3ZTTA

Crystal structure of pneumococcal surface antigen psaa with manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
278
structure length
278
Chain Sequence
b'KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTDSIAEQGKEGDSYYSMMKYNLDKIAEGLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
publication title A molecular mechanism for bacterial susceptibility to zinc.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal binding protein
total genus 105
structure length 278
sequence length 278
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zttA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zttA01
2YNMC 2XY4A 4FNAA 4IRMA 4WZBB 3AEKB 2XQVA 1K7SN 3G9QA 2AFHB 1N2CB 4CL2A 2AFIB 4WNAA 1QH8B 1M1YA 4HN9A 2O1EA 4H59A 4UTPA 2MINA 2OV1A 1M1NA 3TEFA 2YNMD 4WNAB 1TOAA 1G20A 4PM4A 1M1YB 3AEQA 2OSVA 1N2ZA 4OXRA 1PSZA 5GGXA 4N01A 5M29A 1M1NB 1G20B 2X4LA 3AEQB 2XH8A 3CX3A 4OVKA 2M6KA 5FLYA 3LHSA 4MDYA 3EIWA 5CX1B 4G07A 2AFIA 1KAHA 3PSAA 2OGWA 2PS0A 3HXPA 1N4DA 4HMOA 1K0FA 1MIOB 3MFQA 4TKUB 4XPIB 5I4KA 5JJ5A 5HDQA 3AERB 3ZTTA 2R79A 4MLZA 3TLKA 4OXQA 4INPA 4ND8A 3MINA 4NNOA 5M3BA 1KAEA 5M2QA 5CX1A 2PS3A 4K3VA 2ETVA 4ND8B 3MD9A 3MINB 1K2VN 2XV1A 4MX8A 2PS9A 1QGUB 1MIOA 1EFDN 2XDQB 3MWFA 4TKUA 4LJSA 4XPIA 4DBLE 5M34A 1L5HA 1XVLA 3BE6A 1KARA 4TKVA 5JOQA 4GICA 3AERA 4FILA 3PSHA 4LS3A 1N4AA 2PHZA 2QI9F 4INOA 2M6LA 4NNPA 4UDOA 4HMPA 1L5HB 3LI2A 3PDIA 4MO9A 2OV3A 4TKVB 4BBPA 3AEUA 3K1AA 1K75A 4WESA 5KHLB 3BE5A 5KOJB 5BVHA 5CR9A 3UJPA 3PDIB 1FP4B 3AEUB 3K1AB 4WESB 3NU1A 1QGUA 4H0FA 2XDQA 5BVHB 4WZAA 3ZKAA 3AETA 3EIXA 5GGYA 2PRSA 2Q8QA 1ESZA 1H1LA 1QH1B 2RG7A 4WN9B 2WHYA 4HMQA 4WZAB 2Q8PA 3AETB 4UTOA 5KOHA 4M7OA 1PQ4A 2XUZA 3U7QA 4FKMA 1M34B 2WI8A 5KOJA 3ZK9A 3ZK8A 3HH8A 1H1LB 4B8YA 5AFSA 1FP4A 5BVGA 5KOHB 4UDNA 3R5TA 3U7QB 1G21A 4FI3F 2MINB 2R7AA 4PAGA 3ZK7A 3GI1A 3HJTA 3TNYA 3AESA 5JPDA 5BVGB 5B58T 3MWGA 4G09A 4WZBA 3AEKA 1G21B 1QH1A 3R5SA 5JG7A 2AFHA 4WN9A 1N2CA 1QH8A 3AESB 1M34A 5HX7A
chains in the Genus database with same CATH superfamily
4ZDWA 4YLEA 1Z18A 3MJFA 1RI2A 4ECAA 3ER6A 3FDJA 2GAOA 3RABA 3E61A 2KBEA 5IDVA 4A1FA 2RC6A 2FK7A 2NVOA 2WYIA 4Q7EA 1K2WA 4W7HA 1ZRNA 2IU3A 2JW5A 1PFWA 3F47A 2MINA 3PR3A 1WXWA 4RPCA 2GASA 1TAQA 3PTZA 4MIOA 1ZVJA 5EMNA 5CDUA 4RXMA 1X86B 3GK3A 2O8EB 1YB6A 4ZIRB 3L0YA 3MZ0A 3W7AA 2CXPA 1S3FA 2A1UB 1LJUA 1L7BA 2VDLB 3I2FA 1TAGA 1U1IA 4WY8A 5ALLA 3G0CA 2WYUA 1XAHA 3HWX1 3P2EA 1BN7A 2YMPA 2FV8A 1VHLA 3N2KB 1IY9A 1N3BA 2POQX 2VTEA 3PXUA 4HRVA 5I7HA 3L5KA 1EWKA 2AFIA 4XA8A 5B1YA 2FW8A 3C24A 3ZNPA 4GMGA 4DMKA 4E11A 2Y3IA 5LFAA 3A0UA 3ZJTA 2K7ZA 2GZDA 4I1SA 1DAMA 4N8SA 3LUKA 1O5OA 3ROKA 3DA8A 2PX6A 2Q46A 1T1SA 2ANBA 2WJWA 5CB8A 5IYZA 4CTNA 4ZI5A 2DUMA 5LJLA 2SHKA 2J1LA 3A2LA 1KO8A 3MTIA 4RL6A 2GTPA 4EPVA 4I36A 2DZDA 1HSZA 3F6PA 5KINB 1P9WA 1URPA 1VG8A 3NBQA 4F12A 1HYGA 5HKOA 3I9LA 1XELA 3LLVA 3ONEA 1C0KA 5IFKA 1NTOA 1JPJA 3QX7A 2XECA 1MBZA 3C1TA 4WRRA 2O48X 1X94A 3MOGA 1PT5A 1CR0A 1WDWB 4EMUA 1GGFA 2RK4A 3LSTA 4EYKA 3E5NA 1YBMA 1VCOA 3EZ7A 1FVHA 5H70A 4ZZ0A 3KEQA 4Y18A 3FUUA 2DY1A 1YDMA 2BGKA 4N6NA 1L5SA 2PUAA 3W0LB 1TLLA 2V7QD 5JD6A 1NI4B 2ZR8A 2OWEA 1CB7A 2N47A 2Y92A 3GAAA 3LHFA 5DYGA 5C3UA 3IXQA 2ZSUA 1DKNA 3GQVA 1SUDA 4PC6A 5I7FA 4UDOA 5IJ0A 1TYAE 3LT4A 4ZEMA 3FCOA 2PCJA 4C9BA 1PYDA 3MLEA 1RI1A 2R87A 4FC7A 2RSLA 1VKZA 4QICA 3JRNA 4ARSA 2QTAA 1AN9A 5GONA 5B1IA 4M9XA 4CM4B 3JQAD 2YVLA 4QQRA 3LY7A 3T7AA 4TVKA 2VP6A 4B0OA 4B74A 4PCVA 4GEGA 1N2SA 3MXTA 3WP0A 3X1DA 1LD3A 5SY6A 2HB6A 2OYCA 3T41A 3JQ8B 1T3SA 2X5XA 4L5IA 4LQ4A 1C1HA 1AM4D 3OQ6A 1Z3CA 2D1SA 1Q19A 4UTOA 4YMLA 3D3EA 3OEYA 5DM4A 5AVRA 2O8BB 2OO7A 3GLRA 3GW8A 3OUZA 2GBGA 4TLAA 4YXWD 2XLCA 1UPUA 2FMTA 3GUCA 2QHXA 2JHPA 2YV5A 4ACAA 1DJMA 2GCOA 3EBOA 1W4LA 1X7GA 1YK1A 2BI7A 2OMKA 3OZGA 2JI4A 4Q7LA 5DX8A 1KY4A 4B46A 1F2UA 5JYCA 1UBOS 2FY8A 1CX9B 4HQKA 4RDIA 3F6BX 4Y6OA 5G0UA 2QVXX 5TJ9A 3VKFA 3BZBA 1PL0A 4ECEA 5KBYA 4TWJA 3ROEA 4D74A 1Z6ZA 3SOZA 1VLMA 3WYGA 4EG0A 5LBUA 2WIGA 2REQA 4BECA 3OLWA 2GX6A 5EE5B 1UOEA 1YXMA 3TLYA 3VPSA 3DV0B 3N8GA 4ZHSA 1JH9A 5DN6D 3BMQA 4JT8A 3PJEA 3MWDA 4U9HS 1E5QA 2WINI 1PN3A 4F4FA 4WHMA 2AN3A 3AEKB 4V1CI 4WKCA 1KVTA 3ZHYA 2C4UA 3L02A 2Y1GA 1W1WA 1ZKMA 3GF4A 1Q0PA 4EWLA 4ZCTA 3O6VA 5I3ZA 1E1CB 1MQ8B 3P26A 3WHPA 4CEJB 3D0KA 8ABPA 1G9XA 2Z58A 4G63A 4L5BA 3H9GA 1IY1A 2GVDC 1WUIS 1MLDA 3ZKWA 5LXTB 2II6A 4YMIA 3NWJA 5JTUA 1XQWA 3G49A 4DCCA 1DUIA 5CM9C 3WWCA 5HZMA 1SXPA 4DW8A 3ONFA 5AW4A 3EVTA 1OWMA 2H29A 1RWNA 2X4DA 4A82A 3IVAA 3HC7A 4C30A 5A4KA 4B6OA 4CHGA 1XLUA 1ZBDA 5EE3A 6NULA 4MUYA 3FHTA 3O9ZA 4BLVA 1DAFA 3WXBA 4UUNA 4HMOA 2OEPA 1Z8NA 3CTPA 4KDFA 4OB8A 1DX6A 2UKDA 3VA7A 1ZMBA 1H3EA 2ZB4A 4JUFA 5BWLA 4JJIA 3FYUA 2CK3A 3IA2A 4JNKA 4KIGA 3CVOA 1K9VF 1MJHA 3HJCA 4MXDA 4FYHA 4HWRA 1JB9A 3QBEA 4L6AA 2FWJA 4CFYA 2GPAA 5KSYA 4HFRA 5DM2A 2ZT5A 3RNLA 1FFCA 2P2ZA 2P1ZA 1JJBA 1VIMA 3QYAA 3UWOA 3OZDA 3VJLA 4Z2YA 4AJ9A 1WE2A 4NOJA 1G6HA 3OCVA 1IN8A 2XYHA 5ARCA 2LIVA 3ZY5A 4D8WA 2N46A 3VR6A 4CM8B 3LGAA 2HYDA 5AQ1A 1GHTA 4BO7A 5L7YA 1DOHA 1XMOB 3H83A 2YBDA 4TLBA 4ETIA 1SIBE 2IX9A 2SKDA 4UU8A 2HWUA 1GTVA 2WWWA 4JR1A 3VR0A 1KK0A 1PZFA 2YDXA 5G0TA 1TI7A 4OH1A 1QO9A 2B20A 2DU8A 1TPZA 4I8XA 1CQIA 5LP6F 2JFXA 3FTFA 3PYLA 5K03A 1MB3A 3IEXA 5JXIA 2QRLA 4LHVA 4QTXA 4JA2A 3C1AA 3JW8A 1OV6A 3DDWA 1PU2A 4CQMD 2REBA 3IRVA 2QRQA 3VR4H 1O94D 4EVQA 1G4HA 2EP5A 1ACMA 1NI4A 4OQ4A 4D4LA 5F77A 4X6YA 1T0JB 4RSMA 4CL8A 1LRLA 4EX7A 2PKQP 4CU5A 3PQ3A 4RCYA 4NE9A 2W98A 3NIFB 1FFBA 4NEQA 3GPCA 2PR2A 1UK7A 2HMAA 5EWMB 4M9RA 2EAUA 1ZHHA 3OTWA 4B8YA 4RUKA 1QP8A 1SXHA 2VO1A 5EI5A 4Q4CA 4CV1A 1PUJA 3DDSA 3EWIA 5BOVA 1FNNA 3H2BA 2JIRA 1LZLA 2Q5HA 1P2UA 1QZZA 2BI4A 4LHYA 3V4VB 1SZJG 3FYDA 3NT2A 3LKVA 3P2KA 5CNMA 2J3MA 1M6VB 2V7VA 5IG2A 1BQEA 1SOUA 1SQGA 2QORA 1T5TA 2P41A 3HCFA 1SKAA 3IV6A 1CR6A 3N39C 4H3VA 4L4RA 1KH3A 2BKXA 2IXFA 3I64A 5A4JA 1J00A 4EY5A 1RW4A 3TRKA 1NMXA 4G84A 3LVFO 4KPGA 1XG5A 3OZBA 2YICA 4ZHQF 5G41A 5IKXA 1XU9A 2EOAA 1OOEA 2ECFA 2PGOA 3MVEA 4MTCA 1PT7A 3CTMA 3QTBA 4DVJA 5K0CA 1DBVO 2VH2A 2RD2A 1E9SA 4W6ZA 1O5IA 1HZZC 2A5YB 2IZ6A 1EB8A 3BBPA 3EZXA 2ENUA 2I6SA 4LXXA 4N9WA 4TLMB 4CKWB 2EFYA 4JR0A 5BWCA 1IZZA 3ZIDA 4F56A 3GA7A 5COBA 4P93A 4NTZA 3B12A 3OHPA 3T5TA 3KEMA 4TMXA 4E7OA 3DLHA 1LNZA 4PYOA 5KTTA 2PTHA 4JOCA 1GNLA 4P82A 3F8SA 1G20B 2XF2A 3E7DA 4Q3OA 1GILA 3N0RA 2CF5A 1Q22A 3NIBA 2R1ZA 2W6ID 3HRKA 4FMCF 4JJ6A 4MQ6A 4WLFA 5DTRA 4D25A 1RQNA 4IDQA 3CC8A 2Y1DA 3GBVA 2BCEA 1IIRA 3TQCA 3TQFA 1E1CA 2IS2A 1U3FA 3QXXA 4KO3S 1ZH8A 3HB0A 1HPLA 5JXWA 4CEJA 3IP6A 5J2TA 1JKJB 4FK8A 4MPDA 2YCLA 3NAMA 1U4SA 4UKDA 1IZ0A 2V59A 4NONA 1B43A 1T0HB 2JFPA 3OUUA 4UU0A 3V8PA 4PN3A 5IT9A 1WSWA 1NVXQ 1S0UA 1LBSA 2V9ZA 2O54A 3DW1X 3GWZA 5EUBA 2CNWA 2VSOA 3L8GA 1EBBA 4C4RA 4IQ4A 2VVTA 1Z8FA 2NW6A 3BB3A 4ML3A 4YMGA 4EHAA 1AT1A 1DXQA 2AG0A 3ZUPA 4EF5A 2HMTA 4YAOA 1CF4A 3V4LA 2O7NA 1F8FA 3DC2A 4J03A 2CL6X 4GXRA 2VUIB 3NR2A 2HWYA 3RBAA 1E4EA 2C2ZA 4YT2A 4XR9A 3SDZA 3UJCA 5I45A 1TTPB 3L41A 3OT5A 3ZH9B 5IVHA 1DJQA 2F1HA 4EKIA 5JMOA 5DZSA 1OKKD 4XX0B 1AKYA 2QTLA 3U61B 2X5KO 4HH3C 1KP3A 6YASA 1ULZA 1K7FB 4IUBS 1E0KA 1U6IA 2AOUA 3ABZA 3PD0A 5EZ5A 1SUWA 3A11A 4HUQA 4DWVA 3LCUA 3IPCA 2QSZA 5BOSA 1ZWKA 2A94A 3CNQS 4NK4A 4BJ6A 3OD1A 4JB8A 2VWGA 2OAEA 3PWTA 5JAUA 2H59A 2BONA 2XOXA 3OIVA 4EENA 2QM0A 4XFKA 2H5JA 4M49A 3OHMA 4TLCA 4F5ZA 1SKUA 4I4IA 4BB5A 3S70A 4P0QB 1O1YA 1EJBA 1FTNA 2OHVA 3F4LA 4B6EA 1CUAA 3CCCA 4BVJA 1B0UA 2W58A 1ZEMA 4ROTA 1L4LA 1PFKA 3NC1C 2UUAB 4H3SA 1AK9A 1DXYA 1QRDA 2XOEA 1VPWA 5BV1A 1PVOA 3ZDCA 3SSOA 1R8SA 3DBRB 3VI3B 1G17A 2JCVA 4YP1A 4BQPA 4GXNA 1QGDA 4PWZA 1HX7A 3WP1B 2Q2NA 1Z68A 4U5XA 4PO9A 3S99A 1C80A 4M0UA 5FDFA 3HMKA 3QUCA 5FNVF 5G4KB 4JU8A 5I9NA 3NTVA 3L92A 2ZJ1A 4KVGA 4A10A 3UH0A 4E12A 3E5RA 3Q41A 5CB0A 1NZFA 1EGVB 1TKRA 2JKVA 4DLXA 1BOOA 1DIOB 3F46A 2E4VA 2JIZA 5KNBD 3VUFA 3LUPA 1C4OA 2V96A 3I28A 4JITA 4PC3A 3T4XA 2V65A 2V3WA 4QWMA 3CF4G 4CEIB 2A0FA 3VKGA 1RQ7A 1KJZA 2G88A 2L69A 2HCTA 5CTAA 3SOPA 2JCGA 1USVA 2HNBA 2RGAA 2GEJA 1C9MA 4HK4A 3E8MA 3K96A 3IR6A 1W5EA 2OENG 1XYVA 3O8DA 5H8WA 1NURA 3D6HA 3K9NA 4GU5A 4H7JA 4NIMA 2C3OA 4OAPA 3RC9A 1E9CA 2GPTA 1A71A 1AB5A 2RGEA 2XDAA 3QXSA 3CVYA 1QPZA 2DLNA 3L7IA 3TKAA 1KP2A 2GVNA 4ESVA 1Z0ZA 2FZKA 3L1VA 4HJRA 4C06A 1C3JA 1NE7A 2ZBRA 4LMPA 3CX8A 3WIEA 4YJHB 2QMEA 1R9JA 1H1TA 1CR4A 4H15A 2IZZA 4R1UA 4WOCA 5E3IA 5E9QA 2OGTA 3AT1A 3OMXA 4X1YA 3WNBA 3PGMA 1T1GA 3PK0A 2IELA 2DGDA 1G16A 1YQEA 2GEKA 1D2GA 3HY6A 2QU8A 3OWHA 4B43A 1VL8A 3ZE8A 1CUVA 3KALA 5C1OA 2HA2A 3WYAA 4WASA 2YWHA 4JP5A 1OA1A 3RFUA 5K0JA 3BXEA 3GDHA 5JD4A 3CRMA 4G3XA 3R0ZA 3UJ3X 2H51A 2IEGA 2O20A 2FW9A 5B64A 3QKRA 5KU1A 4OJKA 1T5OA 3QYJA 4JAVC 4MUFA 5KHOC 2CXQA 1FLNA 1PJ8A 3JD4A 5IBCA 4DNFA 3DE0X 4WV3A 2XYPA 3L6UA 1CFJA 3ETHA 1BHSA 1T9BA 4EYGA 3NDJA 2Q3EA 1VKNA 4R1SA 3ADKA 2CLHB 3ZEAA 1JKJA 4IVRA 4Q82A 2DH6A 1X19A 3QX8A 2OK8A 4PCAA 4YECA 3T7DA 3VPBA 1RWPA 1XCPA 2Q1XA 5CDGA 5JOQA 3SBDA 1KZ9A 1CHNA 1JHZA 1YONA 1ML4A 1T5SA 1RPAA 5KI6A 4C0JA 2UXDB 4Q6BA 5C35A 3DZIA 4RELA 4A0SA 1VHDA 3ETCA 1SAYA 1G3QA 5B12A 4BO5A 5JRZA 5IAAA 1HDGO 3GZTB 1OHHD 5LVAA 2AN5A 2X3UA 3FWNA 4BASA 1NASA 5JEDA 1UADA 4BBZA 2QPAA 2WAAA 3C14C 4QNRA 4XUGB 3VNRA 5ES4B 1W36D 3EXFA 1RHMA 1WR8A 2ABWA 4GC5A 5EIWA 4ETNA 1NVTA 3TZ6A 4BEVA 4B3GA 4P36A 3MN1A 3V2UA 3GLHB 4JLDA 5KNCA 3DE4X 4LOIA 2Z6QA 1QTQA 4IUYA 1GCIA 1R8JA 1JWLA 4DDWA 4C3ZA 1RSZA 4HY3A 2OQVA 4QUAA 4II7A 4CG3A 4N5MA 4Y7CA 2G3YA 5J1SB 3RYTC 3UAYA 1EDZA 4YRAA 1PEAA 1GCAA 3IDAA 4D4KA 1K7XB 1QH9A 5AESA 1SA0B 3DFKA 1W5SA 4HUJA 2OOSA 4ISCA 2IYPA 1KFCB 2GD0A 4UVIA 1GA1A 3PPWA 1I1NA 1HNWB 1JTFA 3C2QA 4G6ZA 2I7XA 4RQBA 4C78A 2FE1A 5LP6B 3DO8A 3SQOA 3IEUA 3EA4A 4QJ5A 3DBRA 5J5VA 4WJZA 4NOLA 4IUCS 3MJ4A 5HJ7A 1BWPA 4LFBB 3CX6A 2M9MA 1A9SA 1EJ6A 3M6UA 1SCBA 4JI6B 4MQUA 3D7MA 3KT3A 4QECA 1YDEA 1O08A 2HPVA 2A7QA 2R84A 1WZEA 4IYJA 1GNQA 4H4EA 1R3UA 4WFKA 3JQQA 2JS7A 5AHKA 1IBRA 2VJDA 2FQQA 3FLMA 3QFFA 5I9BA 4G86A 3CX7A 2VSYA 1ZJ6A 1R0RE 1WSBA 1X74A 2E3JA 2EL7A 4M7RA 4TLLB 3QU2A 4HXFB 4JJEA 4YAJA 1DBRA 1QVRA 2OB2A 1Y81A 3H97A 4I19A 4RCVA 3P0IA 2AEFA 3Q10A 3E5MA 4H59A 3WV5A 4BL5A 2QN7A 1NATA 3PICA 2Z9DA 5A6VA 3RFTA 1NR1A 2FEKA 3FCYA 2CHEA 4XW2A 1M2OA 1GPUA 1GKKA 4TYYA 1I33A 2GA8A 3AHCA 4QRIA 3WL7A 3RSQA 4HATA 2JFUA 2R6AA 4L16A 3QI7A 5ISMA 3IIMA 1FK8A 2GPWA 4M9ZA 4Z5XA 2BM0A 2JGLA 5CDYA 3L9WA 9MHTA 4HVLA 1Z26A 3GLQA 1A8PA 1KPGA 1ZXLA 4CFSA 1R6VA 4GR5A 3FCAA 1M0EA 1OH5A 1GAWA 1W88A 5C34B 5J2UA 2ZYDA 3N5KA 2LKDA 3U26A 5EHIA 5ENVA 1H2BA 4B4DA 1P5ZB 3THYA 1YSCA 5DCUA 5D51S 4OI1A 4ZHQB 3FUWA 3ZWKA 4XCVA 2XZPA 4E30A 2QE7A 4GMXA 4MV7A 3KKEA 4WL0A 3AILA 1MQSA 3PE3A 4G0VA 1T9GS 1WTCA 1E2FA 3DKIA 4B6PA 4G0UA 1MW9X 3COVA 2QP9X 3KCNA 4EGCB 4WBNF 5DP1A 5CFQA 3ZJUA 1E69A 3ETLA 2DBQA 1TCCA 3STTA 4BVFA 1RJGA 2A35A 4BRZA 4E70A 5DIFA 5HIMA 5IDXA 1A7JA 3H1EA 5F2NA 3EFOA 4E88A 2AFRA 4OTZA 3A9VA 4EY7A 1XMSA 1FRNA 4FMCB 3DULA 3GFQA 4BV8A 3G0OA 1Z2CA 4LF7B 3IQXA 2AOVA 3EXEB 5B36A 4TKVA 3QY0A 4R51A 3O4GA 1J8QA 1RPTA 1JA1A 1BO6A 1LLQA 1MOQA 3MYYA 1YUNA 3DTTA 5HUQA 1OAOA 3WFIA 2SKCA 1QOZA 3HCEA 4RVOA 2XCQA 1RYMA 4IDHA 2ONZA 3JZAA 1F8YA 2B21A 3IMGA 2J9ZB 1NVGA 5FUWA 1RKQA 1TW2A 1OC4A 1YGYA 2D0DA 2HF2A 1TM2A 2HPAA 4LJAA 1ZONA 2PZAA 3H8SA 2WUVA 5DCYA 2NLOA 4MV3A 4EHHA 1O0BA 1OIXA 2VZLA 4P54A 4DTIA 4LF8B 1DAGA 3GLIB 3EPLA 4LFAB 1U02A 1DRKA 3F7TA 4D4JA 1HEIA 1QIFA 1SRRA 4GMFA 3KYBA 2HMSA 4QELA 1ZUNB 4AMBA 1XX6A 3K16A 1XROA 3RQIA 2DR0A 5PGMA 4UUMA 2I1QA 3RCBA 4BUZA 4HGNA 3R6GA 2BL4A 2YFQA 4OMCA 5EZQA 2OQRA 1PEDA 2AZ4A 1HQYE 1SXQA 1XLTC 3P96A 4K9OA 1CY2A 2AHRA 3LRTA 2ARKA 2PZKA 2VA9A 3OFVA 2GBCA 2HIGA 4NBSA 5C1IA 4UNIA 1OLSB 3IPAA 2CWWA 2F1OA 3D6FA 1YA4A 2VP9A 1SCAA 2R4QA 5E7QA 2QK4A 4ZEWA 2MMCA 2WF6A 3GLHA 3C3BA 3S68A 5MHTA 4F8JA 2DT5A 4PLCA 1L5FA 4ZT6A 1CJBA 2X42A 4RWEA 5FTWA 1H4TA 4OB7A 6ADHA 2LCIA 2ZXFA 1P0QA 3NTLA 3ORHA 4BEWA 1I4EB 4YVFA 4ZU1X 4ZV9A 2X9LA 3E9EA 1M2KA 1SA0A 1XDDA 3I34X 1GR0A 1JLHA 4TVOA 3SF8A 5JYDA 5FNVB 3R8XA 4WXRA 2ZRHA 3JSXA 1QVWA 1TUIA 3AF2A 3HVIA 3OC6A 3OX4A 4MOWA 3PS9A 1NQOA 5G1NA 2VL7A 1T3HA 2HU5A 2JAWA 2X3YA 4UE6A 5JROA 1I3KA 4GL2A 3KSRA 4JJKA 4A8TA 2X8JB 1NBWB 3Q7TA 1DO0A 2DP4E 3K0AB 4AWXA 3ZJYA 1P0PA 3BD6A 4G65A 4QJ4A 4YYEA 1KIMA 3CEPB 3M0EA 4R2JA 5DMHA 5L95A 3DEZA 1HRKA 2Q6IA 3L0PA 3NJ4A 2JBHA 4RZUA 4AMVA 1TQ8A 2V7WA 4FFWA 4KMSA 4YLGA 3UPTA 1N5JA 4YJGB 4OQXA 4GMKA 1A97A 3GMIA 4LPSA 3V55A 3WQRA 1NNSA 4XGQA 3IDZA 5P8WA 1U7PA 2I4LA 4DCGA 3IJEB 4DCSA 1XU7A 2EC5A 2A5FA 3G2JA 1YNOA 3OP1A 4H3HB 5AM3A 3OQMA 2W8BA 1U65A 3IO3A 3SLRA 3N2GA 3I05A 2WWVD 3WIVA 3DWFA 4NU5A 3MTDA 3GWGA 1NP6A 2FX5A 3FB1A 4JYZA 4ENWA 4EKGA 4R2MA 2WDZA 2Z4TA 5AVJA 2Q5OA 3CLSD 3ASZA 3K7EA 4UBOA 2RHWA 2O2GA 1UXIA 3BMCB 1O7JA 1QV9A 4NDAA 5AMXA 2IYWA 3TI7A 3FCCA 2E4ZA 3K94A 1FFAA 4IZIA 5CJPA 3S1SA 2BGNA 1XO1A 1B42A 2ODPA 2X5JO 4ALIA 1K9SA 3ODPA 3RTCA 3W3AD 3L8EA 1ZK3A 2EKLA 1USGA 2ZRNA 5LQDA 4AKHA 2PA0A 4UFPA 3U09A 5D7NA 3OQOA 5C9ZA 2I78A 3B3AA 1KKLA 5JRJA 2B1IA 3UK2A 5I51A 3DDUA 1TLTA 2E0IA 2W2NA 1FXSA 1X80A 5TPZD 3DLAA 1Z7EA 4K6HA 3SDSA 2OGZA 3I30X 1IQRA 2C7RA 1UOQA 4NCNA 2POCA 1GGKA 4U7FA 3SMVA 3GZJA 3R5JA 1WU7A 4HYYA 1W4AA 4J16A 4UPDA 4PWYA 3T5BA 4BNDB 1POXA 3PZRA 1M0WA 4CM5A 5IJZA 3L7OA 1FMJA 2H0RA 2VDKB 1MMFB 3HU2A 3I9OA 2HPZA 4TRMA 3TEJA 1E89A 4R9VA 1XEXB 3U3JA 4PFKA 1C9JA 2PX4A 3PVCA 1HE1C 2F8TA 1Q14A 1CULC 1Z33A 2FK8A 2AE1A 2C7BA 1NQ5A 3KB1A 1BWQA 5DM0A 4C29A 1Q2UA 1NQWA 4EO9A 2RONA 4FW8A 2IYRA 1R4MA 3OT4A 2BOVA 1XPJA 1H0SA 2AG5A 2WOOA 3V7UA 4W5RA 1P1JA 4M0MA 5GOZA 1T6YA 2P2DA 4CM6A 3AF5A 5ALRA 3UJ7A 1CERA 5HQ3B 3K4HA 2EV9A 4C5AA 3QOYA 1XKTA 1I80A 1F4VA 3F98A 4JJFA 2ZGVA 3CNOA 3LD9A 4GNKA 2C9YA 2Y71A 5BRJA 7YASA 2QQGA 1PJQA 3OURA 4RNDB 4PLPA 4JU9A 3W5AA 1E1KA 1V3VA 3BL8A 4TL8A 3ZLTA 3NOVA 3CVWA 2WPDA 3CNLA 5GPBA 4YRIA 4A15A 1FUEA 1MP0A 2VNHA 3HP4A 2OHHA 3TTWA 3G17A 2F9MA 1PJZA 3QLVC 4CE6A 1U9ZA 4TTIA 5ALOA 4M54A 2EEZA 2J3IA 3GJYA 1Q6ZA 1R10A 2BRUC 2I8LA 2JFNA 3AYXB 3LGSA 3G2PA 1S8AA 3TFQA 1CKEA 2I6QA 4K1LA 1JDPA 4Z0PA 5K7SA 1IH8A 1RTKA 2ET6A 3DWGA 1ZRMA 3GRVA 4I8IA 4RMIA 5GGXA 3H87A 1EP1B 2FPRA 1NPYA 3D6NB 4G9EA 4X95A 5FI1B 4B71A 4RTPA 4FZ3A 1AF7A 2V6FA 1K3TA 1RZRD 3A6PC 1IXSB 4NF2A 4MVJG 3SZLA 2I33A 4CLXA 4TZKA 5BYBA 3FFWA 2ZZNA 4LVNA 2QNIA 5FNVA 5T64A 3H2IA 4UHEA 1MAWA 3A9TA 4M1TA 4BBJA 1HUQA 2FWNA 2AZTA 4KIFA 3QUQA 3FLBA 5DNYB 4XASA 2WJ4A 1T2DA 4DR3B 4O3MA 2LP4Y 4IEIA 3GA0A 1VKRA 3QMPA 3BDVA 1LTKA 2B9EA 3R0XA 4GQAA 1CRPA 4DR5B 3MJDA 2QOEA 3GL9A 4OL0A 1A3CA 4B6QA 1E1QD 1IOWA 4L08A 4AQDA 1Y1LA 4LVUA 4NABA 3WK9A 3RYCB 2V3CC 3D8SA 3KQTA 4YJGA 3T9EA 1E8DA 3QOXA 3ZZTA 1Z0IA 2P5YA 5ABPA 1ZD8A 1AKUA 2FGJA 2GJ8A 4PG7A 5ERXA 1XB2A 2A86A 3U3KA 2HC9A 3IOMA 3QNMA 3Q3IA 2MSLA 3QPCA 4CKCA 1G64A 2P2SA 3E2IA 4PRZA 3A37A 4NYMQ 1O6GA 1V37A 4GX2A 2CXTA 2YFKA 1VPVA 4LMRA 1DIAA 3VVMA 3HCBA 2HA3A 1RLIA 2C5EA 2DTEA 4I66A 3V1MA 4WBNB 1CETA 3HJNA 1CDDA 2YHAA 2QZPA 3AXTA 3IHLA 2XPCA 4JBNA 5HILA 1BRTA 3R9IA 2HK8A 2BKLA 3VDRA 4DCNA 4HZUB 2PNJA 1JXAA 2PWYA 3C7KA 2XD9A 2CVZA 3QITA 1WX1A 2JGEA 3HYLA 5DGXA 5JSUA 1KC1A 1KJJA 1ZM2A 3OJOA 3C1UA 5A1JA 3K70B 3GJ5A 3PNKA 1H05A 5I7SA 1SVUA 1U1GA 4Q4JB 4KWHA 1UBUS 3UENA 5JSZA 3WNZA 4H1WA 2QQ0A 2AG6A 3C3XA 4YQYA 4KLZA 3FYCA 1N9GB 3JQ6A 3PRKE 4JT9A 3KT8A 3W4KA 1MPTA 3P0EA 4MQFB 3X2FA 5KQLA 1G7SA 4I9HA 2I62A 3ZHTA 1LPOA 1NW9B 2UYGA 4F0JA 1RBYA 2ZJ5A 4JX9A 1CRQA 3VJMA 3LF2A 1OYYA 1FLAA 2V5UA 2JLAA 3ZGLA 3SSAA 1Z25A 4RZSA 1TUBB 1VCHA 2K87A 4PQFA 4S0ZA 1VLVA 1DAIA 1JMVA 4OI4A 5BN1A 1WEKA 2H3EA 4ENTA 2HYIC 4QUEA 2Z5FA 4WZBA 1N33B 3U7RA 1XAIA 1W29A 2AFHA 1IC6A 3QUSA 4JWKA 4LY6A 5IMSA 3RSFA 3QVXA 2YYYA 1GL6A 1G5IA 1PNTA 1L6IA 2O7VA 4XJVA 5JCJA 3TM5A 3UAZA 1RRCA 2ZUBA 4M46A 1ZLYA 1U0SY 4Y67A 3A1FA 4JS0A 4M38A 5FTJA 3PHBE 3J81A 2OHXA 5ITZB 3H7AA 3I2GA 5D1HA 1Z16A 2B5VA 4DCOA 1Y3IA 4L0DA 4Y0NA 1R0SA 2J4FA 1AUPA 3DDZX 4ZEXA 1Y8QA 1F2DA 1VRWA 3DZJA 3H11B 5JSFA 3I5UA 4K28A 4B6FA 1FOEB 5HQ3A 1NF3A 1IN1A 2INGX 1IRIA 4ASUD 4H16A 1FC0A 1IQPA 2YFHA 1JE1A 1L2TA 1AC5A 1VB5A 2VOEA 3IV7A 1DC5A 3ACDA 4IEFB 3MB8A 4RMHA 2E87A 4WCFA 1WOYA 5A3SA 2FQXA 2WNHA 4DE5A 4LSZA 4O4JF 3RYFB 4MQBA 2OXEA 4N54A 5BMVF 1DOAA 4M8LA 2MSDB 4P58A 4J0FA 3RD5A 1HSOA 2PUFA 3UCEA 3GDWA 3Q9NA 4TWBA 3R7SA 1K7YA 1LF0A 1I30A 1UC5B 2OBBA 3DPSA 3PQ6A 4L8LA 1DQZA 1XL1A 3M5DA 4URHA 5K4AA 1XCOA 1EP9A 2X0NA 4DV4B 1AK1A 4HGPA 1F4LA 2FLKA 2TMDA 3C3DA 3KZOA 3CNBA 3MINA 3O5AA 4EH1A 2YY5A 1K92A 3PKIA 3QUAA 5JRDS 4OAOA 4WLNA 1TCAA 3L46A 3PB3A 4HEQA 4KGZA 1Y9DA 2H4HA 3OEHA 1E6UA 1G7CA 2A9KA 4CTMA 1PG2A 5KYTA 3OSUA 4S1TA 5F5NA 2Y76A 3PI6A 1TM3E 2HJRA 1JSZA 3A25A 3DCNA 3GRCA 4OP3A 2NVBA 3CUKA 4WFQA 5AP9A 5BSMA 1RAAA 3C3KA 3H4TA 4FTWA 3ZGZA 3R44A 3CUVA 2C9MA 3MRVA 4YNBA 5KWJA 4OBEA 2O9JA 1FBNA 4PZEA 3KQSA 4F4CA 4JMLA 3QTLA 4RYLA 5C80A 4X7RA 3D3WA 3VNBA 3MWEB 4MS1B 3DMFA 4U1RA 1AOXA 4ND6A 3RAFC 4O4LA 5HZGA 1Y8AA 5EGSA 1IB6A 1VPDA 2H9IA 3KEOA 3NIDB 5BUQA 2Y1WA 2VHZA 2VEOA 2GN0A 2CMKA 5CR9A 4KDRA 3IKJA 1YBHA 4BIIA 3IEMA 1RLMA 2RARA 3GFOA 3K1AB 1RRMA 3BAZA 2DPHA 2Q9AA 2GFIA 1J97A 3DB2A 4JYAB 2VLBA 2NP6A 5BSGA 1YB4A 1EINA 4ZZ1A 4P3OA 1JYFA 2FZVA 2OD9A 3D2AA 3EGVA 4M0LA 3T0IA 3VMMA 4AQYB 4KR6A 4H1TA 4AICA 2ZJZA 3U9SA 1TPYA 2XKKA 2H7VA 3TX2A 4MB6A 1HKHA 1E9DA 1D8AA 3PVSA 2BZGA 3ABQB 4FKMA 4NCJA 1S2GA 3RIEA 4WBNA 4QHSA 5IZ4A 1B3BA 3SCZA 1Y6GA 1Z0FA 2W2OA 1N7HA 1FVFA 1J42A 5KNDA 5ESXA 5FI5A 5H9WA 1E66A 4Y2PA 2AEMA 1E2UA 2FE4A 4PW0A 1JIIA 1ONPA 1PV1A 1YZFA 4KXXA 4OHZA 2Y1CA 4BV2A 1KQGA 3S8YA 2XXAB 2PV7A 1TQ6A 3IQDB 3KL4A 4U02A 5E2BA 3DKVA 2WWYA 3GYBA 3L4SO 4KQCA 2ZANA 3ELYA 4TT3A 1GGJA 2XR1A 3RWBA 4AN1A 1U11A 2JFHA 4CEHB 5CEJA 3R40A 4G5RA 1ZH6A 4BRWA 4QHYA 1EVKA 2IZ5A 4HB2A 3KJFA 4MUXA 4PU0A 1TVKA 3TLAA 4I4TF 3I0NA 5BURA 2IBMA 1SUPA 1PZNA 2UZAA 2ZROA 3K9HA 3ZW8A 4K9PA 4DJEC 3AKEA 4DLPA 1SBIA 1WZNA 1NLUA 3F97A 3KWLA 3WL3A 1ZR2A 1I5OA 1UC4B 1UT6A 2KB0A 2H07A 1N2ZA 3C6MA 4V3CA 4EA9A 1WXXA 2CJFA 5ALHA 2VRWA 4IX9A 3VDQA 2BD0A 3DCYA 4M6WB 1IVNA 2F6RA 1U1FA 2BJVA 5J47A 3PYXA 4ZWNA 3T7TA 1YR3A 4HDKB 4YFVA 3Q3CA 2OBXA 1I3LA 1CD5A 3VAYA 2DERA 4MV1A 3ZCSA 4Z7OB 4HTFB 5J4YA 1WL8A 1LUAA 1XLVA 2O23A 2ZR9A 2DM6A 1NXXA 5ITZA 4KSYA 1V1MB 1PO7A 2WVHA 3RVOA 3F5DA 3AV0B 3U3RA 5KZMB 1MFZA 1XVVA 1WMEA 5IAEA 3IMKA 1GQ2A 3H11A 3G8AA 1DDOA 3LF1A 2HXYA 2XCSB 3GBPA 3I53A 2IYTA 3ZE7A 4BX8A 2P0YA 1OWNA 4FFDA 1Z5WA 3UICA 4DR4B 2V03A 4M76B 4DLYA 4BNMA 4EBFA 4FDTA 3EN0A 3FFXA 3GLTA 2JIBA 1JFFB 1V26A 1GUAA 2ZWMA 1PFGA 3ZPXA 1KOLA 5B3JC 3CG4A 2BFDB 1DEOA 1G3UA 4XYGA 1KWKA 3O83A 5MFPA 2Q5LA 5AKYA 3GJ6A 5GOTA 5FBLB 1YZKA 5EERA 3NASA 4YP5A 4CF4A 5EJ4A 1CEXA 1GQOA 2ZJAA 4FFPA 5K3FB 3DFMA 4DILA 5ADWA 1NT2A 1SZPA 4CUJA 4PE5B 3ZZ1A 4QRHA 1HQDA 4MB2A 2BELA 3QY9A 4PSUA 1US8B 4U8GA 1PI3A 1T4MA 1YIOA 3F4BA 4DRYA 3HSKA 4DY6A 3DPIA 16PKA 2X2EA 1Z0JA 3PFGA 5F1OA 4C3UA 1JHXA 2VEDA 3P5SA 2AFIE 1QWSA 3Q8XB 3R3UA 4IF6A 1U0FA 4ZPXA 1RYHA 2MYUA 4C43A 1PNQA 2WICA 1KQNA 3R2JA 4B3HA 3C3YA 5E4TA 4BFLA 1P44A 2R65A 3DUFB 5FPSA 3WZLA 2ZRQA 1EX9A 4GOXA 3GAMA 4OI2A 1E94E 3RVBA 5FOQA 4JYBA 4MS1A 1U3GA 3HBMA 3PKZA 3CY6A 4BX2A 1OGYA 2D8AA 3LV8A 5L3QA 3LWBA 5LIRA 3PX7A 5C8ZA 1QVZA 3I9FA 2XUHA 2YY6A 3RVLA 1EVEA 5CT9A 4UCQA 4F46A 1GA4A 5JMWA 4EGFA 2QV7A 4M36A 5HKAA 1E5TA 1TDJA 1PQUA 3PNQA 4HAWA 4OHOA 1CJVC 1WEHA 3EEOA 4EI7A 3S2FA 4HGOA 2AD5A 4OHUA 1X1CA 3O1JC 1MJGA 5I8PA 5EWLA 5LL6P 3AKCA 1ZOOA 4S24A 4IDEA 2KYRA 2X7HA 4JEIA 3ZNNA 3ZXYA 2ZRCA 5E7MA 3PC3A 1BYIA 1H6CA 1MQAA 3P27A 3EWNA 1NM5C 3OESA 2ZYHA 2FP4A 1EGQA 1OV4A 3BUSA 2VQEB 1D4OA 2C2HA 3GO4A 3P9XA 2QSYA 3DM5A 3M1LA 4MGYR 1D2HA 4R2WA 5JMPA 3T7EA 4Z4GA 3GIWA 1N77A 2DCUA 3PV0A 3HU5A 2RH5A 1SB9A 1NV8A 1SVWA 2PEYA 3B89A 4XGNA 1KRWA 5WRFA 3TLBA 5LZ5A 4GMHA 1TF2A 1HDRA 5TT0A 3EA5A 2XXAA 4PM4A 4I5GA 3DVAB 2BTOA 3O0TA 3OLYA 4DCUA 2NZWA 4CL3A 2Y1OA 1IVYA 1JF8A 1U3WA 2ZAYA 1M1NB 3QKWA 5ALUA 2V6GA 1XD8A 2AJ8A 2CMHA 5THKA 1FUUA 2C7QA 2PVSA 2DEUA 5BPFA 1SQ6A 4RVNA 3S8EA 1YZ3A 1UDRA 2QD4A 2ZEJA 5FBWB 4BRUA 4E94A 2IDJA 1FFXB 1XP8A 5J5CA 2FOIA 1MDFA 3GFGA 2J7PA 5AUPB 3QLUC 4DY4A 4DUGD 3U4QA 1KRXA 1MU0A 1RHJA 4FGUA 5TPWA 1O57A 1G8KA 4YAEA 1AV7A 2G9RA 3JVUA 5JPCA 2FU5C 4OLFA 2FWMX 1YACA 2G28A 5DHUA 1U2QA 4KXNA 4HDNB 4OLHA 2O8FB 1OH6A 1KGDA 1VRVA 2E55A 3FJYA 3CKLA 3PRHA 3KXIA 3T61A 4E7PA 2ZSAA 4I1YA 4C89A 1F12A 3T1NA 3GFSA 5D3MB 3TDNA 2VWHA 4TTQA 2B25A 3UMSA 1PJBA 2ZSBA 3MLBA 2OYSA 5BNFA 5KEIA 4QAQA 1V1MA 3DP7A 2GR9A 3LW7A 4LDNA 2J8ZA 2JZCA 4FYMA 2BFOA 4O4JB 1U2EA 1EWYA 1SHTX 2EBWA 1VI5A 2LW7A 3T99A 1I2DA 1VE7A 5E6SA 1J9GA 1WV0A 5JBIA 1NNLA 1N8KA 2C97A 3MIIA 3WBFA 2WQ7A 4RHTA 3C3JA 3FJOA 3JZFA 4R41A 5AK3A 1CY1A 2WHEA 4B4UA 3A9UA 5CIQA 3P32A 1MNAA 4W1QA 4LPKA 1W48A 1XTBA 1KDOA 1NY6A 3HP1A 2PK3A 4QOEA 3TN7A 1YDHA 2PJZA 1WCYA 5DB4A 3H2GA 2G1AA 5FJJA 3FKSD 1MC4A 4YONB 3LRXA 4EW3A 2YZMA 2QX7A 5IVDA 5BSVA 2HRBA 1BJKA 1TX4B 3EIXA 3JWGA 5K3FA 4CMEA 1Z62A 2REXB 2WD7A 1P5FA 1R1DA 1JBEA 2OC4A 1E3TA 2GSDA 3O0DA 4XUCA 3QEAZ 1ISIA 1SUEA 3AETB 2C7OA 1ZK2A 1P2VA 3H5TA 4JY7A 4YAWA 4ZDIA 5KTYA 4XIYA 1L7NA 1SR8A 3SC3A 3GJSA 2O06A 3LA8A 3MTGA 4CMGA 1UFVA 2B7BA 5H0IA 1QGED 1IN6A 4AKTA 3DVLA 5KOHB 1ISRA 3H13A 4LRXA 5LQAA 2BHTA 3B6IA 2PL3A 2FUKA 2YH2A 3DLCA 4QXMA 5AI5A 3ENVA 2EBHX 2P8JA 2P2GA 3DUFA 4H35A 4EB3A 3T5DA 4LHZA 1P6XA 5JPDA 4JYMA 4BIMA 2P9FA 4IRUB 3CB4A 4ARIA 3KLPX 4DQUA 1SQFA 3JAKB 1BH6A 2OD2A 3QEJA 4AG5A 3HXOA 4KVFA 4BTVA 1QH8A 2AFVA 2NVWA 1ZGZA 1Z8HA 1V47A 4DARA 2ZWAA 3ORRA 1IMJA 1I6WA 3N1UA 5JZVA 1IJKA 1XJQA 4IY1A 3E7PA 1PZMA 1TVMA 2EKPA 1GPH1 4Y0VA 4M1OA 4YYZA 2HWWA 3Q40A 2WSIA 2BDTA 4Q9IA 3Q8LA 5I48A 2ZWIA 1CU1A 1S7GA 4Q39A 1S2NA 3G9TA 2ZRPA 3PR1A 1PR0A 2PT9A 3DW3X 4GBMA 3ZVMA 1WOMA 4ZKEA 4D99A 1MVOA 3GJ3A 3QIAA 5KQSA 1JDUA 2QX4A 3DNFA 3WGIA 4D82A 3P9IA 1PSZA 3BICA 3CKYA 3CSSA 4J3NA 3O2NA 3ISVA 4H2DA 2W0MA 3Q3JB 2QGNA 1L4UA 3DLIA 3NAQA 1T6NA 2NO7A 4HAIA 2PG3A 1XZBA 3IAAA 4N3BA 1T9HA 3M3DA 2VLIA 5HW0A 5I4CA 5IASA 2AK2A 1U0TA 1JE0A 2F2TA 3TLXA 4PG4A 3ZQ6A 2WV7A 3C4VA 4C4YA 4RTOA 3B3FA 1SC6A 4LHXA 3M6AA 1ZFNA 1ZO8A 3I39X 1Z63A 5B53A 4FD3A 1LWNA 5HIIA 3WMEA 5GWXA 2G25A 4I4TB 1YDGA 4AZ3B 3KR2A 3EC2A 4AK9A 4BQOA 1TJPB 3K0CC 4CKBA 4V1CB 3HFJA 5EN4A 2FWPA 2XMCA 2D06A 3OWOA 5CYPA 3RWOA 2Q99A 1UPBA 3RSSA 5IVKA 3RUIA 1T2NA 2AQKA 2RIRA 3A6HA 4JXJA 2M1ZA 5CNJA 5JMTA 3OZCA 3V9PA 3D2BA 1Y4SA 2BUBA 3E1GA 4JVMA 1KBQA 1ECJA 1FFXA 1TKAA 2CXNA 2Q1SA 3DTYA 3JD1A 4L75A 3C5EA 5DTIA 5ADHA 1TK3A 2TMKA 4Q4AB 3U80A 7REQB 6PFKA 3I04M 4N1AA 4IOJA 4G36A 4BX0A 4IDOA 4Y1FA 1VIDA 2P69A 4R83A 4JDUA 2B94A 1B73A 4IHKA 3TUIC 3T5PA 1B6GA 3ZLVA 1HWYA 4F3YA 2VPQA 1VE6A 2QMYA 2GTIA 3SZUA 3PWKA 2C54A 3KB8A 1Z6GA 4CV3A 1M1XB 2ZAIA 2HJ9A 1SXJC 2YJ4A 1O6FA 1UBGA 4AC9A 4EMSA 1IN7A 3TH5A 1Z7YA 3ZV6A 3EZNA 2DBVO 3CLVA 2Q6OA 2Y66A 4CCYA 2HSJA 2VHWA 5BMVA 4AYTA 1Z83A 1RFLA 4IRXA 1YJCA 3E3AA 1LJ8A 1O4WA 1EM8B 4RLQA 1BOFA 3S7TA 3TOCA 4BFZA 4F85A 5G40A 2OG2A 5FEMA 1I32A 1RWKA 1ST3A 5ELMA 1JLKA 421PA 1QH1B 1GL7A 2CHUA 3NCHA 4BPBA 4L9AA 4TQ9A 3FTNA 4X1KB 1RWXA 1O5TA 5G0SA 4JCOA 3V00A 3OI7A 3WB9A 2WBLC 3NEYA 4XFJA 1NRJB 1GXSB 1EFPA 4HPWA 3FUXA 4G1VA 3Q7RA 3ROQA 3H8VA 1DVRA 3PVZA 1NKSA 3JPYA 4H6WA 1BYUA 1BSVA 2Q8NA 5IT5A 2NVUB 1Q5PA 5KPJA 1QFJA 2ZYRA 4PAGA 3WLRA 3K2IA 2EW2A 3QYPA 1AXGA 5IHXA 3VVBA 2VI5A 3M3PA 4PZZA 1HETA 5THQA 3BC1A 3R9XA 2CLDX 3M9LA 3N70A 4NYIQ 1ORIA 4ES6A 2ATCA 3KKNA 1I3MA 4U9UA 4LKOA 3TLEA 3PWSA 5EMHA 1KXZA 2FW0A 4GKKB 1BMFD 1TC2A 3P9NA 1KI3A 1J8MF 2IKQA 1OZGA 1W85A 4OHFA 4LZWA 3BMNB 4RZXA 2FFHA 1WZIA 3HCDA 1C9YA 2WWHA 1L4BA 2F8LA 3N8KA 2RK3A 3QHQA 4FSDA 4HN9A 5CH5A 5IAJA 3ROMA 2PRYA 5HG0A 2B0JA 2JLSA 3AVPA 4O2BF 4AZ0B 3DTNA 1D0SA 2I2FA 4IG4A 1VYTA 3JAKA 5HSGA 2Z0MA 2G67A 3OX3A 4TV9B 3E81A 4EG1A 5HKKA 1UJBA 3OY7A 3OZWA 1PZXA 4NCHA 3EARA 4YA6A 4QM6A 5CEFA 4M1QA 2DUUA 1OA0A 1EFRD 1PR2A 2QTWB 3BCSA 3FNGA 3OIDA 5MF6A 4DZRA 4RLHA 1I2MA 2D6FA 2GF9A 3O8QB 1OXMA 1R18A 3G2IA 3BQ9A 1RDFA 2IT1A 3SY8A 4RS3A 5JCOA 3QH4A 4LCBA 2QMHA 3YASA 1HH4A 5IBPA 4F2HA 2RGYA 5AVTA 3JALA 2XGOA 3BXHA 1W5TA 4KQ1A 1XD9A 4M98A 1FDWA 3ET4A 2OAQ1 3OX1A 3IXLA 1E98A 4RF4A 1SG0A 4Z0HO 3SZOA 4ENPA 2PGIA 5ALVA 2O8CB 2C04A 2ZAOA 1Z6TA 3GGOA 4UUAA 5EJIA 4K6MA 1CQXA 5HFNA 3TPCA 4IIXA 2C3UA 2VHXA 4L5CA 4NV3A 4CW7A 3BA1A 3FD8A 3GQBB 3SIXA 4IKOA 1HC7A 3SJAA 4M99A 2CLKB 3IESA 1LBQA 3SS9X 3W04A 2DAPA 3ED1A 3HPRA 2OZLB 1W34A 5THXA 2IGTA 1WPXA 2IXBA 3WGQA 5I7EA 4KIJA 4CT0A 3IHWA 4RPJA 1LF5A 2RH8A 3A4LA 3NHWA 4JKYA 4L72A 4MKXA 1V0JA 3V7YA 4M0KA 1BE6A 1T10A 3MGBA 2G5CA 3NM5A 4PZPA 3BIWA 2W2XA 4WLOA 3K15A 1W94A 4B4VA 2ZTHA 1ZGGA 3UC5A 1XBTA 4FLFA 5HMLA 4BNKA 3MMXA 3JQCA 5BWBA 3RVPA 1CEYA 3RRFA 3OE5A 1ODJA 5FX2A 4L2IA 2BGTA 2JI8A 1U7TA 4OHBA 2KI5A 3TB6A 3I6ZA 4QG3A 1VJGA 4YQEA 2OV4A 4AJNA 5B2FA 1QE3A 2A4MA 4JLMA 4JZYA 4U2EA 3HUEA 2XZLA 3RASA 5EMLA 1D0IA 1DQPA 3JR7A 2UYYA 3FBTA 1J2UA 1E79D 2EWVA 1EUDB 2HRQA 3PXXA 1ZA2A 1JNYA 2R4UA 5FHRA 1OXBB 5EJ6A 3CH4B 4IDCA 3FDZA 1G20E 4NHOA 1DHRA 1OSNA 3G2LA 3RTBA 4UDXX 3SGLA 3UHJA 3VISA 3W7BA 4DIDA 1ZGBA 3LQQA 3JVDA 3DCJA 1AZSC 5F1YA 4OGKA 5KYUB 3WLAA 1LW6E 3AI7A 4MVJE 4PIVA 4UDNA 1NW4A 1O3YA 1LS6A 1YJXA 4KQJA 1GM5A 1ZH4A 2BAGA 5TRTA 4H18A 4RD6A 1R0XA 5TMEA 3ZWDA 3RUCA 1C9KA 1EM8A 4TKMA 3RNOA 2FN3A 3E05A 1A8UA 4UM5A 1M2WA 1QCZA 1QHXA 3VNQA 3X1XA 2A0UA 3M4JA 1QH1A 5E6UA 1V3QE 1T1JA 4PX5A 3R7WB 6ABPA 5JXHA 1QGAA 3EJ6A 4WCVA 2QTCA 1QJ4A 1DEXA 4LSMA 5FO0A 1CJUC 2ZYWX 3KSZO 3NIGB 4DC9A 3DT6A 3EQ6A 1BZYA 1J8YF 1VG0B 1YH3A 2BPOA 2ID7A 2VJCA 2X7XA 2UZ1B 1I9CA 2QRVA 3FSGD 3NYRA 3OJFA 3HDHA 1L3BA 4KXVA 2ZRLA 3NBFA 3ETNA 1X8JA 1YFKA 2NVUA 4E21A 4FBLA 1XMXA 1E7RA 2F43A 2ZCVA 1KDTA 1N3IA 1W2GA 1STOA 1XRLA 3IODA 3NHFA 4I1UA 1N6RA 4O0LA 4PSCA 3SICE 5EYPA 1COZA 1ENOA 1CC1S 1H66A 1UJ4A 2H1IA 3GHYA 3ND7A 3TMAA 2IU0A 4CTJA 4OXRA 2WM9B 5IKMA 4F8YA 4OCZA 4RGYA 3V7NA 1W46A 2DXIA 1W35A 3RLIA 2DJIA 1K6EA 3C85A 4H7HA 3ENNA 4KK3A 4CMBA 2H3HA 4OLBA 3QXGA 4G9GA 2C31A 2CCJA 2X5NA 5T3UA 1YGPA 2B7LA 3ZDYB 4DV7B 4L0CA 3VZQA 3ZXSA 4RKQA 3A04A 1GDHA 1K0FA 5CT6A 1P7WA 1ENYA 1A96A 4AZ0A 5JR3A 3ZW7A 4YS6A 5LKAA 5TF0A 2ZIXB 1DMRA 1OBVA 5CD9A 4M88A 4MUKA 1UJMA 4UHBA 3IT3A 3UB2A 3VR2A 4GDFA 1RXSA 1U6KA 3C0KA 3H86A 2H2WA 1CUUA 3C41J 4UDYX 2H1FA 1D1QA 2NM0A 5I01A 1L1EA 1F3OA 1XOIA 2JF0A 2ZUSA 3N87A 3O8QA 4GD3Q 4LXTA 1ULAA 5CA1F 1R3DA 5J4HA 2IU4A 3MD0A 2FZLA 2XGJA 2F1IA 2PKEA 3UV3A 5ESDA 3ESZA 1GPKA 4M7PA 3MT9A 4DV3B 4RORA 2JGAA 4QDUA 3PRJA 1E7SA 4BAZA 5B5SA 3OZUA 2HU2A 4OM8A 5CLLA 2G1KA 1II8B 4HFNA 4MW9A 4IQGA 5IKPA 5JJKA 4K9NA 4YCBA 4C7MA 2V7EA 4U2CA 4KE6A 1YR2A 3EVCA 1G3RA 4PZCA 2QQEA 5HWSA 5K05A 5TMPA 3LLSA 2GNPA 1FU4A 1DOZA 2OZLA 3TVDA 4AMGA 4PYLA 1DRJA 2BMFA 3L7LA 4CIAA 2A8YA 2HXGA 3KSDO 5D1NA 1U3CA 4CF6A 3K4PA 3W79A 4FYPA 3F71A 3HZRA 3FETA 3VZPA 3KFVA 4ER7A 1PR6A 1N5DA 2IJGX 1Y5NA 4FFOA 1JALA 3DQZA 4EO4A 3AY0A 4ZT7A 3OE7A 3PA8A 3PQEA 4HMQA 1FW8A 5I9SA 3NBXX 1EXVA 1LPMA 2MYNA 5COQA 3LUHA 4JOSA 4RPLA 4Y1RB 2W6MA 4YDRA 5H16A 3LHKA 3PPIA 5DHRA 3VQTA 3ZEIA 1G6KA 2Y0BA 4IVNA 4EJSB 3SXPA 3W6UA 5JQGF 1HY3A 3FOBA 1VBKA 4GLOA 4X3PA 3ZXUB 5J4LA 4JMPA 3RUAA 3FHCB 2WG2A 3QXCA 1B8PA 1LX6A 2GYWA 1AKVA 2R7AA 5HTKA 2EQAA 1AQIA 5JTTA 4WW0A 5LM3A 1GTSA 4F3RA 1JKXA 2WHPB 2C5FA 2QMUA 1G21B 1DUSA 4R9SA 1Z4OA 2FMHA 4XGKA 2GKGA 3SJUA 3NHKA 5EIBD 1LI7A 1U8YA 2I7VA 1FQKA 1MRNA 4XVCA 2ZSHA 4P3XA 4Q34A 1X1SA 3HCAA 1J2EA 1GPBA 2H17A 2VPXA 4QXQA 1AKMA 1Y7HA 1BQ3A 1DRUA 3FPBA 5KYUA 5I8ZA 3TZHA 5BMOA 3VO1A 2PSSA 1T6BY 3UANA 4DLVA 1F0KA 1P0FA 4RFVA 5E95A 3VZSA 4N5LA 2VPPA 4O5AA 5ARBA 1BE8A 2AS0A 3CZCA 3KQYA 3UMYA 3AB8A 4GPAA 5MGBA 3EGCA 4FS3A 1JU3A 1SHZA 1DWPA 1UPFA 2IUYA 3AFOA 2FPGB 3L1HA 4J91A 4LCJA 5KCMA 2AYZA 2CNKA 5BUZA 2XHZA 4XSVA 5T4EA 3U62A 1JFLA 2ZVPX 3VPAA 4EDHA 3VGPA 3NHJA 4FUQA 4J29A 3A4NA 3LX8A 3D6UA 3T52A 2GM3A 1Y6JA 2TRSB 4RBNA 1N36B 5FXMA 1L3CA 2ZJBA 3HL0A 5HCUA 1PR9A 4WTOA 4BX3A 2PMCA 3RAPR 4BDSA 3VR3D 1JGTA 1DBQA 3JWEA 4MWZA 3ZD9A 2HFJA 3GLHE 4DBZA 3HR4A 1D6MA 2WJVA 4DN6A 4H9GA 1NHWA 4D1YA 1M9NA 1XA3A 4XAQA 5CMLA 4DDMA 4BQFA 3DL2A 4IDAA 4G4GA 3IR7A 1M2HA 1Z4QA 3R3WA 4R31A 3OCCA 1GGHA 1NQVA 1A98A 2JGKA 2WM2A 3FNFA 4BQRA 4K3VA 5KYGA 3HFRA 1F2TA 5EHGA 1ZM9A 3LDAA 2IXEA 1XDGA 2OCGA 1YE5A 1Q0HA 1H8ED 1YHZA 2ZXEA 3FYTA 1HYHA 1T5DX 3BQNB 4F91B 4Y2JA 1XXHB 5DULA 4C0SA 2DTXA 5GVSA 2O5EA 3NT4A 1UT5A 4LS3A 3E82A 1LBHA 2Q5IA 4IUDS 1IQUA 3AP3A 3L1UA 4QJBA 4F06A 1LQTA 4NNPA 5JJ5A 1WVGA 1OFIA 3CT6A 3OCZA 3P9KA 5B3KA 2LGJA 1S2DA 2JCSA 4Y98A 5A04A 2VNAA 4Q21A 4YDSA 5B30A 2Q1UA 2XB8A 2G6BA 1U4OA 2XDYA 3C5WP 3PHCA 4PTLA 3UGKA 4WQMA 1DMSA 3NP7A 4XR4A 1NOKA 3SX2A 4YR7A 4QXAA 3BE8A 1TM1E 2A30A 4HI0E 1JQAA 2YWBA 4LAFA 3RU3A 4R2KA 4C7XA 1KEEB 4NU6A 4HLDA 3T7JA 5TR9A 4UTXA 2BMWA 4KU4A 4ZEOA 1GDDA 1PFQA 4MPTA 5LA6F 5JADA 2G83A 2HEIA 4TWIA 2HOQA 3A8TA 1X7YB 5JBQA 1L7PA 3UWPA 1CZUA 5TIIA 1PJLA 3G0BA 1NLZA 2Q45A 4KPFC 3EW7A 2Q0QA 1SFRA 1UR5A 4IH9A 2IZ1A 4ZV4A 1SULA 5CD1A 4GWKA 4OJQA 2CHVA 2WMYA 1DKUA 4ZCIA 3BORA 3ZBTA 4B7ZA 2WFLB 3W06A 3DMPA 1SOAA 1W1IA 3CT4A 4MWEA 2BKAA 3D1LA 3G2KA 5K3EA 4GX0A 2ZE6A 3V1KA 4K2AA 1XRJA 2PBZA 1OFVA 4WGGA 4DIOA 4Y1RA 2FG6C 4QEZA 1E6KA 4CN9A 1C41A 4EJSA 4UHDA 4ZP1A 1KH1A 3VR4A 3J80A 1YKSA 3ANLA 3MOIA 3MJHA 3D6VA 3GAFA 3I09A 1WUJS 2QJFA 3BD7A 3T0GA 4EUEA 1NOIA 3SKVA 4J0HA 5H3CA 4BQEA 1P3Y1 1Z6AA 1XEFA 1N75A 3BH7A 3M3HA 2GSWA 2WHPA 1AHIA 4YMTA 1D4AA 1QHFA 3LT2A 1G2IA 4DOMA 2XQFA 1ZD1A 3T35A 2ECQA 2CYCA 3B51X 4FYJA 4PPYA 3BCHA 4WVFA 5L9AA 3K09C 3USZA 3BGOS 2BUCA 3BRSA 5JZBA 1QSGA 3NBYC 5JSQA 5L4SA 2DF8A 1X1AA 1FYXA 1VECA 4NG4A 2DFKB 2I3GA 2VZEA 3N5CA 3IUYA 1N1EA 1Q7TA 2NUAB 4C4OA 4YP7A 5BN5A 1Y42X 1PEKE 3E9DA 4B17A 4ABYA 3K8QA 3JARB 1OBFO 1I7QB 2KWIA 3AINA 2YTZA 2B5WA 1A95A 1O97D 4MLZA 2OUKA 4N03A 2FPGA 1H3NA 1K4MA 4C07A 1ZD9A 4JLAA 1M66A 4JQSA 3G5LA 3PEWA 1TEZA 2EF1A 4XD7D 1QQTA 3DZDA 4H6XA 4RHXA 4HKTA 3WMXA 5FT9A 1QRUA 3RROA 2JLVA 3AR4A 1F5NA 2OM2A 3P0JA 4OV6B 4ZVSA 3WGTA 1RKVA 2QLNA 1J9ZA 4KQMA 4QBTA 1C7EA 1XFDA 4JGIA 4MV4A 2EJUA 5B37A 1SC4A 2RH9B 3H2HA 3L6CA 3VJKA 4YQFA 1KI6B 4PHCA 2WSSD 1SHKA 2VAPA 3H84A 2PUVA 1S9HA 2Z1NA 1KQOA 3DBIA 4O2BA 4CIYA 2IHYA 5JNRA 3GLFB 4P08A 1W36C 1ZOLA 3ESDA 4EHBA 2D74A 1E4VA 2HM7A 3LX4A 3THRA 4TL6A 4AZWA 1ZIOA 2E48A 4GYWA 1JJVA 5ED0A 4CLDA 1WQ3A 1CEQA 3KSUA 4FFBA 1FDVA 4UZSA 3LBNA 1AQNA 2SNIE 2QN3A 3DCIA 5ALDA 1THTA 1EJ2A 4KH0A 4UAGA 1KYIA 3STHA 3T6KA 3ZLBA 3ZHUA 5B6PA 2YZ7A 2XBMA 3U4GA 4IHJF 1HT0A 1YI8A 2YHSA 3ABOB 3BWYA 5SYMA 3USES 1VMAA 2H2FA 2H00A 4BO3A 2R1VB 5CA1B 1WMAA 5KTNA 3CJRA 4KR3A 1GYQA 4URWR 5LD2C 1MEOA 4IKPA 1H94A 1XD2B 4NBUA 4BCBA 3C16C 1PNOA 4H7EA 4UHFA 1LWOA 5EHNA 4IXWA 3V8NA 4BFWA 1DP4A 1H1LB 4N0DA 1W76A 2V0CA 4H4CA 4Q66C 3SU8A 3WA6A 1VGQA 4G5YA 4YY3B 4GE3A 4HNRA 3KD3A 4KQGA 1D04A 2P77A 2QAGA 2E4XA 2NXCA 4MKGA 1SQSA 3FKJA 1KEEA 5JXJA 4F9FA 2VHVA 4DRXA 5BV8A 5DGCA 2W2MA 3QWFA 4IEEA 3L43A 4AG3A 1Z5ZA 5I7VA 2P3LA 1V6SA 1U5AA 4QT4A 1X7YA 3K2EA 4XH9B 3H2KA 5AW7A 1Z5OA 4QPNA 4C7OA 4RY2A 3WAJA 2JA1A 1M2GA 3GZNA 4B3IA 1ZMOA 4MDHA 3KJNA 3DWEX 4RV5A 1PP4A 2IL1A 4W4TA 4Y30A 3S1AA 3VX3A 1V71A 1EK0A 4RZ2A 5JQGB 2EKQA 2JLRA 3O4RA 1AZTA 5FJIA 1Q50A 1Z07A 1KDRA 1YWGO 2SECE 5JDIC 2Q0HA 3AUSA 1GAQA 1GNVA 1ORHA 4MDEA 2Y9PB 2G07A 2XWPA 3TR0A 3ZC3A 5FLXA 4EPWA 2H57A 1ISMA 3I6MA 1ZXBA 1XWWA 2ZREA 5ERGB 1XPOA 1GPYA 4ENRA 3V6MA 3IYLW 3DE3X 1U81A 1OH8A 2VAMA 3OJCA 1KR2A 2QLMA 3UF0A 1SVLA 3KZ1E 3LXMA 3N0XA 2VIIA 1FRVA 1L7EA 4MJ3A 4QU9A 3VO2A 4CIXA 2Y6UA 2KBFA 2R1TB 4WK0B 1V4NA 4JL8A 1O6BA 1E99A 2JHCA 4OBWA 4NU8X 4RJIA 3WL8A 4AZTA 1X42A 3HCOA 3SIPA 3LXUX 5AVWA 1BNCA 3DD5A 1JZTA 5LCXA 1Q16A 2ZUFA 2R6JA 4EKEA 3D4OA 1M3SA 4FDMA 1GJRA 3EVGA 4OXXA 3WOHA 5KMGB 1Y1TA 2CEAA 4AS3A 1TIPA 3IURA 3ZHCA 2Y93A 2IS6A 2OHJA 4MI1A 4JNCA 2C2GA 2E1RA 4GR4A 1WKVA 3ZZMA 1JTVA 1MJ5A 1ZJ5A 2NUAA 2RJ3A 2VRCD 3L06A 4FDUA 4HEA1 3KUXA 4DJFC 3NI2A 3TQOA 3NXSA 3KC2A 3WLFA 5JCXA 4P22A 4LXYA 1XQXA 5KNBH 4YDHB 3ELDA 4XWYA 1U0EA 4EK9A 1MTZA 3EDYA 4NAUA 5F7OA 1ITZA 3BXOA 4L27A 4LOJA 3QJ5A 1UMDB 4M1ZA 1D3AA 1QYDA 2CFTA 4Y2YA 2VHEA 2YMLA 4X1YB 4ZT5A 5FWDA 3QWAA 4TTSA 4U6QA 5G2OA 4WCDA 4KE8A 3MTBA 4BVHA 4R71A 1MZPA 1K75A 4GFDA 2QTVB 1GTL1 2D7DA 5IAGA 1EX7A 1VL2A 2H4WA 4WKNA 3U4CA 2WTUA 3LLCA 2O57A 4N5NA 1VKOA 1XRSB 1KFBB 2DFVA 4B31A 3RDPA 2WT8A 5FORA 4JI3B 1Q0RA 3D54D 3NU1A 2P65A 1QOPB 2RHOA 3ZD8A 1W1UA 4D8UA 3OM0A 3NHLA 3T95A 3VYWA 4L4YA 2AOXA 3UMRA 3TIGA 3NGLA 4NR0A 2B30A 2C8JA 1H9CA 4GBED 3AV3A 1G5HA 5DBFA 1G9TA 1FQWA 1RI4A 1VZ3A 2V7TA 1QHYA 3IAM6 3LYUA 4WE3A 4ARZB 4I5IA 1KE2A 4ZQEA 1KJWA 2QV0A 4K0RA 3OOHA 1OR8A 2IITA 2JFOA 3DB1A 4HNAB 4PIPA 2WJGA 3FTDA 4IDFA 3B3GA 2JGNA 3G9UA 4Q16A 1QFXA 5EQTA 1KK1A 1RT9A 3U7QB 3BN3A 3FIJA 1ISFA 5C1PA 3ME5A 2UZ4A 1GL9B 1B6RA 1ZC4A 2YWGA 3QFTA 4Z7NB 2I67A 1H93A 1UBNA 4ZVNA 4GXQA 5CA1A 3AQIA 2EIXA 2BEVB 3BTUA 4UAUA 1DV2A 1TCVA 2HNAA 2X6TA 3LPNA 1XD2A 4D0RA 3WKEA 1RLOA 5AD1A 1U1EA 3GRYA 4K9RA 5DLYA 1Q0SA 4P3PA 2OVFA 4Q7MB 4LF4B 1ADJA 1ONBA 2KMLA 5IJWA 2F62A 1N6IA 1VG9B 4KQFA 3TYXA 4MRAA 3ED5A 4S1VA 2PVCA 3F96A 5KNCD 3KAPA 4O4HF 2WMOB 4ZANA 5CNIA 2SBTA 1XIVA 1ZA1A 5JZMA 2XLBA 3ADPA 1HZZA 1XQ6A 3R7AA 4BLPA 2QXYA 1KFEB 4QGBA 1XDSA 3CIOA 4I9GA 3ICVA 4CNBA 3ZE0B 1A9PA 4R01A 5HS6A 5D87A 2QY6A 3KYCB 1T9KA 2RHGB 4N7BA 3T3HA 1K6MA 3O8RA 2GXUA 3FNRA 5C52B 1ZVMA 5FLKA 1U8TA 5GY7A 3WDKA 1OX4A 3P9RA 4GH5A 1BHO1 1KKUA 1QFZA 2J6CA 4P4NA 1PTJC 4XIFA 3TZEA 2UUOA 5E2AA 5IS2A 4K03A 5IHPA 4YRMA 2V1UA 2PWBA 1B15A 3PP8A 4DA4A 4QPDA 4MHOA 2C5HA 3JZIA 1VCIA 3SZ3A 2P9EA 3H9BA 2IVZA 4MAAA 3AEXA 2JATA 3VTAA 3CN7A 2I4TA 3DDNA 3WIUA 4B3DA 3GHHA 3O4HA 3WK8A 4CMIB 2JBAA 1U0GA 2AQIA 1NWCA 1DAHA 4ITRC 1J0BA 1L7RA 1K86A 1PZEA 3WQSB 4KSCA 4PN7A 4J4HA 2V8BA 4KRYA 2EZ8A 2EIHA 4HX9A 4XYEA 2WK1A 1CR2A 1KNQA 3TQQA 3V46A 4ISBA 3JYOA 1K2VN 4BYMA 4IV8A 4OYYA 2AZMA 4YB8A 2DR2A 2R1TA 4FFNA 1PBNA 1UXHA 3CHYA 1G8SA 5ESWA 2DFTA 1KK3A 3PGA1 2GJAA 3SKYA 3BT7A 3HA3A 3TNJA 2XGSA 3GT0A 2G77B 4UMDA 5A9RA 4RK5A 3T4PA 3NUQA 3OTQA 1APBA 1YVDA 3TE6A 4D5GA 1G5TA 3DE5X 4DBVO 5GM2A 1BKDR 1W25A 3FTEA 1QIJA 1EUZA 2QJOA 2X15A 4W8OA 4JHXA 1GTRA 2AJLI 1RYZA 4M0DA 1QDLB 3ZS9A 4GZ3A 1GSHA 2QE7D 3DL7A 3OIYA 6REQB 3QKSB 1SD5A 2YR0A 1FP6A 4IJQA 3KHUA 4X8OA 4K05A 2VYQA 3VHXA 4DMHA 3R7LA 1U2GC 4GYYA 2IHNA 3JTEA 4L6CA 2WHQA 5K0SA 1TO1E 5JNTA 1O03A 3CPJB 2DLCX 5H83A 4BGUA 4DJDC 1P81A 1J0AA 4DQXA 5E6RB 2VDVE 2W00A 4DMMA 1TT5B 1NMEA 3L8ZA 5BV0A 5JCPA 1GG2A 3IAEA 3VDNB 5LWQA 1W47A 3N2EA 3A1EA 2E7ZA 5HM6A 3QP9A 1TJNA 2GPSA 3LOQA 1UINA 4NCKA 1W75A 3S2UA 1TTQB 3ZQJA 4DJJA 1LC3A 1KO7A 1UDCA 5IJXA 4QGGA 1U8AA 1EFTA 4GP6A 1YB5A 3AL2A 2FEAA 3FVTA 4QD3A 1W8IA 4ER6A 1PL8A 3ONWA 1HGXA 5HGJA 4DJAA 1WZUA 3QA3E 3C7TA 3NVDA 1Q1AA 5DGTA 2R96A 1IB0A 5B58T 3VGJA 4MRSA 4G2TA 3NGXA 4WFJA 3Q7QA 2ZQ5A 2JJYA 3MGAA 4WX2B 4J7CA 4ARZA 3N8IA 3CZMA 4MI6A 3UMCA 3MQFA 1JSCA 1UKYA 1ZK1A 4Q37A 4YJ2F 3O8CA 4OQMA 3UXMA 2XMDA 1P74A 1WCIB 2CLCX 2IY8A 3M34A 5LQSA 4UD2A 5CTJA 3U49A 3NHSA 1YO6A 4E5VA 2IXGA 3FMIA 1U0NA 1LK0A 4IO1A 2AKYA 5JWRA 1ECPA 3U13A 1UBMS 2YW2A 4IIBA 4A8HA 4OX9B 2BEVA 1A9YA 1A5TA 1ESEA 3TIIA 1NX9A 3Q5DA 2B4QA 3I5MA 2H5IA 3I01M 3OY2A 1UBKS 1K8YB 2N75A 3OZSA 3RIMA 3TBHA 2YN2A 5LPNA 1MB2A 5I5GA 5KOYA 3HXKA 1FPMA 2FR8A 3L7MA 1BEUB 2FB9A 2Y8EA 4L0QA 5LA6A 2M6KA 3TL6A 4CU2A 4LZNA 4YUXA 1J5EB 1Z4PX 2NUPB 4R3NA 4RSGA 4H7PA 3SXUA 4BN0A 2WLSA 4UQPA 4NJMB 3KZXA 2H5EA 1TMKA 1KAHA 3JXEA 1HQCA 4RWZA 3UUEA 1EFHA 2ZR7A 4O63O 4E14A 3DBHB 1Q84A 5DTJA 2G71A 1YHNA 4XLTA 5A05A 4HWTA 3MQ4A 1YZLA 4NENB 4JFAA 1XAGA 4GRAA 4ZOLF 5K0BA 4NVRA 3X3HA 4FW9A 2YVUA 5FPQA 2A5JA 4CTOA 4KPUA 1P4SA 2WYHA 4QARA 5SV2A 3WJ1A 5IFLA 3LDGA 4LV5B 1W4ZA 1K89A 2J3QA 2ZBQA 1PG5A 2ZJFA 3KYCA 3EXIB 2HQ1A 4E46A 5EE0A 1NFQA 4DQKA 2DY0A 5F21A 5FCDA 1AQLA 4X00A 4DF3A 5F76A 2VDWB 5K6AC 1DAOA 4R0VA 2BFAA 2PXCA 4ZCQA 4G37A 5CVUA 4PX3A 3T1QA 3CKKA 4Y2RA 2QRGA 3PNMA 3LMKA 2CXSA 3ESRA 4CMIA 4KAFA 1DQNA 4M22A 1MA3A 1A8QA 1JQBA 3OQVA 4MUAA 3UOAB 4BLTA 4HB4A 4DLSA 1E2PA 3EGXB 4OMDA 4TMTA 4OA8A 2GBPA 5LP1A 1ZD5A 2R6FA 2KM1A 3AOEC 3EH2A 1CUBA 3PC2A 4PG6A 4WIAA 1QLWA 4NBVA 2H1RA 1NXWA 3JQPA 1TMOA 3JR3A 1XVAA 3DVSX 5J58A 1GGEA 4OHMA 3AHGA 3NH6A 3O82A 5ALZA 3MUEA 1LLUA 5G1PA 1VA5A 1K5PA 4Z6KA 3BG5A 2ZRBA 1RQRA 1ORDA 2WC1A 4UMEA 2C5AA 2ZTVA 1G55A 1ANKA 4QQNA 2N3ZA 3VV3A 1EVIA 5AIBA 2FWRA 4F3TA 3V33A 4PZ0A 3PITA 4G23A 4V3BA 3I4FA 4GP7A 3GLVA 4GI5A 4ZT3A 1RQXA 2AC2A 2LR0A 3X1MA 3ZCXA 4LG1A 4LZLA 5DKFA 3BX1A 1QUFA 1RQ2A 4HH0A 5A4AA 4I08A 1J06A 1B00A 3MAAC 5AIAA 1W19A 5TB5A 6REQA 2IH4A 3OECA 1CUWA 1WXGA 3AUKA 2O1XA 3E22B 3OZRA 3TBKA 1NX6A 4WADA 4MVJH 2G76A 3RO7A 4GLFA 3U48A 2WIDA 3JQ9C 3V8MA 3VAAA 4KAAA 4WACA 5I7RA 3GYGA 2NSJA 4JZKA 4CQJA 5ALQA 1FJXA 4JV5B 2Q1TA 3DDHA 3WAKA 3NYIA 1SBHA 1M0SA 3N0WA 3FPEA 5E6RA 1L5GB 1NC1A 1TT5A 3HBLA 1TO6A 4KWTA 1QMGA 1JKFA 1M2VB 1OI3A 2ZTUA 4O29A 1NW5A 4QFCA 2OPHA 5CW1A 5B58C 2FSIA 1NF8A 2A1TS 3Q3VA 3Q9SA 1XZ8A 4KWCA 1G41A 3EC7A 4WN3A 4PNZA 5LYJF 4MJ7A 3OLVA 1JIKA 2WJIA 1AA9A 2XI4A 4UBKA 4W5HA 2HA4A 4OAQA 1RXIA 3DKPA 5JALA 2CN1A 1NN5A 4L28A 3RHZA 4RACA 4S1WA 3KS9A 4AT1A 1V16A 4L8GA 2R8XA 2IPAB 1OUMA 3K9QO 4LYYA 4LDAA 4U8HA 5C51B 3WTCA 3M8KA 4P2GA 1M1YB 3H5AA 2E4UA 2J45A 2D5IA 1H2RS 3QVGA 4KLCA 5DXJA 3W3AH 4KQHA 2D1TA 1NBMA 1X3SA 1Q7CA 3OVMA 4IHJA 1U2DC 4EB6B 2X1VA 3TM4A 3CEAA 3SJBA 4KN6A 2I5PO 4Q1VA 1KK2A 4PQRA 1WCIA 1C3OA 1IONA 2OBYA 2VJNA 3KHSA 5HFJA 3K6SA 1P4RA 3FLEA 3KE8A 3HO6A 4NBWA 2R7MA 1SCUA 3C15C 2FQWA 4WH0A 2IY7A 5BV7A 4XSGA 5H59A 4TXJA 4HC4A 1GN8A 1J8DA 2OCYC 4D44A 2BGRA 3BH6A 4HZGA 4E1AA 2VF2A 5JLJA 1F60A 3AJ9A 4RPGA 4AZVA 4WERA 4F4HA 3KD2A 2YC2C 3Q0IA 4I0WB 1F8XA 4U7PB 4WI1A 4BEBA 1CZNA 4EHFA 1ABBA 3IXMA 4OGLA 3ZD6A 4ZO7A 1DEHA 2GD2A 2O2HA 3KL2A 5EFOA 2EU8A 5E0OA 3A6JA 4HEHA 1VHTA 1TL7C 4I5DA 1IHUA 1TRKA 2J33A 4HAVA 2Q3MA 2NUPA 4OK3A 4QQKA 3SPXA 4W9NA 1AS3A 2QD5A 3AYZB 2JEYA 1Q12A 1Q0LA 3HR7A 1LCIA 3K32A 3PIIA 2FA9A 4NJMA 1EESA 3OKFA 2JIMA 4QFBA 3DBHA 4LWOA 4U6SA 3ZX4A 1LV8A 2H48A 3C87A 4UZFA 4KWIA 2HDWA 1H2FA 2BFNA 3M6MD 4NBLA 3KQMA 3I5AA 4OP2A 1IXZA 5DEIA 1ISGA 3PT5A 4GZ6A 3TL2A 4BVKA 1TF5A 3N6RA 4DT1B 3H1PA 1H5QA 2ZU0C 3B5IA 4A4DA 1FDRA 1K6XA 1NJ2A 4BWYA 5EHQA 4C7KA 3C5CA 4A8JC 1FTGA 1CJCA 1KBZA 3HB4X 3LH5A 1X2EA 2VSQA 4RVGA 4XJXA 3LPAA 4G97A 4OLAA 1FIUA 1ZX1A 1HORA 2QN2A 2VDWA 4P5DA 4R0NA 1PTKA 1CJTC 1T8RA 4KEAA 3D7NA 5AK5A 3T4EA 2B1JA 1PJTA 3CLRC 2PRKA 2OXTA 3FGZA 1P4GA 5EE9A 5FO1A 3NCTA 621PA 4CKZA 3HLTA 3CMMA 1VE1A 2F59A 4P92A 1RPNA 5AH0A 3TVYA 5KVVA 2WHYA 3ESAA 3EGXA 4Z8XA 4BRSA 1EI9A 3RGGA 1FYEA 3K05A 4XVQA 1Z0DA 4PLGA 1FF9A 4NC9A 3QG1A 4RD3A 1Y4ZA 3DFIA 1AKRA 1N6KA 4DA7A 1EHCA 2AW5A 4I5FA 5DX1A 3R7NA 1IBKB 4B44A 1VYHA 1E62A 2ODNA 4RK7A 4PAMA 2WRZA 4REQB 1A2OA 3GRRA 3H1FA 2YHBA 2FRXA 2VUHB 3ZWAA 2H7YA 1S8OA 2WILA 3NHZA 2Y99A 4OHVA 3MWGA 1R0ZA 1P3JA 2FMFA 3L0ZA 4FHDA 4YPFA 3ZZUA 4TYWA 3DL4A 3H8WA 3KOZA 3O2SB 4JK3A 2ZJ2A 1Z73A 4UPEA 3OC0A 4X61A 2FX3A 5CVJA 5E2IA 3EGIA 1BJTA 1A9OA 1UKBA 4MV6A 2FMKA 3JQBA 3L7NA 2E5LB 1D09A 1DBIA 1XJWA 4BO9A 1RWOA 2R7LA 2NXJA 3AY7A 1FUKA 3E22A 2GN1A 5JZ9A 1AQJA 1UZAA 2BP7B 5F5LA 1OIWA 2OBFA 3HBAA 3WMFA 5FTKA 5JISA 4KMOA 3INNA 3GVCA 5I7OA 1A4RA 1UK9A 2O0HA 3PENA 1MRZA 1NJ8A 2C1XA 3Q9LA 4LISA 3FHLA 3KJQA 5CVVA 4FZJA 5A5FA 2PUEA 3LU1A 1E1DA 2IRWA 1EFKA 2ZRJA 3WOVA 1Q0TA 2QUKA 1U8CB 1UMBA 3CLUD 4NU0A 1SOMA 1UMCB 2QJTA 2WF8A 2WT4A 5HRAA 3T3IA 1HKUA 1I8TA 1M2VA 2RGDA 3EOBI 3OZ7A 5I9MA 3Q3GE 4XCXA 3M83A 2C61A 5HK8A 5DJ5A 1MJFA 1E5LA 2ECPA 2VQDA 3P71T 4CF3A 3OOWA 1JHOA 4EY8A 3EEIA 1TM4E 2JCYA 4RJKA 5C81A 5HMMA 1GUBA 2JARA 4YJ2B 3OD5A 4X41A 4L7QA 5CDSA 5IX8A 2CSXA 2XNJA 1EBUA 4PR0A 1PX2A 5IULC 2PT5A 3HVUA 5ICMA 5L3SB 3UIEA 4E08A 4XRGA 3CEHA 3HKDB 2WYVA 2E4AA 2W8ZA 2Y2UA 3B2QA 3N2ZB 4L0MA 3ADOA 3NDIA 1JAIA 1B8NA 2XSZD 4EB6A 3D81A 1A9TA 3KJEA 1FDIA 1VBMA 2ZJ0A 3JCZA 1DQSA 2VP5A 3W5HA 3QVLA 1P6UA 4X8HA 2BFFA 3K0HA 5E3HA 5LMZA 1V3TA 3KUDA 4HGQA 1QDEA 1MABA 3LPLA 1U94A 2I3ZA 4V0RA 5L6MB 2IE0A 2JH9A 3PQ8A 5JJLA 3IVXA 1YDFA 2VF7A 4L4ZA 1VA4A 3MWKA 4PIMA 4EHDA 4E2YA 1MN6A 3SD7A 3BE6A 4NWIA 2H65A 1Q1NA 2BZ1A 5TY0A 3TTUA 1AHNA 1UPXA 3I37X 4O4HA 4HNUA 3S8MA 2VPIA 5AJHA 2UUBB 3QEBZ 1J23A 3K71B 4ZOLB 5KYVA 3WFJA 3BFVA 2ZKIA 2O0JA 3M2TA 5D3QA 5A06A 2GRAA 2CCKA 4DG9A 3PNOA 2FSUA 2IYYA 3B5EA 2HZBA 4EARA 2H0AA 3WMWA 1W5FA 1VHJA 3A1WA 1UKZA 1FQJA 3H18A 2E49A 3L4KA 4KHPB 3CRVA 1C9EA 4TROA 3KFLA 1RBMA 3BWDD 3IKLA 1VG1A 3WRYC 5GV8A 4GOJA 2GHIA 4YRQA 4XKJA 2BZ0A 3ZU4A 3Q5EA 2BI8A 3D6MA 4Z4HA 3W5BA 3QVSA 1O54A 3B7GA 3L79A 2FRDC 2VZ8A 5ES3A 1F6WA 3Q11A 3MB5A 4S05A 2GPJA 4OXNA 4Q4LA 4OMUA 3U40A 3WGJA 2PFSA 4NJEB 1SU4A 2EFGA 1V4VA 1QHSA 4PS1A 1FU8A 3L8HA 1BVRA 1HA3A 5JS1A 4RD2A 5C2JB 4ZVQA 1GGNA 4E33A 1JBKA 1MC1A 1U0HC 4N18A 1FTWA 4G0PA 4LJYA 1AURA 3NEJA 1VJTA 1PK8A 3WDSA 4CIVA 1IG3A 3D4BA 4R5MA 3T3EA 2VUSA 2QRUA 1JLRA 1FDTA 2H8GA 2BVNA 2HA6A 4INAA 3TNDA 5TSDA 4CKEB 1J8FA 1G0NA 4U9IS 1TM7E 1RZUA 3HGMA 1QPBA 2O50A