3ZTNH

Structure of influenza a neutralizing antibody selected from cultures of single human plasma cells in complex with human h1 influenza haemagglutinin.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
219
structure length
173
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYAMHWVRQAPGKGLEWVAVISYDANYKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSQLRSLLYFEWLSQGYFDYWGQGTLVTVSSASTKGPSCLVKDYFPEPTFPAVLQSSGLYSLSSVVNHKPSNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAEMAGGLUTININ
publication title A Neutralizing Antibody Selected from Plasma Cells that Binds to Group 1 and Group 2 Influenza a Hemagglutinins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 32
structure length 173
sequence length 219
ec nomenclature
pdb deposition date 2011-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ztnH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ztnH01
3LS5H 3H6JA 3EJJX 1SQ2N 2XZAL 5IFHH 5L88L 1HNGA 4OLXL 3HZYB 3EO1B 1OTTC 4HWZB 4HH9A 5FV2A 5IEKB 4YXHH 5JNYB 2XN9B 3FO2B 3WIHH 1YEJH 3HI1A 4NUJA 4LBEA 1KFAH 2OI9B 2OL3L 5HHOA 3S88L 1KC5L 3VFSB 4M6AA 5KG9A 4ZDHB 1OQOA 1HIML 2R4SL 1FPTH 3C60A 3GB7A 4MXVE 1A7BA 2NX5A 1SEQH 2IQAB 2NY4B 1V3KA 4NRXB 2E3VA 3FT3B 3QR2A 1K9TA 1QO3B 3QEHA 2DQGL 4NZTL 3VXTA 3B2UC 5DA0B 4NRYA 4ZAKD 3HMXH 3NAAL 3N50A 1I1AD 3DARA 4YGVA 4XP4H 3U4AA 3L3KA 3PL6D 1YEKL 5B8CB 2NW2B 1F90L 3E1F1 4OGYL 3FTGA 4G9FE 4ZFGL 2IANA 3ARFA 1OP9A 3UAJC 4LIQL 3TT3L 4HXAL 3G9VA 4YGAB 4XNXL 1A6WL 4PJ8B 3VGEA 3RX5A 1CYGA 1QFPA 5F97E 2GJZA 2VMFA 2X40A 4ISVB 5F9OH 3ROLA 1DEDA 2CK2A 4HX1B 4IRSA 4N0CD 4HC1H 2WSKA 2GUOA 3HAEA 5DD0H 3MCKB 1BF2A 3MLUL 3QPQC 4UIMB 2I27N 5E2UL 5D71L 4M7JL 4NQDE 1OAZL 3V6OC 3IDNB 3W2DL 5BW7C 3FQUB 1A1NA 1OD7A 4BA8A 3U7WH 1CIUA 5CBEB 2KDGA 4GG8A 1H3TA 5T33L 1EZVX 4HUWA 4LCYB 2VERN 2I9LA 4J1UA 5IMKB 3HI6L 3O4LE 4YIQA 5F89B 2JLLA 4OZHA 4TNWF 4LVNB 1T0NA 4RGNC 2A6KA 1F4WL 5DI8B 1K4CB 4IHOB 4Q6YA 1YQ2A 3H9SB 4G6JH 5ETUA 4Q9RL 1XGRB 1W72H 2F5BH 1FH5H 2LU7A 4FFZH 3LB6C 2XXCB 4M5ZL 5I1EH 5DEZA 2VXTH 5I8OH 4LSQL 1VKXB 4JAMB 3WL9B 1X7QA 1A9BB 4ZUUA 1YNTB 5I1AB 5IG7A 4NUGL 4XB7A 5LAXB 3U9PL 5ALBH 1YN7A 4OCYL 4MA8L 3H7BB 1D5BB 3HPLA 5E8DH 4S1QH 1CT8B 2CIKB 1IAKA 3V0WL 1FNGB 5AWNH 4DKEL 3G04B 3PWUA 2EEAA 4WJ5A 3X3FL 3HZKB 4M48L 3MR9A 1BX2A 1EFQA 2EKSB 4OT1H 3UMTA 2CJUH 5C0BA 2YD2A 3SDYL 2WMPA 3I6GB 3IVKA 3CPLB 3U0WH 1FV1A 3QDJA 2W60B 4FFYH 4X4YB 1KB5A 1S78C 1YEDB 5I16A 1KB9K 1CE1H 5C70A 1OW0A 1OAXH 4MSWB 4MYWB 4YDVB 3FCTB 2DQTH 2YUVA 4PRNA 1W8OA 3MXWH 3X12A 5KW9H 3F6IA 5C08A 2VC2H 4KJPC 1A3LL 4APQD 3HMWL 1F13A 4J6RH 3KVQA 1PEWA 3BZ4A 1T2JA 3HCVA 3VH8A 5SX4I 4JPVH 4WO4C 3SDXF 5ISZB 3VXUD 1CDUA 1E27A 3VFWA 1PLGH 2E9IA 1U41A 2O5XL 3K2UH 3ILQD 4UQ2B 5HBBA 2NYYD 2XN9E 5EULV 2DQDH 4RFNC 1QRNA 1AQDB 3FAWA 1GL4B 5EBLA 1G7LB 3MNWB 1UM4H 2HT4D 1XGYL 4Y19D 4DGIH 2XTJE 4S1DD 1M7IB 2SEBA 5FEBA 4OF7A 1ITCA 4NQXA 4M6MH 3WO4C 4MNQB 4JEGB 3MMEA 4PRPD 2EXWD 3TJEH 3O2VH 1UA6H 1KULA 5C0AA 3W11D 3WNNA 4EN3A 2W91A 1FL6B 5DJAA 1TETL 2IPKA 3H42L 3WNKA 4CDGC 5DMYA 1SJHB 2BOCB 2F74B 4GG6F 4R0LA 3RKDC 5CP3A 1A5FL 4G8GB 5FUCE 1NC2B 3QUYC 4S2SA 3RNKB 3BKCL 5IEHB 1RIVL 2HN7B 4OBRA 2EE3A 5IB2B 5DJZB 5EPMB 1OAQH 3STLB 3ZYIA 3MSPA 4KRMB 3QCVL 3UZEA 3FN9A 3KR3L 4XCNB 2X42A 4AMKL 4M1DL 4NN5C 1A7QL 2IPUK 1NC4B 4NFBA 3QCTH 1NCDH 3PG2A 3IAGC 3JV0A 4N0YL 1G0YR 3QDMA 1V7ML 4MLSA 3S36X 1RVFH 5SWSE 5DHVA 1CXEA 4WHYH 3VFUA 2HWZH 4EBQL 5HVHB 4YBLB 3M17A 5EO0B 4JDVB 3GO1L 5I9QB 4BZ1L 1C7SA 1JYXA 5HHVL 3UYRH 4NDMB 4Y4FD 4OD1H 5KTEH 4DJMA 2LVCA 1KJMB 2GTWB 4ONGH 2GTZB 3TA3C 1KIUA 2GI7A 4PY7B 2HLFC 1NBVH 4OKVA 4LSSL 4Q0XH 2ZG2A 5EN2A 1X4ZA 4PJCA 3H9SE 2J7LA 1KENH 5E7BA 3FN0H 3LEVL 3TYFA 4X6BA 4C58B 4ZFZA 3TZVD 4ZD3L 5DQDH 2O61B 3RWHB 4YEFA 3I6KB 2VZUA 3ZL4H 3T2NL 5KOMC 3P11H 3BIBX 1N0LA 2OZ4L 3MROA 2NY5H 4PP2A 2ZOKB 5CEZL 4LF3A 3EZJB 1Y18B 3K8KA 3OKLA 3FB7A 3IXTB 35C8L 4PB0L 1NFDA 5F7UA 1BBDH 4QTIH 1EX0A 2NX5E 4M4PA 4HGWA 2ILLA 1AP2B 4PUBL 4Y5YB 2BNQD 2W9EH 4TULH 1QLRB 2EYTA 1HH6B 5ESQA 5IMOA 3GMOB 5AZEL 2RQ8A 3EOTH 3CU1A 1KCUL 5I15H 4P23B 4L5FH 2I60H 2IAMA 5JW4N 8FABA 2KL6A 1MQ8A 2NY5C 5FAAA 2VISA 3KPQA 2EH7H 3C5SB 4JFHD 4FQLL 1LD9A 3VWJB 4XPFH 4DOHB 5EOTB 4K2UH 5TE4H 4R7DB 1T21B 5HDQL 2V2XB 5BO1L 4XBGB 4E0RA 5I1JH 1CDCA 3O6KH 3TVMC 3U2SB 4HJGB 3Q3GB 4U1GC 4FG6C 3RZCD 3VWKC 3W9DA 3VD4A 5SWZE 2P7TA 5GSRB 3RWFA 2CDGB 4ZXBC 3N9GL 3FHAA 3MLTB 5EFIB 2WUCL 3FO1B 4LGPB 4LQFL 2CK0H 1AY1L 3QIWD 4M6OL 4RMRA 2JJUA 1XCQB 4PJ7B 4EI5D 4PJGF 3GSUA 4OZHE 1X5FA 2ZUTA 5DSCB 4OCSL 1AFVL 1KPVA 3NFNA 1BJ1J 1S9KC 4J2XA 1MSPA 4OAWA 3F58L 1AI1L 3WIFA 1RURL 1FYTB 3OR7A 4O2FA 5T1KA 4KI5D 5IMMA 5E6YA 3HR5B 3T4AB 2GHWB 5I18H 2NY2D 3KYMA 2EDFA 4KTYA 1LEKB 3KLHD 4YHML 5GZOC 4ORZC 2D0HA 4FHBD 3V4VH 3U79A 5D6DA 1CR9H 3LKQB 3DX9B 4O02L 1M4KA 1CDYA 3EYOB 3KLAA 4BKLA 4WI5A 1MJUL 4CJ0A 1HINH 5BXFA 2OYPA 5DEGA 5JPNA 3I84A 4NYLB 5DJDA 2A9NL 2YUXA 5EIQA 3EGSA 2YBRB 3O3AA 2EDNA 4ZAKC 3R1GL 4JFYB 4ZYKB 2V2TB 3EHBD 1VDGA 3WCYA 5C0BE 5DK0B 1IC4L 5CJXA 4KZEH 1IL1B 3MLVL 3QDJE 3O6FC 3WFBH 4OZIF 4K55A 4RFOL 4WHTA 3ALWA 4ZFOL 5DD1H 5CD3A 1EH9A 5EU5A 1MREL 1EXUA 4Q9BA 2PXYA 5C08E 3P0VH 1I4FA 4XCYA 1R3KA 3K4DA 3UTPE 1BD2B 2CKBA 2FL5A 2OTPA 1FVEB 1L0QA 1MHHA 2DMBA 2B8OT 4DKAA 3P73A 4HMEA 4KZDH 2AAVA 1LO0H 5DYOA 1A6ZB 4EVNB 1A4JA 5F8QC 1H3PL 5FYKD 1QRNE 1D5XB 3ARYA 5I19L 4X83A 1CD9B 4LKXA 4X0KB 1FG2A 2QL1A 5KSAB 4P2CG 3RA7L 2OJZL 2FJGB 3F5WB 1MEXH 1RIHH 1YPZF 1UWXH 3RI5F 3QUKB 5CJOL 4CL7A 1DVFA 5I73C 1J8HA 1HZHL 1L7TH 5IBLD 1K3IA 3FOMA 1KJ2H 4HS3A 1FJ1A 1KNOB 3DUUB 5C0AE 1X6LA 4LSVH 1Q9KA 5DR5L 4ODVL 2OR7A 3TESA 1DQML 1T89C 4PJIE 2F8OA 3LMJL 4U1JB 5FGRA 4LHUD 1V5JA 5GGSA 1ZEAH 3IDIA 2VR4A 3B83A 1RUML 4FQ1H 2MJWA 1KYOJ 1G1CA 3CU7A 5GGVH 1TNMA 5IHUH 2A73A 3QDGA 4U6XA 5FCUL 1NLBH 4KGLA 1INQB 2HJKA 4KDTC 4HK0A 3PNWA 2IGFL 2NZIA 3QDME 4XMKH 4GXVL 1MFAL 1OB1A 4DAGL 4WW2C 3UP1A 4LPUA 3JVGC 1U0QA 2P42B 4JPKH 2H3NB 3SGKC 1ES0B 3REWB 3PP4L 3HKFA 4OCRH 3LN4A 3CC5A 4R8WH 2OSLB 1YEEH 4UU9A 3KYNA 3QG7L 4Q9CA 3CCHA 2X9YA 2BOBB 4APQC 5ID0A 4DCQB 4KPHL 4GXUM 5JUEL 5HPMA 4LVOB 4UT6L 3ARDC 4RMSA 3NN8A 2GY7B 5D1ZA 4HHAB 4LP5A 3NA4A 4YDJB 1CWVA 3P40A 4HF5H 1PZUB 3C2AL 3QJHB 3ILQC 2NYYC 1TDQA 5DJ6A 2W9DL 1FYTE 4QT5B 4JZJA 3QO1A 1BM3H 4PTUA 5AD0B 2AQ1A 5T3XL 1QFUL 4F7TB 3CSGA 3HFML 2QQKH 4U6VL 2HKFL 2HT4C 2WINB 4MS8D 3MUJA 3QQ3B 4ERSL 2QSTA 4S1DC 1KSRA 2YC1A 4OSUL 5T3ZL 1PD6A 3DMMD 4FQPA 1VPOL 3VFVB 3U1SL 1HKFA 3FOLB 2EXWC 3VGAC 4X6CB 5AUMA 4YFLF 3W11C 1XIWB 1BZ9B 3OJDB 2YRZA 4M93C 3NZHL 2BHZA 2VL5A 1F4XL 5DMKA 3RPIA 1RZ8B 5DUBB 2XT1B 5B4MD 2NY0B 3TIDB 4JFFD 3D0LA 3L3OB 4XMLH 4KWUA 4PFEA 5DZOA 3E2HB 2KKQA 2DIAA 3NIFE 4Y5VB 1EEYA 4JQVA 4FTVA 3EJZD 5EBMA 4V1DB 2W65B 4P2OC 5AG9A 1FVCB 1RSFA 3IFLH 1N6VA 3E3QC 4QHMA 5EU6A 2PW2A 2AV7A 4C59B 3EBAA 3KPRB 1T83C 2ADIB 2AERT 1GRWA 1E6OL 2COQA 3RY4A 2QQNL 1W0WA 3CH1A 4F37F 5GS2H 1JPGB 5HHQB 1HI6B 5BS0A 1T66D 4LNRA 3QISA 3CLFH 5T5FL 5F3BB 1UJTA 2AQ2A 4Y4FC 3P4LA 1K5NB 2VH5H 1E28B 4LVHB 1NMBL 2OL3A 4UTBL 1CXFA 1TTGA 1ZHKB 1ZTXL 5IVXA 2O93L 3ESUF 1B3JA 4M7LH 5SX5H 3BHBA 4JG0H 4BQ9A 4FFVD 2M2DA 2YD3A 1KIQB 5CILL 2A6IA 1Y0LB 4G6FB 5HGDB 1FBIL 3O9WC 3V5HB 4JDTL 4NNXB 1EJOL 4QHNB 4CNIA 3QEGH 3ULVF 5I66A 2GT9B 4JO1H 3O2WH 2GAZA 3IFNL 4XVTL 5GGTL 3SGJA 3NOIA 4IMKA 4JPWL 3OKMA 2PYED 1KT2A 2H8PA 4G7YL 1Q0YL 5B21A 3JSSA 1VFBA 5D2NA 3TNMA 1RZJL 1OM3L 5GRWA 5DFVD 2D7TH 3DVNA 1OD9A 1LMKA 4WY7H 4PGDA 3G6JA 3ARGA 1EO8L 4ONFH 2AJYH 1GZPA 4JHWH 1FIGH 2ZNXA 4JG1H 4NO0B 4Z0BH 4PJXF 4PJAF 3OJ2C 3BVNB 3B9KD 4LEXH 4LLMB 1T7VA 4O5LL 3TO4A 4X4XA 1HHJB 5CJ8A 1S9XA 4MNHB 2VN4A 5F9DC 3P30L 1NUFA 3MC0A 5A2FA 2XZCH 5I76A 2Q7YA 1FFOB 1YC7A 5GS1A 2P5WA 1II4E 5FYJD 3RZCC 4ODXA 1LDPL 2XA8H 3JV6B 1A14L 2RFXB 4CMMB 1MIEL 4OZFG 1GGTA 4NC1C 4G3YH 1ND0B 3MRCA 1ZLVK 4Z76A 2QJDA 5EBWA 3HS0A 4QHLA 1VCAA 4MWFB 4QYOB 1PYWB 1TVDA 2ADFH 3HR6A 3QNYB 4W70A 3A67H 3VJ6B 3CDCA 3QIWC 3RGVB 3HZVB 2QHLA 1J8HE 3OKDB 4EI5C 1EVUA 1J12A 5KVMC 3WSQH 4HS6B 4QRUB 3O3EA 4HFWB 3SE4C 1YZZA 4R2GB 3REVA 3FZUD 3F7PC 1L7IL 5ESAB 4LK4A 2FH8A 2P24B 1UH4A 4KI5C 2IALA 3EYUL 4LCCC 2NY2C 3TN0C 4LLUB 3HG1A 1MF2L 2FEDC 2NXYB 1RIUH 5GGRA 2FEEL 4Z8FL 5K59E 1ZAGA 3IJYB 1VENA 2X4TB 1FE8L 1SEBA 4Y2DB 3U4EA 3MNZB 1JZ3A 1G7JB 4BZYA 4X9GA 2EDJA 4I9WE 3Q5TA 5I6XB 3QDGE 5E94B 1MWAB 2C1PA 4AM0B 5FHBH 5JOFB 5FYKH 4MCYB 1QKZL 4S1SH 3U0PA 3EHBC 2Y07L 3AREC 3W0WA 1KTRL 1NGZB 1DLFL 1L9MA 3NPSB 1ZE3C 4MLIA 3QT2A 1KTLB 4RGMB 4OUOA 3AY4A 4XAWL 4ZUVA 1VACA 1WT5C 3QH3A 1UKSA 2ZJSL 3OV6A 3AB0B 2ORBL 3IJSB 1SYVA 2XFXB 3ARSA 3KPSD 3MUZ1 4M62L 4WI8A 5DDHB 5EU7E 2BVQB 5EZIL 3OWEA 5JW3H 3MOBL 1HSBB 4J3XA 4XZUB 4MQ7A 4KJQC 1TJHH 2PW1B 4Y5XC 2YN5A 3HUJF 1FGNH 1FNEA 3JUZA 1OF2B 3L3DA 1A1OB 2GCYB 1V05A 5IV2A 3ET9F 3B6SA 2R1YB 5FUZL 4S0SD 3VDCA 5D8JL 1TVHB 1LE5B 2VXSH 2H2SD 2Q86B 1T7WA 4MJ6B 3LSOA 5B3JE 1YEHH 4KTDL 3B9AA 5IBLC 5CZXD 2FBOJ 1ERNA 1KCRH 3INUL 4KKLD 4Y8DC 1D9KC 4GQ9L 4BQCA 2B5IC 5F7MC 5C92A 2BNUA 1NBZB 2XPGA 2DKMA 3GHEL 1KLUB 3HE7B 1NAMB 3LKPA 3SO3C 3VG9C 2IEPA 4L9LB 4MMZC 1DBBL 1PG7W 2V6HA 4MAYA 4UUJA 1G7MB 3O8XD 4HK3J 1JWSB 3RJQB 3STZA 1NGWB 5TDNA 4ZPTB 3SE9L 1BJ8A 1KGCD 1A1MA 4NZRH 4AIZA 4PD4K 4YPGA 3T4YA 1C1EL 4NPYB 4X7FC 2PO6A 1TIUA 1ZWIA 1OSZA 4EZMA 2VDNH 2JIXB 1JWMA 4FTVE 2K9UA 2X6MA 4JFDB 5TE6L 3PDGA 3PHOB 3VD5A 1HHIA 4P3WA 1A6TB 2DMKA 4YHOH 5IB4A 4U0QB 1FQ9C 1TZHB 1UB6B 5EU6E 3HRZB 5HYJE 1NANH 1J5OL 3IKKA 1P7HL 5IVNA 5DUPH 1DQJA 3BGFC 4E42A 1EIBA 1HEZA 3QFJD 1RMFH 3MBEA 1CDBA 5BS0E 2IQ9L 3X3GL 3QWQB 3C8DA 2NXZB 4HLZG 5F7EL 1QBMH 5FKPB 2JJVA 2DI9A 1HSAA 5K33A 5J57B 4JY5H 4E41A 1GSMA 3VD3A 4Z77B 2OZ4A 1CFNB 1U8JB 3TBWA 2IC2A 1TVBB 5IVXE 4GMSH 3PGCB 5DJYB 2P46B 5D7JB 1OTUC 1SJXA 1ZGLM 3SDDA 1ONQB 2UWEA 4G8IA 4OIAA 5DTFB 1XGUA 3W82A 2VAJA 3WXWL 1P9MA 3LKRB 5L2JA 5I8CA 4JKPL 1RUPL 4MS8C 1S3KH 4QLRA 3BISA 3OKNB 4IOSD 4TUOA 3LQZA 3VFTB 1JHKL 5EOCL 3DYPA 3DMMC 2NW3A 1G7QB 3WN5A 1QSFD 4PJEA 1M6OB 1EK3A 1JNNL 5IT2L 1GVIA 5J9PA 3HZMB 4XMPL 3D3VA 2A83A 1RZKL 3CZJA 4UV7H 4HT1H 5D2NE 1OWRM 3GMNB 4NT6B 1CFQB 5KVEH 1OGTA 1K8IB 1XF2A 1SMAA 2NZ9D 3G6JE 2GFBA 3DROB 3KYKL 1R5WA 4X6DB 1IQWH 3H7LA 4PP1D 1U8HB 2GSIB 4WEBL 1JHTA 3C08H 1HHGA 4WWID 4RAUA 4GAGH 1A64A 1MJ7L 4P4KD 1W0VB 4LSRL 4HIIA 3EJZC 1WBZA 4L8SB 1WJ3A 3MV7D 1U8IB 3BQUC 4LAJH 5DHXB 4C57C 5KSUB 2APTA 4KRLB 1ZANH 4Y1AB 1YY9D 1DUZA 1I85A 1ZVSA 1WIPA 2WP3O 4CKVX 4PRBA 3T2QA 4WU7A 2R1XB 3QUXD 5JXAH 1RU9L 2DQIL 4R90H 1G9NL 3FT3A 3LS4H 5CUSL 2YPKA 2P5WE 1K4DB 5GRZA 3U30B 3TH4T 4H1LB 5F1IB 4JDZB 1YEFL 1FZOB 1L4IA 5DQ9A 4O2EA 3KJ4C 1CGYA 4EOWH 1A3RL 3F8UB 3AXLA 3CVHB 3GSNH 5JMOC 4IRJD 3UTTA 3CMGA 1BVKB 1A6UL 4FFVC 3L7FB 4P2QB 4PY8I 1G7HB 5HHMB 3V5KB 2WZPD 2A74A 1Q72L 3EDJA 3L5XH 4L8BB 2G75B 1AE6H 1Z9OA 2HJLA 2R56H 5DVLA 4MZ3A 3WLBA 3QDAA 2AV1A 1YYLL 4K7PH 4XBEL 3V6FA 1J1XH 3ESVF 2B39A 5GJTH 3EOBB 1ADQL 4OZ4B 1GAFH 2YUWA 1DL7H 5MENB 4CU6A 4MX7A 4PLJD 4PRAA 5FCSH 3HG1E 1I8KB 1IEBB 3X14A 4CMHC 1CDIA 3QQNA 3IU3B 4NM8H 5IBTL 4LCYA 2HRPH 4K3DH 3EYQC 2CR6A 3L7EA 5IMKA 1PKQA 4ZFOA 3FB5B 5I1LA 3H3BC 3IAPA 5FYJH 2R8SH 1BVZA 3CFBB 4LLYB 2DYPD 2XZZA 3T2OA 3ZDZF 3EOAA 1YQVL 2DQJL 3ZYZA 4DN3L 1BREA 1FDLL 3C8HA 5BRZA 2CXGA 4F9LA 2ERJC 1NGXB 3MXVH 2GITA 5C07D 2ENSA 2Q76B 1OAKH 1FO0B 1Z3GL 2VLME 5DRNA 4JGUA 4XNYL 1LP9F 2J5LC 1KEGL 1A9BA 3X13B 3VFNA 2AJZB 3NCFB 2XIDA 5DVNA 1IGFL 1YEGH 2J6EH 5BOPA 1D5ZA 2B1HL 3E8UL 1NGPL 5E2WH 1GGBL 4XCCL 5A1AA 1PGRB 1SMOA 1P84K 2LE9A 2WBJD 3NH7L 4I3SL 3BEWB 4NKOA 1DEEA 2XACC 4YX2L 3HLAB 2OTUA 1GJIA 3F12A 1JRHL 3GFUA 3S7GA 3IFPB 2HMID 3O2DL 4GSDH 3QIUD 4MXWL 5E08L 2FZ3B 2JB5L 3TBVA 4JVPA 3FQNA 5A16B 4L29A 2ZCHL 3V8OA 3MV8A 1SHMA 3D87B 4HULB 2VDML 4PLKD 1VGEL 4O2CB 5LG1A 2P8PA 3O6ML 4JHBA 5D1XC 3HNVL 2EDEA 4U3HA 4CU8A 3MA7B 1UXWA 2OMBA 2VLKB 43CAB 2BC4B 3ETBF 3ULSB 3BIKA 3MO1B 2R2HB 5D5MF 2J4WH 4DZ8B 1NPUA 2NY6B 4RGNB 1AGFB 4FZ8H 5E2JA 1PZ5A 1UWXK 2HFFB 2X70A 4XNUL 4G5ZL 4ODBD 3UDWA 3P4MA 4DUVA 3LRGA 4KHTL 1M7IA 3RDTB 3ALPA 1CI5A 1ORSB 4LHQB 3I75B 2DQUL 1AD9A 3QXUA 2Q8AH 5KJRH 4WW1B 3VXNB 1D5IH 1J7VR 1RZ7H 1L0YA 4HCRA 4GRLA 3KJ6H 5IWLC 3ZT6A 1XF4B 3H9HB 4F3FB 1U58A 3OAUL 4MNGB 5L9DH 2WUBH 1S7XB 5EIIB 1YUHA 1LDSA 1G0DA 2EZ0D 4NKDB 4HPYL 3QUZC 2BY0A 2BMKA 1HKLL 4XWGL 4JZOA 1WZ1L 5HGAB 2DAVA 5I2IB 3BW9B 4NJAL 2OCFD 2VAAB 4PB9H 1KN2H 1ZVYA 4G42A 4WI7A 5GPRA 5DZLA 3T77B 3MLPA 2G9HA 1W72B 2BERA 4E41E 4P59H 3PV6B 4J3VA 1S7SA 4MDJB 4OTXH 1FFNA 1NAML 5J6GB 1DBAH 3SO5A 5JIIA 1AC0A 3Q6FA 4YHYB 4RGOH 4AEHH 4KVCL 1NC4A 2UWEE 4OD2B 4NKQB 1EFXB 5LCVL 4NZDA 3RY6C 2WP3T 2Z93B 4YHPA 1LO3H 4WO4B 3QB7C 5EU4A 3IETA 3KS0J 5E8PA 1LK2A 2H2SC 4HJ0D 4PJ5A 4JDVA 5C3TA 1G6RA 1DN0B 1YNLL 4QRPA 4RFNB 4MA7H 4RWYL 1IILE 5CZXC 4JE4B 4NDMA 2VLRA 1T2XA 2V9QA 2DWEA 3U6RA 1LO5A 3C8KA 5FKAB 5FOJA 1Q9LB 2GTZA 5GSVB 1RZIB 3D3VE 4GAJH 3QXTA 1MNUL 9CGTA 2XQYK 3O4LD 2R1WA 4DFIA 3CFDA 3WO4B 1F3JB 1U8NA 4OLYH 3O8XC 1ZHBB 5IR1B 3QEQE 5KANI 4FQ2L 2PR4L 1XH3B 2R0ZH 4DQOH 1UACL 4GJTB 4J8RB 4LLDB 5J1AA 3DPBA 2X4PB 4X7SL 4HAFA 4XBPB 3UPCA 1AHWA 2OX5A 3FB6B 1DQTA 3EDFA 1P7KA 3MBXH 1N5AA 3D85A 1MCPH 1CICD 3N1FC 2ESVA 4K94L 1ORQB 1F2XK 1GOFA 3DX7A 3ROOA 3U4BH 3C5JA 3QUYB 1LO4L 1D6EA 3SOBH 5IQ9B 3LZFL 4QRSB 2DBJA 2JJTC 2DJUA 1MY7A 4CW1B 3D5OF 1ZT7B 1CLCA 5GGUA 3MYZA 5HYQB 1QFWL 1G9ML 1QYGL 2JELH 1QR4A 2D0GA 2K1MA 2VDOL 4MD5B 4NRZA 4NN5B 5D7IB 2VJXA 2XNAA 4HIJB 4KKBD 1JNHA 1MHEA 3QIBD 3GIVA 3FFCA 4PJFE 1U3YA 3VGHA 1NAKH 1B2WH 1HXYA 4K8RH 4TTGA 3OR6B 4LMQI 4PJBF 2VQTA 1WF5A 5EO9A 3V6OE 1I1FB 1NCWH 5KBNC 3V4PH 5GGTA 3U9UB 4Z7OE 2HAZA 3UYOD 1MCLA 2WWKO 3UTTE 2GK0B 1IGJA 4ODSL 1BGXH 4I77H 5AZ2L 1M7DB 3TA3B 2I9TB 1PQZA 2X1QA 2DRUA 4RGNE 4PV9A 1QSVA 2C3VB 1VERA 1NCAL 2XN9D 3Q3GA 5EC1A 3OL2A 4OV6F 4Z7WF 2AABL 3EDDA 3WJLA 2R4RH 3QXVA 2ATKA 3X11A 4FS0A 5L6YL 3LKNA 3K8MA 2DLFL 2IBGA 4K8RC 3D2UA 2XTJD 4OM0H 1EAPA 4PV8A 4M8QA 4K07A 1VFUA 3MLTA 7CGTA 5KVGL 2EE6A 1C08B 1PKQE 2VXUH 3RBSA 3TYGL 3RRQA 1JPSL 2NZ9C 4PJ7A 4TYUA 1EEUA 3RWGB 5CBAA 4Y4HA 4PP1C 4NQSA 3RVVD 1S9VB 5BRZE 1IE5A 1DLHA 3O45B 2GJ6B 4MD0A 3A6CH 3TV3H 4Z7NF 3T0EA 4RBPK 1UXSB 2DLIA 2WAHA 2D7NA 2YMXL 1IT9L 4JFOB 4JKLA 3OKEB 3CVHL 4NWUH 1DANU 3HNSH 1NCTA 3SE3C 1RUKL 3QBTB 3T3MF 4KMTH 2CGRL 4KV5F 3GSXB 4LARH 1N7ML 4PG9B 4PREB 1CXLA 1WIUA 4M8VA 3WUWG 2AJSH 1T2QL 1XZ0B 4JO2H 2CLRA 5LBSH 2QR0A 5HY9B 2ID5A 4HWBA 1FL3A 3KWWB 3DSNA 3D39B 4I18C 3PABB 3O3DB 2WM0A 4JFYA 1CFVH 3L5HA 1EGJL 3CD4A 5H37H 5SWSD 4QOKB 2ADGA 1E4JA 4QRRB 3ZHKA 3KXFA 5M94B 3ARVA 4KGJA 1C5BH 1SM3L 3MREB 1JN6A 2D31A 4NQCB 3VWKB 3OPZL 3MV8E 4G6AC 4IDLA 3UTSA 1YY8B 1TJGH 3IDMA 4N1CA 3MGOA 4JKWA 5FA3A 1FVEA 3MLXH 1FO0L 4GS7C 3B2VH 4I3RH 3LS5L 2JJSC 2GSGA 4W4OC 3H9SD 5FOBA 1Z2KA 3RUGB 5IFHL 3BE1L 4KRPC 1HK6A 1T04A 4KKCD 3DXAA 3MLZL 4GUPA 5F1OB 4YXHL 3IDGB 5D7LA 1I7TB 1I9JH 5CEYA 3WIHL 1YEJL 3IS1X 3ZE1F 1UG9A 1KFAL 2A0LC 3VI3F 3B4NA 1CGUA 1I7ZB 4PGCA 1JPTH 1IGTA 5E8OB 3QNZA 3DECA 5CKGA 3AU1A 4U3CA 1P4LB 2Y72A 3SDCA 2HG5B 4R3SA 4GH7B 1FPTL 3V4UH 2NX5D 4Z0XA 2OS7A 5JLZA 4TUJA 2FD6H 1SEQL 1A6AA 1S7QA 3K1KC 4OGXH 4ZAKB 2CDEB 5T3XE 3H9ZA 4NCC1 1I1AB 4TTDD 4U1SA 3QEUB 3HMXL 1FLTX 4XP4L 3O6FB 1G0XA 3BKJH 4R96A 4HUVA 2YZ8A 2ZUUA 1KF9B 1MQKL 1BIIB 4PRDA 3QG6B 5E95B 3FQTB 4JZNB 2HLAA 1CG9B 2BFVH 3VU2A 3MRMB 4K3EL 2O5ZH 2ZPKH 3A0OA 1OCWH 1UKTA 4NN6C 1J0IA 1JVKA 4OFYD 4RISH 5F9OL 3NIGF 4PJ5E 1CK0H 1PVHA 2H3NA 4HC1L 4TNVK 1ES0A 5SWZD 3REWA 5GXBB 4QRPE 2H2PC 3T0BA 1ZT4A 2VLRE 5ERWB 4MNQD 3U7WL 3RTQA 4OZFA 3FB8B 3I2CH 1AIFB 1SY6H 4HHAA 4O4YH 5K9JL 4YDJA 5I73B 4HGMA 1LE9A 5FM4A 4UT7L 3BEVA 4LKCA 3RP1A 1HQ4B 3IFOB 1I7RB 4WHYG 3ZTJH 2E9BA 4I0PC 4G6JL 1N6UA 4G8GD 2F5BL 1W72L 1FH5L 4FFZL 5I1EL 1BQLL 2QHRH 2VXTL 1EEZB 4JFPA 5GRJH 4WI6A 1Z6JT 2ESVE 4P9MH 2E7LC 3ARQA 2XZQH 4HUMB 2X09A 5CJ5A 1LEIB 1T22B 5ACMA 5ALBL 4WFHD 1KCSH 1BZ9A 12E8H 1E4WH 3O11A 4S1QL 5I1GH 4XXCA 1JZ8A 2EZ0C 3MRPA 3S34H 4J7RA 3WIIH 5GJSH 3K74B 1DUYA 5C2BH 5C0BD 1KJ2B 5JIKA 3FFCE 1MVUB 1BQHB 4OT1L 2CJUL 4MJ2A 4CADB 3GJEB 4I2XB 3QDJD 4WW2B 3I3DA 4Q6IC 4Y5VA 1S7UA 5SWQA 3WDHA 5LGKA 3C6LA 5LWYH 3U0WL 4FFYL 4HUKB 1CE1L 4HS8L 3CH8A 3DYMA 3BOVA 1OAXL 1EHNA 5CLWA 1K85A 4F15C 5C08D 1AXSB 2DQTL 4APQB 1JV5B 2VXVH 3WYRA 5KW9L 1MCQA 2VC2L 1P2CA 2EYSA 3ARDB 2RJMA 3VXUB 4J6RL 1S9YB 4LLWB 4MGXA 4YHIA 2BJMH 4JPVL 5F6IC 4H8WL 2MOVA 4HIHA 4ENEC 3QHZH 3S97C 3WJJC 1PLGL 3ZKQD 4J4PD 4YZFE 3PWVB 2ZG1A 3DIFA 2DQDL 3GSWB 3ZHLA 4BFBD 3D18A 1I8IA 4HJJH 1R3HB 1S7VA 3PP3K 1E4XL 1UM4L 1AH1A 5EZLA 1IGYA 4DGIL 3I3BA 5FGCE 3WFCH 4PRPB 4XPTH 3E6FA 4HSQA 4D9QE 4M6ML 3VGAB 3ZMRA 4S1RH 1KIQA 1RUQH 2X4QB 1TTFA 3VXME 4PJEF 3ZKXC 5KSBF 4KK8D 2RAMA 4LSDA 3TJEL 3O2VL 1DQLH 1DE4A 1UA6L 4U7KA 1PJ9A 3T0EE 2ICWI 5HTSA 1I9IH 4M93B 2AKRB 3OXRB 1OP3K 3FRUA 3SJVA 5FGBC 3EYVA 3VXSE 1GC1C 1V7NL 1A7OH 1DQDH 1UM5H 2V9RA 2G5BB 4P2RB 3ABZA 1RJLB 1N5YH 4AEEA 1CFSA 2XV6B 1M05B 5J6HB 4GRWE 3NFPB 2ADJA 4N5EC 2YK1H 2FATL 2VR9A 1F6LL 4D8PB 4P2OB 2J2ZA 4I5BA 2PYFA 1V3MA 4KKBC 2MQ3A 3QIBC 1FRGH 2FIKA 5MERB 3TGXA 3RL2B 5EC2A 2JCCB 1NCDL 3QCTL 3DRTA 5ICXB 4YDKH 5BJTB 3BVNA 2EIZB 3KXFE 5ACZB 2HWZL 4DKFH 1ADQA 3SDAA 2AXJA 4KH2A 3TNNA 3OJMB 1MCSA 4Y4FB 1IZJA 3UTSE 4G9DA 3WE6B 5E00A 3UYRL 3CDGA 1FZJB 4OD1L 5KTEL 2VIRB 5C9JB 2F5AH 3K7UA 4QXUH 4ONGL 3MQIA 3TP4A 2F53A 5HGHB 1NKOA 2P8LB 1NBVL 4JM2A 4Q0XL 5DGRA 2XQBH 1FNSH 4BQ6A 4JQXA 1FYTD 3ULUC 4YNYB 5JW4M 1KENL 2ATPB 5DS8A 4QY8A 3O9WB 5DQDL 3DXAE 2DDQH 3M1BA 4ZMAT 1YECH 2MWCA 3T0XA 4HH8A 4JFQB 5C0EA 1AKJB 3RWCB 3MFGB 4ELKA 2XTJC 3M8OH 3VFPB 5MEOA 3ZL4L 2FYYB 2HKHH 3P11L 5BVJA 3BPCB 2AW2A 4QYOA 2NY5L 3VXQB 4H25B 2FSEA 5IF0B 5LVEA 1FN4B 5T1MA 4RIRB 3T3PE 4QRUA 4JRXB 2EDWA 1ZV5A 1BBDL 4QTIL 3V7MA 4M1CD 1CD1A 1CFTA 5JOPE 2Z31A 4WNQB 1WFTA 4QTHA 3BGAA 2BVYA 2BNQB 3O2DA 1C5DB 1KXTB 2P45B 2W9EL 4TULL 5LGJA 5CHNB 1BOGB 2YD8A 5E2VH 3EOTL 1G6VK 1HCVA 2F15A 2IAMD 2WBKA 3GI9H 4OLEA 4Y2DA 5I15L 1G7JA 3I50H 4L5FL 1MUJB 1GZQB 3TBTA 3U0TB 3V5DA 1XR8B 4LCUA 1BD2D 2BSED 2APFA 2EH7L 2E8ZA 5F9JA 1S8DB 4UTAL 4KUZH 3EDEA 4EQ3A 4XPFL 1U3ZA 2F58L 4DVBB 3D9AH 5TE4L 1ZS8B 2IBZY 1NGZA 3RVXD 3QZWB 4MJ5A 1TZIA 4C56A 5C0NC 1UKQA 1BMGA 3NACH 1UJ3C 4PRIA 1EHLH 3RHWF 4FZEH 1WICA 3O6KL 3BZFB 5KSAD 3RZCB 5I1JL 3MACL 3CSYB 5C09A 3SQOH 4AIOA 4U2YA 1WAAF 3UYPA 4PJDB 3MUY1 3EUUA 1HSBA 2V5SA 3QHFH 1G7PB 5I1IH 3MV9A 3QO0B 4XRCB 1X44A 3QIWB 5E5RB 3BN3B 4EI5B 4L3CB 3GMPB 1OP5H 2K3TA 4KKCC 2DWDA 1JE6A 2K7PA 2ICWB 3OXSB 5HYSB 4AK1A 1JGDA 4JHAH 4N0UA 2B20A 5T1KD 2HVJA 2Q86A 5DFWH 1FCCA 2OJEA 4LCCB 2NY2B 3TN0B 2ITCA 2OTWB 4GW4B 1RULH 4M61B 4R4FH 5I18L 2IH3B 5GIRB 3MRQB 5DJ2A 4WTXA 5C0CB 3C60C 3V4VL 1IM3B 2I25N 1CR9L 3HE7A 3F7YA 3HAEH 2FJFA 2DL2A 1BAFH 4XVUD 4DK3A 5CKAA 1QVOB 5JDSA 1HINL 4NJ9L 1N26A 3KPOB 3D69B 3L3JB 4C83B 2Y36H 3D6GA 5ID1A 4AT6B 4AENA 4JPIB 1UVQA 5EZOH 5IFJA 1G84A 3PHQA 4BSVA 4ELMB 1P53A 1J8KA 3SHSA 1F3RB 1U8PA 3TBYA 2OBGA 4XCEA 4HV8B 4KZEL 3ARFC 1A7NH 5DJXB 3WFBL 5IW6A 5DD1L 5JW5B 4PR5A 4DVRH 2AJ3A 3HRZA 4H0HB 1OPGH 3N1PC 4D9RE 1T1WB 3P0VL 4QKXB 3IDJA 1AO7A 4NWTH 4N90E 4Y5XB 3QXAA 4P49A 4BSJA 1MCNA 1NGYA 3EOYG 4IRSC 4F58H 5C6WH 5DMJB 5CMAB 4KZDL 4IBLT 1FL5B 1RJZA 1LO0L 1DBMH 4QXTA 1OT1A 1IEAB 1NDMB 5HI3C 4NO5A 8CGTA 1RV6X 1ETZB 2E7CA 2PCPB 1NJ9B 5H94B 4JVUA 3ECBA 1MEXL 1RIHL 3BH9B 3LV3A 1DVFD 1D6VH 1GYAA 5D7JA 1J8HD 3OGCB 4OV5B 1OVZA 3P9MB 1L7TL 2A38A 3LQMA 2Z35B 4MXQC 1D9KB 4WDIA 2B5IB 1JTOA 5HGBA 1XGTA 1HWHB 5FF6B 1KJ2L 4CVWA 1J05B 1QSEA 3SO3B 3WFEL 4HWUA 1AGCB 4LSVL 4R9HA 4XNZC 2J8HA 1U6AL 2MKWA 3EDKA 4NNYB 4UILH 4LHUB 4YR6A 5TGBB 3SJVE 4Y4KA 3S96B 5KN5B 3JWDH 1E6JH 2VLJA 4WV1A 4KKAD 4V1DD 3MJ8B 2Z92B 5D9SB 1ZEAL 2Q6WB 1U95A 3RWJA 3MLSH 3B8YA 5D2LA 5D96C 4JY6B 4FQ1L 2VDKH 5E2TH 4I9WD 3G5XB 5C6PB 5GGVL 3QDGD 1WQVT 1G7IA 5IHUL 3DROA 5I1HH 3L3HB 2DTMH 4UNUA 5B39G 2EICA 1C12B 1FNLA 3IJHA 1WCBA 3BAEH 3BP4A 4X8XA 5M95B 4WFFE 4RZCA 4YUEH 4P46A 2ENYA 3BGFB 3BDXA 3OB0K 4XMKL 5H2BA 4LDLB 4ZTOH 1OW0C 2B7DT 1DSFL 1DN2A 1R3LB 4JPKL 4WU5B 5KSUA 5CCKL 1E4KA 4DTGH 3JWDC 4OCRL 1WBYA 5J3HD 4QNPF 2FHCA 3GUTA 1YEEL 3I6LE 5FK9A 4LQ1A 4CDHA 3MPCA 5EU3A 3HPJB 5D1ZD 5DO2D 2F53E 4IDJH 5CP3H 3PXJA 5INCB 3LN5B 4HF5L 3L3IA 1RHHB 4WEMB 4MMXC 4B7IA 1PY9A 4OM1L 5A43C 1RFDL 2J8UB 1BM3L 1FSKC 2B2XH 2R9HC 4QO1A 3QUMA 1NSNL 5SX4H 1I1RA 3DMMB 3GMRB 3NTCH 1NH6A 4HD9A 1CQYA 3PWLA 3NVQA 1F4YH 2IJ0C 4LRIA 1H5BA 2MHAB 2N7AA 5KOVC 3WBDA 5ICZB 5EUKB 4KK8C 1JBJA 5C1MB 4EN3C 2IFFH 4BSWB 2W92A 5ALCH 4ZOCA 5C0FB 2EIEA 2YPLA 3TFKD 4PRHB 4IJ3C 4I4WB 5I17B 1ZLUK 4NO0D 5I0ZA 4R0LC 3PWPA 1XF3A 3S3PA 5F96H 1MCKA 1VHPA 2P48B 3DV4B 4I3GA 4ETYA 1FZMB 3IRPX 1OSPH 2DM3A 4PJ7F 4RMVA 5MENA 3QWOA 5IK3A 4WUUA 1D5MA 3RKPA 5C6TH 2YA1A 4ZQKB 1JWUB 4XMLL 1ED3B 5KSVB 4OD3H 5EZJB 5ACLA 4WHDA 3BQUB 2AXFB 3RBGA 5ANMA 2DQEH 5D7KE 5EU6D 5HYJD 5I71C 3WLWD 2KUTA 3IFLL 2MQ0A 4P4RB 2M1KA 5HD8C 1KN4H 1QFHA 1FO0A 4R4BA 2E7HA 4XVJH 1RPQA 2YSSA 4C56E 1T20B 4PRIE 2KZWA 2AJZA 4ODTL 1I7UA 2WIIB 2HTKC 5C09E 3CLFL 4YBQC 4FNLH 4GAYB 1BVLB 1Q9WA 4F7MA 1Y6NR 3RGVD 3BP5B 3KJ4B 1QHPA 5FO9A 4X98B 4D2NA 2VH5L 1UEYA 3MV9E 1OQXA 3ARBD 3B3IA 3LPFA 3W81A 2VE6B 4HKXB 4X6EB 2CIIA 4ZUTB 5KS9B 4AL8H 4JG0L 2Y5TA 1T5WA 3DVGB 3C09C 4ZOAA 2EC9U 1N64H 5B38B 3G6AB 3GSQA 4EDWH 1KUMA 2FWOA 4GKZB 2HTLD 1JFQH 4N0UE 1LO2H 1J0JA 3GSRA 4JO1L 2FO1A 4L3EA 5FO7B 4LGRB 2PYEB 1Q8MA 4CMHB 2C4XA 1MH5A 4M7KH 5C0DB 4OLUH 3EYFB 1S9WA 4N9GB 5DK3A 1JPFB 1JGLH 4M3JA 1YEIH 3GSNB 4BH7A 3MRGA 3N06B 4XGZB 2D7TL 3PWNA 1YMMA 4OFKA 5L2KB 4ZODA 2ERJB 1VADA 2AJYL 4JHWL 4JG1L 1P4IH 4Z0BL 3LRSB 2QQLH 1Z5LB 4YFEA 1U8OB 3RWEB 2MCPH 3TO4D 2IAMC 4LDOB 4LEXL 3RDTA 4L8CB 2YEZB 3OKKB 2FDBP 4GT7A 4U6TA 1TCRA 3G5YB 1QEWA 1SYSA 5CJQH 3ILPB 4I48B 4F7PA 3VDAA 3RVXC 2CSPA 4M5YH 3WUWA 3IGAA 3P9LA 1F00I 1AO7E 5IJVB 2APBA 2J8UE 2P5WD 4X9FA 4U1NB 4Z7VB 5JA8B 3QNXB 3S5LB 1JI1A 2M26A 3SCMA 3VA6A 2LV4A 2YXMA 4U49A 3VD9A 2XA8L 3V2AR 2ICEB 4LLVA 5C0RH 4JQIH 1NFIB 4G3YL 5K9KB 3W9EB 1WWCA 1AGDB 5L8KB 2ITDA 5GRVK 2V2WB 4Z6AT 5CFHA 4NM4H 5DURB 4OUUB 1M7XA 5F7DB 1WIOA 3SY0A 2ADFL 3VE0A 2C7UA 4HEPG 5D1XB 3ZE0E 2D03H 1OTSD 4JO3L 3WSQL 3UJJH 4EI6B 1JI2A 1MLCB 1QSEE 5HI4D 2IPTL 4ODUB 4RFEA 5E7FA 4RMQA 4Y16A 1MPAH 4NCDA 1U92A 4WCYH 2JIXD 3NIDF 3HG1D 4UQ3B 2VLJE 1JGEA 2FGZA 1JZ4A 2CKBH 1RIUL 3DYOA 2RHEA 5D6DC 5C7XH 5D2LE 1EPFA 4KUCD 3FT4B 4H26B 2HP4A 4FFWC 5DFTA 5A3IC 3UBXG 5JHLH 4FXGA 1CVSC 2X4NB 5FHBL 4K7PY 4LLDA 5FYKL 1DP0A 2DMCA 3WKNA 4X6CF 4S1SL 2VLMD 3L1OH 4M1GL 5CJXC 5E6IA 3G5VB 1H0DB 2H9GB 5FDWB 4HQQH 3BDYH 3BH8B 2W0FA 1X5YA 3QUZB 1HH9B 3SDXA 2VLLB 3GMLB 3RI5K 4LU5H 4N0FB 3TH3T 1X5XA 3C5ZA 4WWKA 3BWAA 1VGKA 5FM5O 3NA9H 3KPSB 4P5KA 4X5XA 3D25B 2ED7A 2AEWA 4NHCH 2PXYC 4F7EB 5JW3L 1QD0A 4QRSA 2IWGA 4KI1A 4UOW0 4TOYH 4OBSA 4HZAA 3MRIA 1TJHL 4FA8A 3SGDH 4MHHG 3VD7A 1CDJA 4F33A 5CZVH 1F42A 5CP7B 4PJ9D 4B5EA 1A7RH 2YKLH 3BPNC 1AQKH 2KH2B 4LCWB 5GRUH 3EAKA 4L4TA 1HQRB 1MCJA 1NDGA 4Z78B 4N9OB 4TVPE 4JFZL 5JHDA 4U3XA 2VXSL 3IB4A 5AYQA 1DVFC 2GK0A 4MA3B 3VFMB 4GG6A 1J88A 2IADA 1YEHL 4P5TA 5TDOA 2ZSVB 3HHRB 1GPOH 4PG2A 1KCRL 2Q3ZA 5DF0A 2A9MH 3BN9D 3RU8H 5DMIL 3KYOA 2YPLE 5D1QA 3QYCA 1RUAH 3O8XB 1PY4A 4QGTA 5I8EB 1F58L 3PWPE 1X5AA 3C9NB 5MEQA 4N0RA 2EE9A 3WV0A 1BQUA 4KKAC 4NZRL 4Y0GA 1OT2A 4WUUE 3IXAA 2PO6D 5E1AA 3FONB 2UYLB 3I9GH 1IC5L 2E27H 2FX8H 4U1HB 1P7QA 1UZ8B 4Y1AD 2VDNL 1GXEA 1DBKH 1L6ZA 3TBSB 3CFJA 3FJTA 2J88H 3MRJA 4DUWA 3RWGA 5ANME 3LH2H 5C0IA 5L8LB 4YHNA 2QV2A 4YHOL 1GHFH 4WTZG 1ZSDB 3NCJH 4G7VH 5DUPL 3UXFA 4RCAA 1LHZA 3QFJB 3KPLA 3I02A 3FFDB 3T1FB 4WEUD 3MBED 2DQCL 1I9RH 4MJIA 5FO8B 1RMFL 3GSXA 4CVXB 4KJYA 1FZKB 5EU7C 5EA0H 1KJVB 2R0LH 2QTEA 5J3HC 5ESVB 1QBML 4E41D 2GQHA 4JY5L 3IKCA 4XCFH 5GHWH 3RVWC 2WQRA 5HY9A 3FRPG 5D1ZC 5DO2C 3UPRB 4MD4A 5IROA 3UTZA 1T1ZB 3S5LG 4GMSL 1HDMA 1JNLH 4NHUB 4P99A 1VEOA 3RJDA 4JZJC 5AYUH 2A6DA 1N3NB 5EUOB 4XPAH 5DUMH 3GK8H 3BRDA 1OTTD 1ZGLB 3OX8B 5CWSB 4POZD 2XWTA 4EJ1C 1PSKL 1NFKA 2L7JA 3OMZA 3DURB 5TPWH 2D7PA 1BFVH 4NQCA 3IU4H 4L3EE 1JF1A 1OGAA 2QSVA 2EIDA 1R5VB 1U8KB 3QA3A 3SKNA 3L9RA 15C8L 1U8LB 4QRQB 2CDFA 4MAUH 3TFKC 4FQQA 4UV7L 4KTEH 4Z5RB 4F37K 2WWMC 5KVEL 5D4QA 3QEQD 3BUYA 1YMME 1U3HA 2A77L 1IQWL 5MEPB 2Z9TA 5K93A 4AYFA 3IDGA 3C08L 3U36B 4GAGL 4JQVC 4Q2ZB 3QPXL 2E6QA 4BH8B 3TO2A 2BVUA 1HIMH 1GOGA 5D7SH 1HOCA 4NO3B 1S7WB 2R4SH 4OLVL 3UAJD 1BZ7B 3DX8B 1ZANL 1AJ7H 3PWJA 2F9BT 3QUXB 1ZT1A 2DQGH 5JXAL 1K2DA 3L95B 3BO8A 4PJHB 4HUXB 4JRYA 2FB4L 4E5XA 1IAOB 4I18B 4R90L 2EO9A 3LS4L 3NABH 3U83A 4F57L 3HNTL 4ZO8A 1ZMYA 4PJGA 1I1AA 1Q9OA 1YEKH 4N8VG 3DETD 3RWDA 1MWAH 3L3GA 3PL6A 5IKCB 4TSAH 4ZTPH 1CF8H 4EOWL 1BIIA 3UTTD 3GSNL 1A6WH 3ZKSD 1N6QH 4JZNA 3UO1H 5DQJA 4OZGB 3EO0A 5IB3A 4QWWC 4RGND 1QSZA 4AQOA 4GS7B 4LSTH 4U6HB 3L5XL 4YO0B 1AE6L 1HXMB 4D0CA 2R56L 5IB1B 3GMMB 5JO5B 3AUVA 3Q6GH 5D71H 4KRPB 1SJEA 3LB6D 1HILB 4MDIB 2FBJH 1A7PH 1YYML 3W2DH 4K7PL 3SGJC 1N4XH 4IMKC 1J1XL 3CIQA 5GJTL 5D72H 4WIQA 1GAFL 1DL7L 3GMQB 2LU4A 3GSOB 3H3KA 4KQ3H 4M02A 4WFGE 2XRAH 2X1XR 5D2NC 4NM8L 5TH2A 4K3DL 4J3WA 5IM7B 1Z9SA 3ARGC 5F72S 1EERB 2DYPB 4OZIA 1MIML 5FYJL 2H32H 3MRNA 3BZEA 3MODH 2R8SL 4CVUA 5BRZD 4KDWA 4QCIB 4K23H 5C07B 1XF5A 4JN2B 5TDPB 5LQBH 3IF1A 3MXVL 4K3HA 1OAKL 4IOFD 3TO4C 3VCLA 2X4OB 3SDXE 4I0CC 4G8FA 3TM6A 2HT3D 4B7LA 4XP9H 4OB5H 3MJ9L 5ENWA 3V6BR 2I07A 1LEIA 3MNVA 1A0QH 2FO4A 3G08A 1JUFA 3PF2A 4JFXA 2J6EL 1DCLA 1MAKA 4GKNA 4G80A 1EFXD 1HYSC 4Z7UB 4FQCL 2VQ1B 4HUNB 5GS1C 1H15B 1WGOA 1YPZA 2YA2A 2WK2A 3O81A 4GSDL 4L4TE 3E0GA 2EDTA 3FQXB 3PIQA 2HH0H 4I2XA 4NCC2 1F4AA 1QHOA 3VW3H 4NN6B 4P3DB 1YMHB 4MZ2A 4ONHB 5JHDE 2QSQA 3NCYS 1XGQA 1QQDB 4L4VA 1A2YA 3EFFA 4R6UA 2X89D 4GG6E 4R7NA 1CL7I 1K8DA 4XC3H 3CFEA 2R15A 3VXOA 2XKNA 1ZA3A 2G2RB 5HI4C 2V9TA 4XXDA 3SBWA 1MFBH 3BPOC 3RZWA 1NL0H 2J4WL 1YDPB 2NTFA 1CGXA 1CLYH 3AS0A 3FT2B 1XGPB 4FZ8L 3RKDD 4F2MA 4YFLI 3ZLQC 1R24A 3KPMA 4I0PB 2PETA 4Y19A 5E8NA 2EXYC 1J86A 3DV6A 5DT1H 3SKMA 3W39B 3RVTD 3JBG7 2Q8AL 5KJRL 3CFKA 3D0VA 3F7VA 1D5IL 1RZ7L 2GY5A 2OQJA 3P77B 3KJ6L 4LLQB 3VFRB 1T0MB 1ZHLB 2MCG1 4EUPG 5L9DL 2WUBL 5C0JA 1MCRA 3AY4C 2ED9A 5C0GA 4MJIE 4RAHA 3MLWH 4KK9D 1T3FA 3MJ7B 3VRLF 4PB9L 4X6DF 3BKCH 1G9EA 1KN2L 1W0YT 5ICYB 2HVKA 1RJLA 4GMTH 4Q6IB 1M05A 4X7DC 4G9FB 5AEAA 1CXIA 2AS5M 4XB8A 1QLFA 4P59L 3T8XA 3V6ZA 4OTXL 2V7NB 4F15B 5DJ0A 3B9EA 1DBAL 3KHQA 1HCFX 3UJTH 4V2BA 4QEGA 4RGOL 4FMFA 1BBJB 5BJTA 2CRMA 1LO3L 5F6IB 2EIZA 5BQ7A 4OKDA 4PJ5D 3N85H 3PDOB 4X6FB 2L4OA 2IH1A 3OZ9L 2E6PA 4NQDB 5HHVH 3BX7C 3WEXA 3IDXL 4JFEA 3BZDA 1U91A 1A6PA 1KTDA 1OGAE 3JTTA 2VLRD 1BZQK 1IKFH 5IQ7H 1FZJA 2DN7A 4L8DB 2H41A 1NCCL 2HJFB 1T5XA 3O4LB 4GAJL 3LEVH 3WHXA 4MAYC 4ZD3H 5LGHH 1OL0A 3TZVA 4OLYL 2ATPA 5K9OB 3SKJH 4DQOL 2R0ZL 2OZ4H 1ZGLP 1NEZB 1QA9B 1Y6MR 2PO6C 4I13B 4YHZH 2DLHA 3FAXA 3MRBA 4P3CH 1OWWA 2VDQH 3D85D 3QJFB 5DVMA 2CRYA 3MBXL 1MCPL 2NLJB 4RIRA 3U4BL 1CU4L 3SOBL 2DQFB 3LKOA 4POUB 5F3HA 1TTUA 3R06A 4PYGA 1FC2D 5T1LB 3MBEC 2JELL 2F8XC 4JRYE 5FECA 4FABH 5E1HB 4QRRD 1QR1B 3TVMD 3OHXB 4X7TA 3QIBB 3V0VA 1V3JA 1J18A 1BOGA 4UI2A 3PGDB 3FQRA 4FG6D 3TIEB 4PJGE 5B39A 3S4SB 7FABH 1NAKL 1B2WL 4K8RL 4F8QA 1E0OB 4RSVA 1L0XA 1MUJA 1NCWL 4ZXBD 4CN6A 3V4PL 2HFEB 2N4IA 3FN3A 3SDDC 3VRIB 1I3RA 1UH3A 3DUSB 2Y23A 4GO6B 2AQ3A 1BGXL 4I77L 1JK8B 3THMH 1CE6B 3X17A 3C87A 4UV4H 4UNVA 2XYCA 1P9MC 1VFAA 3P4NA 4POZC 5IBUB 4EIZC 2X4RB 4U1KA 4RA0C 3WN5C 4U1LA 4X8JA 3MRFA 4X99B 2NY3C 2R4RL 1Q94B 1WSST 3N9GH 5JORB 1IEHA 2XTJB 5GZOD 4AQ1B 4PJXA 2CO6B 4PJAA 4RQQB 4OM0L 4RRPG 4YC2B 4B53A 3O41A 5H35A 1F02I 3IT8D 2NNAA 3CMOL 2VXUL 1WC7B 2XWBB 4OCXH 4D9QD 5JTWA 3DRQA 4OZIE 1MI5A 1RZGA 4Y4HD 3VXMD 1IAII 5CSZA 3BP6B 3ORJA 5E03A 3T0ED 5DJCA 1X5HA 3A6CL 1H8NA 4M43H 5HVWA 2CLVB 1N8ZA 4LEOB 4YHMH 3VXSD 1S5HB 2X10A 4NWUL 3VFOA 4HIEB 3O6FD 4M61A 4KMTL 5BZDA 3K4AA 4LARL 4FQHA 4OQTH 1I85C 5ITFA 1HHKA 3FQWB 2AJSL 1ZLVH 4X9BA 4JO2L 43C9B 5BOZG 2VZVA 5JPMA 5LBSL 3ES6B 3PQYA 5F88B 4BZ2H 1F97A 1P6AB 5DRXB 3R1GH 1YPZE 4NQEA 4URTB 5SWSB 3DETC 1U8MB 1CFVL 1O7VA 2VABA 3RWIB 4F7CB 3BXNA 3NZ8A 2AXGA 4I8DA 4L4VE 1C5BL 1B4JH 5E24E 1WTLA 3UTSD 1TCMA 4U7SA 1FFRA 4UAOC 3RNQB 1TJGL 5IB5A 2BCKA 1U36A 3AM8A 2BSTA 1T1WA 4LGSB 4UDUA 5FIEA 2QSCH 3MLXL 4I3RL 4PGEA 3QULA 2A6JA 5J7CC 4FN0A 1GIGH 5JQHC 5I19H 1EHAA 3MLYL 4HH9B 4ZS7H 1MHPL 2O26U 5CGTA 3CXHJ 2EDYA 3G6DH 3HI1B 4NUJB 4LBEB 4JRWA 4FOMA 1DJSA 2PN5A 4OCMC 4O51A 1ZHNA 4Y19E 1S7TA 1I9JL 2YPVH 1HZHH 4DZBA 2I24N 1DFBH 3MV11 3BPLC 3OGCA 2NMSA 4JREC 5HJ3A 4ZNEA 4LVNC 5KG9B 4FQXA 2V7HB 3IDYC 3OF6A 4F9LC 5F1NA 3C60B 3GB7B 2NX5B 1OARH 3QP3A 1DQMH 3DOSA 2CH8A 3V4UL 4A2LA 2RB8A 4IOFC 3ZKMD 5DC4B 3QEHB 3VXTB 2YZ1A 2FD6L 3MTRA 1DBJH 2HT3C 4NRYB 3HUJA 4PTTA 4OGXL 1QTYT 5INDA 4AH2A 5D9SA 1ZLSH 5GZND 4YGVB 3E6HA 3L3KB 1CXHA 2GJJA 1FFPA 4A6YA 2Y6SC 3FTGB 5FCUH 1I3VA 3ARFB 3BKJL 2CUIA 3ARDD 1QPXA 3S4SG 2W0KA 5IMLA 4G6KH 4TSBH 2GJZB 1MRCH 3ULUE 2BFVL 4EDXA 4HKBA 3ROLB 2O5ZL 4IRSB 2ZPKL 3DBXA 3HAEB 2GUOB 1VFOA 4HMCA 4P57A 3PV7A 4RISL 2PNDA 2MPAH 5SWZB 1CK0L 2J3SA 2EO1A 4HCRH 3U46A 2V5MA 5D7IF 2BRRH 4JFEE 1A1NB 5JUEH 4OIBA 4GG8B 4HUWB 2I9LB 4J1UB 2EDBA 3I2CL 1SY6L 4OZHB 4O4YL 3NMEA 2A6KB 3TCLA 4U6VH 3VFGH 4LAQL 5ETUB 4XHJC 1BJMA 1MRDL 3P0YH 3UDWC 4XNZB 1RK1A 1X7QB 2Y1VA 3P4OA 4P2RD 2AGJH 4MHHI 3VDBA 1UQSA 4ZUUB 2QHRL 3P9WB 5GRJL 2J8OA 5IG7B 4XP1L 3RVTC 2P8MA 3CX5K 5DD5L 2JK5A 4GRLC 4P9ML 3WNOA 1YN7B 5E4EC 2XZQL 4P2OD 4HEME 3CLEH 4BSWA 1WV7T 4JY4A 5D96B 5JQ6H 3MV01 4JM4H 1KCSL 1I75A 4X4ZA 1IAKB 12E8L 1E4WL 1EHXA 3PWUB 1G6RH 4XNQB 5I1GL 3S34L 3UTOA 3MR9B 1BX2B 4JFFA 3RIAK 3TH2T 5JR1H 4KK9C 5GJSL 5C0BB 2APWA 3UBXA 5EBGA 3IVKB 4ZQKA 5C2BL 1JWUA 4QF1A 1FV1B 3QDJB 1KB5B 3C6LD 2BNRE 5I16B 5LWYL 1KLGA 4NKMB 1QBLH 3KPPA 2H26A 3ULVE 4GW5A 4PRNB 5EDXA 3X12B 5C08B 3V79C 1V8HA 2AK4A 4D9RD 2AEQH 3BZ4B 3VH8B 3HCVB 2VXVL 4K7PX 4YXKH 4XHQA 4N90D 2XKSA 5A2LH 3LEXA 4CVZA 1E27B 1CD8A 3VFWB 1QG3A 3O9WD 5T5FH 3HTLX 4HWNA 3Q5OA 2BJML 4LHJB 3QFDB 1B9ZA 1AKJD 2X44D 2P1YA 1QRNB 4KK6D 4D94A 5EBLB 2DTSA 1FSKB 1MAML 2FLRT 5HHOE 5GS2D 5ADPH 2VYRE 1IM9A 2FHBA 2C4FT 4HJJL 2V5TA 5DRZA 2SEBB 2A2QT 1H3GA 4PJXE 1MFDH 4PJAE 2VE6A 4UBDC 4NQXB 4JRXD 3VMPA 5IESH 2RCSH 1A9EA 3MMEB 1YJDL 4LSPH 3OKOA 3WFCL 4XC1H 4XPTL 1MI5E 4JDTH 5C0AB 1EJOH 4S1RL 4AG4H 4EN3B 3G6AA 1BWMA 1A22B 2XWJA 4ODWA 2Z8SA 5DJAB 4JB9H 2IPKB 4IJ3B 1DQLL 1AHWC 3KDMB 5DD3H 4PJIB 1I9IL 4JPWH 1IGIL 4LOUC 3RUGF 1Q0YH 5I1KH 2IANE 1A7OL 1DQDL 4S2SB 1UM5L 2AEPH 5L0QC 1N5YL 2DLTA 3MRKA 1EO7A 3GSNA 1VEPA 1R5IA 3PQYE 1BWWA 1HE7A 2YK1L 4K7FA 2LU3A 4OCWH 3ZT7A 5I71B 1NUDA 1LEGA 1T7XA 3QWRD 4WFFD 3QDMB 4NQEE 5IHZA 2DI8A 1FRGL 3B9KA 2VTFA 4WTZA 4XH2A 2VSCA 3VFUB 1INDH 4YDKL 3M17B 2MQCA 4J12A 1F6FB 3OAYH 1NGQL 5E9DA 3RVUC 4DKFL 2VNCA 2Z4QA 1JP5A 1EZVY 4KROC 1QP1A 3I6LD 2Y7QA 4OKVB 3STBA 1TPXC 2F53D 2F5AL 4QXUL 5FYLE 5EN2B 2ICES 3CK0H 4PJCB 3JV4A 3MRLA 2VUOA 3TYFB 4ZFZB 3FRPA 2XQBL 1FNSL 3WJLC 3C09B 3S5LA 4NKIL 4LPYA 3T0WA 4G8EA 4GRWH 2H1PH 4KC3B 3TN0D 2DDQL 1YECL 3MROB 4Q7DA 5E8EA 2FEDD 4PP2B 4HWBH 4LF3B 3M8OL 4ZSOA 2HKHL 3ISWA 2Z0BA 3MJ9A 3OKLB 2XKUA 3FB7B 5C0CD 1LP9A 4ZNEE 1NFDB 4Y4HC 2J6EA 4NGHH 1UC6A 2X4SA 3T0EC 4ZG1A 2P44B 5K9QG 3C6SA 3JWOH 3PGFL 4HGWB 3SE8H 3ARED 4H5SA 1ROWA 4TRPH 2EYTB 3SGDI 5ESQB 5IMOB 4Z7QE 3F7QA 3HUJE 1X9QA 4HBCH 5E2VL 2ZUSA 3KNBA 3UJIH 2IAMB 4RMWA 8FABB 4L1DA 3GI9L 3UTQA 2VISB 3KPQB 4LPXA 4KJQD 1WITA 5D7KD 1MLBA 1FVDA 1LD9B 2BVOB 3LRHA 4LASH 3LEYL 3DTXA 3DI2B 1CGTA 1FYHB 4RWHA 4XI5D 2VN7A 5EORH 2R23A 3D9AL 3V0AC 1YNKH 4E0RB 3BD3A 4YHKH 1YN6A 3JWOC 4PRID 3NFSL 3W9DB 4MB5A 3NACL 5J4MA 3MRDA 5D5MA 4FZEL 4OLZH 2W9LA 5C09D 2P7TB 5C2UB 4GLRH 3RWFB 3SQOL 1ZLWK 4HG4J 3ZDXF 4N8VA 1C16A 2BXYA 3MV9D 3SGEI 4YHLH 1D9KD 2ZKHH 3QHFL 4G43A 4WW2F 5I1IL 1KIRA 1CVRA 4HAGA 4UINH 3DO7A 3GSUB 3ZE2F 1KPVB 3NFNB 5GISH 2CUHA 4PIRF 1HQRA 1CLZH 3WIFB 3FO0H 3OR7B 4O2FB 5HVFB 5T1KB 1RK0B 1R6VA 4JHAL 2OR9H 5IMMB 3LHPH 3AFLA 1FNAA 3KYMB 4MA3A 2BDNH 3J7HA 4NQUA 2ZSWA 2X4UA 3SDCC 4R4FL 3GHEH 4GBXA 1DBBH 1JNJA 3KLAB 4BKLB 5DEFA 2O5YL 1CFBA 5BXFB 3NCCB 3ZKMC 5DEGB 5JPNB 1BAFL 3UX9B 5DJDB 3EGSB 1XR9A 3O3AB 4UT9L 3LD8C 4JFFE 4NSKA 4NBXB 3FO9A 4ZUWA 5GZNC 3L5IA 1NCUA 4UIKH 5D6CA 5EZOL 5TE6H 5TJWK 1D3CA 4WHTB 5CD3B 1A7NL 4HKJB 3QRGH 1O0VA 1J10A 5EU5B 5DMGC 1EXUB 3MUGA 4S0TD 2PXYB 3QHTC 1QLEH 4XCYB 1OTUD 2AVGA 1X4XA 1R3KB 4PJCE 4DVRL 1Q0XH 2AK4E 2CKBB 3CXHK 2FL5B 5IVZB 1OPGL 1MHHB 4DWHA 2C1OA 3P73B 1AO7D 2IQ9H 2R39A 4NWTL 5DYOB 5HI5D 4F58L 3BPNB 4Q74A 5CEXA 1DBML 1UCBH 4JLRA 4LKXB 1FG2B 4GKSA 1L9NA 2JCCF 3RTQC 1NFDE 3LKSA 1DVFB 1J8HB 5HDBF 2E9JA 4PRHD 3FOMB 5J11C 3Q2CA 3SEPA 4HS3B 1FJ1B 3ZDYF 3R4DA 5C71A 1Q9KB 1QSED 1AGBA 3HC0A 5CWSA 2AJUH 2BSSA 1MJJA 5EO1A 1T1YB 2LQRA 5IT2H 1QSFA 4UILL 3R0MA 2PUQT 5IJKA 3IDIB 2VLJD 5C9KA 4K9EH 3GJFK 3JWDL 1R5VA 1E6JL 3BQUD 3SKOA 4WHCA 1NBYA 1IBGH 1UT9A 1UCTA 3MLSL 3UC0H 2IG2H 25C8H 2A73B 2W59A 3QDGB 2VDKL 4PJBA 4U6XB 5E2TL 4XXCC 4D0BA 1T1XA 1PKOA 2HJKB 1DDHA 3OQ3B 1ACYL 4HK0B 5I1HL 2WBWB 5MHSE 1R0AL 1DTUA 3B5HA 2D9QB 1S7RA 2DTML 1R3JA 4XNMA 2XTLA 3BAEL 4P4KA 1OB1B 4YUEL 32C2A 1XT5A 4Y5VC 3C6LC 1CBVH 4FXKA 5E5MA 3LQAH 3MV7A 4HFUH 5EG6C 3V95A 4EUPA 4OI8A 1IARB 3LN4B 5E9DE 3CC5B 4U6YA 4O00A 4Z7WA 4UU9B 2ZUXA 5IOPA 3KYNB 4K9EC 3CCHB 3SPVA 2ZOLA 4DTGL 5ID0B 2V5YA 5HPMB 3QUXA 3NN8B 5D1ZB 1BEYH 1G9NH 3DGGA 4HZLA 4BUHA 4ZUSB 2FCBA 3HB3D 4Y8AA 5DJ6B 1WLHA 1T4KA 4IDJL 3B8SA 2MSPA 4JZJB 4WI4A 3QO1B 1A4KA 4X9IA 4PTUB 5FGSA 4KK6C 4NN7C 4TVPD 3ZDZE 1A3RH 5IKCA 2B2XL 5FB8A 4RBPH 4GRMA 2P5EA 4RNRB 2YC1B 2XY2A 4IRJA 5JZ7D 5DRWA 1CGWA 2JE8A 4ZSOE 2OK0H 3EYQD 3LQAC 3M45A 4M3KB 5A2KH 3S37H 4KU1A 4X5LA 4YK4C 3L6FA 3NTCL 1LP9E 5HDLA 4PJDF 1F4YL 5GGSY 3SKUD 1J1OH 5L2KD 2IFFL 4UDTA 5JO5A 2VL5B 4RAVA 2BVPA 1G9NC 4QHUA 1EDQA 5DJ8A 5DMKB 3PWPD 3RPIB 3PJSA 3D0LB 2ZUQC 2F8VA 4WUUD 5IBTH 1OSPL 3V9FA 3GMQA 1IC7H 4HLZH 3L5WA 4HWEH 1EEYB 4IS6A 4FTVB 5EBMB 4HIXH 3BP7A 4OD3L 1EJ6A 4KI5F 2DF3A 1INEH 4NO2A 3TPUA 5EU6B 5HYJB 2PW2B 5CIPA 2Y9RT 1KG0A 2AV7B 2DQHH 4H20H 4IMLA 2JJWA 1GH7A 2ZUVA 1B0RA 1W0WB 1U93A 3CH1B 2DD8H 5F93C 3MGAA 4XVJL 5C8JA 5BS0B 2R2BA 4R26H 4LNRB 3SDAC 1CXKA 3OGOE 4IEFB 5D5ME 3E8UH 4BYHA 3K46A 3Q1SH 1GGBH 4QXGH 1F6AA 5DURD 2IF7A 3T1WA 2OL3B 2VDPH 2WBJA 3EO9H 5IVXB 5D1XD 4ELMF 3ARBB 3CZFA 2C3GA 4JM2C 4O58H 4LRNH 4Z7UA 5J56B 4NBZB 3BHBB 3O2DH 4FQJH 4DGVH 4U1MA 4JQXC 3OBAA 2UZYB 5FHAH 2ZWLT 3QIUA 4X5WA 2A6IB 3K1DA 4AL8L 5LJYH 2JB5H 1UENA 3MGTA 2R0KH 4XTRD 1N64L 4CNIB 5I66B 1WWBX 4N8PA 4P3DA 1YMHA 5BZWA 3JTSA 2GAZB 2QEJA 3OJVC 1JFQL 5F7YC 1VGEH 4L3ED 3O6MH 3T65A 2BSRA 3OKMB 4MQSB 4DGYH 1KT2B 1ZA6A 2H8PB 1QRKA 4XWOD 3VXRA 4AEIL 3O3BA 1KB9J 1VFBB 4M7KL 5D2NB 3TNMB 4KY1H 4OLUL 4C54A 1KACB 1C5CH 2FECI 3DVNB 2Z31C 3GNMH 2R2EA 2I5YH 3G6JB 4PGDB 3ARGB 3AROA 1JGLL 2VXQH 3I3EA 4JANA 4UOW1 1YEIL 1YMMD 4RRPA 3GSVA 1GZPB 1KGCE 4NOFA 2ICCA 3QUZD 1BFOA 3MLRH 4KHTH 3MFFA 2W38A 3TO4B 1P4IL 4Y2DC 2Z91A 2QQLL 3QCUH 1U8QA 4X4XB 2DL9A 1T03H 3MRRA 2D0FA 4M9PA 1S9XB 3BIAX 3OAUH 4YXLL 1P1ZA 2FR4A 2X7LA 4ODHH 1Z0MA 1ACZA 4XI5C 1CLOH 3G5ZA 4IOIA 3VFRA 5CJQL 1BPVA 1ZHLA 3GBNH 5I76B 2Q7YB 4LCWD 1R3IH 4H0IA 4M5YL 5GS1B 2P5WB 5EOCJ 4NJAH 3MRHA 1WBXB 2IPUG 4ODXB 4NBYB 2VWEE 2H32B 4HUUA 4XPGL 3MRCB 2FNBA 2N1KA 2ZCKH 2YD1A 5HHXH 4Z76B 5EBWB 1J87A 5C0RL 3HS0B 4HMDA 4JQIL 4QHLB 1UWEL 3U7AA 1AD0A 1I1YB 5ILTH 4NM4L 1FP5A 2JB6A 5LCVH 2PTTA 4ZO6A 3O3EB 2D03L 2EYRA 3REVB 5HXMA 3UJJL 2NY7H 2QKIA 3BPOB 2IALB 3HE6A 3PDOA 4KVNL 4X6FA 5DHYA 4BFIA 1RJYA 5MP6H 2D7QA 5DWUH 2VITA 1MPAL 4G6MH 1QSFE 3WXVL 3HG1B 5GGRB 4WFGD 2CLZA 3H9YA 4YE4H 2J8UF 2F54A 1J1PH 1SEBB 1P5VA 2CKBL 2HJFA 3U4EB 1WEJH 3HE7C 5C7XL 4GW1A 1CZ8H 4PJBE 2C1PB 2FX9H 4D3CH 1UGNA 3KPNA 5JHLL 3U0PB 3W0WB 3GJFA 4ORGA 1UYWL 4DN4L 3L1OL 3QI9A 3BGMA 4ZUVB 2P43B 1VACB 3QH3B 4HQQL 3BDYL 1CICA 1SYVB 4Z18A 3MV7E 4YDIH 1N59A 4WWKD 4LU5L 1AGEA 4P5MA 5F9AC 1XCTA 1OLLA 1UM6H 3NA9L 4Z7WE 2EC8A 1B90A 4MQ7B 4NHCL 5KVFH 1G9MH 1QYGH 2YD4A 2FRGP 3PP3H 4TOYL 3QQ4A 5E99L 5KAQF 3L3DB 1Q38A 2FJHA 4PJ9B 3MYJB 5HI5C 1M71A 3U7YL 2AEIT 1TITA 2D9CA 5IV2B 4U1IA 5FM5M 1CGSH 1A7RL 1KYOK 3B6SB 4FMKA 1AQKL 5GRUL 4ETQA 2OP4H 1IQDA 3H3PH 5KSBA 1MFCH 3BD5A 5JHDD 2P5EE 4JHZA 4Z7NE 4IIQA 3LSOB 1FAIH 3R8BB 4K8RD 1OP3H 5D7JC 3GHBH 4P5TD 3EJYC 4LIQE 3T3ME 3GBMH 3GI8H 2BNUB 3RL1B 4KV5E 3HZYA 3EO1A 1GPOL 5IHBA 2XPGB 5MI0C 5GGRY 4HWZA 2A9ML 5IEKA 1G9MC 4MAYB 5D1QD 3RU8L 5JNYA 2XN9A 3FO2A 5I1CH 1T80A 1RUAL 1F5WA 3STZB 5TDNB 3S8WA 1A1MB 4Y4KC 4AIZB 4YPGB 2P47B 3T4YB 5KS9F 1FLRH 4WV1C 3CXDH 3VFSA 2PO6B 1ZWIB 1OSZB 1FORH 4ZDHA 1JWMB 1A3QA 3WO3B 3I9GL 2FX8L 1DBKL 1WC7A 2XWBA 2WNGA 3LDBC 2J88L 2IQAA 3LH2L 2MFNA 4TVPH 5F7HA 4NRXA 1GHFL 1JL8A 1QO3A 1DQJB 4P46C 3QUMH 4WGVB 4E42B 1HEZB 1WWWX 4G7VL 3MBEB 4WI2A 5BMFH 2VRAA 5B8CA 2NW2A 3UEZA 3CVIL 3WNPA 1E4KC 1T2QH 3NCBB 1HSAB 1Z9LA 4FQIH 5GRYA 3N0PB 5EA0L 1J0KA 4E41B 2R0LL 4G6AD 3TBWB 4PJ8A 4KRNA 4XCFL 1U42A 3HB3C 4ISVA 3SDDB 2UWEB 3VI3E 4HX1A 3N1MC 1JNLL 3OAYK 3WS6A 1FHGA 3MCKA 1XGUB 2WW8A 4KRPD 2E8YA 2B0SH 3P2TA 4UIMA 5AYUL 4XPAL 1U8MA 2A1WH 5L2JB 5I8CB 5DUML 3GK8L 3KYAA 3LIZH 3IDNA 3FQUA 4MQTB 4TUOB 5CBEA 2BP3A 3LQZB 5JZ7C 2NW3B 5TPWL 5TQ2H 3WN5B 1BFVL 3IU4L 1OGAD 2NY3B 2A0LD 5J9PB 1WFUA 4W68A 4Z7VF 1KELH 4LRIC 1H5BC 5F89A 3D3VB 3VXRE 2IMMA 2A83B 5DI8A 1K4CA 4IHOA 3BE1H 3H9SA 1OGTB 1XF2B 4MAUL 2CR3A 1XGRA 2GFBB 1HHHB 1R5WB 3W0WE 4KTEL 3QEQB 1VKXA 3MLZH 2W0LA 4JAMA 3WL9A 1U3HD 2HT2C 5I1DB 1JHTB 1HHGB 4RAUB 1YNTA 3V8CA 5I1AA 1GGUA 4HIIB 5LAXA 1WBZB 4ZS6D 3H7BA 1D5BA 1CT8A 5JDJA 2CIKA 2LABA 2V7HA 5D7SL 3NIGE 1DUZB 1FNGA 1DQQB 1ZVSB 3G04A 5DD6B 4GKOA 1WAAA 4PRBB 5DC9B 4WU7B 3WHE1 1AJ7L 3HZKA 4PPTA 2EIBA 2HA1A 4HPOH 4DFHA 2EKSA 1NKRA 4Y7MA 1PG7L 3I6GA 3FKUS 2YPKB 4JRYD 3CPLA 2AI0H 3TWCH 5TQ0H 3ZZ1A 2W60A 4X4YA 4RX4D 4PJFB 1YEDA 2EDRA 3PXHA 3NABL 5IW1B 3MOAL 1JMXA 4MSWA 2YUZA 4OI7A 4YDVA 4PLOB 3FCTA 5DQ9B 4O2EB 2H2PD 1MWAL 5K9QI 5IGXH 1MQKH 3AXLB 4IRZH 4TSAL 3UTTB 4ZTPL 1CF8L 2VZ1A 5ISZA 1EEQA 4U31A 4UAOB 4K3EH 2A74B 1N6QL 4UQ2A 3UO1L 4NP4H 3VI4F 1MCOH 4XTRC 2HJLB 2Y5EA 1X5ZA 1AQDA 4GFTB 3WLBB 4NZUH 3OB8A 4LSTL 1G7LA 2AV1B 4OFYA 3MNWA 4I0PD 3V6FB 1TQBC 3GM0A 5SWZA 3JZ7A 3Q6GL 3PE9A 4F9PA 4YBHA 2FBJL 1A7PL 2HYMA 4MX7B 4PRAB 5F6HJ 1N4XL 3X14B 5D72L 4MNQA 4XWOC 5K9JH 4KQ3L 2F54E 3L7EB 1XF1A 1PKQB 3VXPB 2XRAL 5BV7H 4ZFOB 4UT7H 3BPLB 1H3XA 5I1LB 3GIZH 4JREB 1FL6A 1OAYH 3AGVA 2NY6C 3EOAB 4OF6A 1SJHA 2BOCA 2F74A 3IDYB 5BRZB 2GITB 3MODL 1XFPA 4G8GA 4W6XB 4K23L 1BQLH 3WD5L 1PBYA 5DRNB 4ZOBA 5LQBL 3BFOA 1NC2A 3RDTC 4GQPH 3RNKA 3VFNB 2X2YA 5IEHA 2HN7A 4G9FD 3RAJH 1J9CT 2AJVL 5DJZA 5CEZE 5EPMA 5IB2A 3STLA 4LNVA 3T09A 1D5ZB 4XP9L 4OB5L 4H1LG 4XCNA 3ZSSA 1A0QL 4OGAD 3MUHL 1I8LA 1CS6A 4NKOB 1DEEB 4ZPVB 2OTUB 3F12B 2PTVA 4XNQA 5BV7C 4WGWB 1LVEA 5B22A 1IGMH 3SCMC 5EO0A 1D7FA 4ENED 2FX7H 4NQDD 3TBVB 4C55A 1GGIH 3FQNB 1F2QA 4PJEE 2HH0L 1VEMA 5KSBE 4L29B 6CGTA 4HS8H 3VW3L 1KJMA 4NKMA 5HHNB 4L4VD 2GTWA 3RQ3A 3MV8B 4PY7A 2GK2A 4Q9QL 5ADOH 2P8PB 1L6XA 4YHYC 2YWZA 2OMNA 1UXWB 2RBLA 3BIKB 1U2CA 4K3JH 4H8WH 2O61A 4XC3L 3DVIA 3RWHA 3I6KA 1ZXQA 4Y16C 3QFDA 4MB4A 1MFBL 3L5JA 4J4PA 1NL0L 1PZ5B 2VQUA 2ZOKA 2X70B 1CLYL 4C4KT 1Y18A 4BK4A 5EUOF 1E4XH 3P4MB 3IXTA 4W81A 3MZTA 3OB0H 5JXEA 1AD9B 4HBQA 5DT1L 3LAFA 3HC3H 3O6LL 4GRLB 4N5ED 5CGYC 3JXAA 5E4EB 4PBVC 1U58B 4LFHD 1AP2A 4Y5YA 1U9KA 5T1LD 2X41A 1QLRA 4BUGA 5E6IC 1HH6A 1YUHB 1NUNB 4KQ4H 3KDMA 3GMOA 4H8WC 2G60L 4PJIA 1V7NH 2BMKB 4JCMA 3Q0HA 4JZOB 3F7RA 4P23A 1UZ6F 1MVFA 5I74C 3C5ZC 4WWKC 4G42B 3KLDA 3MLWL 4TQEL 2G9HB 1U2HA 3C5SA 2D4FA 3VWJA 5I30L 2FECL 1S7SB 2FATH 4GMTL 1FFNB 5EOTA 4R7DA 2X1WL 2XICA 3ZSTA 1T21A 1WWAX 2B4CH 3T0VA 2WQ8A 2CQVA 5T1DH 2V2XA 2VZTA 2DM7A 3Q6FB 4XBGA 2LFGA 1QACA 2XG5A 3UJTL 4Z9KB 3U2SA 4HJGA 3ULUD 4YHPB 5EU4B 2N7BA 4XPBH 4KJWD 5E4IA 3IETB 5E8PB 5F1SA 4XPHH 1LK2B 3K4ZA 5GSRA 3KPTA 4PJ5B 3EFDH 4QHKJ 2CDGA 2D7MA 1ZLUH 1G6RB 3N85L 4QRPB 3TLRA 4PJHF 5LXGH 4JFED 2W0PA 4A2MA 5ITBH 4MA1C 5EFIA 2VLRB 3FO1A 1BIHA 2DWEB 4P5TC 1LO5B 2FEEI 3C8KB 3U6RB 4PG2C 1XCQA 5DSCA 1IKFL 5IQ7L 3VGFA 3DLQR 2R1WB 1LK3H 4WENB 3CFDB 5D93C 1U8NB 5D1QC 1MFEH 1OY3B 3DSFH 1FYTA 2B4CC 2UUDK 5LGHL 3HR5A 4YJZL 5J1AB 1MJ8H 3T4AA 4OZGF 3NPZB 1AHWB 3SKJL 1LEKA 1P7KB 4Y2OA 4YHZL 1N5AB 3D85B 4P3CL 4ZO7A 1I3UA 2ESVB 2VDQL 1MHCB 1OOAA 3LKQA 3DX9A 3DX7B 3ROOB 3EYOA 1FIEA 3C5JB 1D6EB 5L0QB 2BK8A 4GLRI 4NYLA 2IBBA 1WAAE 1K6QH 2YBRA 3Q48A 3VGDA 5GGUB 5JW4R 2V2TA 4ZYKA 5DK0A 4NRZB 2XNAB 1MCEA 1IL1A 4LPVA 1JNHB 5C0ND 3TVMB 1MHEB 1NMAH 3FFCB 3GIVB 4U1GB 4FABL 3IAQA 1HXYB 1JF6A 4TPRH 1T6WA 4X9HA 5EO9B 7FABL 2BNRD 1XEDA 4ZXBB 5IROC 3ULVD 1TZGH 1BD2A 1IGJB 4UTAH 1A8JH 4WUKH 3BYTA 2BVOA 2F58H 3LOWA 5ISZE 4KROB 4EVNA 1A6ZA 1PQZB 4PV9B 1TPXB 3THML 4UV4L 2MKLC 5L7XH 1JCKA 1D5XA 3CNKA 3MACH 5BCAA 4X0KA 5EC1B 1URLA 5KSAA 4PY8J 3BJ91 4Z7UF 2FJGA 3F5WA 5T5NF 4BK5A 2DBLH 2ATKB 5HHOD 3X11B 3QUKA 3LKNB 4JGJA 2OLDA 1WVZA 3D2UB 4MNQE 1EAPB 4PV8B 4M8QB 5FGCB 1KNOA 3DUUA 4OF8A 3C60D 1N0XH 5IUSA 5CBAB 3VXMB 4Y4HB 3QXWA 1MI5D 4OCXL 4NQSB 1G1YA 1U3HC 1DLHB 1QPPA 5F71A 4MD0B 4U1JA 2PTUA 3T0EB 2EDHA 5D70H 2D7OA 4G8GE 1RK0A 2VSDA 5HSFA 1B0GB 1IKNA 1K3ZA 4M43L 4ZS6C 3VXSB 1OHQA 4TSCH 2IAND 3ARFD 5T3ZE 4KXZI 1SVCP 4GRWB 1INQA 4OQTL 4WFHE 2CLRB 2QR0B 1PEZA 1FL3B 4NJ9H 2CRIA 3PQYD 2M8XA 3CAFA 4BZ2L 4IRSD<