A 3MCG1 4GW4A 5BRZE 3TGXA 1SMOA 1RZJH 1I1CA 3V0WL 4MSWA 3RWGB 4P5KA 1XCQA 4FMFA 1SJVA 2B20A 4PJHB 3EGSB 3R8BB 1PX3A 4QXGH 2PW1A 5IFHH 3CMOL 2O5ZH 3MRFB 1ETZA 5ABDE 1UENA 3SDAC 4APQB 1NUGA 2XQYK 1CYGA 1NGQH 4RFOL 1TETH 4R4FH 5IGXH 2FH6A 5D2LB 5IOPA 2ICWA 4HIIB 4KV5E 3IDIA 2CK0H 1H15B 4GRWE 1P4LB 5JIPA 1I7RB 4JY5H 5FA4B 5BVPH 4IRSA 1GHFL 1WIOA 2YZ1A 4UT7L 3EJZD 3CJJA 3KPSD 1GGYA 2BNQA 2NW2A 1AIFB 3QUMH 2A9NH 3OL2A 4J3OC 1M7DB 3LKNA 3TO2A 1K6QH 2MKWA 4PD4J 4YZFE 5C0EA 2ARJB 4J3UA 3LPGA 1P7QA 3MBEA 2H3NA 1UCBH 1KCVL 3WXWL 2QQLH 1YEEH 1U3HC 5BVPL 1YYLH 1QFWM 2Y5TA 4G9FD 4RA0C 4C83A 4UUJA 2AQ2A 4XHJC 1ZLVH 4LIQL 2EXWD 4JFEE 4MA3B 2DYPB 3A6CH 1LWRA 4A6YH 1R0AH 4P5KB 4WHCA 1W0VA 3HE6A 4MLIA 4NZJA 1JPGB 3VFVB 4M8QB 3WFDH 2YD5A 3HTLX 2YSSA 4MX7A 3CSYA 1IKFH 3B9VA 1QSVA 4GUPA 1XGQA 4OGXH 1EA9C 1KN4L 3RNKA 3VJ6A 3W39B 2OQJB 2DIBA 3U7WL 1T20A 4PRID 2ZUSA 4NKQB 2D9CA 2H41A 4U6HB 2VLKD 3EOTL 1UXSB 3OAUH 1JRHH 1BZ7B 4GMTH 3VE0B 2ZZUT 1J18A 3C5ZA 3K2UL 4Y8DC 1RUPH 32C2B 2GSIB 3CU7A 3MRQB 1SEBA 5GZOD 4KXZI 3WFHA 5D5MF 1JRHI 1QRNE 1YY9C 4I18B 4NYLA 2ZNWA 4H1LG 3V0AC 1G6RL 5E8PA 1FNHA 3HUJF 4IS6A 4GFTB 4BZ1H 1MCIA 2XRAH 4XGZB 2V5YA 3UBXA 4XBGA 4LPVA 3S4SG 5I16A 2V2XA 4L3CB 2DL9A 4L3ED 1NGPL 2M2DA 4L8CB 1F2QA 3E6HA 4RNRA 3VFNB 5T1MB 1QNZH 4LLVA 4KPHH 2DN7A 2VDPL 2WWMD 4YO0A 4RQQB 4XPHH 4DVBA 3VU2A 4UV7L 4EDWH 3RI5K 3X3GL 5HY9B 4NC0B 1HNFA 1NANH 3C6SB 3W9EA 4CBPA 2P7TA 3MFFA 3PDOB 3Q6GL 3KVQA 2QSQA 2VXSL 4HS3B 3HLAB 1YQVL 4IEFB 5KJRH 5TDPA 2VIRB 3QNZA 3HNTH 1A9EA 3U4AA 4KGJA 1GC1L 1UQSB 3EJYD 2HJKA 4WDIB 5BS0D 1E6JL 2WINA 3RKPA 3QZWG 5DQJA 1BQHA 4JHAH 3T0EC 1BFOA 1MUJA 5CAYB 1T1WA 4QT5A 3VGFA 1KPRB 4FQCL 3L1OL 3ARGD 3M1BB 3RWJA 5AYUH 1AP2A 5DUMH 2OTUA 4K23H 1NEZG 3WIIH 2CKBA 4KXZH 4UIKL 4GG6F 1JN6A 1A7PH 1U9KA 4M3JA 4QRRB 4B41A 4JRXE 4JZNB 4K3DH 4G80A 4JCLA 4NWUL 5GRUH 4OLUL 4XPFL 4D3CH 3S37L 3QXVA 2E8YA 2I24N 3BEVB 4J8RA 1QFHA 3MV7E 3MXVH 3S5LG 3DX8A 4KQ4H 3X3FL 1LE9A 1B3JA 4TPRL 2A6KA 1S5IH 1YUHA 3BPLC 3O0RH 2XACC 1UACL 3PABA 1MVUB 2C3HA 4CMMB 4OF0A 4P5MB 4JKLA 3BN9C 2P5EB 4XRCB 1V7ML 3N85L 2WANA 4MHHI 4KRPB 4EI6A 2GTWA 2OTPA 1DLFL 3ZKMC 4ODWA 4R2GB 2A77L 3G5XA 3RIAF 2NNAA 4F7EA 5GS2D 3BRDA 3RGVD 2XQBH 2NY1C 3LHPH 2DQCH 1DQQA 3WNKA 3MFFB 1S78C 3PDOA 2Y36H 1U95B 4WUUE 1A3RH 2IF7A 1F4XL 3G5XB 4HIEB 1EEYA 3RL2B 4YO0B 3LKPB 5HD8D 1CICC 1EHXA 1B0GA 1DEDA 5J12C 2R4RH 3FO2A 1IKNC 2AK4A 3LZFL 2ATPB 1WUNT 1UVQB 4OI8A 2RFXA 2Q3ZA 4LMQE 2CIKA 3S9DB 2OJZL 5F44A 4KWUA 1WC7A 3KPTA 3T0EA 5CP7B 4GMSH 3NFNB 2CO6B 2HT3C 4GAGH 1SEQH 3CK0H 5E2WH 4MJID 5T5FL 2VR9A 3OAZH 1MHPL 4KJPD 1A7OL 5D1ZB 32C2A 1S9VB 1AGDB 3QUXC 2Y1VA 2DF3A 3JUYA 4XB7A 2EC8A 1A1NB 3T0EE 2XTLA 2R9HC 3O9WD 5CEZL 1JGEB 4K3DL 3PP4H 4L4TE 4OIIH 3QXAA 1RHHA 5HHVH 5DJYA 1J1PH 4YE4H 3TA3C 2X4OB 4K23L 1NLBH 3VI4F 5GRJH 5HGAB 2YWYA 1G6VK 4TUKH 4WRLA 2ZCHH 3I02A 3EDKA 1FL6A 2Q6WA 5J3HC 4NQDD 1D5ZB 1S9YA 3R4DA 4FQIL 1AHWC 1D6EA 3VFTA 3T08A 4OD1H 4XP1H 1UZ6E 5C08E 3C6SA 1J10A 4WI4A 1I7UA 4W4NA 2YUWA 2MCPL 3VXOA 1VCAA 3PGCA 3RIAK 3X3GH 1ITCA 3F8UB 4GXVH 1ES0A 1KLUB 3DX9B 3SY0A 5D7JD 1WCQA 1UM5H 4JAMA 3CLEH 1BM3L 4YXKH 2W9EH 2AABL 2GAZB 1EGJH 2RJMA 1WIPA 3TVMC 2KBGA 3TBSA 1UG9A 2WLYA 1R3HA 5TF1H 1OLZA 3B6SB 3NH7H 2APBA 3GK8L 1T03H 1IAIL 5DVLA 4X8XA 3THML 2HH0L 4PRDB 2X1WL 43C9A 5F9DC 3VWJB 2ZPKH 1E6OL 2FHFA 3KLAB 3LDBB 3ZZ1A 1U8NA 4KUCF 3KXFB 3GSOA 4BQ6A 1J8HB 3GMMB 2Q20A 4O51B 2ICWB 4XP6L 5DURB 2WBJD 5EU7E 5IESH 1WZKA 1O7VA 3FT4B 4NQEE 3L6FB 1U8HB 2B4CC 1OL0A 5HPMB 3BP7A 2V9QA 1A6WH 2VMFA 3PUCA 2D4FA 1QLEH 3DXAB 5FYJH 5F9AC 4WNQA 4PY8I 1DQDL 3SDYL 3QO1A 4ODTH 1H0DB 2IPTH 3SGEI 2C26A 2VJXA 2D2OA 3IF1A 3SE4C 3TPUB 4AT6B 4D0BA 4M7LH 3RWGA 4YPGB 3I50L 4DOHE 4JHWH 5IMLB 1NMAH 5F3HA 2YD9A 3RVTD 5D7KE 3QFJB 3ECBB 1CE6B 1QFUL 1REIA 2VDRL 4OQ1A 1NFKA 1YY8A 5INCA 4HXAL 2CGRH 1XF4B 2FIKB 3S7GA 3C09C 3NCBB 3CX5J 3I3BA 1NDMA 4AIXA 3BJLA 3T3ME 3DIFA 5C0RL 2A0LD 2W92A 4PRDA 3RX7A 4HKJA 4R4ND 1OLLA 4UDTA 5E6IB 1H3XA 1HYSC 4O4YL 4W6YB 1ZLWK 2GSGB 1B9ZA 2DMKA 3RIFF 5D1XD 2PF6A 5ETUA 2ATKB 3C2AL 4XCYB 3HAEA 4H20H 2BY0A 6FABH 1UWXH 2Y9RT 2F8OA 4QRUA 3JWOC 4KKBD 4K3GA 4UV7H 3DJ9A 3CU1A 3EDJA 5GZND 1JNHB 5HHOA 3GMOA 2BCKA 5HVGB 2X10A 4MSWB 1YY9D 4OFKA 5BS0A 4IMLA 1L4IA 1S9YB 1RJZB 2DKMA 3VFMA 4GUPB 1G6RH 5EBGA 5T3ZD 1RJLA 2ICWJ 4BKLA 5C1MB 3QFJA 5LBSH 1FFPB 1N0XH 4I9WE 3L7EA 1SHMA 5E94B 2W65A 2BY2A 1KCSL 1I3RB 2D3VA 5EBWA 4RGND 5IVZB 4PJAE 4AM0B 1MFCL 1ADQH 4I2XE 1VFBA 1W8NA 2DQEH 1T21A 2OBGA 1Y0LA 5EIIB 4FNLL 5TE7H 2NZ9C 1QEWA 2Y5TB 4X6EB 3RQ3A 1NEZB 5DJ8A 3BD5A 2BVQB 4MNQB 1PAMA 3LH2L 1JYWA 3FT4A 1MRDH 3U9UB 4GAJH 4JFYA 4O51A 1FJ1B 3RZCB 5SX4I 5JQ6L 1S7WB 1LVEA 1JZ7A 3AS1A 4HF5L 2F54B 2DD8L 4WJ5A 3WFDL 2VZ3A 1FL3B 3AY4C 5F9WB 1YPZF 4DEPC 2NLJB 3FT3B 1VACB 5ID0B 4MNHA 2JB6A 4EUPH 1AIFA 1W0YT 2QR0B 35C8H 3EDEA 3V6OC 1VERA 1MI5E 1BX2B 5BCAA 3SOBH 1CI5A 4HSQA 5ISZD 2FX8L 2R2BA 2B1HL 4EQ3A 1Z5LB 3H9HB 3MA7B 3T04D 5T3ZL 1LE5B 4UTBH 3WXWH 1A5FH 3V7MA 4HWBH 4Z7QE 4WHYH 3WYRA 1KNOA 3HMXA 1T1ZA 4LBEA 1W72L 1AKJB 1GIGH 1N6UA 3EGSA 3OZ9L 2AEQH 5IM7B 3EKCA 1KJVB 5CZXC 1BZQK 1MFDH 4G6FD 3J7HA 3CVHH 1X5GA 4DUVA 2AW2A 1ND0B 3TVMB 3ZKXB 4ORGA 3STLB 4HUVA 4R9HA 2V7HB 3CFKA 3QHZH 2CIIB 1PYWB 5GGSA 1U8KB 5I19L 2YEZA 3SGDI 2BVYA 2VABA 5DRXA 3QB7C 4JZNA 3DX7B 4KHTH 2NY2D 5SWSE 4EUPG 1TENA 1A47A 5DI8B 3HRZB 5IVNA 3QXAB 4YDKH 1FNFA 4IBLT 1PFCA 3CIQA 3KR3H 3DVGB 2ARJQ 3QUMA 1IGJA 2HKHH 4TNWF 1C12B 1IAKA 4K3HA 3U36A 1JNLL 5TQ2H 5KSBF 2HFGL 4MAYD 3JV5A 4NM4H 3IVKA 5HYJB 3QIUD 3SBWA 4TUJB 1KUMA 3T4YB 4NQCB 5I1EL 3T0DA 3HZMB 4D9LL 1WITA 2E3VA 3F6IA 1ONQB 5EU6E 4Y2DD 1MCPL 3AREA 1GOGA 3UYOD 5E2VH 2H9GB 5IQ9A 3EDDA 3OKDA 5GJSL 5DK3A 5GRYA 5JTWA 2JIXB 1C16A 1DBKL 4LVNB 2D7PA 1FNSL 5DD0L 3G5YB 4J2XA 3IJYA 5DJ2B 1MRCL 2ADGB 2VDMH 2B1HH 1KB5L 2EO9A 1A0QL 4U2ZA 1ZGLB 5F89A 4CU6A 3D87B 1JK8A 2OI9C 1FZOB 4RISH 1F3DJ 4LRNH 4WY7L 4JM2F 4PJIB 4HG4J 4KTEL 5JZ7D 2MPAH 4PJAA 5I1LB 1UWGL 3HPJA 3ZO0A 1FGVH 2P8PA 4GRWF 2VKXA 1IL1B 5EU5A 4JFDB 4DFIA 5HHME 3H0TB 3T09A 2V5SA 3DUUA 2HFEA 3IJSA 4OF8A 3ET9F 4AJ0A 3BKYH 5HYEA 3BDYH 3UO1L 2ADFH 3T2NH 1YC7A 1VADA 1ZLVK 5IWLC 4MMZC 3F7RA 1LE9B 5GSRA 4XWGL 3TYFA 4MYWB 4YC2C 5L2KB 3MZGB 1C5BH 3GGWB 1QLEL 4X7CC 2APFA 4F33A 2Y6SD 2OM5A 5D1QC 1DLHA 2MWCA 2JB5L 1F4WH 4ZSOE 3VGHA 3U0TB 4O58L 1RZJC 5CILH 2L7JA 4GRLD 1CK0H 3GSNL 1JWMA 2XV6B 3VWKA 1P6FA 4JFDD 3REWA 3CFCL 3G04A 2P5EE 4WWKC 3HE6B 1SYVA 2JELL 2HH0H 3HC0B 3BDBA 1KOAA 3ZDZE 3UMTA 3V7AG 5B39G 2EEAA 3MR9B 2NY1D 2XQYG 2BRRL 3V4PL 7FABH 1BGXL 3HFMH 4NGHL 5DZOA 4WHTB 2BNRD 4P2OA 1MLCB 1SJXA 3DRQB 5FB8A 4LKCA 3W0WE 1BGXH 3TZVC 3BP4B 2P49B 3BT2L 3MLPA 1NC4D 1DEEB 1CU4L 3IDNA 3UP1A 3REVB 2BSTA 3UTTE 4E41A 1JWSB 4JO4H 5BXFA 4X4ZA 2EECA 2XNAB 1OGTA 4ZMAT 5E9DD 4M62H 5EOTB 2MQ0A 5BV7L 1JTTA 3GJEA 4R96B 4C55A 4BSWA 4MZ2A 1NEUA 3CLFL 3UTQA 3GJEB 4PRAA 2W9DH 1J5OH 1R5IB 2J5LC 1G7LB 2V5RA 1RUMH 4G6KH 2AS5M 4XB8A 4E41B 3H3BC 2EIBA 3BRFA 3QEUA 3FQUB 3RX8A 4YHNB 1JPTH 1KIPA 5KSBE 1NBQA 2AJUH 4HWZA 3ZSSA 3HUJE 3U0WL 3L5XH 2PNDA 5IFJA 1MJ8H 4JRYB 3UO1H 4ZFZA 4N0FB 3QFDB 2BXZA 4R90H 4OLYL 2X4RB 1KIQA 1S9WB 3MV01 3OKEA 4PTUA 5C9JA 4KH2A 5E9DA 5E03A 3QCUH 4KDVA 5JXEC 4WI2A 1CQYA 1NCTA 4NOBA 2AAVA 5TE6L 1JMXA 3TT3H 3KYMB 2HTLD 3CK0L 1WCBB 1A0QH 2A9MH 4M4RA 2DLFH 1LO2H 1QA9A 3L3JB 4N90E 2Y5EA 4U0RC 4OB5H 1OT1A 5AEAA 4U1GB 3JWDL 4EI5D 4MD0A 4O2CB 4HLJA 3EYVB 2EDXA 2UYLA 3GIZL 3TT1L 2AI0H 4KUZL 1KJ2H 4PRPB 4JFFA 4Q6IC 1SVZA 2NY6D 4PREB 3ZE0E 5CSZA 2GQHA 3TCLA 5BO1L 3ZTNH 2NQCA 1MAML 2IH1B 4R8WH 3VFOA 5IHZB 4XXDB 1N7MH 3TIDB 4JFPB 3RWFA 1WK0A 1I7ZA 3C9NB 4LCWA 4LSRH 4RMUA 5HVHC 5CEYA 1OAUL 3MV8A 4L8DB 3AMLA 4NM4L 4JLRA 3VMOA 4HS8H 4YHNA 3BZFA 3DVNB 3BT2H 3VG9C 4RFEB 3PQYE 1FZOA 2BFVH 2NW2B 3SJVD 3ULVL 4FTVD 3WJLC 3UTSA 3I6KA 2QHRH 1KTLA 5EUOE 1QG3A 2FECI 3GB7B 2BRRH 3V4PH 1TCMA 1RUKL 4Z77B 3VXMB 4LKXA 3BP5B 2V6HA 1S3KH 4G9FE 1ZV5A 4NBYB 1H3WM 2EXYC 4G3YL 4KI5E 3SE3A 1UA6L 2GEEA 5GGVH 1D5IL 4HKZA 3V6BR 3O4OB 5FXCH 5IV2B 3GSRA 1VESA 2VZ1A 4Y4HA 2X4UB 4OLYH 3L3HB 1OOAA 2X4TA 4LLDB 4PJHA 1BJ1J 1VA9A 2R56H 1CL7L 3U4BL 5H2BA 1E0OB 1FVEB 4XPBH 5DQDL 2JB5H 3TBWA 5D7LB 3KXFD 3QJFA 3PWVB 1AO7A 4AIZB 5ICYA 1GZPA 4KC3B 1DSFL 4Z7WB 3B9KB 3REWB 5KW9L 5CBAB 2GIYA 4Y19D 5IB1B 4JO3H 4EI5A 1J1PL 3BQUD 3QUZB 1A5FL 2XWTB 1AE6L 4HULB 5HSFA 2AK4E 4XNUH 4LCUA 5F1SA 1A4JA 4ZOBA 1NBVH 5BZWB 4JG1L 1QKZL 5IEHA 3VXQA 5IMOA 2P43B 3OKKA 3ETBF 5B22A 1EIBA 4BFGA 3HFML 4HS6B 2Q1EA 3SKJH 4OUUA 1HXYB 1HH9B 4Z5RB 1ZT1B 3SDDD 1B4JH 1I8IA 1C5DA 3DSFL 3EHBD 5D2NE 1JHLH 4Y5VA 1TTUA 1A6UH 4OD2B 4WV1C 2ESVD 5JHLL 4PV8B 1FLTX 2I9LB 3QBTB 4I0CC 2XXMB 2UV3A 3IJYB 4CW1B 1DBML 3LS4H 4NQXB 5KANI 2WP3O 3MC0A 4P2RB 4U6VL 5LBSL 1FZKB 3LRSB 3CDYA 4TVPH 4UT6L 1U8OB 1CGVA 1NMBL 1PY4A 2NR6C 3RPKA 2DQFB 3KPSA 3ZYOA 5L0QB 5CINH 3SPVB 1H3VA 4LEXL 3RTQD 1KLFA 3V6ZB 2VAAB 3TA3D 4M7ZB 3DUHA 5I18L 1WVZA 1WTLA 4JGJA 4X5WA 3HE7C 5I1IL 5JPNA 4YHKL 3MV8B 4NFDA 3NIGF 4WTWA 1NDGB 5INDA 4LHUD 3WL9B 5IBUB 2LE9A 5D1ZD 5F21B 4ZXBB 4I8DA 1DQML 4LP4A 4BK4A 1T1XB 3H3KA 4I2XB 3U36B 3QSKB 3PGDA 2DRUA 3P73B 4HUWA 2J5LB 4Y16A 3WN5A 3PGDB 3ARBC 4ONFH 4XC1L 4R4NC 2ZOKA 4N5EC 4JFFB 1T5XA 1HZHH 2WBJA 4L9LA 4LASH 3GM0A 3MLYH 5HI5D 2UUDK 4ERSH 2PTUA 1TZGH 2Q3AA 5EUOF 5DHXB 2OR9H 2EIZA 4FQCH 3RPIA 4AZ8A 1QA9B 3L3JA 4M6AA 1BZ9A 5BVJB 4N0YH 5C0RH 4GS7B 2A6IA 1WT5C 2H32B 5GS2H 4N8CL 5H2BB 4LEOA 1N4XH 1NBZB 3U83A 4HLZH 4TSBL 3BMWA 3L3HA 5I74C 3HG1B 4WUUD 2AV7B 1BQSA 1H5BB 4UILH 1B2WH 3I84A 3IJHA 2X4QB 1KG0B 3N1PC 4Z7WE 5K33A 4JKWA 4I3RL 3AREC 4NQTA 4U1NB 3P4NA 5DMJB 3WLBA 1M1SA 4XVTH 2BVUA 3JWDC 3L7FB 5SWSA 4KGLA 4M7LL 2WNGA 5D71H 1FIGL 4BZ1L 4Y4FB 4PRAB 3VXRE 5L8JB 2VC2H 5IB5B 3UZEA 2YOCA 2PYED 1X5FA 5E6IA 3WEXA 4ETYA 3BHBB 5CJXA 3OKKB 1YMHA 1S7UB 3DO7B 5I1HL 2NY4C 1IGFH 3ALWA 3U1SH 3BGAA 4IHOA 3KPNB 2A83B 4F2MB 5TFSH 4JLRB 1CDBA 1DVFD 4K7PL 4LGRB 3B9KC