3ZULA

Padron on (fluorescent) icis intermediate state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
214
structure length
213
Chain Sequence
SVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTMAFNRVFAKYPENIVDYFKQSFPEGYSWERSMIYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWELSTEKLYVRDGVLKSDGNYALSLEGGGHYRCDFKTTYKAKKVVQLPDYHSVDHHIEIKSHDKDYSNVNLHEHAEAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLUORESCENT PROTEIN DRONPA
publication title Low-Temperature Chromophore Isomerization Reveals the Photoswitching Mechanism of the Fluorescent Protein Padron.
pubmed doi rcsb
source organism Echinophyllia sp. sc22
molecule tags Fluorescent protein
total genus 60
structure length 213
sequence length 214
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3zulA00
2IE2A 4U2VA 2V4EB 5DQBA 4B30A 4B30B 1EMEA 2HPWA 4Q9WA 3U8AA 4OQWA 2C9IA 1MOVA 1MOUA 1H6RA 3LS3A 2IOVA 1YJ2A 3SSKA 2G6XA 2Z1OA 2FWQA 2PXSA 4JRBA 3AKOA 2H5OA 1Q73A 4HE4A 3CBEA 2Z6XA 2A56B 3DQCA 3WLDA 2DUHA 2YDZA 3BXBA 4ZB1A 4H3MA 2HGYA 2WSOA 4LJCA 1XAEA 3CGLA 2DUGA 4W6GA 2YE1A 3H1OA 4L1IA 4W6DA 4ZBLA 4KAGA 5EHUA 3RWTA 4R6DA 2OTBA 2A52B 3KCSA 2PXWA 3LVDA 4W6LA 3WCKA 5DPIA 3SVDA 1RM9A 5DPHA 4TZGA 3SS0A 1RRXA 4Q7RA 3SRYA 1BFPA 2DUFA 4H47A 4XOWA 1Q4BA 4L13A 2VVHA 2QT2A 3SV5A 1JBZA 2Q57A 2G6YA 2HJOA 3SVRA 3SG4A 4KGFA 2G5ZB 2OKWA 2G16B 1OXFA 2ZMUA 4IK9A 4W77A 4GESB 3DQFA 3W1CA 3DQEA 4W7FA 2OKYA 3E5WA 5FVIA 4DXIA 5HBDA 2VZXA 3EVPA 4W6UA 3DQ4A 3CFAA 4Q7TA 2QLGB 4W6SA 2EMOA 2HRSA 3GJ1A 4JFGA 2AHAA 4ZFSA 2BTJA 3SSTA 3H1RA 3BXCA 3GJ2A 2O29A 3SVCA 4JC2A 3G9AA 4ZF4A 3U0KA 4ZINA 2DD7A 2Q6PA 3SSVA 4W6JA 2OGRA 2GX0A 5DY6A 4ORNA 1EMLA 4W6TA 4UTSA 3OSRA 5DTXA 3M22A 2AWLA 3SG5A 2IB5A 1YHHA 4DXNA 4PPLA 3VHTB 1HUYA 5HZTA 3DQMA 2DDCA 4W6MA 5AQBB 1ZGOA 4IK8A 2Y0GA 3AI4A 3SG3A 3VICA 4LJBA 4Q7UA 3CB9A 5HZOA 4W7AA 4ZF5A 2ZO7A 5EXBA 1UISA 3I19A 4BDUA 3A8SA 4EMQA 5EB7A 1W7UA 2QLIA 2A48A 3DQAA 3DQ6A 4JGEA 3DPXA 2HCGA 3V3DA 4PFEA 2H9WA 3EK4A 4DKMA 2Z6ZA 2WHUA 3DQJA 1KYPA 3DQDA 1Z1PA 4H3NA 4LQUA 3CFHA 2A46A 2EMNA 4N3DA 5J2OA 4KF5C 5H87A 2GW4B 1YHGA 3SVEA 3DQ3A 2DUIA 4W6HA 1JC1A 3UG0A 4W6CA 3SSYA 5HGEA 5T3IA 3EK7A 5DTLA 3AI5A 1XQMA 3ADFA 1KP5A 2A50B 2HQKA 3U0MA 3LF4B 4RYWA 2WISA 3LVCA 2YE0A 3DQHA 5EBJA 4OGSA 2JADA 2A53B 2B3PA 1EMCA 3ST0A 3ZTFA 2VADA 5BT0A 1QY3A 2FL1A 1EMMA 3SG6A 2G2SB 4J88A 4IZNA 3U8CA 3GB3A 3EVRA 4JEOA 4HQ8A 3ZUJA 4RTCA 3DQ2A 3E5VA 2P4MA 1GFLA 2DUEA 5HZSA 1MYWA 4Q9XA 2YFPA 4EDSA 4B5YA 4W6NA 4EDOA 2HGDA 5DRFA 3SSHA 2DD9A 2GW3A 3SVSA 3ZULA 3O78A 1B9CA 4PPKA 3ST4A 2AWKA 4W6IA 3EVUA 4KW8A 3O77A 4DKNA 3ST3A 2VVIA 2OTEA 1KYSA 1QYFA 4DXQA 3DPZA 2VVJA 3PJ7A 4R6BA 3OGOA 1YJFA 4W6AA 1EMAA 5DPGA 2WSNA 2G3OA 4W7RA 1H4UA 2AWJA 3U8PA 1Q4EA 5BTTA 4KF5A 1RMPA 1YFPA 3TMTA 4W6BA 3GL4A 5BQLA 4XGYA 1XSSA 4W72A 1EMKA 2QRFA 1YHIA 4P1QA 3NF0A 2WURA 3E5TA 5DRGA 3LSAA 1G7KA 1F09A 3PJBA 1ZUXA 4XVPA 4XOVA 4W7CA 5DTYA 4W74A 1OXDA 2DDDA 2C9JA 1OXEA 1Q4DA 4J89A 1RMMA 5H88A 4P76A 3SVOA 5DU0A 1W7TA 4KF4A 5EB6A 3SVNA 2OJKA 5EXCI 3LF3A 5EJUA 3TMRA 1XA9A 3IR8A 1RMOA 3P8UA 4LJDC 4H48A 5DTZA 4OJ0A 3PJ5A 4W6FA 3P28A 1GL4A 1Q4AA 1Q4CA 3DQIA 4TZAA 3EKJA 2V4EA 3DQUA 1W7SA 4J8AA 3SSLA 3K1KA 3S05A 5LK4A 2QLEA 4KGEA 3DQ5A 3SSPA 3ZUFA 3BX9A 3GEXA 1EMBA 1KYRA 3DQNA 2Z6YA 1F0BA 2AWMA 4KEXA 2ZO6A 3RWAA 1XMZA 1QYOA 3OSQA 5DQMA 1ZGQA 3CD1A 4W69A 4EN1A 3KCTA 2HFCA 4AR7A 4GOBA 4KW9A 2WIQA 4GF6B 2G6EA 1QYQA 3SVBA 1ZGPA 3DQLA 3PIBA 3DQOA 4DXPA 4IK4A 1YZWA 2H8QA 2ARLA 3ST2A 2B3QA 4OHSA 3IP2A 1EMGA 3EKHA 4IK5A 4L12A 4W7XA 3NT9A 3DQ1A 2O24A 3SG7A 3DPWA 5FHVA 3W1DA 2EMDA 3NEDA 2QZ0A 2O2BA 3DQKA 4W6KA 5LTQA 3BXAA 4H3LA 1CV7A 3SG2A 4W6OA 2IB6A 2POXA 2QLHA 3U0NA 2A54B 2V4EC 4IK1A 4DXMA 2AH8A 3NT3A 2H5QA 3MGFA 2H5PA 4W6PA 4W76A 3UFZA 4W7EA 4ZF3A 5LTPA 2HQZA 4LJDA 2FZUA 3NEZA 5HW9A 4AS8A 4OY4A 3DQ8A 4LW5A 1C4FA 4KA9A 3LVAA 3DQ9A 1GGXA 1S6ZA 4EULA 5BTTB 4HQCA 2QLGA 5FVGA 4XL5A 1EMFA 2RH7A 1Z1QA 4IK3A 3WLCA 3SVUA 2H6VA 4PPJA 4W6RA 4W73A 5EXUA 3CFFA 2VAEA 5DPJA 3LA1A 2ICRA 4Z4KA 5LTRA 3U0LA 4ZIOA 3EK8A 4KPIA 5H89A 4JF9A 3ED8A 5KTGA 2ZMWA 5FVFA 2A47A 4DXOA 1HCJA 4RYSA 3VHTA 2GX2A 4W7DA 4Z4MA 3VK1A 2WHSA 4NWSA 1JC0A 4I2YA 4LQTA 1QXTA 4HQ9A 2QU1A 3M24A 3CD9A 4ANJA 4W75A 4KW4A 2WHTA 2H5RA 3DQ7A 4HVFA 5HZUA 3EVVA 1JBYA 2G3DB 5F9GA
chains in the Genus database with same CATH superfamily
2IE2A 4U2VA 2V4EB 5DQBA 4B30A 4B30B 1EMEA 2HPWA 4Q9WA 3U8AA 4OQWA 2C9IA 1MOVA 1MOUA 1H6RA 3LS3A 2IOVA 1YJ2A 3SSKA 2G6XA 2Z1OA 2FWQA 2PXSA 4JRBA 3AKOA 2H5OA 1Q73A 4HE4A 3CBEA 2Z6XA 2A56B 3DQCA 3WLDA 2DUHA 2YDZA 3BXBA 4ZB1A 4H3MA 2HGYA 2WSOA 4LJCA 1XAEA 3CGLA 2DUGA 4W6GA 2YE1A 3H1OA 4L1IA 4W6DA 4ZBLA 4KAGA 5EHUA 3RWTA 4R6DA 2OTBA 2A52B 3KCSA 2PXWA 3LVDA 4W6LA 3WCKA 5DPIA 3SVDA 1RM9A 5DPHA 4TZGA 3SS0A 1RRXA 4Q7RA 3SRYA 1BFPA 2DUFA 4H47A 4XOWA 1Q4BA 4L13A 2VVHA 2QT2A 3SV5A 1JBZA 2Q57A 2G6YA 2HJOA 3SVRA 3SG4A 4KGFA 2G5ZB 2OKWA 2G16B 1OXFA 2ZMUA 4IK9A 4W77A 4GESB 3DQFA 3W1CA 3DQEA 4W7FA 2OKYA 3E5WA 5FVIA 4DXIA 5HBDA 2VZXA 3EVPA 4W6UA 3DQ4A 3CFAA 4Q7TA 2QLGB 4W6SA 2EMOA 2HRSA 3GJ1A 4JFGA 2AHAA 4ZFSA 2BTJA 3SSTA 3H1RA 3BXCA 3GJ2A 2O29A 3SVCA 4JC2A 3G9AA 4ZF4A 3U0KA 4ZINA 2DD7A 2Q6PA 3SSVA 4W6JA 2OGRA 2GX0A 5DY6A 4ORNA 1EMLA 4W6TA 4UTSA 3OSRA 5DTXA 3M22A 2AWLA 3SG5A 2IB5A 1YHHA 4DXNA 4PPLA 3VHTB 1HUYA 5HZTA 3DQMA 2DDCA 4W6MA 5AQBB 1ZGOA 4IK8A 2Y0GA 3AI4A 3SG3A 3VICA 4LJBA 4Q7UA 3CB9A 5HZOA 4W7AA 4ZF5A 2ZO7A 5EXBA 1UISA 3I19A 4BDUA 3A8SA 4EMQA 5EB7A 1W7UA 2QLIA 2A48A 3DQAA 3DQ6A 4JGEA 3DPXA 2HCGA 3V3DA 4PFEA 2H9WA 3EK4A 4DKMA 2Z6ZA 2WHUA 3DQJA 1KYPA 3DQDA 1Z1PA 4H3NA 4LQUA 3CFHA 2A46A 2EMNA 4N3DA 5J2OA 4KF5C 5H87A 2GW4B 1YHGA 3SVEA 3DQ3A 2DUIA 4W6HA 1JC1A 3UG0A 4W6CA 3SSYA 5HGEA 5T3IA 3EK7A 5DTLA 3AI5A 1XQMA 3ADFA 1KP5A 2A50B 2HQKA 3U0MA 3LF4B 4RYWA 2WISA 3LVCA 2YE0A 3DQHA 5EBJA 4OGSA 2JADA 2A53B 2B3PA 1EMCA 3ST0A 3ZTFA 2VADA 5BT0A 1QY3A 2FL1A 1EMMA 3SG6A 2G2SB 4J88A 4IZNA 3U8CA 3GB3A 3EVRA 4JEOA 4HQ8A 3ZUJA 4RTCA 3DQ2A 3E5VA 2P4MA 1GFLA 2DUEA 5HZSA 1MYWA 4Q9XA 2YFPA 4EDSA 4B5YA 4W6NA 4EDOA 2HGDA 5DRFA 3SSHA 2DD9A 2GW3A 3SVSA 3ZULA 3O78A 1B9CA 4PPKA 3ST4A 2AWKA 4W6IA 3EVUA 4KW8A 3O77A 4DKNA 3ST3A 2VVIA 2OTEA 1KYSA 1QYFA 4DXQA 3DPZA 2VVJA 3PJ7A 4R6BA 3OGOA 1YJFA 4W6AA 1EMAA 5DPGA 2WSNA 2G3OA 4W7RA 1H4UA 2AWJA 3U8PA 1Q4EA 5BTTA 4KF5A 1RMPA 1YFPA 3TMTA 4W6BA 3GL4A 5BQLA 4XGYA 1XSSA 4W72A 1EMKA 2QRFA 1YHIA 4P1QA 3NF0A 2WURA 3E5TA 5DRGA 3LSAA 1G7KA 1F09A 3PJBA 1ZUXA 4XVPA 4XOVA 4W7CA 5DTYA 4W74A 1OXDA 2DDDA 2C9JA 1OXEA 1Q4DA 4J89A 1RMMA 5H88A 4P76A 3SVOA 5DU0A 1W7TA 4KF4A 5EB6A 3SVNA 2OJKA 5EXCI 3LF3A 5EJUA 3TMRA 1XA9A 3IR8A 1RMOA 3P8UA 4LJDC 4H48A 5DTZA 4OJ0A 3PJ5A 4W6FA 3P28A 1GL4A 1Q4AA 1Q4CA 3DQIA 4TZAA 3EKJA 2V4EA 3DQUA 1W7SA 4J8AA 3SSLA 3K1KA 3S05A 5LK4A 2QLEA 4KGEA 3DQ5A 3SSPA 3ZUFA 3BX9A 3GEXA 1EMBA 1KYRA 3DQNA 2Z6YA 1F0BA 2AWMA 4KEXA 2ZO6A 3RWAA 1XMZA 1QYOA 3OSQA 5DQMA 1ZGQA 3CD1A 4W69A 4EN1A 3KCTA 2HFCA 4AR7A 4GOBA 4KW9A 2WIQA 4GF6B 2G6EA 1QYQA 3SVBA 1ZGPA 3DQLA 3PIBA 3DQOA 4DXPA 4IK4A 1YZWA 2H8QA 2ARLA 3ST2A 2B3QA 4OHSA 3IP2A 1EMGA 3EKHA 4IK5A 4L12A 4W7XA 3NT9A 3DQ1A 2O24A 3SG7A 3DPWA 5FHVA 3W1DA 2EMDA 3NEDA 2QZ0A 2O2BA 3DQKA 4W6KA 5LTQA 3BXAA 4H3LA 1CV7A 3SG2A 4W6OA 2IB6A 2POXA 2QLHA 3U0NA 2A54B 2V4EC 4IK1A 4DXMA 2AH8A 3NT3A 2H5QA 3MGFA 2H5PA 4W6PA 4W76A 3UFZA 4W7EA 4ZF3A 5LTPA 2HQZA 4LJDA 2FZUA 3NEZA 5HW9A 4AS8A 4OY4A 3DQ8A 4LW5A 1C4FA 4KA9A 3LVAA 3DQ9A 1GGXA 1S6ZA 4EULA 5BTTB 4HQCA 2QLGA 5FVGA 4XL5A 1EMFA 2RH7A 1Z1QA 4IK3A 3WLCA 3SVUA 2H6VA 4PPJA 4W6RA 4W73A 5EXUA 3CFFA 2VAEA 5DPJA 3LA1A 2ICRA 4Z4KA 5LTRA 3U0LA 4ZIOA 3EK8A 4KPIA 5H89A 4JF9A 3ED8A 5KTGA 2ZMWA 5FVFA 2A47A 4DXOA 1HCJA 4RYSA 3VHTA 2GX2A 4W7DA 4Z4MA 3VK1A 2WHSA 4NWSA 1JC0A 4I2YA 4LQTA 1QXTA 4HQ9A 2QU1A 3M24A 3CD9A 4ANJA 4W75A 4KW4A 2WHTA 2H5RA 3DQ7A 4HVFA 5HZUA 3EVVA 1JBYA 2G3DB 5F9GA
chains in the Genus database with same CATH topology
2IE2A 4U2VA 2V4EB 5DQBA 4B30A 4B30B 1EMEA 2HPWA 4Q9WA 3U8AA 4OQWA 2C9IA 1MOVA 1MOUA 1H6RA 3LS3A 2IOVA 1YJ2A 3SSKA 2G6XA 2Z1OA 2FWQA 2PXSA 4JRBA 3AKOA 2H5OA 1Q73A 4HE4A 3CBEA 2Z6XA 2A56B 3DQCA 3WLDA 2DUHA 2YDZA 3BXBA 4ZB1A 4H3MA 2HGYA 2WSOA 4LJCA 1XAEA 3CGLA 2DUGA 4W6GA 2YE1A 3H1OA 4L1IA 4W6DA 4ZBLA 4KAGA 5EHUA 3RWTA 4R6DA 2OTBA 2A52B 3KCSA 2PXWA 3LVDA 4W6LA 3WCKA 5DPIA 3SVDA 1RM9A 5DPHA 4TZGA 3SS0A 1RRXA 4Q7RA 3SRYA 1BFPA 2DUFA 4H47A 4XOWA 1Q4BA 4L13A 2VVHA 2QT2A 3SV5A 1JBZA 2Q57A 2G6YA 2HJOA 3SVRA 3SG4A 4KGFA 2G5ZB 2OKWA 2G16B 1OXFA 2ZMUA 4IK9A 4W77A 4GESB 3DQFA 3W1CA 3DQEA 4W7FA 2OKYA 3E5WA 5FVIA 4DXIA 5HBDA 2VZXA 3EVPA 4W6UA 3DQ4A 3CFAA 4Q7TA 2QLGB 4W6SA 2EMOA 2HRSA 3GJ1A 4JFGA 2AHAA 4ZFSA 2BTJA 3SSTA 3H1RA 3BXCA 3GJ2A 2O29A 3SVCA 4JC2A 3G9AA 4ZF4A 3U0KA 4ZINA 2DD7A 2Q6PA 3SSVA 4W6JA 2OGRA 2GX0A 5DY6A 4ORNA 1EMLA 4W6TA 4UTSA 3OSRA 5DTXA 3M22A 2AWLA 3SG5A 2IB5A 1YHHA 4DXNA 4PPLA 3VHTB 1HUYA 5HZTA 3DQMA 2DDCA 4W6MA 5AQBB 1ZGOA 4IK8A 2Y0GA 3AI4A 3SG3A 3VICA 4LJBA 4Q7UA 3CB9A 5HZOA 4W7AA 4ZF5A 2ZO7A 5EXBA 1UISA 3I19A 4BDUA 3A8SA 4EMQA 5EB7A 1W7UA 2QLIA 2A48A 3DQAA 3DQ6A 4JGEA 3DPXA 2HCGA 3V3DA 4PFEA 2H9WA 3EK4A 4DKMA 2Z6ZA 2WHUA 3DQJA 1KYPA 3DQDA 1Z1PA 4H3NA 4LQUA 3CFHA 2A46A 2EMNA 4N3DA 5J2OA 4KF5C 5H87A 2GW4B 1YHGA 3SVEA 3DQ3A 2DUIA 4W6HA 1JC1A 3UG0A 4W6CA 3SSYA 5HGEA 5T3IA 3EK7A 5DTLA 3AI5A 1XQMA 3ADFA 1KP5A 2A50B 2HQKA 3U0MA 3LF4B 4RYWA 2WISA 3LVCA 2YE0A 3DQHA 5EBJA 4OGSA 2JADA 2A53B 2B3PA 1EMCA 3ST0A 3ZTFA 2VADA 5BT0A 1QY3A 2FL1A 1EMMA 3SG6A 2G2SB 4J88A 4IZNA 3U8CA 3GB3A 3EVRA 4JEOA 4HQ8A 3ZUJA 4RTCA 3DQ2A 3E5VA 2P4MA 1GFLA 2DUEA 5HZSA 1MYWA 4Q9XA 2YFPA 4EDSA 4B5YA 4W6NA 4EDOA 2HGDA 5DRFA 3SSHA 2DD9A 2GW3A 3SVSA 3ZULA 3O78A 1B9CA 4PPKA 3ST4A 2AWKA 4W6IA 3EVUA 4KW8A 3O77A 4DKNA 3ST3A 2VVIA 2OTEA 1KYSA 1QYFA 4DXQA 3DPZA 2VVJA 3PJ7A 4R6BA 3OGOA 1YJFA 4W6AA 1EMAA 5DPGA 2WSNA 2G3OA 4W7RA 1H4UA 2AWJA 3U8PA 1Q4EA 5BTTA 4KF5A 1RMPA 1YFPA 3TMTA 4W6BA 3GL4A 5BQLA 4XGYA 1XSSA 4W72A 1EMKA 2QRFA 1YHIA 4P1QA 3NF0A 2WURA 3E5TA 5DRGA 3LSAA 1G7KA 1F09A 3PJBA 1ZUXA 4XVPA 4XOVA 4W7CA 5DTYA 4W74A 1OXDA 2DDDA 2C9JA 1OXEA 1Q4DA 4J89A 1RMMA 5H88A 4P76A 3SVOA 5DU0A 1W7TA 4KF4A 5EB6A 3SVNA 2OJKA 5EXCI 3LF3A 5EJUA 3TMRA 1XA9A 3IR8A 1RMOA 3P8UA 4LJDC 4H48A 5DTZA 4OJ0A 3PJ5A 4W6FA 3P28A 1GL4A 1Q4AA 1Q4CA 3DQIA 4TZAA 3EKJA 2V4EA 3DQUA 1W7SA 4J8AA 3SSLA 3K1KA 3S05A 5LK4A 2QLEA 4KGEA 3DQ5A 3SSPA 3ZUFA 3BX9A 3GEXA 1EMBA 1KYRA 3DQNA 2Z6YA 1F0BA 2AWMA 4KEXA 2ZO6A 3RWAA 1XMZA 1QYOA 3OSQA 5DQMA 1ZGQA 3CD1A 4W69A 4EN1A 3KCTA 2HFCA 4AR7A 4GOBA 4KW9A 2WIQA 4GF6B 2G6EA 1QYQA 3SVBA 1ZGPA 3DQLA 3PIBA 3DQOA 4DXPA 4IK4A 1YZWA 2H8QA 2ARLA 3ST2A 2B3QA 4OHSA 3IP2A 1EMGA 3EKHA 4IK5A 4L12A 4W7XA 3NT9A 3DQ1A 2O24A 3SG7A 3DPWA 5FHVA 3W1DA 2EMDA 3NEDA 2QZ0A 2O2BA 3DQKA 4W6KA 5LTQA 3BXAA 4H3LA 1CV7A 3SG2A 4W6OA 2IB6A 2POXA 2QLHA 3U0NA 2A54B 2V4EC 4IK1A 4DXMA 2AH8A 3NT3A 2H5QA 3MGFA 2H5PA 4W6PA 4W76A 3UFZA 4W7EA 4ZF3A 5LTPA 2HQZA 4LJDA 2FZUA 3NEZA 5HW9A 4AS8A 4OY4A 3DQ8A 4LW5A 1C4FA 4KA9A 3LVAA 3DQ9A 1GGXA 1S6ZA 4EULA 5BTTB 4HQCA 2QLGA 5FVGA 4XL5A 1EMFA 2RH7A 1Z1QA 4IK3A 3WLCA 3SVUA 2H6VA 4PPJA 4W6RA 4W73A 5EXUA 3CFFA 2VAEA 5DPJA 3LA1A 2ICRA 4Z4KA 5LTRA 3U0LA 4ZIOA 3EK8A 4KPIA 5H89A 4JF9A 3ED8A 5KTGA 2ZMWA 5FVFA 2A47A 4DXOA 1HCJA 4RYSA 3VHTA 2GX2A 4W7DA 4Z4MA 3VK1A 2WHSA 4NWSA 1JC0A 4I2YA 4LQTA 1QXTA 4HQ9A 2QU1A 3M24A 3CD9A 4ANJA 4W75A 4KW4A 2WHTA 2H5RA 3DQ7A 4HVFA 5HZUA 3EVVA 1JBYA 2G3DB 5F9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IE2 A;  4U2V A;  2V4E B;  5DQB A;  4B30 A;  4B30 B;  1EME A;  2HPW A;  4Q9W A;  3U8A A;  4OQW A;  2C9I A;  1MOV A;  1MOU A;  1H6R A;  3LS3 A;  2IOV A;  1YJ2 A;  3SSK A;  2G6X A;  2Z1O A;  2FWQ A;  2PXS A;  4JRB A;  3AKO A;  2H5O A;  1Q73 A;  4HE4 A;  3CBE A;  2Z6X A;  2A56 B;  3DQC A;  3WLD A;  2DUH A;  2YDZ A;  3BXB A;  4ZB1 A;  4H3M A;  2HGY A;  2WSO A;  4LJC A;  1XAE A;  3CGL A;  2DUG A;  4W6G A;  2YE1 A;  3H1O A;  4L1I A;  4W6D A;  4ZBL A;  4KAG A;  5EHU A;  3RWT A;  4R6D A;  2OTB A;  2A52 B;  3KCS A;  2PXW A;  3LVD A;  4W6L A;  3WCK A;  5DPI A;  3SVD A;  1RM9 A;  5DPH A;  4TZG A;  3SS0 A;  1RRX A;  4Q7R A;  3SRY A;  1BFP A;  2DUF A;  4H47 A;  4XOW A;  1Q4B A;  4L13 A;  2VVH A;  2QT2 A;  3SV5 A;  1JBZ A;  2Q57 A;  2G6Y A;  2HJO A;  3SVR A;  3SG4 A;  4KGF A;  2G5Z B;  2OKW A;  2G16 B;  1OXF A;  2ZMU A;  4IK9 A;  4W77 A;  4GES B;  3DQF A;  3W1C A;  3DQE A;  4W7F A;  2OKY A;  3E5W A;  5FVI A;  4DXI A;  5HBD A;  2VZX A;  3EVP A;  4W6U A;  3DQ4 A;  3CFA A;  4Q7T A;  2QLG B;  4W6S A;  2EMO A;  2HRS A;  3GJ1 A;  4JFG A;  2AHA A;  4ZFS A;  2BTJ A;  3SST A;  3H1R A;  3BXC A;  3GJ2 A;  2O29 A;  3SVC A;  4JC2 A;  3G9A A;  4ZF4 A;  3U0K A;  4ZIN A;  2DD7 A;  2Q6P A;  3SSV A;  4W6J A;  2OGR A;  2GX0 A;  5DY6 A;  4ORN A;  1EML A;  4W6T A;  4UTS A;  3OSR A;  5DTX A;  3M22 A;  2AWL A;  3SG5 A;  2IB5 A;  1YHH A;  4DXN A;  4PPL A;  3VHT B;  1HUY A;  5HZT A;  3DQM A;  2DDC A;  4W6M A;  5AQB B;  1ZGO A;  4IK8 A;  2Y0G A;  3AI4 A;  3SG3 A;  3VIC A;  4LJB A;  4Q7U A;  3CB9 A;  5HZO A;  4W7A A;  4ZF5 A;  2ZO7 A;  5EXB A;  1UIS A;  3I19 A;  4BDU A;  3A8S A;  4EMQ A;  5EB7 A;  1W7U A;  2QLI A;  2A48 A;  3DQA A;  3DQ6 A;  4JGE A;  3DPX A;  2HCG A;  3V3D A;  4PFE A;  2H9W A;  3EK4 A;  4DKM A;  2Z6Z A;  2WHU A;  3DQJ A;  1KYP A;  3DQD A;  1Z1P A;  4H3N A;  4LQU A;  3CFH A;  2A46 A;  2EMN A;  4N3D A;  5J2O A;  4KF5 C;  5H87 A;  2GW4 B;  1YHG A;  3SVE A;  3DQ3 A;  2DUI A;  4W6H A;  1JC1 A;  3UG0 A;  4W6C A;  3SSY A;  5HGE A;  5T3I A;  3EK7 A;  5DTL A;  3AI5 A;  1XQM A;  3ADF A;  1KP5 A;  2A50 B;  2HQK A;  3U0M A;  3LF4 B;  4RYW A;  2WIS A;  3LVC A;  2YE0 A;  3DQH A;  5EBJ A;  4OGS A;  2JAD A;  2A53 B;  2B3P A;  1EMC A;  3ST0 A;  3ZTF A;  2VAD A;  5BT0 A;  1QY3 A;  2FL1 A;  1EMM A;  3SG6 A;  2G2S B;  4J88 A;  4IZN A;  3U8C A;  3GB3 A;  3EVR A;  4JEO A;  4HQ8 A;  3ZUJ A;  4RTC A;  3DQ2 A;  3E5V A;  2P4M A;  1GFL A;  2DUE A;  5HZS A;  1MYW A;  4Q9X A;  2YFP A;  4EDS A;  4B5Y A;  4W6N A;  4EDO A;  2HGD A;  5DRF A;  3SSH A;  2DD9 A;  2GW3 A;  3SVS A;  3ZUL A;  3O78 A;  1B9C A;  4PPK A;  3ST4 A;  2AWK A;  4W6I A;  3EVU A;  4KW8 A;  3O77 A;  4DKN A;  3ST3 A;  2VVI A;  2OTE A;  1KYS A;  1QYF A;  4DXQ A;  3DPZ A;  2VVJ A;  3PJ7 A;  4R6B A;  3OGO A;  1YJF A;  4W6A A;  1EMA A;  5DPG A;  2WSN A;  2G3O A;  4W7R A;  1H4U A;  2AWJ A;  3U8P A;  1Q4E A;  5BTT A;  4KF5 A;  1RMP A;  1YFP A;  3TMT A;  4W6B A;  3GL4 A;  5BQL A;  4XGY A;  1XSS A;  4W72 A;  1EMK A;  2QRF A;  1YHI A;  4P1Q A;  3NF0 A;  2WUR A;  3E5T A;  5DRG A;  3LSA A;  1G7K A;  1F09 A;  3PJB A;  1ZUX A;  4XVP A;  4XOV A;  4W7C A;  5DTY A;  4W74 A;  1OXD A;  2DDD A;  2C9J A;  1OXE A;  1Q4D A;  4J89 A;  1RMM A;  5H88 A;  4P76 A;  3SVO A;  5DU0 A;  1W7T A;  4KF4 A;  5EB6 A;  3SVN A;  2OJK A;  5EXC I;  3LF3 A;  5EJU A;  3TMR A;  1XA9 A;  3IR8 A;  1RMO A;  3P8U A;  4LJD C;  4H48 A;  5DTZ A;  4OJ0 A;  3PJ5 A;  4W6F A;  3P28 A;  1GL4 A;  1Q4A A;  1Q4C A;  3DQI A;  4TZA A;  3EKJ A;  2V4E A;  3DQU A;  1W7S A;  4J8A A;  3SSL A;  3K1K A;  3S05 A;  5LK4 A;  2QLE A;  4KGE A;  3DQ5 A;  3SSP A;  3ZUF A;  3BX9 A;  3GEX A;  1EMB A;  1KYR A;  3DQN A;  2Z6Y A;  1F0B A;  2AWM A;  4KEX A;  2ZO6 A;  3RWA A;  1XMZ A;  1QYO A;  3OSQ A;  5DQM A;  1ZGQ A;  3CD1 A;  4W69 A;  4EN1 A;  3KCT A;  2HFC A;  4AR7 A;  4GOB A;  4KW9 A;  2WIQ A;  4GF6 B;  2G6E A;  1QYQ A;  3SVB A;  1ZGP A;  3DQL A;  3PIB A;  3DQO A;  4DXP A;  4IK4 A;  1YZW A;  2H8Q A;  2ARL A;  3ST2 A;  2B3Q A;  4OHS A;  3IP2 A;  1EMG A;  3EKH A;  4IK5 A;  4L12 A;  4W7X A;  3NT9 A;  3DQ1 A;  2O24 A;  3SG7 A;  3DPW A;  5FHV A;  3W1D A;  2EMD A;  3NED A;  2QZ0 A;  2O2B A;  3DQK A;  4W6K A;  5LTQ A;  3BXA A;  4H3L A;  1CV7 A;  3SG2 A;  4W6O A;  2IB6 A;  2POX A;  2QLH A;  3U0N A;  2A54 B;  2V4E C;  4IK1 A;  4DXM A;  2AH8 A;  3NT3 A;  2H5Q A;  3MGF A;  2H5P A;  4W6P A;  4W76 A;  3UFZ A;  4W7E A;  4ZF3 A;  5LTP A;  2HQZ A;  4LJD A;  2FZU A;  3NEZ A;  5HW9 A;  4AS8 A;  4OY4 A;  3DQ8 A;  4LW5 A;  1C4F A;  4KA9 A;  3LVA A;  3DQ9 A;  1GGX A;  1S6Z A;  4EUL A;  5BTT B;  4HQC A;  2QLG A;  5FVG A;  4XL5 A;  1EMF A;  2RH7 A;  1Z1Q A;  4IK3 A;  3WLC A;  3SVU A;  2H6V A;  4PPJ A;  4W6R A;  4W73 A;  5EXU A;  3CFF A;  2VAE A;  5DPJ A;  3LA1 A;  2ICR A;  4Z4K A;  5LTR A;  3U0L A;  4ZIO A;  3EK8 A;  4KPI A;  5H89 A;  4JF9 A;  3ED8 A;  5KTG A;  2ZMW A;  5FVF A;  2A47 A;  4DXO A;  1HCJ A;  4RYS A;  3VHT A;  2GX2 A;  4W7D A;  4Z4M A;  3VK1 A;  2WHS A;  4NWS A;  1JC0 A;  4I2Y A;  4LQT A;  1QXT A;  4HQ9 A;  2QU1 A;  3M24 A;  3CD9 A;  4ANJ A;  4W75 A;  4KW4 A;  2WHT A;  2H5R A;  3DQ7 A;  4HVF A;  5HZU A;  3EVV A;  1JBY A;  2G3D B;  5F9G A; 
#chains in the Genus database with same CATH topology
 2IE2 A;  4U2V A;  2V4E B;  5DQB A;  4B30 A;  4B30 B;  1EME A;  2HPW A;  4Q9W A;  3U8A A;  4OQW A;  2C9I A;  1MOV A;  1MOU A;  1H6R A;  3LS3 A;  2IOV A;  1YJ2 A;  3SSK A;  2G6X A;  2Z1O A;  2FWQ A;  2PXS A;  4JRB A;  3AKO A;  2H5O A;  1Q73 A;  4HE4 A;  3CBE A;  2Z6X A;  2A56 B;  3DQC A;  3WLD A;  2DUH A;  2YDZ A;  3BXB A;  4ZB1 A;  4H3M A;  2HGY A;  2WSO A;  4LJC A;  1XAE A;  3CGL A;  2DUG A;  4W6G A;  2YE1 A;  3H1O A;  4L1I A;  4W6D A;  4ZBL A;  4KAG A;  5EHU A;  3RWT A;  4R6D A;  2OTB A;  2A52 B;  3KCS A;  2PXW A;  3LVD A;  4W6L A;  3WCK A;  5DPI A;  3SVD A;  1RM9 A;  5DPH A;  4TZG A;  3SS0 A;  1RRX A;  4Q7R A;  3SRY A;  1BFP A;  2DUF A;  4H47 A;  4XOW A;  1Q4B A;  4L13 A;  2VVH A;  2QT2 A;  3SV5 A;  1JBZ A;  2Q57 A;  2G6Y A;  2HJO A;  3SVR A;  3SG4 A;  4KGF A;  2G5Z B;  2OKW A;  2G16 B;  1OXF A;  2ZMU A;  4IK9 A;  4W77 A;  4GES B;  3DQF A;  3W1C A;  3DQE A;  4W7F A;  2OKY A;  3E5W A;  5FVI A;  4DXI A;  5HBD A;  2VZX A;  3EVP A;  4W6U A;  3DQ4 A;  3CFA A;  4Q7T A;  2QLG B;  4W6S A;  2EMO A;  2HRS A;  3GJ1 A;  4JFG A;  2AHA A;  4ZFS A;  2BTJ A;  3SST A;  3H1R A;  3BXC A;  3GJ2 A;  2O29 A;  3SVC A;  4JC2 A;  3G9A A;  4ZF4 A;  3U0K A;  4ZIN A;  2DD7 A;  2Q6P A;  3SSV A;  4W6J A;  2OGR A;  2GX0 A;  5DY6 A;  4ORN A;  1EML A;  4W6T A;  4UTS A;  3OSR A;  5DTX A;  3M22 A;  2AWL A;  3SG5 A;  2IB5 A;  1YHH A;  4DXN A;  4PPL A;  3VHT B;  1HUY A;  5HZT A;  3DQM A;  2DDC A;  4W6M A;  5AQB B;  1ZGO A;  4IK8 A;  2Y0G A;  3AI4 A;  3SG3 A;  3VIC A;  4LJB A;  4Q7U A;  3CB9 A;  5HZO A;  4W7A A;  4ZF5 A;  2ZO7 A;  5EXB A;  1UIS A;  3I19 A;  4BDU A;  3A8S A;  4EMQ A;  5EB7 A;  1W7U A;  2QLI A;  2A48 A;  3DQA A;  3DQ6 A;  4JGE A;  3DPX A;  2HCG A;  3V3D A;  4PFE A;  2H9W A;  3EK4 A;  4DKM A;  2Z6Z A;  2WHU A;  3DQJ A;  1KYP A;  3DQD A;  1Z1P A;  4H3N A;  4LQU A;  3CFH A;  2A46 A;  2EMN A;  4N3D A;  5J2O A;  4KF5 C;  5H87 A;  2GW4 B;  1YHG A;  3SVE A;  3DQ3 A;  2DUI A;  4W6H A;  1JC1 A;  3UG0 A;  4W6C A;  3SSY A;  5HGE A;  5T3I A;  3EK7 A;  5DTL A;  3AI5 A;  1XQM A;  3ADF A;  1KP5 A;  2A50 B;  2HQK A;  3U0M A;  3LF4 B;  4RYW A;  2WIS A;  3LVC A;  2YE0 A;  3DQH A;  5EBJ A;  4OGS A;  2JAD A;  2A53 B;  2B3P A;  1EMC A;  3ST0 A;  3ZTF A;  2VAD A;  5BT0 A;  1QY3 A;  2FL1 A;  1EMM A;  3SG6 A;  2G2S B;  4J88 A;  4IZN A;  3U8C A;  3GB3 A;  3EVR A;  4JEO A;  4HQ8 A;  3ZUJ A;  4RTC A;  3DQ2 A;  3E5V A;  2P4M A;  1GFL A;  2DUE A;  5HZS A;  1MYW A;  4Q9X A;  2YFP A;  4EDS A;  4B5Y A;  4W6N A;  4EDO A;  2HGD A;  5DRF A;  3SSH A;  2DD9 A;  2GW3 A;  3SVS A;  3ZUL A;  3O78 A;  1B9C A;  4PPK A;  3ST4 A;  2AWK A;  4W6I A;  3EVU A;  4KW8 A;  3O77 A;  4DKN A;  3ST3 A;  2VVI A;  2OTE A;  1KYS A;  1QYF A;  4DXQ A;  3DPZ A;  2VVJ A;  3PJ7 A;  4R6B A;  3OGO A;  1YJF A;  4W6A A;  1EMA A;  5DPG A;  2WSN A;  2G3O A;  4W7R A;  1H4U A;  2AWJ A;  3U8P A;  1Q4E A;  5BTT A;  4KF5 A;  1RMP A;  1YFP A;  3TMT A;  4W6B A;  3GL4 A;  5BQL A;  4XGY A;  1XSS A;  4W72 A;  1EMK A;  2QRF A;  1YHI A;  4P1Q A;  3NF0 A;  2WUR A;  3E5T A;  5DRG A;  3LSA A;  1G7K A;  1F09 A;  3PJB A;  1ZUX A;  4XVP A;  4XOV A;  4W7C A;  5DTY A;  4W74 A;  1OXD A;  2DDD A;  2C9J A;  1OXE A;  1Q4D A;  4J89 A;  1RMM A;  5H88 A;  4P76 A;  3SVO A;  5DU0 A;  1W7T A;  4KF4 A;  5EB6 A;  3SVN A;  2OJK A;  5EXC I;  3LF3 A;  5EJU A;  3TMR A;  1XA9 A;  3IR8 A;  1RMO A;  3P8U A;  4LJD C;  4H48 A;  5DTZ A;  4OJ0 A;  3PJ5 A;  4W6F A;  3P28 A;  1GL4 A;  1Q4A A;  1Q4C A;  3DQI A;  4TZA A;  3EKJ A;  2V4E A;  3DQU A;  1W7S A;  4J8A A;  3SSL A;  3K1K A;  3S05 A;  5LK4 A;  2QLE A;  4KGE A;  3DQ5 A;  3SSP A;  3ZUF A;  3BX9 A;  3GEX A;  1EMB A;  1KYR A;  3DQN A;  2Z6Y A;  1F0B A;  2AWM A;  4KEX A;  2ZO6 A;  3RWA A;  1XMZ A;  1QYO A;  3OSQ A;  5DQM A;  1ZGQ A;  3CD1 A;  4W69 A;  4EN1 A;  3KCT A;  2HFC A;  4AR7 A;  4GOB A;  4KW9 A;  2WIQ A;  4GF6 B;  2G6E A;  1QYQ A;  3SVB A;  1ZGP A;  3DQL A;  3PIB A;  3DQO A;  4DXP A;  4IK4 A;  1YZW A;  2H8Q A;  2ARL A;  3ST2 A;  2B3Q A;  4OHS A;  3IP2 A;  1EMG A;  3EKH A;  4IK5 A;  4L12 A;  4W7X A;  3NT9 A;  3DQ1 A;  2O24 A;  3SG7 A;  3DPW A;  5FHV A;  3W1D A;  2EMD A;  3NED A;  2QZ0 A;  2O2B A;  3DQK A;  4W6K A;  5LTQ A;  3BXA A;  4H3L A;  1CV7 A;  3SG2 A;  4W6O A;  2IB6 A;  2POX A;  2QLH A;  3U0N A;  2A54 B;  2V4E C;  4IK1 A;  4DXM A;  2AH8 A;  3NT3 A;  2H5Q A;  3MGF A;  2H5P A;  4W6P A;  4W76 A;  3UFZ A;  4W7E A;  4ZF3 A;  5LTP A;  2HQZ A;  4LJD A;  2FZU A;  3NEZ A;  5HW9 A;  4AS8 A;  4OY4 A;  3DQ8 A;  4LW5 A;  1C4F A;  4KA9 A;  3LVA A;  3DQ9 A;  1GGX A;  1S6Z A;  4EUL A;  5BTT B;  4HQC A;  2QLG A;  5FVG A;  4XL5 A;  1EMF A;  2RH7 A;  1Z1Q A;  4IK3 A;  3WLC A;  3SVU A;  2H6V A;  4PPJ A;  4W6R A;  4W73 A;  5EXU A;  3CFF A;  2VAE A;  5DPJ A;  3LA1 A;  2ICR A;  4Z4K A;  5LTR A;  3U0L A;  4ZIO A;  3EK8 A;  4KPI A;  5H89 A;  4JF9 A;  3ED8 A;  5KTG A;  2ZMW A;  5FVF A;  2A47 A;  4DXO A;  1HCJ A;  4RYS A;  3VHT A;  2GX2 A;  4W7D A;  4Z4M A;  3VK1 A;  2WHS A;  4NWS A;  1JC0 A;  4I2Y A;  4LQT A;  1QXT A;  4HQ9 A;  2QU1 A;  3M24 A;  3CD9 A;  4ANJ A;  4W75 A;  4KW4 A;  2WHT A;  2H5R A;  3DQ7 A;  4HVF A;  5HZU A;  3EVV A;  1JBY A;  2G3D B;  5F9G A; 
#chains in the Genus database with same CATH homology
 2IE2 A;  4U2V A;  2V4E B;  5DQB A;  4B30 A;  4B30 B;  1EME A;  2HPW A;  4Q9W A;  3U8A A;  4OQW A;  2C9I A;  1MOV A;  1MOU A;  1H6R A;  3LS3 A;  2IOV A;  1YJ2 A;  3SSK A;  2G6X A;  2Z1O A;  2FWQ A;  2PXS A;  4JRB A;  3AKO A;  2H5O A;  1Q73 A;  4HE4 A;  3CBE A;  2Z6X A;  2A56 B;  3DQC A;  3WLD A;  2DUH A;  2YDZ A;  3BXB A;  4ZB1 A;  4H3M A;  2HGY A;  2WSO A;  4LJC A;  1XAE A;  3CGL A;  2DUG A;  4W6G A;  2YE1 A;  3H1O A;  4L1I A;  4W6D A;  4ZBL A;  4KAG A;  5EHU A;  3RWT A;  4R6D A;  2OTB A;  2A52 B;  3KCS A;  2PXW A;  3LVD A;  4W6L A;  3WCK A;  5DPI A;  3SVD A;  1RM9 A;  5DPH A;  4TZG A;  3SS0 A;  1RRX A;  4Q7R A;  3SRY A;  1BFP A;  2DUF A;  4H47 A;  4XOW A;  1Q4B A;  4L13 A;  2VVH A;  2QT2 A;  3SV5 A;  1JBZ A;  2Q57 A;  2G6Y A;  2HJO A;  3SVR A;  3SG4 A;  4KGF A;  2G5Z B;  2OKW A;  2G16 B;  1OXF A;  2ZMU A;  4IK9 A;  4W77 A;  4GES B;  3DQF A;  3W1C A;  3DQE A;  4W7F A;  2OKY A;  3E5W A;  5FVI A;  4DXI A;  5HBD A;  2VZX A;  3EVP A;  4W6U A;  3DQ4 A;  3CFA A;  4Q7T A;  2QLG B;  4W6S A;  2EMO A;  2HRS A;  3GJ1 A;  4JFG A;  2AHA A;  4ZFS A;  2BTJ A;  3SST A;  3H1R A;  3BXC A;  3GJ2 A;  2O29 A;  3SVC A;  4JC2 A;  3G9A A;  4ZF4 A;  3U0K A;  4ZIN A;  2DD7 A;  2Q6P A;  3SSV A;  4W6J A;  2OGR A;  2GX0 A;  5DY6 A;  4ORN A;  1EML A;  4W6T A;  4UTS A;  3OSR A;  5DTX A;  3M22 A;  2AWL A;  3SG5 A;  2IB5 A;  1YHH A;  4DXN A;  4PPL A;  3VHT B;  1HUY A;  5HZT A;  3DQM A;  2DDC A;  4W6M A;  5AQB B;  1ZGO A;  4IK8 A;  2Y0G A;  3AI4 A;  3SG3 A;  3VIC A;  4LJB A;  4Q7U A;  3CB9 A;  5HZO A;  4W7A A;  4ZF5 A;  2ZO7 A;  5EXB A;  1UIS A;  3I19 A;  4BDU A;  3A8S A;  4EMQ A;  5EB7 A;  1W7U A;  2QLI A;  2A48 A;  3DQA A;  3DQ6 A;  4JGE A;  3DPX A;  2HCG A;  3V3D A;  4PFE A;  2H9W A;  3EK4 A;  4DKM A;  2Z6Z A;  2WHU A;  3DQJ A;  1KYP A;  3DQD A;  1Z1P A;  4H3N A;  4LQU A;  3CFH A;  2A46 A;  2EMN A;  4N3D A;  5J2O A;  4KF5 C;  5H87 A;  2GW4 B;  1YHG A;  3SVE A;  3DQ3 A;  2DUI A;  4W6H A;  1JC1 A;  3UG0 A;  4W6C A;  3SSY A;  5HGE A;  5T3I A;  3EK7 A;  5DTL A;  3AI5 A;  1XQM A;  3ADF A;  1KP5 A;  2A50 B;  2HQK A;  3U0M A;  3LF4 B;  4RYW A;  2WIS A;  3LVC A;  2YE0 A;  3DQH A;  5EBJ A;  4OGS A;  2JAD A;  2A53 B;  2B3P A;  1EMC A;  3ST0 A;  3ZTF A;  2VAD A;  5BT0 A;  1QY3 A;  2FL1 A;  1EMM A;  3SG6 A;  2G2S B;  4J88 A;  4IZN A;  3U8C A;  3GB3 A;  3EVR A;  4JEO A;  4HQ8 A;  3ZUJ A;  4RTC A;  3DQ2 A;  3E5V A;  2P4M A;  1GFL A;  2DUE A;  5HZS A;  1MYW A;  4Q9X A;  2YFP A;  4EDS A;  4B5Y A;  4W6N A;  4EDO A;  2HGD A;  5DRF A;  3SSH A;  2DD9 A;  2GW3 A;  3SVS A;  3ZUL A;  3O78 A;  1B9C A;  4PPK A;  3ST4 A;  2AWK A;  4W6I A;  3EVU A;  4KW8 A;  3O77 A;  4DKN A;  3ST3 A;  2VVI A;  2OTE A;  1KYS A;  1QYF A;  4DXQ A;  3DPZ A;  2VVJ A;  3PJ7 A;  4R6B A;  3OGO A;  1YJF A;  4W6A A;  1EMA A;  5DPG A;  2WSN A;  2G3O A;  4W7R A;  1H4U A;  2AWJ A;  3U8P A;  1Q4E A;  5BTT A;  4KF5 A;  1RMP A;  1YFP A;  3TMT A;  4W6B A;  3GL4 A;  5BQL A;  4XGY A;  1XSS A;  4W72 A;  1EMK A;  2QRF A;  1YHI A;  4P1Q A;  3NF0 A;  2WUR A;  3E5T A;  5DRG A;  3LSA A;  1G7K A;  1F09 A;  3PJB A;  1ZUX A;  4XVP A;  4XOV A;  4W7C A;  5DTY A;  4W74 A;  1OXD A;  2DDD A;  2C9J A;  1OXE A;  1Q4D A;  4J89 A;  1RMM A;  5H88 A;  4P76 A;  3SVO A;  5DU0 A;  1W7T A;  4KF4 A;  5EB6 A;  3SVN A;  2OJK A;  5EXC I;  3LF3 A;  5EJU A;  3TMR A;  1XA9 A;  3IR8 A;  1RMO A;  3P8U A;  4LJD C;  4H48 A;  5DTZ A;  4OJ0 A;  3PJ5 A;  4W6F A;  3P28 A;  1GL4 A;  1Q4A A;  1Q4C A;  3DQI A;  4TZA A;  3EKJ A;  2V4E A;  3DQU A;  1W7S A;  4J8A A;  3SSL A;  3K1K A;  3S05 A;  5LK4 A;  2QLE A;  4KGE A;  3DQ5 A;  3SSP A;  3ZUF A;  3BX9 A;  3GEX A;  1EMB A;  1KYR A;  3DQN A;  2Z6Y A;  1F0B A;  2AWM A;  4KEX A;  2ZO6 A;  3RWA A;  1XMZ A;  1QYO A;  3OSQ A;  5DQM A;  1ZGQ A;  3CD1 A;  4W69 A;  4EN1 A;  3KCT A;  2HFC A;  4AR7 A;  4GOB A;  4KW9 A;  2WIQ A;  4GF6 B;  2G6E A;  1QYQ A;  3SVB A;  1ZGP A;  3DQL A;  3PIB A;  3DQO A;  4DXP A;  4IK4 A;  1YZW A;  2H8Q A;  2ARL A;  3ST2 A;  2B3Q A;  4OHS A;  3IP2 A;  1EMG A;  3EKH A;  4IK5 A;  4L12 A;  4W7X A;  3NT9 A;  3DQ1 A;  2O24 A;  3SG7 A;  3DPW A;  5FHV A;  3W1D A;  2EMD A;  3NED A;  2QZ0 A;  2O2B A;  3DQK A;  4W6K A;  5LTQ A;  3BXA A;  4H3L A;  1CV7 A;  3SG2 A;  4W6O A;  2IB6 A;  2POX A;  2QLH A;  3U0N A;  2A54 B;  2V4E C;  4IK1 A;  4DXM A;  2AH8 A;  3NT3 A;  2H5Q A;  3MGF A;  2H5P A;  4W6P A;  4W76 A;  3UFZ A;  4W7E A;  4ZF3 A;  5LTP A;  2HQZ A;  4LJD A;  2FZU A;  3NEZ A;  5HW9 A;  4AS8 A;  4OY4 A;  3DQ8 A;  4LW5 A;  1C4F A;  4KA9 A;  3LVA A;  3DQ9 A;  1GGX A;  1S6Z A;  4EUL A;  5BTT B;  4HQC A;  2QLG A;  5FVG A;  4XL5 A;  1EMF A;  2RH7 A;  1Z1Q A;  4IK3 A;  3WLC A;  3SVU A;  2H6V A;  4PPJ A;  4W6R A;  4W73 A;  5EXU A;  3CFF A;  2VAE A;  5DPJ A;  3LA1 A;  2ICR A;  4Z4K A;  5LTR A;  3U0L A;  4ZIO A;  3EK8 A;  4KPI A;  5H89 A;  4JF9 A;  3ED8 A;  5KTG A;  2ZMW A;  5FVF A;  2A47 A;  4DXO A;  1HCJ A;  4RYS A;  3VHT A;  2GX2 A;  4W7D A;  4Z4M A;  3VK1 A;  2WHS A;  4NWS A;  1JC0 A;  4I2Y A;  4LQT A;  1QXT A;  4HQ9 A;  2QU1 A;  3M24 A;  3CD9 A;  4ANJ A;  4W75 A;  4KW4 A;  2WHT A;  2H5R A;  3DQ7 A;  4HVF A;  5HZU A;  3EVV A;  1JBY A;  2G3D B;  5F9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...