3ZTNH

Structure of influenza a neutralizing antibody selected from cultures of single human plasma cells in complex with human h1 influenza haemagglutinin.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
219
structure length
173
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYAMHWVRQAPGKGLEWVAVISYDANYKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSQLRSLLYFEWLSQGYFDYWGQGTLVTVSSASTKGPSCLVKDYFPEPTFPAVLQSSGLYSLSSVVNHKPSNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAEMAGGLUTININ
publication title A Neutralizing Antibody Selected from Plasma Cells that Binds to Group 1 and Group 2 Influenza a Hemagglutinins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 32
structure length 173
sequence length 219
ec nomenclature
pdb deposition date 2011-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ztnH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ztnH01
3TT1L 3G9AB 1MCOH 4S0TD 1Q9OB 1UA6L 3GIVA 1YNTB 4FA8A 5IQ7H 5JOPE 1J12A 4X9BA 1NFDF 4DCQB 3BUTA 3C8HA 4X6CF 1C1EL 5EZJB 5JW4N 3JWNC 4XI5C 2I5YL 2H3NA 1JF1A 3W5NA 3LQAC 4PRPE 5DS8A 1FE8H 3TN0D 3GSXA 4P2QA 4K3DH 1JYXA 2X1QA 4GW1A 4UTBH 2D7QA 3BT2H 3QDMB 1NCAL 2MTPA 2OJZH 1T7YA 3FAWA 4WWID 4MVBD 3P30H 3PQYB 1CICB 2MQ0A 2W0FA 5F1SA 3GHEL 4Z7NE 5T3ZE 2B4CL 1QG3A 4XP5H 4KXZI 1X5GA 1G1YA 5ALCH 3SDXE 3CSYA 3AC0A 1L7TH 4X9HA 1G9NL 3EHBD 2RAMA 3QJHB 1S7SA 3RKDD 3OPZH 3QEQA 3F7VB 4YHYB 4LLAA 4QXUL 4CADB 3ARGC 4MJIA 3MRHB 5E56A 1LO4L 5BVPL 4HUUA 2CQVA 4UAOB 2AJ3B 3WUWA 3BKJH 3DSNA 3F7YB 3OKKA 3P73A 2BVPB 2F53A 5H8DA 5JQHC 5I6XC 1FCGA 2XZQL 4Q58C 3NCYP 1QHOA 5IUSA 5DEFB 3B3IB 1KCLA 5IMLB 4X4ZA 3WHE1 1GL4B 2VXVL 3MRBA 4OZGB 1PZ5B 4N0UE 4HKBB 5HI3C 2DMCA 3E3QC 5DQDH 1KPUA 1T6WA 3W2DH 5DRWB 5BZDB 5E9DA 2NX5E 4NN7B 1UJ3C 4XHJD 4PJ8C 3RUGA 3CFBA 4LL9A 4L4VB 3P77B 1WIPA 1V7ML 2MFNA 3AS2A 4NQEE 1FVEA 2VZUA 1BZ7A 3RRQA 3S34L 2CKBH 4F3FA 3BZFB 1JF5A 3LKSB 2J1KA 3O6MH 5INDA 1MI5E 1S78D 1KB5A 2WUCL 3V9FA 4ZFGH 5GS1A 3NZHH 3TM6A 1F4YH 3ARGA 3U4EA 2W92A 4RX4A 2MOVA 1OTSD 5GRUL 3CFEB 3QEGH 2KQNA 2IGFL 4U1KA 1PLGH 4UQ2B 4I13B 4XVJL 4PJBB 1RK0A 5K9JL 4FQXD 4QCIB 2H1PH 4NWUL 4MA3B 4BSJA 2H26A 4FHBD 1AO7A 4TRPH 3LAFA 4MB4A 1J1OL 1RZKL 4KWUA 4ZUTA 4WFGD 5IB2A 2ZKHL 5SWQB 3WXWL 1H3XA 4UDUA 2PYFB 1NCWH 3VFTB 3ARDC 4K94L 3ULUE 1AP2A 1UJ3A 4MDIB 2R1XA 1QRNB 5DK0A 5DMJB 1W0VB 4FZ8H 4PP2A 4UMGA 2VXSH 5DR5L 1NAMA 4PY8J 4YHIA 2VDMH 2VXQL 1N6QL 5EIVA 3WNPA 4UI2A 3MV8A 4MA7H 4Y4KB 3TIEA 4U1JA 1LP9B 3GKWH 5HHVH 4GG6A 5FFLA 2FX8H 3CIQA 5IV2A 5EU3A 3NIFE 2EDJA 5HDQH 3NIDF 1R3LA 3MSPA 4XHQA 4ZSOE 1KEML 1TFHA 3EOYG 3MC0A 4P4KB 1A0QH 4GAJH 3O3EB 5E99H 3NACH 2X9WA 4LCWA 3JWOH 4KQ4H 1JP5A 3I75A 1DR9A 2XTJD 1W72A 2BMKA 3GSRA 4JN1L 2CGRH 4I0CC 4ODSL 5C2UB 4NZDA 5IW6A 3HNTL 2NY0C 5H2BB 2ITCB 4DN3H 2Q87A 1RZ7H 5KVDL 3DLQR 4JEGB 1QSFE 2PYED 3PHOA 3BZEB 1NAKL 1J1XH 3DX8B 4TTDC 5JA9A 1RUQH 1MFEH 2YRZA 1N2RA 4YHOL 3GGWA 5D1ZD 3W0WA 4G6MH 1M71A 1TQCC 4OFPA 1Z9SA 1FLTX 4BFGA 3IJHB 3QHZL 2UZXB 5JXAH 5BV7C 4P46C 3ARDA 4GSDL 4YUEL 3UC0H 3O4OB 4OZIE 4GUPA 3I02B 3C6LD 1MFNA 2FO4A 1JHLL 1DVFC 2YEZA 4GRWE 3WNOA 5DD5L 4PJCA 4TNVK 2X1OA 4PB9H 4PTUA 4ZTPH 5I0DA 1WCBA 2AEQL 3TBTB 2V6HA 3L3HB 1CFVH 2VR4A 4UBDC 3AVEA 3DXAD 4H8WH 2V2WB 1LO5A 4R4NC 1WEJH 2FGWH 2F15A 3O3AB 4PR5A 5HYSA 1KXQE 2MHAB 1V3LA 3H9SD 4RGOH 1FNSL 4XPFL 2NY2C 1HYSD 2LAGB 4Q6IC 4ZAKC 5IJVB 4DVBA 2DJ4A 3GIZL 5JNYB 5ENWB 3VG0H 4I4WA 2J8UB 4BFIB 3TNNA 5TF0A 4MZ2A 5C9KA 1FO0B 2UVFA 3QO1B 1IKFH 3WUWG 3VFWA 2MSPA 4OJFH 3FT2B 1IC7H 1HDMA 4XBPA 4JPIA 4W6YB 2Q86A 4R6UA 3BWAA 3BW9A 1TIUA 4P46A 3PWJA 1NBVH 5GGSA 4PJIF 5CD3A 1AJ7H 2VZOA 4CVWA 2B2XH 1NMCC 4OLZL 1KCKA 1AGEA 5FK9B 1MFCH 1CFNB 1DVFA 1JFQH 1Q9KA 3QQ4B 4UIKL 5FKAB 2HT2D 1PEZA 1S7RB 4JRYE 1NGYB 4CU8A 4E5XB 3BVNB 1KYOK 5FDYA 1RHHB 1MCNA 5DJCB 1DP0A 2NY5C 1AGFB 4TSAL 3N1PC 3G08A 1FCCA 5FYJD 4WHTA 4HIXH 3MJ9H 3PL6C 1AD0A 4OQTL 4Q6IA 1BFOA 3ROOB 3V5HA 4ZAKA 1LEKB 1RD6A 3K2UL 4M9PA 1NDMB 2OJEA 4U1NB 1UXWA 3BPOB 3FAXA 3V4UH 1JGUL 3TEUA 8FABA 2DD8H 4NKMA 3D3VE 5H37G 1G7MA 3UBXG 1IT9L 1KJ2B 4HT1H 2H41A 2DIAA 4YDJB 5E8PB 2AXJA 4KAQL 4LLVA 2W9LA 4LSTH 1EXUB 1CGSL 2EYTA 4N1EA 4XCEA 4KUCD 2EH8H 4CDGC 2O5XH 1NCBH 2EDFA 5GGSY 2LFGA 3WLBB 3IF1A 3M1BA 4MVBC 3GO1H 4NQDE 4BUGA 5C0GA 2PW1A 2BSTA 5SX4H 3ZDXE 3O6KL 3MLYH 3LN9A 4GAFB 4JM2F 4HDIB 1NUDA 1IJ9A 1ZV5A 4GQPH 3D69A 3VWKD 4KQ3H 2MPAL 1AY1L 4JGJA 4F57L 2FX7H 1I1YA 2X89D 5EO1B 1JNLL 4BH7B 1OHQA 2HH0H 3MX0A 4PV8B 1MQKL 2CMRL 1TVHA 2YKLH 5EPMB 3ROLB 1I3RA 3EBAA 3PL6A 2E7HA 1ONQA 3CVIL 2WQ8A 4F58H 1H3UA 4DKAA 3MXVH 2H32A 1XEDA 3ZHKA 2X5PA 3GIVB 4M4PA 3PGDB 3S98A 4PGEA 2XIDA 2APWA 5LGHL 2XWJA 3HMXA 5D8JH 2ZPKH 2H3NB 1F3DH 3N9GL 1ZEAL 3BD5A 4G6KL 3GSXB 4JRXD 4P2QB 2Z92A 5CJQL 5C8JA 4AQ1B 4GW1B 2EKSA 3L3IA 1UWXH 2AV7A 2EZ0D 3MJ8A 2XI9A 3LB6C 3P0YL 1A22B 1SY6L 1XF4A 1I9RL 2CLVB 2W0FB 3A67H 2GSIA 1A6VL 3A0OA 3FQUB 3LPWA 4MLSA 4XHJC 2VERN 1FZMA 1E4JA 2BHYA 4GQ9H 4KVCH 3VDAA 4ODTL 4LSUL 3VWJB 1OARL 4ODVL 4Y5XC 4NZTH 4LSVH 2F5AH 5FO8A 1S7SB 4CNIA 3WKNA 4LP4A 5IT2L 4JDTH 4QTHB 1RHFA 5I8KH 2B1HL 4NP4H 4MJIB 2HG5B 4JZJB 5CWSB 2VLME 1JGVL 5CMAA 1TTFA 4LASL 4OTXL 1S78C 5I1HH 4HUUB 5CEZH 4XAWH 3WUWB 2V2XA 1BD2D 5FHAL 4R4FH 1S3KH 3OKKB 2EIZA 1Z9MA 2F53B 3P73B 5FXCH 2A77L 1J0HA 4XZUB 3SOBH 4K3EL 5ITBL 1OTSC 4DJMA 5FAAA 5KW9H 3MRBB 3LVEA 3THML 5GGTA 3IU3B 2AEPH 1IEAA 4O5LL 4FQXC 4Y7MA 1KPUB 3IXAA 2NZ9D 3FZUD 2OMNA 4M7ZB 3KYMB 4XGZA 4XP6H 4F7CA 1XF1A 4YJZL 5E9DB 3H0TA 3DO7A 1Q0YH 1TJHH 3CFBB 2XY1A 4G7YL 4RFOH 3OJMB 3X14A 4NO2A 1FVEB 3FRPG 1PSKL 1AXTL 1CE1H 4FQLH 1BIIB 2DOCA 5F6IC 1XAUA 1A3LL 3HC4H 4F3FB 4JO4L 1QBMH 2YD3A 4Y5XA 3MRFA 5HYIA 5INDB 1LWRA 1KB5B 1IQDA 4P2YA 4FFVD 5GS1B 1EEYB 2A2QT 2OLDA 3STLA 3VFUA 3UBXB 3GSVA 3RIAK 3EFDL 5C2BL 4Y19A 1F3DJ 4JPKH 5H35A 5FUZH 2PUQT 4MNGA 5A2FA 3GJFA 1CDUA 3CU1A 4NYLA 5E8EB 3JBG7 3O2DL 1RULH 3L3OA 4ODWB 3D0VA 3MOQA 3KPRD 3ZTNH 4I18C 1HHHA 4G9DA 5ERWA 3OPZL 5DRZA 2H26B 2HKHH 3OF6D 5FV2A 1AO7B 2XRAL 5D7IF 4ZUTB 1XZ0A 5DGQA 4X98A 4MA1B 1INDH 4L3EE 1IM3A 4FQXA 4FQ1H 4UDUB 3U36A 4HS3A 3LCYA 4RGMC 4AIZA 1G6VK 5BRZD 3MLUL 3LHPL 3WE6A 4Z7WE 1S7UA 1JNHA 5HHMB 4K9EL 1UM6H 2R1XB 2OQJA 3U83A 5DK0B 5D1ZC 5SWSD 4PP2B 5IVXF 1XGRA 1NAMB 4YHIB 1II4E 4Q0XL 5HBBA 3MV8B 3MV11 2IWGA 3MUZ1 2Q8AL 3TIEB 4U1JB 5L88H 4GG6B 1P4BH 5IV2B 3W2DL 3C6LC 5GRXG 3PV7A 1KIRA 4TUKL 1MEXH 1R3LB 3HFMH 2IEPA 1AXIB 1JGLL 4C58B 2XPGA 4OCLC 4LCWB 2BNQE 4F7MA 3SBWC 5CZXD 3I75B 5D5ME 4Q9RH 2FJHA 4HCRA 3GSRB 3HA0A 3OJVC 4KKAD 1K4CA 1QLFA 4NBXB 4JVWA 2XFXA 4M6NH 1VB9A 1L4IA 3N0PB 1FL3A 1HYSC 4I77H 3OKEA 2CUHA 5GRJH 5KSBF 4I18A 4JDVA 2XZCL 3PHOB 3UTTD 1DBAL 3CDYA 3OB0H 1AHWB 4JVUA 5C0BD 3ZL4H 5IGXL 3KXFE 2YPLE 2FATL 5T1KB 1DANT 4HC1H 2ESVA 3GGWB 3W0WB 4JE4B 4Z18A 5TE4L 2R56H 3TO4D 3ARDB 4KI1A 4NO3B 4CDHA 5D7SL 4GUPB 4C4KT 1XF2A 2FO4B 5D1ZA 2APFA 2RB8A 2WWKT 5FB8A 2YEZB 1MFDH 5B38G 1HCFX 4GKNA 4PJCB 3UTQA 2FDBP 3N1MC 4PTUB 1EJOL 1WCBB 4MX7A 3C6LA 1NBYA 4K7PH 3VGHA 3BUYA 4P3WA 2HT2C 3GFUA 25C8H 2Y72A 4PR5B 5HYSB 1YPZA 5TE6H 3PE9A 1NUFA 3SBWA 3WDJA 3DXAA 5CBEA 1I1RA 4F15C 1MPAH 2FX8L 3VXMD 4DVBB 3SCMD 1EFQA 4NKIH 5SWZB 3LPFA 4OLXL 4KPHH 4U1GB 3H9SA 3O3DA 1MJ8L 4MCYA 2FJFA 1M05A 4KQ4L 3D85D 1R3KB 3DSFL 5LJYH 3Q6GH 1HDMB 1EZVX 1DE4A 4XBPB 4N1HB 2Q86B 2D03L 5I73C 2H9GA 1WF5A 3BWAB 1B0WA 2BOCA 3BW9B 4DOHB 4D9QD 5BV7B 3QDAA 4K71B 4P46B 3PWJB 1KXTB 5GGSB 5KSVA 5CD3B 3OV6A 5JDJA 4BSWA 1AGEB 2P42B 4HG4K 1MFEL 1DVFB 5GISH 4OI8A 1Q9KB 3L5XH 4ALAL 3S96A 1KJ3L 2WANA 1D3CA 2C9AA 2FEEI 2ZUXA 5C0RH 3TV3L 5IHZA 1T03H 2HJLB 3O6LH 4WW2C 5HDBF 4C4KO 1DZBA 3G08B 3S35H 1BF2A 2WWKO 5JDSA 4WHTB 1WWCA 2NY2B 4ONOA 2WNGA 3T2OA 4Q6IB 2YR3A 4ZAKB 1PG7L 1MCQA 1CFVL 3L7FA 1SBSH 4JQIL 3S9DB 1UXWB 1Y6MR 5E4EC 4UUJA 32C2B 3RU8H 2OR7A 4U7MA 2AJXL 8FABB 2R8SH 4NKMB 5KS9F 3VXUD 3RJQB 5GGQH 3ARPA 4OAWA 2IAND 3K3QA 5T3ZH 3O11A 4WFHD 2DLTA 2J5LB 4HUVA 1XCTA 1VGEL 4LLVB 4U2ZA 4X7SL 2EYTB 1MLCA 2L7JA 1IGJA 4XCEB 4EUPH 2BVOA 3U30C 2KPNA 3UTSE 3JWDL 5F7EH 3SQOL 3GNMH 4P9HH 1NMCB 2EZ0C 1RIUL 2O61A 4WNQA 3QFJE 3IAQA 5C0GB 2BSTB 5HGBA 4UINL 4BM7A 2ED7A 5HGAA 3D69B 1RVFL 4LSQH 3LH2L 4OCXL 1NBVL 5AZ2H 1ZMYA 4P5MB 1YEGH 4WW2A 2QR0B 4GMSL 1I1YB 1F42A 4TYUA 2FBJH 1EMTH 3RGHA 4JY5L 1A4KA 3BJ91 1I3RB 1SJXA 3PL6B 3NCBB 4FZEL 4KHTH 4XXCC 4PD4J 1ONQB 3GMMA 1DUZA 1U36A 3T2PA 5LQBL 2X89A 2H32B 4N9GB 5CJBA 2GIYA 3BDYL 1EO8L 3QUZD 1JCKA 4RQQA 4RWHA 1KIQA 4PGEB 5TH2A 4Q74A 1QR4A 2XWJB 1JPSL 4HWUA 5EUOF 1WAAE 1HH9A 4F2MA 1M7XA 4XNXH 4LGSB 4JVPA 3JUZA 4P57A 2Z92B 4PJHF 4ZMAT 2R4SL 4M9OA 5B38B 4HHAA 5C8JB 2EKSB 3L3IB 2D9QB 2AV7B 4YH6A 3MJ8B 1F58H 1G7PA 2NZ9C 3FZUC 3MLZH 3PWUA 4JRXA 1M7DA 3TN0B 1LDPL 2GJ6D 1XF4B 4H26A 3VI3F 1I1CA 5FO9A 1E6JL 2UWEA 3OAUH 4LSTL 2RQ8A 2FB4H 2Z91B 2GHWB 3RX5A 1YECL 1YQVL 5FO8B 4CNIB 4DGVL 1O0VA 2EH8L 1WFUA 2HVJA 3QXDA 1JNNL 3DRTA 5K93A 4N8VG 4CN1A 4DUWA 5M7QA 5EO0A 2P8PA 3QIWD 3V4VL 5CMAB 1T04B 3MUJA 3QI9D 4NQCE 5GZOC 1RUMH 4YGAB 3IFLH 1KCVH 4XXCA 2EIZB 3W11D 2EDOA 3ULUH 2HKFH 4XCNA 2R2CA 4YXKL 5IBLD 4CUCA 3A6BH 4OSUL 4HUMB 1IEAB 4OZFH 3CLEL 4LFHD 1J0KA 3IXAB 1Z2KA 4EXPX 3D9AL 4XGZB 4F7CB 2X42A 1F45A 3H0TB 3R8BB 4HIEA 4I2XA 3DO7B 1HINL 2GTWA 1SJVA 4XMLL 5EOTB 1Z5LA 3GEWB 3X14B 4NO2B 5IB5A 1B2WH 3NTCH 2J6EL 3SJVE 1U91A 5L7XL 4Y5XB 3MRFB 2G5BA 3QUKA 1IQDB 2QQKH 1M6OA 4C56D 3KPTA 2VKWA 5D7LD 1P53A 4XCCL 4ZUUB 15C8L 3VFUB 3GSVB 3IFOA 4NFBA 2P49B 1MF2L 5H35B 4H0GA 3CFCH 4MNGB 3GJFB 4MAUH 4NYLB 3BP4B 5ALBL 5CZXC 3L3OB 3D0VB 4WFFD 2HVKA 1HHHB 1RU9L 4G9DB 4BZ2L 1U3JA 4S0SD 2D7MA 3ZT5A 1U95A 2LQRA 2AK4E 5DRZB 3P4NA 5J12B 5I8EA 5I8KL 5DO2D 5IBTL 2ARJB 3VFMA 1XZ0B 1OF2A 4X98B 3KPRA 4GRWH 4KRPD 3U0TA 4FQXB 3U36B 1S3KL 4X4MA 1S7TA 4AIZB 5GRVK 2D0GA 3OF6A 1GZPB 1L6ZA 2GJZA 3FT3A 3WE6B 2JCCE 4D0DA 1AFVH 3BQUD 2OQJB 4NFDA 3P4LA 4HV8B 1ZLSL 1XGRB 5I16A 1KF9B 2VDNL 2XN9D 3WFBL 3UAJD 5FUCE 5EC2A 5BRZA 5JA8B 1FH5L 2DN7A 4S11A 1PKQE 5JW4R 1R5VA 3AM8C 5CJ8A 5F6IB 4Z7OE 5HYEA 2LU4A 3UYPA 1CLYL 3BDXA 3L7EA 1DANU 1Q0YL 1TJHL 2XPGB 4WJ5A 4G8GD 3OKMB 5JOPD 2M8XA 5KTEL 4Z7QE 3MYJA 3KLDA 1MLBB 1F02I 5D7JC 1J86A 2CR3A 3LIZL 5KG9A 2FJHB 2CSPA 2BNRA 4PRPD 1QO3A 4R9HA 3DNKA 2XFXB 3PGFH 1A02N 1BQLL 1FL3B 3WIIH 3OKEB 3GBNH 4XPTL 2XTJB 3X3GL 2RR3A 4I18B 1DL7L 4JDVB 5EG6C 3SCMC 3MNVA 4R26L 1I3VA 1PY9A 1U8KA 2GI7A 1UYWL 2CRZA 2OK0L 1X5LA 2PYEB 3UTTA 1WFNA 4RGMB 2I9TA 3IKKA 3ZTNL 5C0BA 3JTTA 1D6EA 2A74B 4KJWC 5L2JA 5CZKA 1XF2B 5D1ZB 3DUSA 1OP3H 4XC1L 5IVOA 1NGZA 3KPMA 4GKNB 5IHUL 4MX7B 3D1MC 1SVZA 3AM8A 3C6LB 1NBYB 4OB5H 1U8IA 3BUYB 1UM6L 1B4JL 2VWEE 1MNUL 4UDTA 3WMSA 1NL0L 3HZYA 3R4DA 1FN4A 3L95A 3NIGF 4GG8A 3DXAB 5CBEB 3IU4L 3MLRH 4M3JA 1P4BL 4XNZC 1RURL 4DEPC 4C83A 5IKCA 1MRDH 3QDME 5FM5M 3H9SB 3O3DB 4TOYH 4MCYB 4L1HA 3PQYE 2FJFB 4HD9A 1M05B 5T3XL 3VXMA 3SCMA 4CVZA 3EO0A 4ODUA 5IESL 4HLZG 5IK3A 5E1HB 5TQ0L 1OP3K 2YS4A 3RJDA 3H3PL 2YZ8A 2Y07H 4X4XA 5C08D 3MRJA 1B4RA 2E9JA 1S5IH 1QHPA 2H9GB 2BC4A 3D85A 5TDPA 5B39G 1GGBL 1A6ZA 3GI8H 4ETQA 2VLJE 1BMGA 4S1DC 3NABL 1CD0A 5KSVB 3GMRA 4LSSH 4BSWB 2Z35A 3QUML 3HE6D 5D71H 5CHNB 4Q9QH 4ORGA 1F2XK 3T0XA 1KXVC 4E0RB 3TWCL 3Q6FA 5I66A 1G7JB 3TFKD 5CP3A 2XA8L 4YX2L 4OZGE 3RVVD 1T7XA 3OMZA 2DTSA 5JDSB 5HGDA 3ARUA 4YHKL 1IGYA 2X4TA 5CZVH 1R3IH 1T21A 4F15B 4I3RL 3DVNA 1CF8L 4M48H 1OAUH 4WCYH 3HCVA 4E41E 3L7FB 3I84A 4R4BB 3UROR 2NY6D 1PX4A 1N0XH 1XGUA 1IAMA 2CO6B 5K9QG 3ZKXB 4L4VE 3QG7H 3QRGH 2EDTA 1VPOL 1UB6A 5D2LF 4X99A 5EU6E 3O11B 3TNMA 1Z9LA 4HUVB 1XCTB 4KK5C 2F58H 4F37F 5IW3A 4L5FH 2PW2A 3E6HB 3VXUA 2JK5B 2P24A 5AD0A 1LK2A 5I73B 4GJTB 2IANA 1CN4A 1MLCB 2X09A 1MJ7L 1IGJB 2UZIL 2BVOB 3BESR 2Q1EA 5HHOD 3RWDA 2YXFA 3E8UH 1L7IL 2O61B 2GY5A 4OFKA 1AD9A 1NFKA 4LOUD 4HPYL 4WNQB 4BJLA 4KKLD 1T83C 2C3HA 3DURA 3ARFC 1JRHI 5ISZA 4PJBE 3MRDA 1T1YB 1GC1H 3HRPA 3QNXA 3GMQA 5F6HJ 1G9MC 4WW2B 1FV1A 2D31B 2JELH 1UCTA 3EYUL 1L0QA 1V3KA 2VDQH 3EO9H 3KPNA 1KG0A 2AGJL 5EOCH 3VWKB 3GMMB 1DUZB 3QH3A 4LVOC 3MNZA 5INCA 4KV5F 3QIWC 2A6DB 3LKOA 3LEYH 3TBSA 1QRNE 5E4EB 4RQQB 3ZTJG 3NN8A 2OS7A 5TH2B 3VXRA 2ZUSA 5HJ3A 2V2TA 3PIQB 5L8KB 1LP9E 3MACH 1HH9B 4F2MB 3GSNA 5E24E 2FLBT 4P57B 4HHAB 5IBLC 4XMPL 3V7MA 3HC0B 3OR7A 3NFPA 4LHUG 2R0LL 3FQRB 1G7PB 3RU8L 5CP7A 3ZE2F 1P84K 1ZTXL 5M95B 2R8SL 3PWUB 4JRXB 1M7DB 2EH7H 4AIXA 5SX5H 3CZFA 3KPSA 1DQTA 2P45B 3FHQA 5GQBA 2HRPL 4MLIA 4Z7VB 3LKQA 4NGHL 1SBBA 3O6FD 1FBIL 1KCUL 5ILTH 5FO9B 1T83A 1FFQA 2UWEB 3L5WB 2GJ6A 3CCHA 5CJOH 4ELME 4OD3L 3ARFA 4D3CH 4DZ8A 5E08L 3DMMC 1KN2L 4HF5H 1EGJA 3PNWB 4NQTA 4LNVA 2HVJB 3PDOA 2KL6A 3QXDB 3DRTB 3KHQA 5EO0B 1MWAL 43CAA 3IAPA 2MNUA 4MMXC 3TC9A 1X44A 2BVYA 4FQCL 3L3KA 4LRNL 4PJDE 2AJUL 2DDQH 3SDAD 1WTLA 2R0WH 2GTZA 4KU1A 3KJ6L 3FN0L 3WUZA 3QIWA 1TDQA 4RMWA 1F4WH 4M7KH 4XCNB 1YEGL 4KUZH 3VG9B 1BD2B 1RUAL 5KVGL 5FA4A 1QPPA 1TVDA 2NMSA 2W9DH 3MA7A 4KHTL 3HMWH 2J8OA 2PR4L 4MD4B 4JO1H 5GPRA 1G9NC 2CH8A 4O51A 4WGWB 1SYVA 4Y2DC 2IMMA 2DTML 4HIEB 4I2XB 3O0RL 4KHXL 3O41A 4XWGH 2YD5A 1NCDH 4BZYA 5HPMA 1P84J 4M1CD 2BX5A 2GTWB 3O3BA 4N90E 1Z5LB 3TA3D 3JZ7A 2R1WA 1WFOA 1U91B 5EOCJ 3UAJC 4F8QA 4LDOB 4MA8L 2J8UE 2G5BB 4GH7B 1GH7A 1JZ7A 3VGDA 3DMMA 2NPLX 3QUKB 4NQVB 1M6OB 1JTOA 4QHKJ 1EJ6A 1JHKH 3IFOB 6CGTA 5ETUA 3CX2A 4NM8H 5DT1L 3ZE2E 3TIDA 1Z0MA 1XR8A 2YK1H 2FB4L 3WD5H 2HVKB 3GI9L 1MCSA 3BH9A 4NCC2 3EFFA 1YY8B 2VMFA 3R1GH 5BZWA 4NNXA 5I8EB 4J3TA 5ESVA 4PJ7B 4OZHB 5JIIA 4F7EA 3VFMB 1OF2B 3KPRB 4KK9D 3U0TB 1KCVL 4DN4H 5JORA 1YA5A 3ZE0E 3FT3B 4D0DB 1YEDB 4Y2DA 5I19L 1CFTA 3T0DA 5I16B 4NHUA 2EYSA 5EC2B 5E95B 2OCFD 5BRZB 4KJPD 4JO2H 5DJ2A 4PGCA 3QCVH 2OR8A 1J10A 1VESA 1QFWI 5SWSB 3GSQA 3FRUB 3M8OH 3VD5A 2XN9A 4JQXC 2IQ9L 2ITDA 4WJ5B 4X6DF 1FAIL 3GMNA 2DQHL 2UUDH 2ZSVA 3MYJB 1U2HA 3OG4B 4LPUA 3CDCA 4XVTH 4YO0A 1DSFH 1QO3B 2DWDA 4G8GA 4K94C 4HBQA 5KANG 1G7LA 3RIFK 3ARBD 1J0ZA 2ID5A 1BEYH 3MNVB 1IGTA 1GGIL 4RRPG 3K74B 4WW1A 3E0GA 4IRJD 4NOBA 3S4SG 5I76B 5J8OA 3AAZA 1TJGL 3KNBA 1OB1A 3F12B 4MAUL 1UM5H 1EBAA 3BN3B 1B6DA 3UTTB 2I9TB 2DQTL 5F9OL 1ZT1A 5C0BB 3JTTB 3KGRA 1D6EB 4MJ6A 1MFAL 1UM4H 2AV1A 4Z95H 1EPFA 3RQ3A 3VJ6A 3DUSB 3RUGF 5BXFA 2R2EA 1NGZB 3KPMB 4QRSB 2X4RA 1OAZH 2VLMD 3HHRB 3TO4B 3L1OH 1CCZA 3INUL 5AWNH 5JQ6L 4ZXBD 1CDBA 2Z93A 1UACL 1N4XL 3HE6C 4HXBL 5B3JF 2WAHA 4JQXA 1AIFA 4UDTB 3HZYB 3NMEA 1ZT4A 1NGQH 2NW2A 4R7DA 1XGYH 1FN4B 1KIPB 5GGRA 2GW5A 1KBGL 1TZIA 2GQHA 4AT6A 3TFKC 1P2CA 4GG8B 2A6JA 1UZ6F 4OF7A 4P2QE 5DSCA 3U2SA 2QSVA 4DW2L 4UNVA 3LMJL 5CS7A 4HUXA 2DKSA 3O4LD 3RVVC 4C83B 2IBZY 5IKCB 1ND0B 1FC2D 2VRAA 2VDPH 2CRYA 2V9QA 5K9KA 5DVNA 4OFIA 5AUMA 4NN5C 4YDKL 3VXMB 3SCMB 4CVZB 3EO0B 2NY6C 4YDLC 4ODUB 5IK3B 5T1LA 3U7YL 3MCLL 1J5OH 1X4ZA 4YXHL 4X4XB 4ZD3H 2DQGL 4NUGH 4GBXD 1J1PL 5TDPB 2BC4B 3D85B 3KYKL 4QRRD 3WIIL 1ACYH 2BXZA 3QEQE 1A1MB 4PJ5A 2H8PA 5C3LD 4M1GH 2W0PA 5C08A 2Z35B 4PP1D 1ETZA 3FMGL 1FJ1B 2HFGH 1UXSB 3FO9A 1NFDA 2DKMA 3WFCL 4X6CA 1LHZA 2F53E 4LU5H 4QGYA 4ORGB 3RWFB 4OLYL 4OGXH 4HFWB 3Q6FB 4OM1L 5I66B 5E8OB 5BS0D 4LFHG 4LOUC 3IJSB 1BQHA 3HE6A 4KKLC 1IC1A 2OL3B 4QHNA 3B5HA 3GSOA 5DTFB 3CFKA 3D5OF 5F7LB 4HPOH 3SDDD 1FZOA 4OBRA 5HI5D 5GGRY 5HGDB 4U0RC 4UQ3A 1D6VL 1IGYB 2X4TB 1T21B 3DVNB 1K9TA 3PWNA 3V5DA 4J1UA 4KROD 4XNZB 5E9DE 4DEPB 4Q9CA 5B8CC 3MOBL 2LU3A 1MJUL 4OB5L 1XGUB 1K8DA 3RUGE 4UNTA 2C4FT 4WV1C 4U1LA 4HKJA 2X6MA 5ACLA 1CG9A 5FHBH 4P5KA 5GS2H 1UB6B 3DTXA 4M62H 4X99B 2JB5L 5E7FA 4YPJA 3TH3T 3TNMB 3UYRL 3VFSA 5IFHH 5I8OL 2AKRA 2PW2B 3VXUB 2P24B 5AD0B 1LK2B 4OIIH 5E6YA 2HTLD 2IANB 3S3PA 2NXYD 1G84A 3O45A 3CFDA 5IHBA 3S5LA 3RWDB 3I6LE 3V4PH 1MVFA 3F7QA 3IGAB 5F9WB 1TTGA 1AI1H 2ICEA 4I9WE 5HHOA 3O6FC 2AJSH 4OD1L 5EWIH 3QNXB 1AO7E 1MHPL 3ZKQD 3BRGC 1FV1B 3TT3L 4KVNL 1JZ8A 1CYGA 2CR6A 3LKRA 1FGVH 1I9IH 3E3QE 2IG2H 3UO1H 2X7LA 3KPNB 3QO0A 1R5IA 3S4SB 4Q9QL 3QYCA 3OX8A 3QH3B 3HNSL 3MNZB 5INCB 5B8CA 3IXTA 5E0QA 4M7LT 3LKOB 3TBSB 4DFHA 5CILH 4KFZC 3NN8B 3MV8E 5HJ3B 2V2TB 4K8RH 4FQ2H 1T1ZB 4GG6E 3GSNB 2MQ3A 2ED9A 3QCUH 3QUZB 3W39A 2PTTB 3MLWL 1DBJH 3BWUC 3ILQD 3NFPB 4FFZH 1PBYA 1DLFL 4GO6B 2FEEL 2EDRA 5F44A 4LCWE 5HXMA 1AE6L 3QG7L 4P9MH 4FFYH 2DMBA 3EUUA 3T2NH 1PYWA 1JWMA 4HK3J 3NH7H 4XPAL 4JG1L 4N68A 2ZCKL 2P48B 4OLWH 3LKQB 3T0BA 4OQTA 2KDGA 4PRNA 4HJGA 1P6FA 4M1CC 2GJ6B 3CCHB 4N8CL 1KENL 3TA3C 4DZ8B 1GGUA 3O6FA 3DWTA 5I15L 4LF3A 1QBAA 3PDOB 4A6YB 2R2HA 1KNOA 1BWWA 1AQDB 1RMFL 3OXRA 3TH2T 1NSNH 3W0WE 4EUPG 4QHUA 2RCSL 5J6HA 2IALA 2XA3A 2GTZB 4TVSa 4LVOB 1GOHA 3BE1H 5T33H 3TCLA 4YBLB 4BZ1H 3QIWB 3QI9B 5FGRA 3U9PH 2ZOKA 5EO9A 5DJXA 4AMKH 2VDQL 3ZDZE 2UY7A 2DICA 3CX5J 5FA4B 2CLZA 1SEQL 2VE6A 4PJCE 5FOJA 3MA7B 4YXLH 3SKNA 2P8LA 5CGYD 5F1IA 1X5XA 3HC3L 2VXTH 2WK2A 4O51B 1CE6A 3P3YA 3TZVD 1SYVB 1UH3A 5FUOL 5I18H 5DWUL 3O41B 5IBUG 2V5TA 5HPMB 4U1IA 4PTTA 4QF1A 1QNZL 4R2GD 5GGVH 3L3GA 2LTQC 3OZ9L 2JKXA 4HWBL 3PP3H 2EC9U 5F93C 2Y5EA 1C7TA 1WZ1H 2VDRH 1E6OH 1VEMA 3FFCD 4KJPC 3OGCA 3TA3A 1ZLWK 4K2UH 2EH7L 5CINH 3S7GA 4GXVH 4IDJL 4NZUL 5ICZA 1TPXC 3QUYC 4GMTH 5KZCD 5ETUB 3T4YA 3X13A 2Q76A 3G04A 3Q3GA 1ODAA 4C56B 4IHOA 1XR8B 3TO2A 5D7LB 4DOHE 2R29H 1ADQL 1JWSA 3WDHA 1DQQA 4JLRA 5BQ7B 4MB3A 1SY6A 4PJXF 4JKMA 5BZWB 1MCLA 4O2EB 4NNXB 5ESVB 1WZLA 5F9JA 4RISH 4H88H 3LZFL 5I1IH 1BZ9B 2YD1A 4AG4L 1HKLH 2DI8A 1FVDA 3ARBC 4OKDA 1CFSA 4LNRA 4NN6C 3RBSA 2VKXA 2WIIA 5JORB 3U1SL 3V8CA 3QFJD 4G7VH 2DM2A 3V0VA 4IRJC 4URTB 2H6PA 3DVIA 4R96A 2J88H 3BPLB 4M7KL 1IFHL 2BSED 4KRPB 4UT9H 4LCIH 4NHUB 5ANMA 2PO6D 2LE9A 2N7AA 2ICWJ 2UY6A 3K80A 4YDVA 3U4AA 5DJ2B 3BQUB 4JHAH 3RA7L 4NQSA 3GSQB 1JJUA 1TETL 4I0PC 4TUJA 3EJJX 2XN9B 4JFED 4PJFF 4ZOEA 3SGDI 1LEIB 4XNUL 3LRGA 4PRDA 3VD9A 2FX9H 3U4BH 2HFFA 3VD3A 2ITDB 5H94A 5MEOB 1CGTA 5GRWA 4ZXBC 3GMNB 1GIGH 2ZSVB 4L8DA 4PJIA 2Y9RT 1INEL 3PP4H 5D70L 3QUYA 3TBVA 2I07A 2V17L 1D5MB 2DWDB 4G8GB 3LKPA 1MREL 1OOAA 1BJ8A 3PHSA 1G7LB 2PXYD 4JM2C 1IGTB 3HAEA 3N85H 4XMKL 4PRPB 4X5WA 1KELL 2VN7A 5B21A 4LGRB 1JHKL 3AAZB 1OB1B 1Z3GH 3ARBA 1FIGH 5ESQA 2NY4C 4TVPE 2P7TA 1YEIH 2H2PD 4LDLB 1ZT1B 4HEME 4IRJA 4MJ6B 2AV1B 3VD7A 2D4DA 4J23A 5C71A 3VJ6B 1RUPL 4GBXC 3Q48A 4JFQA 3IDJA 3RDTD 2X4RB 1C5DA 5F3HB 3B2UD 2VZ3A 1AQKL 4NQCD 3O2DA 5AAWA 4PP1C 1QZ1A 2Z93B 3ES6A 2CDFA 3LOWA 1AIFB 3QAZB 2P5WA 4R7DB 1ZT4B 2W9EL 4MQ7A 5GGRB 4BQ9A 1E4WH 1BGXH 1ZHKA 1TZIB 4AT6B 3UDWC 4ZXBA 5DSCB 1FNEA 2A6JB 1CBVL 1FC1A 3U2SB 4HGKC 1JI2A 4FQJL 4HGWA 4NPYB 4HUXB 5GSVB 5ID1A 1W0YT 4J3UA 3SDDC 3EOAA 5HI5C 4FFWD 5K9KB 3QJFA 4NWTH 4Y8DC 5AUMB 1JIBA 4JM2A 4PGBA 4N0UB 3RTQD 3RWIA 4KROC 4LSRH 1ZVSA 5K59F 3O4LA 5J11B 3HE7C 5E2JA 4MXQD 4XVSH 4XTRD 2V9TA 1B3JA 1UT9A 3MLXL 3BGMA 3U0PB 1G6RB 1WBYA 3UP1A 2DLIA 4YBHA 1S7WB 3VFPB 3STBA 2DBLL 3FL7A 4Y2OA 1FFRA 2CKNA 3SJVD 3VXTA 1L9NA 5JUEL 2DWEA 3IVKA 1RZGA 2H8PB 3MROB 3Q1SL 5C08B 2R69H 1ETZB 4I0KA 4GBXA 4NJ9H 4QRRA 4GRMA 2NXYC 1I8MB 3FO9B 1NFDB 4HXAH 4TVPL 4X6CB 1BIHA 5FYLL 4YAQA 1S7XA 4HS8L 5MEQA 3HE6B 5IB1A 4D8PA 4QHNB 3GSOB 3HPLB 4LVHC 3GRWH 1FZOB 3AXLA 4MMZC 3LS5L 4UQ3B 4NJAH 3UDWA 1MCIA 5BS0A 3EYSL 3FQNB 3V5DB 4J1UB 4TNWF 5AWNL 3QIBD 5ACZA 2B1AL 5KN5A 3C5ZC 1NLDL 4AEIH 3SDDA 1K8DB 2F8VA 1T89A 3NCJL 4U1LB 4HKJB 1QFUH 1CG9B 1XGYL 4NN5B 4RMQA 2QJDA 3BXNA 4P5KB 1BFVL 3DTXB 4ZG1A 1BX2A 2NY6B 4YDLB 3HE7A 4XPGL 1CLOL 1SJHA 4FXGA 1HI6A 1MRFH 3VFVB 4FOMA 5GS0H 3AS0A 3SQBA 1D5IH 2F19L 2DQDL 1OCWL 4U0QB 5ADPH 4YHMH 3O45B 4X9GA 2A6IA 2QBWA 3BKCH 4HUWA 1H5BB 3ILQC 5DRNB 1WWAX 3OTTA 4Y19E 3CC5A 2JF1A 4MNGE 5T3XD 1J5OL 3BO8A 4ZD3L 2ICEB 3C8KA 4U33A 4XRCA 5HHOB 1XGQA 2BSSA 5DD0L 4JO3L 4PPTA 4FTVD 5BO1H 1X5FA 1LNUA 3LKRB 2G9HA 2IPTH 1LVEA 5BMFH 4U0RB 3QO0B 1KN4H 1R5IB 3HI5H 1A14H 3SGEI 3WXVH 3OX8B 4X9IA 2IC2A 5B8CB 3IXTB 1NGPH 3C5ZA 3AUVA 3BMVA 3JWDC 5A2JH 3BYYA 2QQNH 4AZ8A 4IRSC 1WWWX 5I1GL 5HVFB 1MCRA 5E00A 3W39B 2ZUTA 4X5XA 5JR1H 1T20A 3PDGA 1P4IH 5CGYC 3HAEG 3BJLA 3HR5A 4P3CH 3VD4A 4Y16C 4KKBD 1FO0H 1PYWB 1JWMB 3TZVC 3CD4A 4TQEL 3MXWH 2V5SA 4PRNB 2QKIA 1ED3A 3AY4C 4HJGB 2YPVH 5D7IA 5B3NA 2VABA 3LDBB 2VDOH 4R2GC 3I6KA 2B8OT 5FCUH 4GXUM 3S88H 2VITA 3O6FB 4LF3B 4EBQL 3K4AA 4WGVB 2R2HB 3T08A 3G5ZA 1KNOB 2CRMA 5F72S 2EIEA 5CSBA 3NPZB 3SDYL 2HMID 5IVXA 2ESVE 1K85A 2E9BA 5J6HB 5D96C 2IALB 1Y18A 1U58A 4K3GA 4HIIA 4KK6D 1Q9LB 3PUCA 3X11A 4JAMA 4M8QA 2VLJD 4MJ4A 2ZOKB 5EO9B 5DJXB 4HH8A 5GSRA 3CK0H 3B6SA 2VE6B 3SDAB 2VH5H 4RDQF 4IRSA 5DGRA 1JMZA 4PRID 5F1IB 1CE6B 1IEHA 3RPIA 1JRHL 1WBXB 3BP6A 4M61A 1YPZE 3ALXA 3UJIH 1KJ2H 4K8RL 4Y16A 3DXAE 3AMLA 4U1IB 4PTTB 4QF1B 2NNAA 4N8PA 5KSBA 3MR9A 3TZVA 3L3GB 1NMBH 3BX7C 4XP9L 1RJCA 1T1WA 5CUSH 2DI7A 4FQQA 1KLGA 3AY4A 3H9SE 4EN3C 1T0MA 2DLFL 2PO6C 1IMHC 4E41D 5F7KC 1H3PH 3OGCB 3TA3B 1AKJD 3CNKA 1ZAGA 1B0RA 1FP5A 1VERA 4OKVA 4OLWL 3MJ9A 5ICZB 4ZS6D 2V9RA 3FFCA 3T4YB 5EU6D 3X13B 2XTLA 2Q76B 3MLVL 3C5JA 4RAVA 3G04B 3Q3GB 1OGAD 4IHOB 3TO2B 4CMMA 3FO0L 1F4AA 3TJHD 2Y36L 5F9JB 3D39A 3B43A 3QEHA 4OI7A 1F13A 4PV9A 1FVDB 1T66D 4LVNC 4LNRB 2WIIB 4F9LC 4H20H 3C6SA 3V0VB 1VSCA 4LMQI 4R96B 2NW3A 4QRPD 4W6XB 3UXFA 4QNPE 5DEGB 5KSUB 3NCMA 5E5RB 2H2PC 5IMOA 5MI0C 5EORH 4YDVB 2LTQB 5FGCB 4NQSB 4WI3A 4TUJB 4EN3A 2I25N 2PO6A 4AJ0A 2R15A 3RDTC 2EC8A 3DVGA 4PRDB 2GJJA 1KCRL 2HFFB 2J4WL 3B2UC 1WFTA 2EDKA 3C2SA 5H94B 3VCLA 5J56B 4O02H 1RIHH 1MCHA 3LRHA 1FORH 4XC3H 2G60H 5JXED 1H3GA 4PJIB 4JFEA 4K23H 1AGBB 3WFEH 1TPXB 4X80H 3TBVB 1XGPA 1UWGH 5C0CD 1GCFA 2DF3A 5I1EL 1RQ5A 4M1DL 1DUYB 1UCBH 1VFOA 2VLLA 4EI5D 1M1SA 3HAEB 3V6BR 2ADFL 2DQUL 4X5WB 1XCQA 4FFWC 3OAYH 3S6CA 2J6EA 1R0AH 4Z0BL 5DFVD 4HJJH 3ARBB 2ADJA 4NN6B 4XH2A 2DQFA 2P7TB 3T8XA 4YHNB 3RVWD 4MXQC 4XTRC 1DBML 1IKNC 4MXVF 4IRJB 3GMLB 3HI1A 3NVQA 3QXAA 3VGEA 3VW3L 1HK6A 1A6WH 3D0LB 4ZTOL 1VCAA 5KVEH 4WRLA 2O5YL 4EJ1C 4JFQB 3IDJB 5I1IL 4NO0D 1HKLL 5KS9A 3LQAH 1C5DB 1B90A 2CPCA 2EYRA 3ES6B 4WI8A 4QRUA 2CDFB 2MCG1 1C8PA 4GLRI 3V6ZA 3RDTA 2OZ4L 4JN2B 3CSGA 1KGCD 5DZNA 4XCFH 4WFED 4FP8H 4JFZL 2MKLC 4LAQL 5HDOA 1XF3B 5DC0A 4ZXBB 1FNEB 3B9VA 3EOBA 3QPQD 1U93A 2NR6D 3G5XA 4HGWB 5JW5B 5ID1B 3Q5TA 5HGHB 5L6YL 3EOAB 5D93B 1UKTA 1CLCA 1Y0LA 4WUKL 4YNYB 1YEFL 1P7QD 3QJFB 4JRXE 1KB5H 1RV6X 2XNAB 3VXOA 3RWIB 4XXDA 5IQ9A 1U8HA 4UT6L 3O4LB 1DBKL 5EZLA 5H37H 3MOAL 4R8WH 3BGMB 1WBYB 1S9XB 4PJEA 5CSGA 1RZFL 2NY4B 3VXTB 1QFWL 3OSKA 1PD6A 3IVKB 3CSBA 4HUNB 4LIQE 2YRLA 1QYGL 3VRJA 5LCVH 7FABL 4GBXB 4QRRB 4GRMB 2QHRL 2DYPD 3ULVF 5EUOA 1HEZA 1VDGA 1UWEH 3UTZB 2VL5A 5J13C 4YAQB 2GITB 5ID0A 2IFFH 1A4JA 1S7XB 4PJHA 4DQOL 5MEQB 3LN5A 5IB1B 4UZGA 1G7HA 4GKZA 4D8PB 5HPOA 1NAMH 3WS3A 1TVBA 3AXLB 1A7QL 2ZWLT 1C5CL 3JV0A 5C7XL 5BS0B 3L6FA 2BDNH 2F5BL 5B22A 4G6AD 2IBGA 2BY3A 3PF2A 5KN5B 1HKFA 2VJXA 4I2XE 3SDDB 1DLHB 1J88A 4YZFF 4Z76A 1M7IA 4P59L 1GGCH 5EZIH 4KMQA 3BXNB 4KROB 1E4WL 3MV7D 3O2VH 1BX2B 1YYMH 1SJHB 4Z7WB 4D0CA 2Y06H 2EDXA 3FN3A 4IS6A 5FOBA 1N59B 4OM0H 1VHPA 2XZAL 2YPKB 4NWTL 4HZAA 3VDCA 4FQHB 5DQJB 1KCSL 1VFBB 2A6IB 5D72H 1DBBH 1T2QL 2X40A 3L3JA 2A83A 1TJIL 4ORZC 4AEEA 2NXYB 2VN4A 3KS0H 4KKBC 5HTSA 1TZGL 3BO8B 1I8LC 4QXTA 3OWEA 3C8KB 4RGNC 4LSPH 5E2VH 5LBSL 1XGQB 1IAII 2YA1A 4K07A 2FHCA 3MRMB 4Y8AA 1WVZA 4N9OB 1MHCA 4EOWH 4LVHB 2G9HB 3KPRE 3S36X 2AXGA 4WIQA 2VXUL 4X4ME 4JZOA 5DK2B 4FTVA 1FSKB 1S9VA 1IBGL 4X6BA 5EBLA 4APQD 2SEBA 1HWHB 3OHXA 3WDIA 2YD4A 3RZCD 2HMIC 1I1FB 1WQVT 3AREC 1JHTB 5BRZE 3GRWL 5DD3H 3QUMA 3EDJA 4KK6C 1AGCA 4EKXA 2IPUK 5E00B 4WEBH 4B7IA 4CMHB 3U48A 1T20B 4JFPA 1JTTA 5L0QC 5DD6A 5KVMC 1YMMD 3HR5B 4ONFH 3MV9D 4LPXA 1SHMA 3IFNL 5JZ7D 1JF6A 5A16B 3HTLX 5EA0L 5C0ND 2BHUA 1P5VA 1OSPH 1I9JH 3IDNA 2BNRE 2QKIB 5J1TC 4HIJB 5D7IB 2VABB 1I8LA 5D4QA 1S7VA 3I6KB 4ONGH 5GGUB 5BV7H 2VITB 3IETA 4TSCH 4X7TA 2IH3B 1WBZA 3G5ZB 4G42A 4BFEA 1JUFA 2VC2L 1J11A 1FNGA 5IVXB 5C6TH 1F4HA 1MRCL 3F7RA 4YE4L 3UTTE 1CQKA 4OCRH 3IJYA 6FABH 1U58B 5C0BE 1F90L 1K5NA 2FD6H 4GRLC 4HIIB 1LO2H 4I1NB 3X11B 4JAMB 4EDXA 2NY3D 4M8QB 4MD0A 4L29A 3QEQD 5BO1L 4WI6A 5GSRB 1OP9A 4PBWD 3AREA 3B6SB 3BP7A 1JK8A 3QQ9D 3W9EB 2UV3A 2EXYD 4S1RH 1I3GH 3KS0J 4NDMA 1CR9L 3RPIB 1PKOA 1J05A 1HHJB 5L9DH 3OXSA 1AH1A 4ZO9A 3ULVL 1T66C 4S1QH 3R8QA 4PRIA 3MREA 5GJTH 3CAFA 1MIEH 2JJVA 2QQNL 5KSBB 4EZMA 1RK1A 3TZVB 2BRQA 5LWYL 2R0KH 1T1WB 1P6AB 4FQQB 3RHWK 1T0MB 1PW3A 4KTEH 1U2CA 3BH8A 4R2GB 2Z4QA 1ZLUH 5I30H 5DD1H 3VXME 4AL8L 3T4AB 1B0RB 1FO0L 4F33B 1FFOA 2NXZD 1S7QA 3FFCB 2J3SA 4OT1H 4XNYH 3HI6H 3G6AB 2A9ML 1EZVY 4IJ3C 3AS1A 1AKJA 2AXHA 4RAVB 4TTGA 3I85A 4YHZH 2VSCA 2VDOL 1MCJA 5D96B 4CMMB 1BJ1H 1T6VN 3RL2B 1CDJA 5KZCB 1VFUA 2BCKB 3MUY1 2BXYA 2NY5H 5F89A 3U6RB 1MAMH 4Y89A 1OGAA 3QDGD 3QEHB 3ARGD 5E8DH 4LEXH 3WIFB 4EI5C 4NHCH 4JB9L 2H32H 5GIRA 3C6SB 3DX7B 2K7PA 5JOFA 3T09A 2LABA 2NW3B 2EDWA 3I3DA 4B7LA 1W2KT 1T80A 3BGFC 4PRAA 2GAZB 2XQBH 3HMXH 2WW8A 4UOW0 5IMOB 1MWAA 3F58L 3QFJB 3RVWC 1FG2A 5J9PA 2Z9TA 1CLZL 4QRPA 4ZPVA 3QWQB 4FABL 4LLQA 3ZZ1A 4I3SH 4J6RH 1A3RH 1LO0L 2PO6B 1J8HD 4OCWL 2IPKA 4XBEL 1KFAH 1LK3H 4EDWL 3VCLB 3PHQB 4PJ8D 3UJIL 4YDIL 3HZVA 4JFFD 3MV8D 2X70A 4JFEB 1N0LA 4I48B 4WI9A 1D5BA 5DHXB 3VXUE 1XGPB 1B0GA 4JCMA 2IANE 2JE8A 4QEGA 3QPQC 2MMXA 3GM8A 3AB0C 2NR6C 3UZQA 3FT4B 1RJLA 4DGIL 4GXUN 4WDIA 4JHWH 5E03A 5E8NA 5I1KH 5TQ2L 3CGTA 3MRIB 5C0CA 3RL1A 3T77A 3QG6A 2PXYB 1A7PL 1MCPH 1NCCH 2X4QA 5ISZE 4EI5A 4XH2B 1A64A 4UIMA 4MXWL 2BJML 3HI1B 4PGZA 5JPMB 3QXAB 1BBDH 3KPPA 1IVLA 1UEYA 2Z8WC 4UT7H 3EOTH 4XP1L 3MJ7B 3RY6C 4HBCH 5GGTH 4WVRA 5MI0B 1MUJA 5KS9B 1R5WA 1OAKH 2EYRB 1QVOA 3KAAA 3W0WD 5FECA 5D2LA 4Z8FL 4DVRL 4H20L 3TJEL 2HLAA 2OSLA 5CLTA 5IMMA 4QRUB 4JPVH 3S37X 1U8JA 3VXRE 2EE3A 3V6ZB 3RDTB 1BJ1J 3RI5K 3L5HA 4NQCB 2LVCA 2WQRA 3EOBB 4C55A 1U93B 3G5XB 5HHQA 3OKDA 5C6PB 2N7BA 2B39A 3BIAX 4Z5RA 4ERSH 3HN3A 1Y0LB 3SKJL 2VDKH 1X4XA 5KAQF 1IGFH 3TYGL 5GJSL 3VXOB 3KPSE 3GZKA 3MLSH 4XXDB 5IQ9B 4L4TA 5EZLB 2OP4L 4G3YH 3C9NA 4Y1AA 4K23L 2CK0L 2WBKA 1P7QA 2C5DC 4JFXA 4MZ3A 2GJ6E 3GJFH 4KZDH 3RTQB 1UWGL 4NRXA 4TULH 1X7QA 1CTOA 1JZ4A 2NY0D 1UCBL 1KJMA 5MENA 1FRGH 5MP6L 1NC2D 3VRJB 4R90H 1YJDL 3FHAA 3RY6A 3SJVB 4WEMB 1R0AL 1QACA 3HUJF 5EUOB 2CJUL 1F6AA 1FDLL 3P11H 4XPHL 2VL5B 2RBLA 1JBJA 5E2UL 5ID0B 1A4JB 2ZCHH 4PJHB 3QP3A 1SJEB 3LN5B 1YEJH 1G7HB 4GKZB 3WS3B 1TVBB 1E27A 4UV4L 3C08H 3I9GH 2IBBA 3L6FB 4X0KA 5F1NA 4JM4L 1U8NA 3WL9A 2ZOLA 4LRIC 3HNVH 4UBDD 2X41A 1M7IB 3D18A 4K3JL 5TFSH 4OCSL 4XCFL 5IFJA 2PETA 3QIBB 3A6CH 1BP3B 1JI1A 4APQC 4KTYA 3RZCC 4HCRH 1MY5A 5FDWA 2ZG1A 4OGYL 2I9LB 4IS6B 5CKGA 5FOBB 3UPRA 2FIRT 3MV7A 4Z7UF 1SYSA 5I1DA 3P2TA 2BVTA 4PGDA 2DI9A 1NUNB 5IFAH 4UILH 1GZQA 1RFDH 4NRZA 4L4JA 3L3JB 1F8TH 2A83B 1KULA 1W8OA 3VMPA 3O8XD 4QXTB 5JZ7C 1BFSA 5CBAA 5C0NC 5J13B 5C70A 3GBLA 3QR2A 4C57C 1HQ4A 1Q1JL 4WU5B 5SX4I 1G0YR 3STZB 3DROB 3WO4C 3ZHDA 4D9LH 3T0WA 2NCMA 2E6QA 1NC4D 4J3WA 3QCTL 4L8BA 4TNWK 2AXGB 4G9FA 3UJJL 5D6DC 1ZGLA 3L3DA 4JZOB 1BQSA 4FTVB 3BAEL 4X6BB 2ATPA 1YEEL 4TVPD 2OI9C 4LRIA 5EBLB 3PWVA 3OHXB 4FNLL 4YWGH 5FYLD 3KWWA 4W6WB 3WNKA 1YEKL 3CVHL 1H8SA 3QUMB 2WUBL 4S1SL 4APQA 5ICYA 3RZCA 2NY3C 2BDNL 1U8MB 2XN9E 4QXGL 3ZLQC 1Q72H 4JFPB 3GHBH 3QQ9C 5DD6B 5DMKA 3B2VH 5DJZA 2P47B 2VZTA 3IDNB 5T5FH 4G8GE 1YMMA 3QNZA 3ARYA 5DI8A 3MV9A 4B50A 1S7VB 3KYOA 1S5HA 4LQFL 2E27L 4X7TB 2ZP0T 4M6OL 3T3PF 1ZVHA 1UGNA 2DLEA 3ZO0A 1WBZB 3X3FH 4G42B 3CMOH 4NZRL 3S36L 1JUFB 1N8ZA 5JIHA 1FNGB 1B9ZA 5HHPB 2BNUA 5D1XC 5D6DA 1SEBA 1I7ZA 2NXZC 3IJYB 5DA4A 1KTLB 4ZS7H 1K5NB 1MFBH 1EERB 1SM3L 3JV5A 4EDXB 5HSFA 4MD0B 4LLWA 5DRXA 2Y4SA 1OD9A 4PFEA 3BP7B 1JK8B 2DL2A 4X6DA 1CGVA 2B7DT 3ET9F 5LXGH 1IEBA 5F7YC 1R6VA 2VQ1A 2BFVL 4BK4A 4P4RA 2VLJB 4FQIL 4U49A 1V7NL 1MCCA 4NDMB 4LARL 1UENA 1OAXL 5FYJH 3OXSB 3U7AA 4PRIB 4KI5F 3MREB 4ZUSA 2AK1L 5FYKL 1SMAA 1RK1B 1JPFA 2J12B 1YY9D 3H42L 1RUKH 5EZOL 3NCFB 5CIPA 2B20A 2HN7A 1XT5A 3BH8B 3DJ9A 4G8EA 2LVEA 2Z4QB 4FRWA 1NKRA 1QD0A 5C07A 3LB6D 2W60A 1QKZH 1S7QB 3MLPA 4E41B 1I9JL 3Q5YA 1A47A 5JLZA 1AKJB 3ORJA 2WM0A 2W0KA 5D1XA 3LV3A 4M6AA 2FH8A 1JTPA 4M7JH 1G9EA 1NLBL 4TSCL 4PJ5E 5ADOL 4QHMA 3VFGL 5C08E 5A3IC 5EU6B 5F89B 4HH9A 5E2WL 4PB0L 3U9UA 1OGAB 1NFDE 4FG6C 2VDLH 2CRIA 2COQA 4X6CE 3C2AH 3LSOA 3V6OC 2AJYH 1GOGA 4Y19D 3MYZA 2V7HA 1GRWA 2M26A 3T3PE 1I8KB 1DFBL 5GIRB 4JKPH 3QDGA 1ZA6A 2HFEB 3PABB 1ZGLP 4PRAB 2F54D 4UTAL 1MWAB 1FG2B 1CL7H 2C3GA 1OM3H 4QWWC 4QRPB 2YOCA 1CZ8H 3RWHB 4LLQB 1KLUA 4GAGH 4NKDA 3BGAA 4KZEL 2IPKB 4WWKC 1UJTA 2YD7A 1LMKA 3T65A 3HZVB 3X12A 2X70B 5ESAA 4QRQB 3ZE1F 3SPVA 1J8HA 2X4UA 4O00A 2AJVH 4Y5YC 2Q8BH 1D5BB 3DBXB 2D7OA 1A2YB 4PJ8A 1KJVA 4XT1C 4JFFA 5F7DA 3VFNA 4DWHA 4X6FA 1RJLB 2G2RA 4LIQH 4XWOC 4Y4HC 4WDIB 3M17A 4M93C 3C60C 2KQMA 1NFIA 5C0CB 3BRDA 1J18A 4M5YL 3HI6L 3T77B 4HLZH 4HWBA 3V6OA 3QG6B 5EIIA 4BUHA 5MEPA 5HHOE 4JPWH 4EI5B 2VZ1A 2F8OA 3HZMA 5KVFH 4UIMB 5T1DL 3VRLF 1RY7B 1NCTA 5C92A 1FG9C 1ULVA 3KPPB 1A7RL 4NNPL 5DZOA 1MY7A 3BGFB 3EZJB 1X5AA 2DJSA 1MUJB 2Q20A 4ELMB 1OTTC 2AXFB 4O4YL 1TNMA 5CCKL 5FECB 4NHCL 1QVOB 2ESVD 4M5ZH 5D2LB 2HLAB 2OSLB 3MRQB 2N1KA 4X7EC 3U0WH 1ADQA 1UQSA 5JTWA 1U8JB 3FB7B 4NO0B 1PAMA 1GXEA 2D7TH 3P0VH 5ICXA 1F11B 3MA9H 1WJ3A 4JDZB 3BZ4A 1L0YA 5F96H 5CLWA 2IAMD 4Q9BA 4PJDB 4TPRH 4HULB 5HHQB 2AABL 2Y5TA 1T22B 4Y5YA 1LEGA 5CD5D 2XT1B 4N0FA 4HFUH 1A9EA 3AB0B 4OUUA 4UB0L 5EC1A 3T04D 4Y4HA 2QSCL 3LS4H 3BISA 3C9NB 3C60A 1JGEA 5F7NC 4PREA 1P7QB 4JFXB 4OV6F 1WLHA 2ATKA 2A1WL 3EYOA 4NRXB 4NC2B 1X7QB 4W70A 2RGSA 3F5WA 4OF6A 1KJMB 1CK0H 1CXKA 3QWRD 4WI7A 2CXKA 1F4XH 1N6VA 3I50H 4DZBB 1ORSA 1EHLL 3KR3H 5KJRH 5I71C 3H3KA 3R06A 4OLUH 1ZOXA 3BKMH 2WZPD 4WY7L 1NC2A 2E3VA 3S37L 1I85C 4LQ1A 4KMTL 3NIDE 4R3SA 5AZEL 1JZ2A 4FMKA 2DYPB 4LGPB 3O8XC 2O5ZH 4NCC1 1KPRB 2P1YA 3MODH 4O58L 4Y4FD 1E27B 2ZCLH 4LVEA 2E6PA 5DVOA 1U8NB 4KKCD 4E9LA 3WL9B 1IGCL 1IAKA 1XMWA 2ZG2A 3G9VA 1HILA 1PGRB 3D18B 3LEVL 5IFJB 1NANH 1I9EA 3ZTJH 3BD4A 1A6UL 1QEWA 2WMPA 5FDWB 4ZOCA 3SE8H 4YHPA 4IRZH 1GAFH 4QKXB 1IGIL 4PLNC 3RVTD 1ZS8A 5DUML 2Z31D 1VFAB 3UPRB 3MV7B 3VFOA 5DLML 1NGXA 5LGJA 1SYSB 5I1DB 1MIMH 3BEWB 4PGDB 4HWZA 4NO5B 1CU4L 5ITFA 1GZQB 4G3YL 4NRZB 3NOIA 3V7AG 4KZDL 1J8KA 3C5SA 1IARB 5GHWH 3DO3A 1I7RA 2G75A 1HQ4B 1I85A 5F1OB 3GK8L 1OD7A 1PVHA 2DQCH 3O8XA 1IQWH 3MBXH 3V79C 1CQYA 4L8BB 5I1AA 2NY7H 3L3DB 2A9NH 3G6DH 3MPCA 1HXYB 5JW3L 4JR9H 2D9CA 3CU7A 1NC4A 1X4YA 2ATPB 4U6YB 3PWVB 3UTPD 1REIA 1YNLL 4HJ0D 4P0DA 4RWYH 5ANME 3TVMD 3KWWB 1S9KC 1N64H 4ODBD 4IM8A 4APQB 5FGCE 5ICYB 2FL5A 3RZCB 4PYGA 1KYOJ 1RIVH 2AEIT 4P2OD 4DKEH 1N7MH 3P9MA 4XBGB 1CD9B 5DMKB 5EBMA 2BSRB 4RMSA 4JJ5A 5HY9A 2DQIL 5DJZB 1K6QH 4PJIE 1AXSA 1F5WA 4GT7A 4PJXA 3BSZH 1A5FH 3U7WH 4RAUA 1YMMB 3QNZB 1TXKA 3MV9B 3VH8A 4DGYL 1I8IA 3KYOB 1DJSA 1S5HB 4YK4C 1JF1B 4JHZA 2XWBA 5DS8B 1YY9C 3WO4B 3QXWA 2DQJH 3P9LA 1RFDL 4RMUA 1QLEH 4M7LL 5MERA 1E28A 2QQLL 2BNUB 2DQEH 4DKFL 2EECA 2BY0A 1SEBB 1I7ZB 4L9LC 1LO3H 1JPTH 5CP3H 5E2TH 3G6JF 2IPUG 2OL3H 3DYMA 5EOQL 3CSYB 5JHDA 4LLWB 5DRXB 4PJFA 1ZANH 4AEHH 4X6DB 5KOMC 1DEEA 4LPWA 5GS3A 1IEBB 2X9XA 4LLUA 2C3WA 2VQ1B 4P4RB 2NY3B 5FM4A 3QEQB 5IMKA 5ACMA 1G1CA 4Z7VF 2YWYA 4PS4H 2P5WE 5D2NC 1YYLL 3MRRA 1IAIL 4ZUSB 1MCFA 3MO1A 3E6FA 3W81A 4KDWA 2EE2A 2EDYA 2MCPL 5HYSG 3EYQD 3QHTC 4NQUA 5EFIA 5DJYA 5EULV 3UJTH 4KTDL 4FMFA 1GHFL 5CIPB 1Q72L 2HN7B 2PN5A 3JV4A 3JVGC 3V0WL 3WFDH 3SE9L 1WTGT 3O4LE 5C07B 3VRIA 3IS0X 4XP4L 2W60B 3QHFH 4NT6A 1BM3L 3GUTA 1MCOL 1NEUA 3KLAA 1K3IA 2BRRH 3KYNA 3NCYS 4GW5A 4TNVF 5IQ7L 3RUGB 4ENEC 2PTVA 3LV3B 3CLFH 4L9LA 1ZXQA 2NXZB 1MCWM 3DYOA 4K8RC 3GMPA 4QHMB 1FE8L 1BZ7B 4K3DL 2I27N 1XH3A 2DJUA 1CTNA 4KGLA 4HH9B 5F3BA 4QRRE 4G43A 1LE9A 4UTBL 3BT2L 4WI5A 4PBVC 2YZ1A 3LSOB 2OJZL 4R7NA 5EN2A 35C8H 3V52H 5GZOD 3P30L 3IKCA 3NAAH 1ZVYA 3QDGB 1DQMH 4XP5L 3ARGB 5TE7H 3U4EB 1ZA6B 1OT1A 5D2NA 5ALCL 5FM5O 1YMHA 3OJDA 1L7TL 4OFYD 3GSNH 5BS0E 3PWLA 4U1KB 4OCYH 5J3HC 1VA9A 3WNMA 2KKQA 4DAGH 5I6XB 1RK0B 4N0YH 3SHSA 1KLUB 1AR2A 2F54A 3I2CH 5FYJL 1DCLA 4Q7DA 1W8NA 4J12A 3JVGA 5IB2B 4JKKA 3IDMA 3BKJL 3ULVD 3QULA 2DKUA 3NA9H 3SPVB 1J8HB 4WI4A 1AP2B 1UJ3B 1BLNA 4PJ8B 4POYA 4PJ7F 2IAMC 4OZHF 1DN2A 1EGJH 4JFFB 5JW4M 5F7DB 1XGTA 3GBMH 2VLRA 4MDJA 4X6FB 3H2WA 4PRHD 3VFNB 5HYJD 4A6YH 5DQDL 2G2RB 2HT3D 3M17B 5EU3B 3RAJH 2DAVA 5CD5C 3LQZA 1LDSA 4RZCA 5EIIB 5LGKA 2BNRD 4U2YA 5DJ8A 5MEPB 3HZMB 3QISA 1W72B 3H6JA 2BMKB 3MMEA 4PUBH 3MRLA 2X2YA 2CKBL 1FLRH 1C08A 5IW6B 2NLJA 3CUPA 1QLRA 2YMXH 4X6EA 3O6ML 4BELD 2R4RH 2B0SH 4ZFGL 3WKMH 3NZHL 2FJGA 1F4YL 4DUXA 1V05A 1FPTH 4QT5A 3IDXH 2YWZA 1N2RB 5ICXB 1BAFH 1YNKH 1HHIA 3QEGL 1M71B 3FTGA 1JGDA 1PLGL 4EIGB 3ZKSD 4ZUWA 3U79A 2H1PL 3TT1H 1L0XA 2Y5TB 2R23A 4Y4FC 4Y5YB 1UA6H 4WHYG 1LEGB 3BP5A 4TRPL 1Q8MA 4LCUA 4HS6A 1H15A 2IAMA 4N0FB 3FJTA 4OUUB 4KKCC 5EC1B 3I6GA 2I5YH 3MZTA 1NCWL 5D9SA 5F6HI 4M93B 3VU2A 4H5SA 1LO5B 4PREB 1OWRM 5D7JD 4MNHA 5D7IE 2Q8BL 2R2BA 2ATKB 4FZ8L 2VXSL 1NCAH 2VDML 3F5WB 4MA7L 3GKWL 1FNLA 5HHVL 3GHEH 4HZLA 3RVTC 2B4CH 2Z31C 5LAXA 5HDQL 4TUOA 5IVXE 4K7PX 1ORSB 4RMVA 2NY0B 3OKYA 1A0QL 2VIRA 4I4WB 1U9KA 4GAJL 5E99L 1JVKA 3NACL 3QWRA 2NQCA 1G9NH 3JWOL 3R06B 3HB3C 3TNNB 4U6XA 5KVFL 1NC2B 4CVXA 4MJ5A 3WNLA 3VFWB 5TDNA 4QXUH 1C16A 2V7NA 2CGRL 4JPIB 4KJWD 5IHLB 3K2MC 1LO4H 5BVPH 2EDDA 3TCXA 1TQCB 2Y25A 4P2RD 4DN3L 3JV6A 1RZ7L 1ZA3A 4M5ZL 2XZQH 1S9WA 1J1XL 4Y4FA 4LPYA 3QFDA 1HILB 1RUQL 3IDUA 1KLFA 5I1JH 5I1CH 2EEDA 2VXVH 3FOLA 4OV5A 5KSBE 1A6PA 4G6ML 1QEWB 2P44B 2DM4A 5LG1A 2HJKA 1WICA 1JE6A 5JXAL 4HIHA 4HJ0C 4YHPB 3TVMC 4JY6A 4WI2A 5DUPH 3UC0L 4JQVC 4XCYA 3VFOB 3UZVB 2OZ4A 1NGXB 5LGJB 1V7MH 1AD0B 2FSEA 4P2OC 4PJ9D 4PB9L 4ZTPL 1BFOB 1YQ2A 3V5HB 3FFCE 4HWZB 5ITFB 5CJXC 2D7PA 5CGTA 1BF8A 2OJEB 2Z31A 4H8WL 3S34H 3BN9D 5DA0B 1WEJL 2FGWL 3FN9A 5E5UB 3BRFA 3JXAA 1G7MB 5I71B 1WCQA 4RGOL 5HD8D 4NSKA 3S35X 2WUCH 4N1CA 3D39E 2P43B 4S1DD 5DMGD 3O8XB 1UH4A 5L2KD 5GRUH 2D7NA 3VG0L 5D6CA 2IGFH 4XVJH 5ISZD 3QJHA 1NC4B 5K9JH 1IKFL 4NWUH 4OJFL 3IF1B 4HG4J 4N5UA 3M1BB 1IC7L 4OFVA 2W65A 2PW1B 1J1OH 1RZKH 1ACZA 2ZKHH 1LD9A 1BECA 1RZIA 2AJ3A 2WV3A 3WXWH 3RIAF 2FL5B 4QHKI 1MQ8A 4NBYB 4V1DD 3TVMA 4HSQA 1TLKA 1AJ7L 2B2XL 4K94H 4PJEF 4BQBA 4HW6A 2AQ2A 2WLZA 1MFCL 5DEFA 4AK1A 1JFQL 4JQVA 5DR5H 5I8CA 5EBMB 1TVHB 2VXQH 1N6QH 4JJ5B 3VXRD 1MCKA 5I74C 5HY9B 4P2OA 1AXSB 2BP3A 4JFEE 2A6KA 4PJXB 1G6RH 5CJXA 4JGMA 3VGGA 5KSAD 1F6LL 4RAUB 2GSGA 4KK5D 1KEMH 1AR1C 1A7OH 5J1AA 1KTKE 2HFTA 2KZ1B 4O2CA 3P77A 3MJ9L 4HIXL 3EYQC 2XWBB 4Y4KC 3LEXA 3KPSD 5HDBE 4H1LA 5MERB 4JN1H 1E28B 1RJZA 3V4UL 1S9YA 4ODSH 5A43C 3HNTH 2DD8L 3LKSA 4PJAF 3ARFD 2GSIB 4HT1L 5KVDH 5DJDA 2AQ1A 1NAKH 1FZMB 1H0DA 5JHDB 1OW0C 2DQCL 4PJFB 5KS9E 4YHOH 5E1AA 5D1QD 3NA4A 3ESVF 4LLUB 3UTOA 2O5XL 3QHZH 1NCBL 4UQ2A 1H8OA 4JR9L 5IMKB 4OZ4A 4N5ED 4GSDH 4YUEH 1NJ9A 3FB5A 3GO1L 3MRRB 4HWNA 1JHLH 4EIZC 3KYAA 2V2XB 3MO1B 3E6FB 3MLYL 5DD5H 1ZHLA 5CEZE 3BIBX 3QQNA 2AEQH 5EFIB 5DJYB 1I7UA 4KQ3L 2FX7L 3O4OC 3JV4B 4MDIA 1N5AA 2HH0L 1N5YH 1W0VA 5IG7A 4YK4B 1T5WA 2YKLL 2VLKD 4XPFH 3GRWA 3VRIB 4Y4KA 4F58L 1UEMA 4J4PD 3LKNA 3MXVL 3GUTB 3RVXC 4PJEE 2F74A 3KLAB 3DGGA 4P49A 3CH1A 3GIZH 3ULVC 5D8JL 2ZPKL 2IFGA 3FB8A 3DMMD 3GMPB 3WLWC 5HVHC 3SKOA 1XH3B 4NCDA 1EVTC 1OW0A 4RMTA 1LE9B 5EUOE 2DQEL 4R7NB 5EN2B 1CWVA 2HT3C 5H2BA 3T0ED 3IKCB 3T3MF 1JPTL 1YN7A 3A67L 4PJHE 1NQBA 3STLB 5D2NB 4GQ9L 2WBJD 3DX8A 1YMHB 3OJDB 4Y19B 3QZWA 5JHLH 2CO7B 4KVCL 3UEZA 5IOPA 4NZTL 4PJGF 5TF1H 1EBPA 2QADD 4LSVL 2L7UA 1UKQA 2F5AL 5ERWB 5ECJE 3VI3E 4JDTL 2F54B 1UVQA 2EDNA 4NP4L 4OFYA 1P7KA 3TYFA 3I02A 4Y2DD 4TSAH 5I1HL 3IDMB 5CEZL 4XAWL 1IM3B 2EDEA 4P5TD 4HS3B 4R4FL 3QULB 4OBSA 4OQTH 3TBTA 4WUUD 1S7UB 3SOBL 1JNHB 3K2UH 4U1MA 4RDQG 5FYKD 1WITA 5KW9L 3O3AA 1N3NA 1CIDA 1XGTB 4MDJB 2MHAA 2AEPL 1IT9H 1UB5A 3QHFL 4OLEA 3EJYD 3FQXA 3T0VA 1KIRB 4XP6L 1IGMH 3LQZB 4Z0XA 4KAQH 4RZCB 4PRHA 3CPLA 5DJ8B 5HYJA 5JNYA 4F7MB 4RFOL 5ENWA 4U1HA 1PDKA 5T3XE 3MRKA 3MBED 1OSZA 3CXHK 3MMEB 1FO0A 1IRAY 3MRLB 1CE1L 4FQLL 1K4CB 1QLFB 1DDHA 3HC4L 3WIHH 3FT2A 1QBML 2NLJB 1BVLA 3CUPB 1QLRB 4X6EB 4FTVE 5SV4A 4PY7A 3WS6C 1CIUA 1VADA 3NAAL 1QOKA 4XAKD 4QHLA 2FJGB 3RWJA 2ORBH 1BVZA 4M00A 1DQML 2MPAH 1AY1H 4QT5B 4F57H 4OIAA 4K55A 2KZWA 1JNLH 3H9YA 5DK3A 4JPKL 5FUZL 4POZC 2ESVB 1MQKH 2CMRH 5FKAA 3FTGB 1RULL 1JGDB 3QDJD 3CVIH 3DUUA 4ZUWB 2R23B 2HKHL 1RHHA 4PBXA 3BP5B 4KGJA 1BHGA 4LCUB 4HS6B 2FEDD 2IAMB 5FB8B 5LGHH 1INDL 3UTQB 3RWGA 4FQ1L 2VR9A 1ZEAH 3KHOA 5D9SB 4G6KH 5IF0A 3K46A 4MNHB 5CJQH 1FYHB 3UX9B 4Z7NF 3MQIA 3SDXF 1YPZB 1FNFA 3QEUA 1OQXA 2D4FA 4IOFD 3P0YH 1SY6H 4A6YL 5D7JA 4HX1A 5L88L 1A6VH 4HZLB 1CI5A 3SKMA 1MEXL 2XYCA 3HFML 5T1LD 4ODTH 4PJ9C 4LSUH 2VIRB 1OARH 4ODVH 2X4OA 3WS6A 4U6XB 2PF6A 1FVCA 3BN9C 5IT2H 4Q9RL 1C16B 2B1HH 2V7NB 1DE4B 4PJ5D 1MAJA 1JGVH 1VACA 4OTXH 4KMLB 4M6NL 5HD8C 3ABZA 4RBPK 3VWJC 5FHAH 4EQ2A 2BOCB 4I77L 3JV6B 2QQQA 3CSPA 5GRJL 5DMGC 2B0SL 1S9WB 4Y4FB 1ERNA 5ITBH 3QFDB 1T2XA 4PRIE 3ZL4L 4P2RA 5EO1A 4JZJC 3S96B 4HC1L 4BH7A 1YJDC 1YC8A 4ACPA 4BQ8A 4WTWA 5EPMA 2EO9A 2HJKB 4O5LH 3ROLA 2R56L 4HIHB 1EEUA 5J1SC 5IHZB 5BOZG 4GFTB 2WIMA 2EDHA 2I60H 2ZUWA 2YBRA 3PGDA 4XCYB 3RBGA 3DV6A 4G7YH 3C09C 1MFDL 2FSEB 3BDBA 3HAEH 5C09D 2FR4A 1PSKH 1AXTH 2P46B 1WIOA 2Z31B 4G6FD 4K7PL 4M7ZC 3KLHD 4UUJB 3I3BA 2J2ZA 1A3LH 25C8L 2P8MA 4JO4H 5EU5A 4PJ9A 3LD8C 5F1KC 1YEHH 5TE6L 4KI5D 2IF7A 4OAWB 4NSKB 4ONHA 3QZWG 4LAJH 2CLVA 5KSAC 1MPAL 1CDGA 3FQUA 1OGAE 1QRKA 3WJJC 3EFDH 4NKIL 5C2BH 1H8NA 4KPHL 2A0LD 3NIGE 1KSRA 3QXTA 5D6CB 3VWJA 3O2DH 1QP1A 3IB4A 3FCTA 4OCNC 2YN5A 3WN5C 5GS1C 5L2KA 4O9HH 5SV3A 4QTHA 3Q6GL 2HG5A 1QQDA 2W65B 2XRAH 3BHBA 3MZGB 4JZJA 4WO4D 5CWSA 5HGBB 5DMYA 3ULUF 1LD9B 5JO5A 1RZIB 4QRPE 4X8JA 3ARRA 5HGAB 5DDHA 4L3CA 4HGMA 1PQZA 3TVMB 3MLUH 3LHPH 4XZUA 3GKZA 4K9EH 5ABDE 5MHSD 3NIFF 5I1JL 5I1CL 5D1QC 5GISL 3VFRA 4ZO6A 12E8H 1ROWA 5I8CB 3L5XL 5F8QC 1MAKA 4Q0XH 1A4KB 4YEEA 4P2OB 4MA1C 3GDBA 3IU3A 4V1DA 2Q8AH 2VL4A 3OQ3B 1TTUA 4N5EC 1BQUA 5I2IA 4ZNCD 2A6KB 4G80A 5C0RL 3KYMA 2ERJC 1T03L 3O6LL 5DUPL 4RCAA 4TUKH 1KIQB 2GSGB 1JGLH 5J1AB 2FH6A 3S35L 4O2CB 1ZE3C 5KSAA 2GUOA 3LEXB 3D6GA 5C0CE 4H1LB 4MGXA 4PLKC 5J6GA 2CUIA 1SBSL 3MLTA 3WJJA 1BIIA 1RJZB 2E9WA 1S9YB 1C5BH 2ICWI 4CU6A 3VE0A 2KBGA 4J4PC 5AEAA 3U30B 5GGQL 4H26B 5DJDB 2XZCH 5DXWA 5T3ZL 3WN5A 1DBAH 1EEYA 1H0DB 3UBXA 5IGXH 4OZIF 2FATH 5E1AB 1X6LA 5A40E 5D2LE 5E8EA 4W81A 1FAKT 4GRWF 4ODWA 5TE4H 4KRMB 4OZ4B 5F7EL 1AC0A 3GNML 4P9HL 1NJ9B 2P8PB 5D7SH 1AHWC 3FB5B 3ZKND 5D1QA 1R3JA 2Y23A 3T0EC 4ZFOL 3RX8A 3DUHA 5I74B 4MWFA 1ZHLB 5FM8A 1EJOH 4U7KA 5GZND 1KGCE 2WBJC 4LSQL 4V2BA 5AZ2L 1I7UB 4WFEE 5FKPA 4Q97A 2ZUVA 1OY3B 2W38A 5IROC 1FGNH 2D0FA 1D9KD 2QADC 1N5AB 2FBJL 1EMTL 1TCMA 5EU4A 4DTGH 2MWCA 5IG7B 1T5WB 4CAGA 4L4TE 1HOCA 3D48R 2G5RA 3CVHA 4MQSB 4Y1AE 3QSKB 3LKNB 1G6RL 2F74B 3DGGB 3CH1B 4OLXH 2GK0A 4P5TC 2VLKA 1MJ8H 1A7OL 1TMCB 4J4PA 2VQUA 5F70A 5MENE 3FB8B 4RMRA 3PGCA 4J3OC 4KV5E 4XNXL 5IB5B 4ZODA 5CEYA 3DSFH 3SKOB 1MHEA 5EH1A 4XB7A 4IMLA 4U1GC 1F58L 2D03H 4JREC 3MLZL 5HVGB 3EJYC 1IILE 1YN7B 1K2DA 3UPCA 1CXIA 4WTZA 1AHWA 5DC4B 3QZWB 1XF5A 3EGSA 3OAUL 3T0EA 5IOPB 2VQTA 4ALAH 5T1KA 1RI8A 1U8OA 1KJ3H 3MBEC 4D9RD 1NUGA 2OTWA 1A9BA 1U95B 2WBJA 3P4NB 2EC9T 4K71C 1V3MA 1OWWA 2APXA 4NO3A 1UVQB 5IROA 3TV3H 3GJEA 1P7KB 3TYFB 3RNKA 1P5UA 1XR9A 1RUML 3IFLL 2E7LC 1S7TB 2GJZB 1PG7H 5TPWH 5EUKA 4U1MB 4F7PA 3ULUL 4JQIH 2HKFL 1K4DA 3HG1D 3MV7E 5DHVA 4P5TA 4U7SA 4EVNA 3HUJA 1N3NB 2AJXH 3A6BL 3Q0HA 1N5YL 3MRNA 4WUUA 2YN3A 1UB5B 1MJJA 7CGTA 1R5VB 3FQXB 5HVHB 4LK4A 1IL1A 3ZDYF 2FEDC 3L5IA 2NY1D 1VGEH 4Z0XB 3RKPA 1PG7X 5SWZA 4X7SH 3L7EB 3QUYD 4PRHB 3CPLB 5HYJB 1CVSC 1CD1A 4YR6A 4BH8A 4RFNC 5C6WH 1CDHA 4U1HB 3ZDXF 3MRKB 1A6TA 1OSZB 5KG9B 1B2WL 3JWDH 1R3KA 3NTCL 3ARZA 3SQOH 4C54A 4CJ0A 2CDEA 4CKVX 1YDPA 2BNRB 5GRVL 1DDHB 1RIUH 2J5LC 4G9FE 5F97E 1T2JA 4MAYD 4IOFC 1BVLB 3FRPA 4U31A 3WNNA 1ZHNA 2PNDA 4UINH 3MBEA 4PY7B 1VADB 2QQKL 1KACB 4QHLB 2EE6A 1ZKAA 1RVFH 1U8KB 3LH2H 4OCXH 3RWJB 2C1OA 3BPNC 4GMSH 5JHLL 1CDCA 4MCZA 3CFCL 4OF8A 1WZKA 1HHGA 4Z7UA 4JY5H 1T7ZA 5TF1L 2E7LA 4FZEH 1EHAA 3DUUB 4XNMA 4F9PC 5LQBH 1JYWA 5L2JB 3BDYH 1EO8H 1FIEA 2LU7A 2HJLA 4I0PD 4MYWB 3QDJA 1JPSH 2P5WD 3RWGB 5DJAA 4YFEA 1D5ZA 5IF0B 3U46A 3F7PC 1YMME 2R4SH 3VXSD 1U8IB 1AFVL 3MV9E 2K9UA 3QUXD 32C2A 3QEUB 3L95B 1WGOA 2VSDA 1LDPH 1A1OA 3ARWA 4JM2D 5D7JB 4HX1B 4QRTA 3SKMB 4RSVA 3PWPD 1X5IA 1IGML 4M8VA 1E6JH 1TQBC 4L9DA 2X4OB 3UPAA 1YECH 1YQVH 2NY4D 3TN0C 3KLHC 4DGVH 5I1LA 3ZDYE 1FVCB 1U3HD 1JNNH 4LKCA 4XNQA 3R0MA 3V4VH 1VACB 4CBPA 3MRJB 3WIHL 4KI5C 4X6DE 3PGFL 3KVQA 1A6ZB 1CFBA 3GBNL 4X7DC 4ETQB 3GMRB 4F9PA 2ORBL 2A0LC 4P5MA 2QR0A 4P2RB 4YXKH 4F80A 3ZKMD 3EHBC 4OSUH 2ZZUT 3RKDC 3CLEH 1JPGA 2X05A 3WEXA 3D9AH 4N9GA 4WO4C 2EDQA 3MRGA 2YBRB 3DV6B 1HINH 1EA9C 1H3TA 1L6XA 2HJFA 5C07E 4XMLH 3UZEA 3HCVB 2FR4B 4LHJB 1MH5A 1DQJA 2OXGA 2J6EH 1HSAA 3HE7D 2APVA 4MHHG 5B38A 1GOFA 3CJJA 4RA3A 2P8MB 5L7XH 4JANA 5EU5B 5J06A 4PJ9B 1O7VA 2XXMB 2VAJA 3MJGX 4WTZG 5C09A 4ONHB 3TN0A 4CL7A 3MLRL 5KAQG 2Q3AA 3B83A 4XCCH 5B3JE 15C8H 1A3QA 1MRDL 1MF2H 3LN4A 4TOYL 3BFOA 5ALBH 3SGJC 1UZ6E 3V7AE 2Z91A 3FCTB 1RU9H 3QDGE 3O81A 5D7KD 4BZ2H 1OT2A 4UOW1 5L2KB 1AD9B 2BERA 4Z7WF 5IBTH 1QQDB 3BHBB 1ZGLM 4Z78A 2Y07L 3DURB 1T04A 5JO5B 5ISZB 1S5IL 3MRDB 4X8JB 3B9KD 2QV2A 4KXZH 5E7BA 3GI8L 1MSPA 5DDHB 3QDHA 1TCRA 4L3CB 1PQZB 4LSSL 3GMQB 3WFZA 1UWXK 2XXCB 4JFDD 4AY0A 4WO4A 2WBWB 3RVUD 5J12C 3C5ZD 1ZLSH 3VFRB 5D71L 4QTIH 2VDNH 3C09B 3WFBH 1KG0B 3EDEA 4V1DB 1FH5H 1J8HE 5I2IB 1JMXA 4G80B 1NEZA 4HWEH 2ILLA 3ZKNC 3F6IA 1URLA 5D5MF 2Q7NA 4WV1A 3VMOA<