3ZV6A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb) from pandoraea pnomenusa strain b-356 complex with co-enzyme nad and product analog 4,4'-dihydroxybiphenyl
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
275
structure length
275
Chain Sequence
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTDLRGPSSLGLSEQSISSVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Oxidoreductase
total genus 96
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zv6A00
1YL5A 1LU9A 1M66A 2H63A 3K73O 1IE3A 1XG5A 1HLDA 2D0IA 4RF5A 5AYVA 1KVRA 1X0VA 3H5RA 1GAEO 1GEEA 1UXHA 1B8VA 1YQDA 1ZXLA 5KWEA 1JWAB 4CM9D 1GR0A 2DTDA 2WEKA 3V2HA 2O3UA 1KIFA 1UXIA 4LN1A 3GDFA 2AA3A 4NJMB 3EVNA 3ZWVA 1Q7CA 2Y0CA 3RSHA 4JBGA 3V5NA 1NPDA 4CMAA 1PGJA 3AUAA 4KDFA 1LNQA 2VCYA 1LQTA 3X2FA 1V3UA 5THKA 4CLOB 1EVZA 3ONFA 4XYLA 1E1MA 1JTVA 3GY0A 3ZHYA 3TOZA 2B4TO 4L4RA 4PRLA 5CG2A 4CQMD 3HWRA 5A4DA 4R5HA 2QW8A 3LZ6A 4FC7A 1UDBA 3D3EA 5B4VA 2E82A 1XR3A 4KUHA 5EPOA 4M8SA 2ZK7A 4FB5A 2V6MA 3JQFC 2CSUA 1PZHA 4YQZA 4QTZA 2VT3A 1MV8A 1S6YA 1N8KA 4TVOA 2Y05A 3LC1O 5AXBA 2IZZA 3JQ7A 3KETA 2NV6A 4HY3A 3U4IA 5TF4A 2NU7A 4BVAA 1XQ1A 3HADA 2PH3A 2UDPA 4YB8A 4RPGA 3U62A 1ORRA 3CPSA 3WSVA 1J5PA 3U09A 1NQTA 4F46A 4YJHB 4XJSA 2O3TA 1Z82A 3JCZA 4BNJA 3C1OA 3FNEA 3OJEA 3W8DA 4Z3DA 4GX1A 5IF3A 3H9UA 1NX6A 1A7KA 1IB6A 2X9GA 4BS9A 3RBVA 4IDDA 2QYTA 4YRBA 2WJPA 1ZUD1 1B15A 1TI7A 1G0OA 4OQYA 2BHLA 1PL6A 1VJTA 4I5GA 1TA4A 2PKQP 4H3VA 1ZEMA 1V3TA 4G2NA 4E6PA 4YAKA 4OSPA 3AOGA 5DNAA 1GYPA 4HBGA 4R16A 2AW5A 3GFBA 3D3WB 4ALLA 3I9LA 1P74A 3T7EA 1U3UA 1NFRA 1X0XA 2P9EA 5L53A 2JD0A 4OM8A 4WOJA 5A3VA 4CV2A 2FR1A 1SNYA 1Y9AA 2CF6A 1PGOA 4M89A 4CLRA 4ALKA 4W99A 3V1YA 1YDWA 3L07A 1EQUA 1AE1A 3CIFA 3M1AA 2EG9A 4HFMA 4TSKA 1VKOA 2C2YA 1BXGB 3HFGA 1ZH8A 3BHMA 1HEUA 2B69A 5GZ1A 4K6CA 3DAPA 4P4GA 3A9WA 5HA5A 5JAQA 3PJEA 1DIHA 4CM9A 4N5MA 4B4UA 1EMDA 1EUZA 2RH8A 4JN6B 4DLAA 2B4RO 3ICPA 1ZXBA 2OP1A 4HXYA 3TSCA 5IDWA 2J5QA 3ZWNA 3COSA 1KVTA 3VZRA 3K92A 4D3SA 2QG4A 1YQXA 3NUGA 1LEHA 8LDHA 5HM8A 3BZUA 4CM6A 1P1JA 2QZZA 1YOVA 3JQ7B 4E4YA 2HK9A 1UZMA 1NNUA 5JS6A 2J8ZA 2CZCA 4ROSA 2NU8A 5ILGA 1HKUA 1NAIA 5EESA 3JQGB 2A35A 3GDOA 2AQIA 5DCUA 4ZVVA 3DMTC 2DPHA 4GQAA 5I7FA 2ZKLA 1PZGA 4RGBA 3H5NA 3P19A 1YRLA 2VYND 5JO0A 2VRCA 1H9BA 1U28A 3OQ1A 3EMKA 4KTTE 3OH8A 4GPD1 2PV7A 2GD1O 1PWXA 3L4BA 4DLLA 4OXYA 3PWSA 4WLNA 1YL6A 2PK3A 4PLVA 2BRUA 4BIIA 1UJMA 5DBGA 1I5RA 1KYQA 4NDNE 2IZ1A 4IJWA 3JSAA 2ILTA 9LDBA 3K6JA 5LC1A 4AJPA 4RV9A 1R16A 4ALJA 1HDCA 2Y93A 3PDUA 4YRAA 2WDZA 3RKUA 4HX5A 4CLDA 1ZSYA 3BMCA 3FR7A 3LC2O 3QE3A 4BO8A 3DMYA 1VC2A 3EUWA 4XGNA 3LF1A 5H82A 2O4UX 4G81A 2G0TA 1LLUA 3BXXA 4BHTA 3GVIA 1WNTA 4Z9FA 3WGIA 3RFTA 3E9MA 2Q45A 1PTJA 3DOJA 3S2EA 3ZW9A 2QX7A 2Q2QA 4IINA 5A05A 4Y6RA 1F8FA 1HZJA 3GZNA 1KC1A 4XX0A 1GYRA 1DHTA 1EE2A 3OECA 3OF2A 1XKQA 3GVXA 4MPDA 3N74A 5JW6A 5L7YA 1YKFA 2BGLA 4DC1A 1LXCA 4ZU3A 3RC2A 2GRAA 1DFHA 2EJVA 1GL3A 5LCXA 1LRKA 2X23A 4Y67A 5L7TA 2VUSA 1XEAA 1MXFA 4B7XA 2GGSA 4YTEA 2EKPA 3H9EO 1YOVB 4OJNA 4E3ZA 2VWGA 4A7PA 5L9AA 2ZTMA 1H5QA 4R1UA 4QSMA 4BKPA 3LT1A 3OIDA 1H6CA 4BKRA 1DHRA 4EITA 2DM6A 1U5AA 4XR4A 4HFJA 3F47A 3GNSA 3GLQA 5DOZA 1HE3A 1T2DA 3WOHA 1I0ZA 2J3HA 1R0KA 4LRTB 3ASUA 4AJKA 4W6ZA 3W4JA 5GMOA 4RPLA 1SAYA 1I3LA 3FNGA 4QX6A 5T57A 4F3YA 2FR8A 4KTVE 4UVGA 2OBYA 4YQYA 2PY6A 1BXZA 1GCOA 5LDHA 1GPDG 2G17A 2AE2A 3IKVA 4MP3A 2OL4A 3TPCA 3UXYA 2DBZA 3BTSA 4WK6A 4XIJA 1A4UA 3I23A 3WGHA 4DBVO 3F6YA 3IJRA 3DTYA 4U0JA 4DQVA 3E82A 3ADPA 2FSSA 4B3IA 1NR1A 1QV6A 3C8MA 4DPKA 1C1DB 3TZCA 4E32A 4GL4A 1V0JA 5CPBA 5GY7A 4YWJA 1GZ6A 4OXNA 3RUHA 1XGKA 3D5TA 1XQ6A 3R6DA 1RWBA 4R1SA 3UAGA 8ADHA 4GWGA 3PTZA 2YQ5A 2FOIA 2ZB7A 2O7QA 2V6BA 1OFGA 3WNQA 5EIOA 4KWIA 1HDYA 3DTTA 4B3JA 3C85A 3MJSA 3V8BA 3IMFA 2WMDA 1EE9A 3VDQA 3HJAA 4D79A 3JYQA 4JLWA 1ENYA 5CEEA 2V6FA 2VHZA 1I2BA 1U3TA 3GMSA 3GZNB 3R0IA 1H6AA 3UICA 4FFRA 2Y0EA 1BSVA 4TRMA 4BKQA 5K6AC 3MWEB 4E2ZA 1QYDA 1RYDA 3DOCA 1GU7A 1Y7TA 1H93A 3GRPA 4J16A 4E12A 4YJGB 4XJTA 3BMOA 3INRA 2WYWA 4YEDA 3GMDA 2GN4A 4GVLA 4B8WA 5TIIA 4LW8A 3DHNA 2XXJA 3ROPA 3EZLA 1JA9A 4LCEA 1LSOA 1DB3A 1T4BA 2I66A 1DO8A 3AM4A 5TRTA 3AWDA 3PJDA 1EVYA 2E4AA 2YHIB 3JQ6A 3IL2A 1HDOA 4IIVA 1Q0QA 4MJLA 3ZWAA 1RYEA 2RCYA 1ARZA 3P7MA 2Q1WA 3D0OA 4MVJF 1E7RA 2WM3A 4OKIA 4PLGA 2YYYA 3RUFA 3PHHA 2GDZA 2RBEA 4YAEA 1I32A 1FDTA 1KBZA 3L77A 4A2CA 1C0PA 1GCUA 1O6ZA 4TRJA 4U0KA 4GI2A 1DXYA 3DFZA 3AU8A 1GQQA 4A03A 5ITVA 5JLAA 1C0KA 3L4SO 5B12A 3CMMA 4TKLA 5IDYA 3GK3A 3KXDA 4YT5A 1XCBA 2E6UX 4XYEA 2JFFA 5JO9A 4J2HA 3VZSA 1MC5A 2AG8A 3FPCA 1ISIA 4TKMA 1KY5A 5KVCA 1CQIA 3JV7A 3D7LA 3BAZA 2C59A 5A9SB 4CMIB 1HSOA 1HE2A 1LDMA 1ZW1A 4ID9A 3RAJA 4CJXA 2R6JA 2NVWA 2GYYA 2HMWA 3Q2IA 4XDZA 1U4OA 3QVWA 3PYXA 1E7YA 4YAJA 1B8PA 4WCFC 4QXMA 5TLSA 4TVBA 3U0BA 1Y8QA 2G1UA 4L0QA 3OEYA 3JQFA 4DXHA 4RDHA 4G65A 3F3SA 4A10A 2AXQA 5DULA 1AHHA 4BNWA 5KVSA 3INTA 5AQ1A 1PL7A 4B4WA 2GERA 2PKQO 3D4NA 4CLEA 1R15A 5F1KA 1SC6A 4PZDA 2OUIA 1V9LA 3RCBA 4YT2A 3L6DA 4GGPA 4IM7A 1KETA 1MFZA 1S7CA 1HLPA 4IQ0A 3WJAA 3U4CA 1DC6A 1QRRA 5KVVA 3X2EA 3KZVA 5T8KC 5G0VA 4UUMA 3RJ9A 3OM9A 3ZWYA 4BL5A 5ICSA 3PGXA 3C1TA 5FF9A 3S55A 3ITKA 3MJ4A 1HYGA 3KUXA 5FFFA 3TZKA 4RVSA 1ADFA 1AN9A 4BB5A 3SJ7A 1WW8A 1QG6A 1N7GA 4FCCA 4N5NA 4R1NA 3RWBA 3ZHXA 3RROA 1VJ0A 3DBRB 1GQYA 4EEXA 5KJ1A 2ZYAA 2WD7A 3D1LA 1R4NA 2BF7A 3KYDA 4Y98A 4ONEA 1U2DA 2DBVO 4BNHA 1DPGA 9LDTA 1FDWA 2OFPA 1U5CA 3G17A 3WFIA 4MVJP 4IMRA 4PLPA 3CXRA 1NXQA 3WYEA 1P77A 5A02A 3I52A 3VH1A 4RZHA 1N9GA 2W98A 1ZFNA 2O3QA 4KQXA 4R54A 3LT4A 5IJZA 4B7CA 4ZGWA 2IXAA 4I5FA 4JBHA 1LSJA 5EJ2A 4J4TA 4F45A 1DLIA 2HMSA 2NTJA 3EC7A 4AFNA 3P5SA 1VJ1A 1X7DA 3IP3A 4NJOA 2BI7A 2IRWA 3U49A 4XR9A 1Q2XA 3KM0A 5BNTA 4NU6A 3RIHA 4N7RA 1DC3A 5G0TA 5A9SA 2WWRA 1Y8QB 3UH1A 4RJTA 2YZ7A 3JQAB 1X7HA 4WPGA 2J3JA 5CP8A 2NVUA 1KC3A 1R6DA 2JCYA 3B20A 3CINA 2X0JA 3L0DA 3ASVA 5GZ3A 2P68A 3L6OO 1BXKA 3FCOA 4KOAA 2X58A 2B5WA 2H5LA 1ENPA 5FWNA 1ZKMA 2NVBA 1YQGA 1SEPA 3UOGA 4YACA 1QP8A 2ZJ1A 3U4DA 1N5DA 1E3IA 2BFAA 4QUKA 1DAOA 3VH3A 4YVFA 2VNSA 2Y1FA 3WGGA 4WLVA 4CQLA 3ORFA 4AJ1A 4BB6A 4URFA 3GEDA 3QIVA 1GV1A 4KMSA 3A06A 3AY6A 5DP1A 3TN7A 3ROKA 1GUYA 4KZPA 3GUYA 3LYLA 5JCXA 2E49A 5ITWA 2O2YA 1AXEA 3M2PA 3N7UA 4NMHA 4CUJA 1A72A 2XPCA 2HRBA 4ND4A 1P1HA 4JJIA 4O1MA 3WGZA 3IQDB 4J1SA 1KEPA 4KP7A 4JK3A 1C1XB 4ILKA 1FDUA 3QY9A 3OQBA 2WD7B 5EERA 1R4NB 2Y66A 1P1RA 3G49A 4PG5A 2G82A 2EGHA 1YBVA 2TMDA 4QQRA 4YPOA 3DOOA 3LDHA 3I6QA 1QXSA 1QR6A 2BFOA 4E33A 2QRJA 3INGA 1M6WA 3AFNA 1DFGA 4U6SA 3F1LA 2X8LA 1I8TA 3PJFA 4R5MA 1P44A 4D42A 3NDRA 4BO4A 3FBTA 3WBBA 5KVQA 1BWSA 4NK4A 3KV3O 1J0XO 2CF5A 1Y8RA 2ZTLA 1UH5A 1M67A 4D44A 1MLDA 5FYDA 1GFSA 3RI3A 4YR9A 2VOEA 1ZJYA 3DO5A 3QHAA 1VRWA 3ZNNA 1QSGA 3SX2A 1HT0A 1B2LA 2C7GA 3DAFA 4FR5A 4I5DA 4BV8A 4I8XA 1QORA 3EY4A 3WG9A 4GVXA 4I9HA 5C3MA 4NJMA 5BQFA 4YAGA 1F06A 2NM0A 4WCDA 2AEMA 3EGOA 3KYCB 4GKBA 2J3KA 1XU7A 4Q39A 5KTKA 3VKVA 4CLOA 1SEVA 2EKQA 2G76A 2NVUB 5JC1A 3TDKA 3OEWA 3ANMA 4W7HA 4EDFA 1NHWA 1BHSA 2JJYA 3DL2A 3HE3A 1LSUA 4IY1A 2O3RA 2FSVA 2GO1A 3ZWMA 4ESOA 4UUNA 4R51A 1VPDA 4J6FA 1ZK2A 1O8CA 1IHYA 1YWGO 5IXYA 1SOWA 1Z7EA 3OICA 1V6AA 1RJWA 4QO7A 2ZYDA 1NFQA 3FTPA 2WSBA 4AJHA 2PWZA 4MP6A 4PLWA 4K28A 1V8BA 4AJNA 4OQZA 4EBFA 1G6KA 2QRKA 4CUKA 1YBAA 1QLHA 4CM7A 1YJQA 3NJ8A 1GZ4A 1HE4A 2DVMA 3CZMA 4MOWA 2AQ8A 4R9RA 3CTMA 1FDSA 3NT2A 2PA3A 1WDMA 3FNHA 4BOYA 3ZV3A 2HUNA 2WE7A 4YJHA 3FR8A 2EP5A 3V2GA 1GQ2A 1EBFA 4C4OA 1UDAA 1D3AA 1PJLA 4DYDA 1O89A 4FOOA 4FSHA 4WKGA 4DBZA 2JD1A 3DDNA 3ZWXA 1SOVA 1Y8RB 3MJCA 4MINA 3TRIA 4IXWA 1MA0A 4KUGA 4PFJA 3DHYA 1PQWA 4PG4A 4JROA 3NT5A 1F0YA 2Q49A 1D4FA 3EVTA 1ONOA 3QQPA 2JCXA 2AG5A 3MOGA 3ZZNA 1P0FA 4D7AA 5K6AA 3PRJA 1LLDA 7MDHA 3LQFA 3JD2A 4JXKA 4BNFA 2GSDA 1CIVA 1H6DA 3NGLA 4G5HA 3D3WA 3KOUA 3HDYA 1ZK1A 2DTXA 4RPJA 3UGKA 5JY1A 3C24A 3K31A 3ZWCA 2YDXA 1ZMTA 2PKRA 4KDEA 3K96A 2BFPA 4PIVA 5AXAA 3RU7A 3TF5A 1X1TA 4IIUA 3ZDFA 3K5PA 1OMOA 1WVGA 3OP4A 4DWVA 2HMTA 1BXGA 1E6WA 3SJUA 1Q7BA 4QEDA 3ULKA 2BKAA 5HS6A 3EZYA 3U9LA 4B4OA 1NFFA 1B3BA 4WGGA 4FN4A 2VRCD 4GWKA 5AOVA 4CM4B 4Q3AA 5DN9A 4E2WA 4IJKA 2I76A 3W4KA 1T2AA 3E48A 4WNCA 1NQ5A 1EVIA 2B35A 4O63O 3WS7A 1CJCA 4R9SA 2POQX 1P0CA 1UZNA 3RFXA 4TRRA 2NTNA 3WYCA 3JD4A 4GSLA 3UHAA 3PQDA 3JQGA 1H94A 1LRJA 3ZW8A 1LC3A 2VNAA 3AJRA 3I4FA 4BO6A 2D2IA 4FIZA 3CZRA 1SZJG 1E7SA 3BIOA 4E2YA 2B36A 4EJ0A 1DRWA 2P5YA 3RBZA 4N5LA 4OAQA 1GD1O 3G79A 4NBVA 4YCAA 3R1IA 4FJ2A 1EEHA 3JD1A 2X0RA 4XWYA 1ONPA 3WBFA 1IPEA 4OKNA 4PG8A 1QKIA 4M87A 4R4JA 1I01A 4WCFA 3EYWA 4KWHA 4PG7A 3DR3A 3KEOA 3CH6A 1T1RA 4HNHA 1L7EA 4FGWA 1IL0A 1CQJA 1YS4A 4R3WA 3GPDG 3S2IA 1MX3A 1DIGA 2B4QA 1XDWA 4BNYA 4Q3DA 4X54A 3H9JA 1FDVA 4DTIA 5JAZA 1E92A 4U8GA 3SEFA 1PJBA 1ZCJA 4ND1A 3ITDA 1LDGA 3KSUA 4EW6A 4J9VA 4AJOA 4AICA 3ZV5A 3H2ZA 3RUDA 4M1QA 4MIEA 4OYRA 2FN7A 4ZRMA 5T8KA 2VHXA 2VWQA 4DVJA 4PRKA 1QV7A 1MP0A 2EKLA 1LI4A 4ZRNA 2E48A 1FF9A 4CM1A 3HB5X 2C2XA 1NVMB 4Z9YA 4EGFA 1I30A 3QW2A 4CODB 1MG5A 3SXPA 3DZIA 2Y1EA 5DCWA 2X0IA 1YDEA 1YBMA 4H16A 5EL0A 4BV9A 2GNAA 4UULA 3N58A 4TMFA 4II2A 5G2OA 4PG6A 4RVFA 2CVQA 3AUTA 3DBVO 2UAGA 3ABIA 3HNPA 2GPTA 2YW9A 4R3NA 5FI5A 3BMNA 3WYBA 1MB4A 4FW8A 4HFNA 4J1NA 1J49A 1TB4A 4WUVA 4IGFA 4CV3A 1B3RA 1RPNA 4BKUA 3U5TA 3WLEA 4GAEA 4RPHA 4W7IA 4ITUA 1KOLA 3F5SA 4J90A 4BQPA 4BNXA 4YXFA 7ADHA 1IOLA 1HDXA 1WP4A 2HMVA 5DOVA 3GDGA 1ZK3A 2PGLA 1VSVA 3GC6A 2IXBA 2VTEA 4LCJA 4WCFB 5JSFA 1TLTA 2FHSA 3OIGA 2Q50A 2C20A 2ZTUA 4FD3A 1ZK0A 4NFSA 4MIYA 5TC4A 2DU8A 2XOXA 3D64A 4J0EA 4QFCA 2D4AA 4IDAA 3ZWPA 1YXMA 1EK5A 4NQZA 1PX0A 3WSWA 3OJOA 2E37A 1C1DA 3GEGA 1UAGA 4TQGA 1OZAA 2B83A 4K1LA 1QYXA 1A9ZA 1NWCA 1R66A 5EINA 4MVJA 3C7AA 2IODA 4KUEA 2FWMX 2IYPA 4GGOA 5IZCA 4DC0A 4RVUA 4IDBA 1N2SA 2NADA 2A9FA 2JFHA 3VPXA 3T4EA 1EFLA 4BO0A 5A06A 1PIWA 3WB9A 2X5JO 1E7QA 3AM3A 4J43A 1U4SA 5A9TA 4D46A 3QRWA 3QVXA 1M76A 3KEQA 5CDSA 1YB5A 2QZ9A 3D5QA 3O4RA 5COQA 4EUEA 2X5KO 3L9WA 3E9NA 5IZ4A 1VLLA 1CWUA 4XRGA 4AL4A 2QQ5A 2EGGA 3MZ0A 4XQEA 4MDHA 4YJGA 5AVOA 3WTBA 5U4QA 4N18A 4PZCA 4J49A 3GOHA 1ZK4A 1P45A 4IXTA 2WYUA 3ON5A 3W4IA 2Q2WA 1SCUA 1UXKA 3BMNB 2BFMA 1P1FA 1GEGA 4CR7A 4DQXA 1PR9A 4BO1A 2HAEA 4IBOA 3QA9A 5G0SA 2YHIA 5B4TA 2XF8A 1B16A 5JPIA 3AW9A 4DUPA 1JN0A 2AEJA 3PK0A 4IDCA 3R3SA 2O2SA 1PS8A 1E0DA 4J91A 4PLHA 1C0IA 1O0SA 3G1TA 2OORA 2D3TA 3I9OA 4ZQBA 3RC7A 1Q1NA 1I3MA 4CMGA 4UVHA 3IOYA 4D3FA 3PDJA 2LDXA 3E03A 5ES3A 3RUAA 1PZEA 4IS3A 4A73A 4Z9XA 1DDOA 2GN9A 3QJ5A 4J7XA 4CM5A 3QWFA 3VC7A 1E3EA 5F5NA 3WMXA 4M54A 4EJ6A 1UP7A 1GZ3A 4BQRA 3GQVA 4ND3A 4CMEC 4R69A 3RUCA 3I9JA 4E5NA 2BH9A 4Z3KA 4H15A 4DGSA 2NUAA 1J4AA 3QWAA 2IYOA 5U9CA 4I1IA 1A5ZA 4FFPA 1LDEA 4CMIA 4L74A 3RD5A 4RDIA 2PNFA 3FPLA 1DOHA 4YJFB 3WGYA 3FWNA 4KQWA 4UEJA 2PZKA 1XIVA 4Y9DA 1T26A 1HYEA 2DPGA 2ZATA 2B0JA 2CNBA 3DBHB 3BTOA 3DQPA 5CAEA 2PZLA 4ND2A 3AY7A 1PJ4A 3DEYX 2UVDA 4YDRA 4XKJA 1PZFA 2J3IA 2HCTA 1AXGA 2EERA 4CMHA 2Y1CA 3I4CA 1HL3A 3LU1A 4UREA 4DREA 4DL9A 3K2BA 2EWMA 1OI7A 4YYZA 4QO8A 2C5EA 2HJSA 1IZ9A 2V65A 1NQOA 5A5EA 2J6IA 2UUOA 2O50A 5L4SA 1GDHA 1C3VA 1EUDA 4LVCA 3GZ4A 3OETA 3VHRA 4AJ4A 4BNKA 1LDNA 3MCVA 5A1TA 4BNVA 3DONA 5KJEA 5DDIP 3WXBA 2RAFA 1ONNA 2VOJA 2W2KB 5FEUA 2VYVD 1R0LA 1E1KA 3DBRA 2DFVA 1DLJA 4GMFA 2HSDA 1E3SA 1CYDA 3CKYA 4AJJA 1LSSA 4J0FA 1A9YA 4ZA2A 1MFPA 3PHGA 2NNLD 4HWKA 2EP7A 5L45A 2DC1A 4CLHA 4WEOA 3JD3A 1E6EA 3WICA 2D1YA 3JYLA 5BR7A 3ETEA 1G0NA 3NYWA 3RUEA 5CEJA 5IAAA 3O26A 3HB4X 4J2OA 4OOEA 1BDMA 4S3MA 1GV0A 1G1AA 3KRTA 4W9NC 3WMWA 3GGOA 1JDJA 2Y1GA 3M2TA 5JYEA 4Y6PA 1IPFA 3PQFA 4YJDA 1FMCA 4I9NA 5BNFA 2Q4BA 5DBFA 1DFIA 5CFZA 3KB6A 1GUZA 1A4IA 4XA8A 5U1PA 3I9NA 3VZPA 3WGQA 3K9QO 4E5PA 3H8VA 3JQAA 1ZSNA 4B79A 3F4LA 4O5OA 1VKNA 2ZTVA 2O3SA 4AJ2A 1D1SA 2W2LD 2X9NA 4Q3BA 3SLKA 2RH4A 4NNJA 5ILOA 3PVZA 1JVSA 4IZIA 1GYQA 1I10A 2OHXA 3EAGA 1DC5A 5C5IA 1YE3A 2AMFA 4XYMA 1PGQA 3QWIA 1VI2A 2BMAA 3ZGYA 2H6EA 4P22A 3AI3A 1K6JA 4II3A 4ND5A 2EJWA 3GH3A 5G0UA 3OQ6A 3CMCO 3F1KA 4UUOA 1WZEA 4BMSA 4AJIA 1PEDA 3D4OA 1A71A 1H2HA 1P1KA 3VPGA 4Q3CA 3GVPA 4CM3A 4MO2A 1KEUA 3IAHA 4J7UA 1OBFO 1H6BA 3JQ8B 5F1PA 3AUSA 3VDRA 2PGJA 4PN3A 1U3VA 4WLEA 4IZHA 1MG0A 3OA0A 1IULA 1C1XA 1T2EA 2OOSA 2UYYA 1LA2A 4ZD6A 1YO6A 3LVFO 2HK7A 3UFXA 5EQFA 4D43A 1ZBQA 1JAXA 2FY8A 3SC6A 5KJ6A 5A3JA 3E5MA 3RFVA 5A9RA 4Q3NA 4NPCA 4EJMA 3I83A 4JQCA 1VSUA 2I65A 5BNIA 2EV9A 3DBLB 3PXXA 4UUPA 3OJ0A 2O3JA 2SCUA 4OOFA 1F8GA 5JY6A 1EDZA 1GADO 3CEAA 4MVJE 1RM4A 1ZEJA 3JYOA 3IIEA 4CL8A 4RF4A 2Z1NA 2IDZA 2VYVA 3NJ4A 4RO0A 2GZ1A 2JL1A 4GSKA 2NLOA 4I08A 3WGTA 4AJEA 3NRCA 4K6FA 4XEHA 2VT2A 1WZIA 3AM5A 4R01A 4DIFA 1O94A 1WMBA 4CMBA 3PZBA 3KYCA 1I2CA 1TVEA 2V6GA 3PHJA 5DCYA 5JCJD 1LRLA 2VQ3A 4L73A 4FJ1A 1L7DA 1IUKA 1TT5A 2CDAA 2DUWA 3KSZO 1B8UA 4TROA 2BLLA 4WEQA 4XYGA 3PFWO 3TWOA 2YV2A 2GCGA 5JDCC 5J23A 4CV0A 5C37A 4BO7A 1ISJA 3ZU3A 4PGFA 2Y1OA 1T4DA 4OXKA 2O7SA 4J9UE 2O4CA 1E6UA 4FPXA 1RM3A 2VN8A 3WNVA 5I8WA 3O38A 4UVIA 5ICMA 5IZCC 1DIBA 2A92A 1V35A 3QLJA 1ML3A 4NU5A 4W4TA 3EDMA 1H0KA 5DZSA 4L4SA 5HBRA 1YVEI 5G4LA 4BMVA 5JMPA 2W2LA 1NHGA 3KTDA 3P2YA 3RASA 5MGBA 3UVEA 3E18A 4DMLA 1H9AA 1E7MA 4AJLA 1W6UA 3KBOA 4JX8A 2PLAA 2PZMA 3G0OA 5KNLA 4L75A 4MVJG 1CEQA 3H3JA 3AU9A 4RQTA 1JU9A 1EDOA 1NWHA 5TJ9A 1QYVA 1YB1A 3E8XA 5C7LO 1RM5A 5B1YA 2WD8A 2YDYA 4XGIA 1JKFA 3IUSA 3TZ6A 3RU9A 1E3WA 2DUUA 2HK8A 1XLTA 1ZJZA 2C7VA 4JJFA 4ALIA 1U7TA 1W73A 2WYVA 2ZYGA 3QWHA 1X14A 2BI8A 4TZKA 4BO9A 1DIRA 4DLBA 3MTGA 3ZNQA 2J5RA 3GVCA 4XYBA 5I7VA 4FGSA 4RL6A 2DBQA 3WWYA 4JNKA 4CMJA 1ISHA 1JWBB 1AHIA 3PQEA 1FJHA 3RC9A 3DC2A 4OL9A 3PYMA 4MIOA 3Q9NA 4R41A 4HKTA 5TJHA 5A04A 1VE9A 1TT5B 3E5RA 5GZ6A 1LUAA 1NYTA 1O95A 4E31A 4K26A 1JQBA 4RF2A 2DQ4A 3BMQB 5I7SA 3EK2A 2D5AA 3GNQA 1NVGA 1D7OA 4RQUA 3MJEA 1BVRA 1EK6A 1WPQA 1MGOA 1ID1A 5TT1A 2OP0A 3ZU2A 2UUPA 1WWKA 4IDEA 4J4HA 1PJTA 3GPIA 3JYPA 4CM4A 3NDJA 2HDHA 4HP8A 5JCJA 3ZCXA 2AQHA 3C1AA 3QSGA 3GFGA 4BNNA 2YQ4A 3OSUA 4CR6A 5JDIC 1KVUA 1HWYA 3OIFA 3L9XA 4WASA 3BHJA 4B4VA 2YUTA 4ZHSA 1NAHA 3ICCA 3ENNA 3NX4A 4PVCA 4RVGA 2QRLA 3ST7A 1X7GA 1ZNQO 1BGVA 5DP2A 1LQUA 1ZSVA 4CMEA 2VZ9A 3OA2A 1LDBA 3DZFA 5I9MA 1E3JA 2X22A 3GT0A 1JLLA 5L4LA 2DBRA 4IS2A 3V1TC 3HHPA 2FR0A 4MVJH 3MEQA 4DYVA 1VL6A 4XQCA 4OHUA 4DPMA 1TT7A 2ZCUA 2C0CA 4HNGA 3GHYA 1E3WB 3BYZA 1KS9A 3ZHBA 4A26A 2HKIA 3WDSA 3VH4A 4ZQEA 4Z0HO 3TFQA 3NTOA 3ZV4A 4FJ0A 3MTJA 1PR3A 2PGDA 3CUKA 1UDCA 1PJCA 2PFGA 3P2OA 1JKIA 3UCXA 2B5VA 1MXHA 5COAA 5BSHA 4XCVA 4FC6A 3QVTA 4ALMA 4WJZA 4CLXA 3RQSA 2X86A 1NASA 5CHEA 1DJQA 3OFSA 2PZJA 1UXJA 4E13A 3ZNOA 1SB9A 1E3LA 2PH5A 2ZCVA 4OIMA 2YV3A 2YFQA 3H6KA 4GKVA 1E77A 1ADCA 5EQDA 3UKOA 5BSFA 1OAAA 2I67A 2EF1A 5KCZA 2P5UA 3L6EA 3FBGA 1KERA 4L8VA 1R4MB 1PQPA 4AVYA 3KLPX 3U3XA 2Q99A 1WDLA 4DMMA 2O23A 4ZQFA 3UCEA 2JFGA 3HQ4O 3RUIA 5HS4A 3WIDA 3UUWA 1W4ZA 1SB8A 1H2BA 1XU9A 4DIBA 4B8ZA 2I6TA 2ZB8A 3HUDA 1NM5A 3PHLA 1BTOA 3F46A 4GX2A 3E6AA 5EN4A 4F6CA 3FSRA 5KOIA 2CFCA 2Z1MA 5L40A 2JHGA 3S8MA 2AEFA 4GH5A 4Y6SA 4TWRA 1OC4A 2PD6A 5COBA 4MP8A 5K0ZA 3JQCA 4W9NA 1NBOA 1Y5MA 3LLSA 4GMGA 4D45A 5C7OO 2P91A 5IFLA 3MWDB 2DAPA 3TFOA 2Y99A 4FFLA 4WLUA 1C0LA 2Q1UA 3A1NA 4NBUA 1Z75A 1Z7BA 4EYEA 4MVJD 1QYWA 1HDGO 3QVSA 5ER9A 2EEZA 1Z45A 3UCFA 2J5KA 2VRBA 3FWZA 2Q2VA 4P38A 3STHA 3B1KA 1B7GO 1LJ8A 3LC7O 4D41A 2QYSA 1BMDA 5KKCA 2OZPA 3SLGA 1UUFA 4XDYA 3FTNA 2GLXA 1NPYA 1HYHA 1U7HA 4XD2A 1HTBA 3U4HA 4MVJI 1UAYA 5I8ZA 2Y68A 1J6UA 2I9PA 4NFYA 4UEKA 5ENDA 2C5AA 2CVOA 3DHEA 2P9GA 1T24A 3BA1A 3DWFA 4LSMA 3NEPX 6ADHA 1Y6JA 1PGNA 3JYNA 1HF3A 3V1UA 5IDXA 1I3KA 4O0LA 4EUFA 3GVHA 1P31A 5DF1A 4PLZA 4BNGA 1HDZA 1UZLA 3ROQA 3SC4A 4XGKA 2NQTA 2W8ZA 2BD0A 1Z6ZA 1LLQA 2R00A 1LDYA 1YGYA 2C07A 3B70A 3AY3A 3JQBC 1GY8A 1E5LA 4E5KA 2EIHA 4QT0A 3GUCA 5L4NA 1KY4A 3EHEA 3VAZA 4GX0A 3G1UA 5JXWA 4JP3A 1JVBA 4Q9NA 2LDBA 3W6ZA 3GNTA 3IC5A 1EUCA 1ZIDA 2F00A 3W1VA 1TEHA 2F1KA 2OMEA 2X0NA 4DA9A 2NSDA 2HRZA 4IDGA 2P2SA 3WX0A 2HQ1A 2X7HA 3OMLA 3JQ9C 1T2FA 5JAMA 1ENZA 2R2GA 5JE8A 4BGIA 3G3EA 4OSOA 3K8ZA 2RHCA 2JHFA 2X9VA 3AOEC 4JCOA 3JQEA 1FXSA 4TRNA 1IZ0A 3DXFA 1P9LA 3FI9A 2HMUA 3OJFA 5A03A 2C54A 2ZB4A 6LDHA 4GLLA 2FP4A 4NBRA 1KVSA 5ADHA 1F17A 1U1IA 2YV1A 2A94A 4CQMA 4UEOA 1SO8A 3EW7A 1M2WA 4UVEA 4J1TA 2W90A 4FS3A 3VVCA 1DAPA 1M75A 3W8FA 5ER6A 1KVQA 3ZN2A 4CV1A 1K2WA 4XQGA 5AXDA 1I3NA 1VL0A 2EXXA 3IDSA 3PZRA 3Q9UA 1ISMA 4F6LA 5L7WA 2ZB3A 4J4BA 5JDCA 4L76A 3S2GA 4TZTA 4BO2A 3I9MA 1Q0LA 2OGUA 4YJFA 2IE0A 3F9IA 4E21A 3Q11A 2JAHA 3ZHZA 2AE1A 2FZEA 5DBIA 3GA0A 4O59O 5F21A 3ZNPA 4WLOA 3TZQA 3DBHA 1CETA 5TQVA 5CPFA 4YAIA 5JAIA 1U9JA 1GUFA 3M1LA 3B1FA 1GPJA 1UP6A 3E9QA 2OBNA 2GN8A 1W8DA 4WECA 2CDBA 5CDGA 5CDYA 2B37A 3UW3A 4BMNA 2GZ2A 2G5CA 4ZICA 3QV1A 3S2FA 4XIYA 2JAPA 1QYCA 1D1TA 3JQDA 5EMHA 5CDTA 3ANLA 3NTRA 4PVDA 3LSYA 1ISGA 2D8AA 4ZJUA 4Z6KA 2C29D 2IEDA 3IS3A 3ETGA 3PGJA 2EW8A 2VWPA 3I5MA 3MOIA 4CLRB 4PLCA 3H9QA 1I2ZA 5T6BA 1VM6A 3NT4A 3RVDA 2YJZA 2Y1DA 4RORA 3TL3A 4RVDA 2DTEA 1BRMA 2DLDA 1ZO8A 2FPIA 3BHIA 4UVDA 2HU2A 4P4NA 2PTGA 4FDAA 4IQGA 1XHLA 4BNTA 4DRYA 1XA0A 2RIRA 4O6VA 1K89A 3T7CA 4BGUA 4NR0A 3ONEA 3AUUA 3GR6A 1PSDA 2YFHA 2W2KA 1RKXA 1GTMA 4B3HA 3OJLA 1W0CA 4D3DA 1JKJA 3IKTA 5AXCA 5T5QA 5IG2A 4IJVA 3WQRA 3WFJA 4YT4A 2VHVA 4CM8A 1X15A 3DZJA 3O8QA 4D0SA 4GLOA 2Y0DA 3HN7A 5IXSA 1DEHA 4JJGA 1HETA 1OOEA 4CQMB 1PJQA 3SVTA 1YJ8A 3HSKA 4H7PA 1K3TA 2UV8A 3JQAD 4CMCA 3VPSA 2CD9A 4E30A 1PL8A 1A27A 5T67A 1LLCA 1Q7GA 4CUZA 3HDJA 2CUKA 1Y5RA 3TNLA 4PLYA 3VPHA 4EZBA 3NTQA 1F12A 1XYGA 1BG6A 1B0AA 1K6XA 1P1IA 1HRDA 4WLFA 1WLYA 4A0SA 1DBVO 3WTCA 4IPTA 3QVOA 3IJPA 4XB2A 4HFRA 1DC4A 4J3FA 3KO8A 3LLVA 2CY0A 2BGMA 2FMUA 3MJVA 5TX7A 1ADGA 1DJNA 1RM0A 3I6IA 3K30A 2A4KA 4XQ9A 3BMCB 5F5LA 3JTMA 5JDIA 2VYNA 2YY7A 4QECA 1N92A 4RZIA 1NTOA 5TS3A 3HN2A 3ADOA 1N1EA 2QIOA 1N1GA 3PJGA 1U8XX 2NU9A 3FRJA 1HE5A 4R1TA 4RF3A 5JYDA 3FN4A 2AQKA 2QHXA 4LMRA 4RLSA 5H83A 2Z95A 2D5CA 3I9KA 4S1VA 4E0BA 3PPIA 3GF4A 4GX5A 1BVUA 5F1OA 2GZ3A 3DZGA 1SPXA 3QWBA 3JQ8A 4RCVA 2FZWA 1YONA 4WNIA 1T1SA 1V3VA 4JIGA 2I3AA 4WE3A 1R0SA 4YT8A 5F3RA 4YRDA 1EQ2A 2VHWA 2PD3A 3H3FA 4CM8B 1DRVA 3O8QB 5TSDA 2ZQYA 3I3OA 5BT9A 1NPTO 4BGEA 3PWKA 3ZI0A 3PYLA 3DZKA 1EVJA 2BGKA 2FPPA 2I5PO 3R3JA 4L9RA 1X1EA 3DBLA 2X5OA 4M55A 5IN4A 3Q6IA 2I99A 1PGPA 4A27A 4NBWA 3ZWBA 2JKVA 1VL8A 3VTZA 1Y9EA 2ZQZA 5I9LA 4J1QA 2EHDA 3VKUA 4E2XA 5L95A 1A7AA 3DB2A 2VUUA 1KEVA 3DFUA 4E5MA 3DAGA 4IMPA 1HXHA 4CL3A 2Q4EA 3ZWWA 4IQ8A 5HTOA 3W6UA 2ZIZA 3A4VA 4RVHA 3ZU5A 1HZZA 4L4XA 5DT9A 2H1SA 1PQUA 4IGEA 2RHRA 3CSDA 3TL2A 3FHLA 4NFHA 3B6ZA 3AI2A 4P8RA 1NR7A 4NI5A 4BO3A 4PLFA 2DFDA 1B26A 3AK4A 3PIDA 1TXGA 1WAMA 3WWZA 3I1JA 5THQA 4CMKA 3KHUA 1CF2O 3GN1A 1QLJA 3C7DB 2DKNA 3HFSA 3GHHA 4N54A 2P9CA 1SMKA 5ENVA 2GN6A 3NV9A 5B37A 3GN2A 3VZQA 4DQUA 4GBJA 1ENOA 5KJFA 2R00C 1HDRA 3GEMA 4M49A 4BO5A 1C14A 5MDHA 2X6TA 4XZ3A 1Z73A 3HZZA 3F5QA 4OMUA 2O48X 1WMAA 3LK7A 3BMOB 3IUPA 1L1FA 4J7CA 3SBOA 1DRUA 4ZQGA 2VZ0A 3PP8A 3VOSA 4MKRA 3TOXA 2NQ8A 2VWHA 3TJRA 4LK3A 3ANNA 1WDKA 3GAZA 3BTVA 3PHIA 2Q1SA 1E1NA 4LRSB 4IUYA 5TNXA 3Q3CA 3ZU4A 4OGWA 1PS9A 2JCVA 4BNLA 4CR8A 4EUHA 3UN1A 1CRWG 2P4QA 3HG7A 1JAYA 4LVUA 2CMDA 1P3DA 3PEFA 4NK5A 5JBIA 2IEBA 2Q3EA 3H4VA 5FI3A 3H7AA 3RKRA 5G0WA 4MKXA 3WQQA 4D0RA 3FD8A 4BNZA 2C82A 2Y67A 3JQBA 4OH1A 3HDHA 5KJCA 4PCVA 4FFNA 1IY8A 4FFMA 3RC1A 3GGGA 3VH2A 1ZVMA 4PZEA 5LDGA 4K9DA 4OO3A 3FNFA 3NKLA 1QMGA 3CE6A 2WTBA 3GG9A 3PIIA 3ENKA 4NIMA 1MUUA 3Q0EA 3DZHA 4EI2A 1ULSA 4QFDA 3NDIA 5BSEA 4M86A 2NU6A 5H81A 1DSSG 5CDUA 3TQHA 3BMQA 1LBEA 1NVTA 4DPLA 5I9NA 1FK8A 3JQ9A 5KIAA 3L4BC 1PJSA 4R68A 4JBIA 4UAGA 5JMWA 4I9UA 3NAQA 4C7JA 1CERA 5KKAA 3AOEA 1JW9B 3QP9A 4IDFA 3UF0A 1YB4A 5IDQA 3C7CB 1Y81A 5IN5A 2WE8A 3ZH2A 4BNMA 3GGPA 1K6IA 2OO5A 5K9ZA 3VTFA 2P4HX 3Q2KA 4B7UA 1LTHR 2PD4A 1K0UA 4Q3EA 1UXGA 1I33A 2NACA 1EFKA 4NG5A 3BTUA 1I24A 3DZBA 4JP2A 3WLFA 1AGNA 3O03A 3PLNA 4I5EA 1NP3A 3AI1A 2H9IA 4NHEA 4HUJA 3DMTA 3VPFA 2VZ8A 5G4KA 3V2UA 2VUTA 2X1HA 3WJ7A 1DIAA 1Z74A 1O5IA 3PI7A 3W8EA 1XWFA 4BUCA 2W4QA 1T2CA 1I36A 5HWSA 4W82A 2D59A 2GR9A 4BNIA 1O9BA 1AUPA 1E1LA 1YH3A 4JGBA 4HV4A 4U5QA 3H5AA 1BW9A 1K5HA 4WOKA 2V7PA 4FBGA 4INAA 1CDOA 3PWZA 1YL7A 1WXDA 3VVBA 2EW2A 5L3ZA 4LISA 4CPDA 4YA6A 4LGVA 3ROMA 2BELA 2XXBA 1ISFA 3KYDB 3KSDO 3LT0A 1Q0HA 4P4LA 3B1JA 5JFOA 4XB1A 3S1LA 4RLHA 2DT5A 2VTDA 3C3XA 2CDCA 3ONDA 3A28A 2NTVA 4NBTA 1UR5A 1KEWA 2FRDA 2HLPA 5TGDA 1N9GB 3D4PA 3IP1A 4C7KA 1OC2A 1N7HA 4BGVA 5BSGA 5HRUA 5T64A 5C7IO 3OHSX 1LX6A 3WQSB 4FFOA 1XSEA 2VHYA 4E5YA 1R37A 4NH4A 1R4MA 4LMPA 3LT2A 3TZHA 4A5OA 1UP4A 2Z5LA 4ALNA 1EBUA 3KLMX 3WGOA 5JNLA 4MKZA 5JC8A 1SBYA 4RPKA 1ADBA 2TMGA 3ZWOA 1EZ4A 2IZ0A 2HJRA 1NQAO 4IJUA 4PLTA 4XRRA 4Z0PA 1E7WA 2GASA 3ETDA 2PR2A 4LSWA 3KVOA 3LF2A 3GG2A 3GAFA 4HADA 5A5FA 3O9ZA 2X4GA 1R12A 3FF4A 1ULUA 1IHXA 3MJTA 2I3GA 4ZN6A 2GUGA 2Q1TA 1E5QA 1B14A 5L51A 1T25A 4U7WA 2OXIA 3M6IA 1PJ3A 1ZMOA 4MVJM 3H65A 3NGXA 4BKOA 3K2EA 4CQLB 1M6HA 1MC4A 1U2GA 5G4KB 3T4XA 3JD0A 3OBBA 5TT0A 1PU2A 2Q46A 2XAAA 2GF2A 3PLRA 4Y8VA 3WIEA 1IYZA 1PS0A 3F4BA 3PFFA 2YHUA 3KYBA 1BW9B 2NWQA 1XELA 1D8AA 4NZ9A 4DIOA 1U8FO 2FPGA 3AFMA 3E1KA 1X13A 2JD2A 5CEFA 4FOSA 1PWZA 4Z0TA 1LC0A 2CVZA 3HDQA 4FQ8A 1Y1PA 4BNUA 1F14A 3ZV6A 1BDBA 2ET6A 4U6QA 3Q1LA 5CG1A 1HSZA 2ZJ0A 1ZZEA 5I7EA 4YBZA 4AG3A 2HO5A 3RBXA 3A14A 3H2SA 3GRKA 1PJ2A 4ZQHA 1P33A 3H9GA 3WR5A 5B4UA 3RJ5A 1U3WA 4EEZA 2AHRA
chains in the Genus database with same CATH superfamily
3K73O 1NNI1 4M0CA 1I7DA 1TZMA 3U44A 2D0IA 2VJMB 1RBYA 3GMTA 4ASUA 3ETLA 5AYVA 3LUJA 1GEEA 1ZXLA 1WY5A 1YQDA 2CBGA 4WXMA 3LZDA 3IQGX 4CM9D 2NSYA 2V96A 3V2HA 5H59A 2RK3A 1UK8A 3KC2A 1UXIA 1C8VB 4NJMB 2IVFA 4TQUS 1C9KA 3PXAA 5F2OA 1JGTA 2GHTA 1Q7CA 2JGLA 2Y0CA 2AVNA 3AHFA 3BL6A 3E8SA 4JBGA 1YQTA 3S7TA 1PGJA 3V5NA 3X3HA 2WHRA 5THKA 4CLOB 5MFZA 3E15A 3ONFA 1IEVA 5C1OA 3CU5A 4K03A 3VU0A 1JP7A 1JTVA 3FOCA 4DSOA 2REQB 3UATA 2AF3C 2Q3FA 3ROXA 3TGPA 5CG2A 1TKCA 4UBKA 3P9XA 2GYUA 3HWRA 2AH5A 1WHSB 2NSJA 1XYVA 2QW8A 3LP8A 4IKEA 4QUEA 2CL5A 2VF4X 4D74A 5BP7A 5CLGA 2HGSA 2HRDA 2R60A 4CF3A 1TAHA 3K53A 2JLZA 1XR3A 2C98A 4KUHA 3IR7A 1MAWA 5EPOA 1S3IA 1YACA 1YRYE 2ZK7A 4M8SA 4L3VA 2V6MA 5CGZA 2QE7D 2VHQA 4M3NA 3BWVA 5KPJA 3MTQA 3Q7EA 4JMLA 4REOA 2GETA 3LT5A 5F9MA 1T3GA 4MUBA 4OSEA 4X24A 2QAJA 3ZE0B 3LPCA 2V98A 5LQSA 2QVCA 4X95A 1XXLA 3LC1O 1GZ5A 1L7VC 3RWOA 1QRTA 2ZJOA 3B85A 2A1TS 3DFMA 3U4IA 5TF4A 3D7RA 2OXTA 5C0OE 3RJZA 1XQ1A 3BEDA 3SIPA 3P4XA 3EUEA 3LHSA 2UDPA 3WDLA 1TM4E 3CPSA 1SBHA 5BOVA 1BC5A 2ZUEA 1OASA 2I7DA 2H7CA 3VHXB 4N0EA 4ZHQF 4F46A 1X38A 4YJHB 2EZ4A 2AWNA 2VPTA 5K8CA 1F8UA 4IJ6A 4MZDA 1EB8A 3OM0A 2ORYA 3WL6A 2WMNB 1IB6A 3JPYA 3O8LA 1L5HA 1R88A 3KB1A 4XASA 3RBVA 4CIDA 2UUBB 1Z36A 3NH9A 1FSFA 3PV0A 3KPVA 3LE8A 1PVVA 1VYHA 3ME5A 3ZDQA 1D0SA 3WGNA 4IYRA 1QG0A 4PNHA 2GM3A 1G0OA 4TXNA 2PS1A 3B1ZA 4Q9DA 4EHDA 3PC6A 3GJ5A 3WP1B 4Z54A 1TA4A 2PKQP 4QGHA 4RK6A 4JMPA 3FCEA 4H3VA 4RVCA 1CYEA 5CM8B 3TCXB 3G2JA 1RSZA 4YAKA 3WZLA 1OTXA 4HGYA 1UOOA 3GCGA 3HJFA 2R84A 1XVLA 1RAIA 4CEJB 2WVHA 1CV2A 1DE0A 3RVKA 4R16A 4GW3A 3DLHA 3P0FA 3QUQA 2TSYB 4B71A 3CQ9A 4HQFA 3IIKA 4K9OA 1XPUA 3QFSA 3UKJA 1P74A 3OOJA 1PZNA 1E3QA 3IVCA 1P5FA 4AX4A 5KAPA 1FLDA 1FP7A 4K9PA 5A3VA 1ZGHA 2FR1A 4AC9A 3W2HA 4X7MA 1N78A 1PGOA 1TM2A 4M89A 3V6LA 1TF2A 4W99A 5CT6A 1NOKA 2JZOA 3ESRA 2J9FB 4BUJA 4DV7B 1M7HA 4PTZA 1T6ZA 4TSKA 1A95A 1DU4A 3G0IA 3U61B 3HFGA 2Z2IA 3BHMA 3PWTA 1C1HA 2B1IA 1GZDA 4P4GA 4CM9A 5JAQA 5JAOA 2CFOA 4JBWA 4LHYA 3VBCA 4B4UA 1EMDA 1EUZA 4NLLA 5LOVF 2ZE6A 1NLZA 3LC0A 2VBFA 4H18A 4HXYA 3TSCA 3FLMA 2VDWB 3K0CA 4R9UC 1PG0A 5B58T 3ZWNA 3MRVA 4ZK2A 2C2WA 1XFDA 1IZYA 3K92A 3MUFA 3ZDRA 4KQKA 2R11A 1LEHA 3MIZA 4ARVA 2AOTB 2VK2A 4HPJB 4E22A 3BZUA 3S5UA 4Y9RA 2UZAA 3TZBA 4CM6A 2JCSA 1YOVA 3DFKA 4ZT4A 1CJMA 5E9WA 3ZCRA 4E4YA 1SVWA 3FTQA 3TTUA 4NL4H 4CETA 2Z5VA 4KN5A 5A7GA 2C2BA 1S1MA 3EQ9A 5KOJA 2JKYA 1HKUA 2Q62A 4WACA 2QXUA 4X6YA 4CIYA 1WE2A 4XWTA 2I2BA 1H42A 1P18A 1WXEA 3TX2A 2IS6A 1CRZA 1FYFA 4OA5A 1N36B 4LF4B 5I7FA 2ZKLA 4I8IA 3WLKX 1XTRA 1SURA 4RGBA 1X7WB 3R7WB 1YRLA 1F51E 4G0ZA 1H9BA 3FKQA 3EMKA 2QE7A 3AR4A 1JLHA 1ICEA 3IRVA 4OHZA 3QX3A 4ISCA 1GTRA 4QUAA 3L4BA 4UMVA 1N75A 3NM4A 1NW8A 1B6GA 4IOKA 3L5KA 4GNRA 2PLNA 1Q1AA 2I91A 3VUFA 1N6RA 5DBGA 1MX9A 2JAOA 2QIPA 3JSAA 1CY0A 1X8KA 3OMWA 3PXCX 4DA6A 1Z4LA 2CFIA 4R6WA 3KBBA 5JVDA 3R3VA 4MWZA 3R6WA 4NWIA 1L3CA 3ONNA 1G291 2P90A 4BGDA 1YJXA 5CVJA 5BYKA 1R16A 4ALJA 2EYUA 1ZZGA 4HX5A 1ZSYA 3FR7A 2AFHA 1T3TA 3QE3A 2OSBA 1Z8HA 1G7CA 2M9MA 3AERA 4DLZA 2G9QA 5T4BA 3TDMA 4FM9A 3EUWA 3I3SR 3K9LA 2C3MA 1YHNA 1XTJA 1JQ3A 1NW7A 2O4UX 2A3NA 1U9ZA 4LJAA 3T94A 3NU1A 1OXUA 2PM8A 3GVIA 2R6FA 4BHTA 2WMOB 1QAQA 3NV7A 3ZBTA 1GPBA 2H1OA 2A7QA 3VSCA 3WGIA 2BMVA 2P1ZA 3E9MA 1PTJA 2C96A 3ZZ1A 3KU4A 1USWA 4IINA 4F2PA 5ICCA 3E0QA 821PA 1RI1A 2CXPA 3B9QA 4JI3B 1VSTA 4X20B 4DIUA 2JARA 2NO4A 2AS0A 3OF2A 3HJGA 2QTMA 5JU6A 1DINA 1Q14A 2E0IA 1J8VA 3CM0A 3OU7A 4TV9A 4N8SA 3V34A 1CC1S 1MH1A 1XCLA 3NBZC 4KWCA 4LRYA 4WAUA 3NVKI 1LXCA 2X7XA 4DJTA 7AT1A 1GL3A 3ILVA 5LCXA 2EBWA 2JJ2A 4Y67A 1OI3A 2VUSA 4CT4B 4CGZA 1Q1QA 2REOA 1ZGGA 2GGSA 1VYUA 2EKPA 1NSTA 1X1AA 3QXSA 4KHZA 5AK5A 3UEOA 4KGZA 5BURA 4R0MA 1N9KA 3MCTA 1F2UB 4FWBA 4C0WA 5L9AA 1H5QA 2V4ZA 2H1CA 3VOAA 4RTNA 2NU8B 3UT6A 3I8OA 3LT1A 4BKPA 2RGGA 4M60A 3NNSA 2ASVA 4EVRA 2FAXA 5D8DA 1CJUC 4A2PA 4HFJA 4HLQB 3TLJA 4B3GA 3EWNA 1HE3A 3WOHA 1I0ZA 3KAKA 2J3HA 3B3GA 1RVV1 3ASUA 4W6ZA 3RS5A 4AJKA 4HEHA 3UJAA 4RS3A 4IUCS 4W8OA 4BASA 2CJPA 1J9ZA 3FNGA 4KPUB 5T57A 1M0SA 4AP5A 4GRIA 2YWJA 5FCDA 3R0VA 1Y1TA 4JOBA 4BFLA 1XCGB 3K2QA 4YQYA 1BXZA 2BSXA 4L3OA 1KGSA 3PITA 1RWQA 5LD2B 1GCOA 2HIGA 5HF9A 2JFYA 3LDAA 5CU7A 5LDHA 1GPDG 1UBLS 5LP1A 2QWXA 2AE2A 1ONSA 2XD4A 1II0A 4DUGA 4MW2A 2FQQA 1UFQA 3BQMB 4F92B 3REQB 5K4HA 2AWOA 5D51S 4GKJB 1VB5A 1SKYB 2X1MA 1MJ5A 4JEMA 1X2EA 4PTLA 1NR1A 1C4XA 1OX4A 2VQSA 4OYLA 3C8MA 1Z4QA 1FBTA 2XMRA 4Q3KA 4UQOA 2QOEA 3TZCA 5K2MA 1ZGAA 2HXGA 4E32A 5GY7A 1GZ6A 5A9SA 2JVJA 2IPMA 4R1SA 1RWBA 8ADHA 4GOND 2VP6A 1UMDA 1N7JA 2YQ5A 4N49A 2FOIA 1DZ3A 4MHOA 5F1YA 3JZAA 4JGGA 3OIVA 5DNDA 1HDYA 2NZYA 4JV5B 1ZN2A 4TQAA 2VH2A 3MJSA 1J21A 1NW4A 1BD3A 2NYRA 2DWCA 2WMDA 1URPA 2FSGA 3VDQA 3DMHA 1GRVA 3HJAA 4MZXA 3PPXA 1XRLA 4HN4B 3GMSA 3Q3GE 1H6AA 2A0YA 2CDRA 3CF2A 3MMPA 4FEYA 4XX0B 2Y0EA 4Y2UA 4E5SA 4TTVA 5DGHA 1N3IA 5K6AC 4QVIA 2QAGC 1MGPA 4IDPA 1NATA 4E2ZA 4OI0A 4BX8A 1JG3A 3GNLA 4RGYA 3A4TA 4FQ5A 5CXSA 1V5EA 2XYQA 3GRPA 3LQRA 1V48A 1VFPA 3C43A 2O8VA 3MTAA 4J16A 4PICA 3VV2A 4E12A 4G5XA 2OZLA 2WM2A 1M6NA 2ICAA 3INRA 5HM6A 4GDFA 1FXWF 2O7NA 5HCUA 3Q41A 4B8WA 4UDOA 1QH8A 1W25A 4HZUB 4LW8A 3DHNA 5TIIA 1V43A 4Y7DA 5K3BA 2XXJA 1ANKA 3IAAA 1HURA 1JA9A 3K8OE 4LC0A 1DB3A 1SC9A 2W43A 4G63A 4HDRB 4UCWA 3DPSA 1P6UA 5TRTA 3OQMA 1UBSB 2VJOA 1EVYA 3SKXA 5FORA 1B0UA 3PB3A 4PAMA 2OA0A 4NICA 4PSVA 1ONBA 1Q0QA 2HYDA 3L93A 4JAVC 5A4AA 4ZVLA 1Z2DA 2WM3A 4LF8B 2LIPA 1CUEA 3PHHA 4YAEA 3GEHA 5K0EA 1ECCA 3QYAA 1Y5IA 5KSYA 1GCUA 1T3HA 1B73A 2UYOA 3NI2A 1EXNA 1G3MA 3D2LA 3PUVA 1M8PA 3GLIA 4ZVQA 1OLSA 2ZIXB 4IOMA 4YLGA 4DVJA 5ADUS 2PUWA 1PT6A 4I6JA 4HMOA 4MITA 1CP3A 4A03A 3DEJA 3O8BA 4PPQA 2DKFA 4FD2A 3GJ7A 3L4SO 5B12A 3CMMA 4B76A 1WSAA 5E6RB 3GK3A 3QKRA 3GFVA 2NO0A 4KQMA 1OFUX 3BE5A 3NCHA 1XDGA 2V5AA 4KQGA 2JFFA 2DR2A 5JO9A 1E2EA 3V80A 1QZTA 1ISIA 3Q9SA 2R62A 4Q1DA 2C7QA 1CQIA 1Q44A 1BYIA 4WSOA 3DE0X 3D7LA 2H4WA 1XC7A 5FV4A 1TM3E 5HQJA 3AR6A 5EJ6A 3RAJA 3IVGA 1C7QA 3CY6A 3W6NA 2R6JA 4CJXA 2NVWA 2GPWA 2GYYA 3IB6A 4NCKA 1SUFA 3VPDA 4DJEC 3QVWA 4L57A 1E0JA 3LFTA 1E7YA 1WHTA 1CFZA 4WCFC 1I4OA 4QXMA 4A9AA 3UMSA 4PYRA 3RRZA 2ZS8A 5DRYA 5CAEB 4ZVRA 3MGAA 1LPAB 5K4AA 1PWYE 4M1EA 1XXHE 2AXQA 3CLRC 4NYIQ 3F98A 5DULA 4E5UA 4CU2A 3WHPA 4LHXA 1DI0A 1AHHA 3E3LA 3GLVA 4UUAA 2VDMB 3R8CA 3GLRA 4TLMB 4EM6A 1UBGA 4U2EA 2GERA 3NHBA 1TLFA 2PKQO 3D4NA 1R15A 4ER0A 3P94A 1V9LA 2OUIA 2XWQA 3TSWA 2RGWA 2ZUTA 3GV0A 4YHBA 1QHHB 3Q5DA 1S7CA 4D9KA 1BE6A 3OCCA 4QOIA 4IQ0A 4NAUA 3SHOA 4TN5A 4W1RA 3WJAA 3HCDA 3E2PA 1ESZA 3VHLB 4DLKA 5KVVA 3FYUC 3RJ9A 3H2JA 3B8HA 1WMEA 3OM9A 3VNUA 4GMHA 3EIOA 3GFPA 3QPCA 1M10A 2BZSA 4GICA 4K8OA 4URYR 4BL5A 2B99A 5EJ8A 5B6PA 1GRQA 4GRAA 5CFRA 4RHFA 5FOTA 2OK7A 5BMVF 5FFFA 5I4KA 3KKPA 1ADFA 1AN9A 4EGCB 2NYVA 2A4MA 3BK2A 3NC1C 3RROA 4WFJA 1CNMA 1VJ0A 1GQYA 4HZIA 5KJ1A 2ZYAA 4NCNA 3D1LA 4Y98A 3V4FA 3F4KA 3KYDA 2YL2A 4FSXA 1U2DA 4PAWA 1LCIA 1JDBB 3BCSA 4ZZIA 9LDTA 1ZHOA 2OFPA 3O93A 4CNBA 1K6MA 4WDRA 1E20A 5A62A 1IUPA 4BRUA 3CVVA 3ZR4B 3PC3A 1NXQA 3GW8A 3D2CA 3LPAA 5TPZD 2IP2A 2GEJA 4MR8A 1P77A 4YQEA 3S8YA 1F38A 2JGFA 3HXTA 3QV2A 4S1WA 2O3QA 5EXDA 4RTQA 1A04A 1IM5A 4OD0A 5IEJA 1KFEB 1M1YA 3LVBA 3LT4A 3O21A 2Q27A 4B7CA 2IXAA 4BWVA 5AW2A 3E22A 5IJZA 1TADA 2QNBA 3CUYA 2GJ9A 4BDSA 2B98A 1D2HA 1R1DA 1VJ1A 3HXLA 3IP3A 4L4YA 1P7WA 4NX2A 2PS9A 5E8RA 2IE8A 4ZZ1A 1Z4NA 2R4TA 1R6UA 4NU6A 2D2XA 1UKZA 2V7BA 3PXBA 3OZCA 3HU3A 2WWRA 2WP8J 2YZ7A 1P91A 4XSHA 4FMDF 2DEUA 4XFKA 4ZPXA 2J3JA 3ZBQA 2W8BA 1V95A 2N1BA 3BGDA 4WKBA 2IS1A 5M34A 3SQOA 5LXTF 2WSIA 2P68A 2ZPUA 2H2DA 1BXKA 3L6OO 1GTSA 2ODPA 2B8WA 2RHBA 2X58A 3R40A 4KXXA 2H5LA 1ENPA 4CCSA 2PBLA 2NVBA 5HQ3B 3EEYA 1YQGA 4FZ3A 2WRZA 4CQNA 3VJRA 1QP8A 2ZJ1A 3HP7A 1N5DA 2IPOA 4HNQA 3VH3A 3A11A 4IYJA 5K3FA 1NRIA 3JVDA 2VNSA 4PX2A 3WGGA 4WLVA 1CZOA 1RWVA 3HRKA 1SHLA 2H07A 3HSSA 4AJ1A 1EHYA 4URFA 1EM8A 3IUYA 3OC0A 1GV1A 3C4VA 3GX1A 4L4UA 4LHEA 1O4VA 4P34A 1T6XA 4BP1A 4G37A 1WUIS 2C7PA 3MSCA 1S02A 1C30A 2LZ0A 4KLCA 1UBNA 2XUKA 4CUJA 4NMHA 1COWD 1A72A 2XPCA 5K03A 4QOHA 3OFVA 4KP7A 3KOYA 1JXMA 2CBXA 2QLTA 1AZWA 2VZEA 3L05A 3RH0A 1ZYUA 3V7NA 1FDUA 4A6DA 1C80A 2WD7B 5AI5A 4PG5A 1U8UA 4GPBA 1ML4A 1BJRE 1G20B 2GTIA 4X3OA 1BU5A 2QSUA 2QTLA 3ZE8A 1W35A 4YPOA 5K3OA 1N0UA 1UDWA 1DT5A 2CYAA 1OV4A 4KAJA 1AVTA 2NUPB 1YR1A 2ZDHA 1CUAA 1DFGA 4FYPA 5LLTA 3BORA 2X8LA 3VNRA 1I8TA 1ZM2A 2QLBA 4YN3A 3RRYA 3AHJA 4K9KA 3DDWA 5E95A 4K3UA 4NK4A 1J0DA 4FGUA 1U04A 3QKUA 3H42B 3MC1A 5AJZA 3KLOA 3D1JA 1M67A 3O82A 4D3XA 1OPXA 4LOIA 3DQZA 1CSEE 2A9RA 4TYWA 2Z4TA 4UJ5A 3QHAA 3EXG1 3JVVA 3NBKA 2OY0A 3R5SA 4LTDA 1HT0A 3FGPA 4FR5A 2XX3A 3GRZA 2EFCB 3Q6NA 4I5DA 3DOFA 4A91A 3SZRA 1O08A 1E4VA 5G41A 4CF5A 3Q8XB 4HPWA 1QU3A 1D0VA 4OQ4A 4NMMA 4KDCA 5DEIA 1DAMA 2WWFA 5C3MA 2P11A 1XF1A 2CLIB 2CNWA 1M34A 1QHIA 2P1DA 4LI3X 1SIOA 5F3DA 5JFTA 3C8HA 4ZHQA 2WUFA 3PNSA 3EGOA 3U7EB 2VP2A 3ELDA 4GKBA 4Y3UA 4G5FA 5LJLA 3AEYA 1Z88A 5TPZA 3WA7A 4LXHA 3D02A 1UKEA 1MU0A 4PBSA 4P3YA 5T41A 2B9VA 1G8PA 2AMYA 3T1OA 5SYAA 4AKTA 2EBFX 2FSFA 3QX8A 4IF4A 2PSJA 4EDFA 1NHWA 2B5OA 3NGMA 2PBZA 2HF2A 2JJYA 3DL2A 3DM9B 3HE3A 5FNVF 2ROQA 2O8CA 1JYFA 1IN8A 1TYDE 5A6VA 2GO1A 2ADOA 2WWYA 1JF8A 1QONA 1KMCA 5JPDA 3TBKA 1IHYA 1RAEA 5CM9C 4HAIA 1RLOA 4I4CA 1V6AA 1RJWA 3CUSA 4QPZA 4QUHA 2WSBA 1QOZA 3BSYA 4NCIA 1V8BA 1OR8A 4EBFA 2QRKA 3TIXB 2VDOB 3DR5A 5HXAA 2JLVA 3EA4A 1GSIA 1QLHA 3PVSA 5K0SA 4PYQA 4KC0A 2ETVA 4EA9A 4JEHA 3NJ8A 1FJ2A 1GZ4A 1ZD2P 4AROA 2DVMA 1C8BA 2H1IA 3CZMA 1L5QA 2WVGA 4J8PA 5BN5B 3AR3A 2J4DA 3A6JA 1JSLA 4DMFA 1MB9A 1UJ6A 3CLRD 4UD2A 3EDQA 2SKEA 3HVHA 2QW1A 5HQTA 3P9YA 4RZQA 1XZBA 4XM2A 2WAXA 2E4ZA 1A4XA 5LNK1 1YBFA 2CLKB 4C4OA 2OGTA 3TPFA 1D3AA 4GVPA 3FZYA 1THGA 2A9KA 2LBPA 2ZRGA 3EVBA 4BVJA 2OVFA 1Y33E 2NP7A 1U6IA 4FOOA 2ABWA 4L0CA 3V1NA 3DDNA 1BS2A 3BILA 3FXAA 4V0QA 1Y8RB 4N0DA 5I47A 1MA0A 4KUGA 3DLBA 2ZPTX 4LXTA 3MMXA 5EHNA 2VLIA 3C3BA 1JR6A 3KQOA 1F0YA 4MQEA 2V54A 1YA4A 3UENA 1KMHA 2Q49A 1RYNA 2XYHA 4Z4EA 1NNSA 2AZDA 2VPYA 4BN5A 3Q8MA 1V8OA 5CK4A 3G89A 3QQPA 4JC5A 2JCXA 2ZWAA 4C3VA 1IJFA 1P0FA 2QAGA 4YP7A 3ZZNA 3PRJA 1LLDA 1NXOA 4Q7LA 4D7AA 3ZHTA 3JD2A 1TQ6A 4C4PA 2GSDA 2FJUA 1CIVA 4FDLA 1CIJA 1N7IA 5FWAA 3KOUA 2YUIA 3ZD6A 2DTXA 4CG1A 3JU3A 4RESA 2PXCA 3C24A 3U7JA 1FFBA 3PSHA 1TZ2A 5GIPE 5D5PA 3ZWCA 3SIRA 5M7EA 2PKRA 1CY6A 3K96A 1T34A 4N65A 4PIVA 5AXAA 1KRHA 3TF5A 3IAUA 4IIUA 4OFZA 4I1PA 4YNBA 2OVBA 3UUFA 4DWVA 1SVNA 2RONA 5AVUA 2AMLA 3SJUA 3IAFA 3KOMA 3RTCA 5HS6A 1CLEA 3EZYA 4TGLA 5EEGA 1PKEA 5GIOE 3K9NA 1V5WA 2QRVB 2GCIA 3FPEA 5E3JA 2GPSA 1MX5A 4EPWA 1EP2B 1MJFA 1PBTA 2FCAA 5LYJA 5GVRA 3T3PB 4LECA 1YJCA 3RBXA 4YUZA 2DFNA 3LUKA 1NQ5A 2BFBB 2B35A 4RGVA 5HTKA 3WS7A 1VZ3A 4MGEA 4NNOA 3IKLA 1UZNA 2QL6A 4L6AA 3RFXA 4LQLA 1R5NA 1G8YA 2D5IA 4B33A 3QMWA 4YRTA 3PQDA 3ZW8A 3AJRA 1XT6A 1YMVA 2D2IA 4EATA 3CZRA 1T2VA 3II6X 5BW8A 5JXGA 4BLUA 1KDZA 4EIWA 4JP8A 4TMKA 3UYLA 1EFRA 4NF2A 1NLFA 3M4JA 6Q21A 2OV3A 5T4EA 1EEHA 1Y7IA 3KKNA 4IX9A 4YAWA 3DEAA 4LYJA 5C1DA 4K6KA 4D6PA 1T8TA 5E1MA 3ENZA 1DAHA 1KNXA 4M87A 3KJEA 4WCFA 3SZUA 2XYVA 5JS7A 1CCWA 2JATA 4E6EA 3EYWA 4U2BA 1OLUB 1WZ2A 3DR3A 2R65A 1ZHHA 4RY9A 1AV6A 1T1RA 2Y1WA 3K5HA 1CQJA 3A1TA 2HYIC 4XDGA 4ZDIA 1AHNA 3GPDG 3N2YA 5CLLA 3S2IA 1LH0A 1QB7A 3DEFA 5HKBA 3NVDA 2WF8A 2QTWB 4BNYA 2DLCX 5FTWA 3ESQA 1GG8A 4UTOA 3SWWA 1IDOA 3DLPX 4Q3DA 1D5CA 2QQGA 3UK7A 2AKAB 1ZU5A 3B1VA 1U9YA 4DTIA 1C9JA 1QVZA 3DMGA 4BB0A 1E92A 3DWGA 2AZTA 5B1IA 4MPJA 3SEFA 1QG4A 3A6DA 4ND1A 3ITDA 1KEEB 2IKSA 4JUAA 1LDGA 5J59A 1WCXA 3KSUA 4C7MA 1IXYA 4AMYA 4FOPA 5C1BA 3H2ZA 3RUDA 5F5LA 4MIEA 4ZQIA 5EKXA 1V8ZA 3FYUA 4RZ3A 1ODTC 2VHXA 1OKKD 4AKIA 1KK3A 5B2ZA 1RI3A 3L1VA 5ESDA 1HYBA 2GJ8A 4ZQCB 2D1RA 3BWCA 1LI4A 5FPSA 1VL1A 2BVNA 1RZ3A 3IDFA 3UA4A 4C3OB 3HB5X 1P8AA 2C2XA 3AB7A 3DP9A 1NVMB 3EWIA 3FTCA 3GYBA 1T5LA 2PS3A 5LA6F 2Y1XA 3QW2A 2AJBA 2HDNB 4CODB 4D6YA 5K0CA 4F4CA 2IH4A 1TIKA 3DZIA 4Y6QA 3KELA 5H3LA 5DCWA 4RABA 3VNAA 3OX1A 4H16A 2G09A 4WFQA 1XXHA 1YT5A 1E9RA 2W2PA 2YBDA 2GNAA 5DBEX 4AN4A 3SKVA 4E94A 4PG6A 1G21E 4R2LA 4TV8A 1MW9X 1RBQA 2YMMA 2GPTA 3HNPA 2WHPA 4ZYXA 2OAGA 3AJEA 1JHXA 4KGDA 3CEPB 5CM2Z 4FW8A 4IWNA 3PF8A 1TB4A 5DGXA 1PK9A 3D3KA 5SV2A 2R6CA 3T06B 1B3RA 3JAWA 1W5TA 1QHFA 4P0QB 4S1TA 2OHOA 2W6CX 4FMCF 4P7FA 3U5TA 1E2BA 4HVLA 3O4FA 1CHNA 1UK9A 2JFQA 4ND6A 2JZNA 4C0JA 1XVIA 1T1JA 2WD9A 1F8XA 4PYMA 2MYNA 4C5BA 2WWTA 4DG9A 7ADHA 1TC1A 1WP4A 2ZBRA 3C6ZA 4U4AA 5IK2A 1PFVA 4GYKA 3T9FA 1OZHA 4JI8B 4HJRA 4LOAA 3NDPA 3QXHA 4O2BB 2W6QA 5FOXA 4F8EA 2JKZA 5IKMA 1G5FA 4M7PA 3GUVA 2HNAA 4H31A 2FHSA 2C20A 2ZTUA 1CUJA 1XZQA 2Y2UA 3GUZA 4KIJA 3WKAA 1FS6A 1Z16A 1DQRA 4I2NA 1FYDA 3BE4A 4IDAA 2PX2A 1PX0A 2M6KA 1C4WA 4TKUA 3ZZ0A 1BEEA 1II9A 1V8DA 1YV9A 1OZAA 2JH9A 2YC2C 2X7JA 2PUDA 1A9ZA 2PGXA 4DV5B 3FHOA 1XQWA 2WU1A 4I6GA 2QTFA 4IIDA 4RK5A 3KB2A 3R9WA 1UOEA 2F3TA 3KJNA 3O31A 4OB8A 4QBTA 4FB4A 1E1QA 1YE5A 2V7XA 2FWMX 2FFBA 3DBOB 4KUEA 5EUMA 1KF0A 1FFSA 3H7IA 1G3QA 2BGTA 4M9CA 1NW9B 2VJKA 3NBFA 2G9UA 4FGZA 4UMDA 3SC3A 4P36A 1U2PA 4OLFA 2A9FA 4ZMSA 2VUHB 2HLDD 2PWAA 1EFLA 3IAM1 2WB2A 3UK6A 5I9BA 2PSEA 4XB6B 1E7QA 3AM3A 2Z9BA 1U4SA 1BEZA 2D4HA 3RK4A 3VR3D 1M76A 3KEQA 3KQNA 2WNSA 2BWJA 3D5QA 1WBBA 3H8JA 3DHVA 3H6HA 3R4CA 1FMLA 3K6RA 1N3YA 1JPUA 4MO9A 1NG1A 2EW1A 2XLBA 4TKZA 4AL4A 1CR0A 2F43A 2CLOB 3CCBA 4MDHA 4YJGA 3P8ZA 3VFDA 1IWOA 3WTBA 3KT6A 2XYGA 5AOCA 2ZZMA 3Q88A 1ZK4A 3GFSA 5KOHA 2PQMA 2Q2WA 2QTVB 3MAAC 3ZS8A 2JZCA 1SCUA 1UXKA 3BMNB 3BSWA 3F9RA 5KNCA 1PO7A 1OKKA 1P1FA 3SEQA 1HQDA 3PCXA 1OPRA 3HY3A 2VYQA 4GI5A 1JAHA 2DWPA 3W2TA 4BO1A 1GA6A 5G0SA 4JKOA 1OXBB 2CV0A 4MRAA 3ZIUA 3HP4A 5JPIA 4CTMA 3M6LA 2QTCA 3VYRB 3UPUA 2AEJA 3PK0A 1E0DA 2EFGA 3BERA 3G1TA 1WEKA 5KMGB 1A9XA 2R47A 2FEPA 1Q1NA 5IVDA 3PEWA 2CB0A 2DWOA 4CMGA 1VA5A 3FUVA 3IOYA 4D3FA 1IG0A 3GMIA 4MV4A 5AVWA 3EPJA 3LPDA 3EF3A 1AQUA 3RUAA 3HDTA 4H1UA 1ESMA 5KYKA 5AHXA 1M54A 1WXWA 2PEZA 4A73A 1M1NA 1VPTA 5HGXA 1RABA 1TUGA 2QLJA 1IC6A 4Q4DA 2NUBA 1I1NA 5F5NA 4KPFC 4EJ6A 1CG6A 2GM4A 1U9CA 3M9XA 4K46A 5DB4A 4MK4A 4E1VA 3K70C 3OLZA 3CCCA 1A5SB 2FDXA 5AVKA 3FDZB 4UFOA 1X1SA 3RUCA 2BH9A 1E2HA 1B6TA 1NYQA 3KVNA 2IYOA 3S68A 4I1IA 5C51B 1PNTA 5ED4A 5CT9A 5BMVA 2DKOA 2FZ4A 3NAZA 4HAOA 4YJ3F 3SSMA 2D7CA 3RD5A 1O6BA 4RDIA 2PNFA 4GQIA 4DQ0A 5BR4A 4BAUA 2IOYA 2P9FA 3FWNA 4HQRA 1YJ5A 2R7KA 4DRXB 3PC8C 2ZT7A 2ZDQA 3VOTA 4MWTA 2WW8A 2C92A 1CRPA 5CVUA 3TL6A 2B0JA 2CNBA 3PRHA 3QFRA 3OO0A 1B23P 2IZ7A 1PJ4A 1PLKA 3DEYX 3DD5A 2BM1A 1J0BA 1PZFA 2ID7A 2HCTA 4GS5A 2EERA 5F9HA 1S2DA 1DG9A 1L7QA 1WABA 3OPMA 2Y1CA 4K9NA 3WO0A 4CDMA 1ILEA 1HL3A 1RWMA 3LU1A 4MROA 3UAZA 3GLGE 3GZTB 5IARA 4DREA 4ARSA 2Q0HA 1BE1A 4Q47A 4U2FA 3TTSA 2ORVA 4RNDB 3TSOA 4EHKA 1OI7A 4YYZA 3SVLA 3RSFA 2C5EA 4AS3A 3E0XA 1PLLA 4GLFA 2WZBA 4HC4A 4JWTA 3U5ZB 1CZHA 3SN6A 1XQVA 2UUOA 4KN8A 4MWSA 5PGMA 3ZDAA 4KE9A 3JZMA 1C3VA 5JR3A 3FMOB 3OETA 4P4UA 3SY8A 5HJ5A 5M2QA 3EIXA 3MCVA 5B6IA 3FFXA 3EGXB 3LWZA 3R09A 2CW5A 4G24A 3WLSA 4L0MA 2KBFA 2W2KB 1P1CA 2BMEA 1E1KA 5LXTA 3OBIA 4NBKA 1JKJB 2HSZA 1KH2A 1A7JA 4I6EA 3V7FA 4AJJA 3EJWA 3QNUA 1A9YA 3CONA 1QHXA 2NNLD 3LY8A 5IAEA 4LBYA 4J3NA 3LVRE 4CLHA 3N2NA 4NAVA 4K9LA 4IL5A 5C8YB 1J23A 1PR5A 1QIEA 2D1YA 4DIKA 4BNDA 3MB8A 3V1MA 4D4MA 2I7VA 3AL2A 5IAAA 3V8QA 3R5HA 2A0FA 3RV3A 1T36B 4F3RA 3ANTA 2PMWB 1HE1C 2B21A 4MKFA 3S70A 3PQFA 4CF4A 2CXSA 1W1WA 4I19A 4K9QA 4LVNA 3W5VA 1QGUA 4LFBB 1FSSA 2AW3A 4I9NA 4KO8A 4YJDA 5BNFA 2V9CA 4MYTA 2XY4A 4K6OA 1X92A 2IBMA 1GU0A 3OPXA 3VNBA 1D2CA 1KSGA 5DBFA 4L27A 1RU3A 2LKDA 5CFZA 2VPQA 1KEKA 3HL4A 1GUZA 1A4IA 4XA8A 3WMRA 4ZYTA 5U1PA 3I01A 2HCJB 4PC2A 4PZPA 3WGQA 3H8VA 1PT5A 1V5GA 3B1WA 4YIKA 3HL0A 5IYZB 4D9MA 1A8SA 3HA5A 3P20A 2ZTVA 1CTQA 1KYYA 3TBHA 4D9FA 1IWBB 4EYSA 4LHSA 1RE1A 5FA6A 1JVSA 4NTZA 3H83A 3HRHA 4OA8A 3BXHA 3CH7A 1I10A 4D80A 2AN9A 5C5IA 2L18A 1X74A 2NU9B 1YE3A 2OB1A 2AMFA 2W6NA 4XYMA 1WPRA 1WW3A 3QWIA 1EP9A 3E9ZA 2XBMA 1J56A 1O58A 3VZDA 1K6JA 4EHFA 2OBLA 5A3SA 2W9XA 1F1JA 1QM5A 3IBFA 1ZGZA 5BXYA 1CUYA 3PPYA 4CCYA 3CMCO 3F1KA 4UUOA 3LTEA 4BMSA 3KWLA 5EZQA 4DSZA 2FW7A 3O74A 2QKYA 4JI2B 2HFJA 5FHQA 4FYJA 1BCRB 1ETUA 1R4AA 3GL9A 4MO2A 1OH6A 4RHUA 5F1PA 2GA8A 1U3DA 2A33A 4PS0A 1U80A 3KKQA 4QDXA 4BZQA 1S4MA 2GTPA 4W5OA 5HIKA 4B3CA 1D04A 3NXSA 1YUNA 4P53A 1C1XA 5ERGB 5BQOA 1O57A 3DOHA 4ZD6A 5DTEA 3N59A 4LXQA 1KP2A 1DX9A 1ZBQA 2HD4A 5FNVA 4DY6A 4MUAA 3R5XA 3SC6A 5KJ6A 3WYFA 2HA2A 2NG1A 3OQPA 1OT5A 1S96A 1V1RA 4Y2QA 5H4HA 2PUEA 2B1RA 2KX7A 4ZIRA 1QTQA 4EJMA 4AW9A 1G55A 2XIJA 3REOA 1Q77A 1NG9A 4TL7A 5TPWA 2VATA 4IDOA 3P2KA 1EDZA 3MK31 1QWSA 4MVJE 4DAOA 3FGNA 2R5NA 4ER6A 1ZS9A 4A3SA 4RF4A 1Z9BA 4HEQA 1Q83A 4RO0A 3R9KA 1KI9A 2G9VA 2C7RA 2JL1A 3USCS 2NLOA 3EGCA 3H2YA 2JJMA 3K1AA 5CH8A 1N2IA 1JQKA 2EF0A 5HF6A 3AESA 4FYHA 5ICFA 3VU3A 4AJEA 5FQOA 1R8JA 2J48A 5DIFA 4KZKA 3WBKA 1QDUA 5AJHA 2CV1A 1K63A 1FVHA 2W00A 3DCNA 2XQIA 4O4LF 2EJCA 4R01A 4D0LB 4MYDA 3O73A 4CMBA 2HU8A 1K8ZB 2J3QA 3ET5A 4GLJA 4JJ8A 4NABA 4X91A 3AR9A 1QRDA 2V6GA 2PBFA 3MPUA 1U5BB 1D9XA 1LRLA 4G9BA 4L73A 1T9AA 1X1BA 3M3PA 1L7DA 4YPFA 3TLZA 1K5GA 4AMVA 4HNAA 2DUWA 3TMAA 3TTWA 2B94A 4P7JA 4CKBA 4WEQA 4XYGA 5ICGA 1PW7A 3AFHA 3TWOA 4PANA 1YQUA 2FEAA 2DCUA 2XHZA 2HPZA 1QGAA 3GBSA 3U2QA 3WC4A 4BO7A 4TVKA 1ISJA 1SCBA 2PXXA 4TMZA 3ZU3A 3K70D 1E6UA 1T9HA 1RM3A 2IELA 1RI4A 4IWYA 1MOPA 3ANSA 4KWTA 5AVJA 2A92A 3AC0A 3C14C 4YP9A 3VSEA 3QLJA 4COKA 3WB2A 5HBRA 4BFUA 2IEZA 3TLEA 1YVEI 4TSRA 4I50A 5H70A 3WL8A 2ZWMA 3PKJA 5B1EA 3AUFA 2P6UA 3WO1A 1NHGA 3KTDA 4K40A 2FW8A 3D6VA 3HPQA 1OROA 3KDPA 5EVCA 4DAEA 1A5AB 5MGBA 5AH0A 4MWBA 5FO0A 1EGAA 4JSRA 2QX8A 1X7YB 3D1VA 4PNZA 3OKPA 1E7MA 4AJLA 1W6UA 2GI4A 3K09C 4G8CA 4PY2A 5JXHA 2E1RA 4E7PA 1N32B 2DBYA 2PAAA 5KNLA 3GRRA 1CEQA 2E2WA 2NXJA 1O96A 3OUZA 4O1HA 1M8KA 2XJ4A 4ZKDA 2FB9A 5KNBD 1NWHA 1XZIA 2JLCA 2P6NA 1P2BA 4KLZA 3KVYA 4XARA 4EF5A 4H7KA 1IJBA 2BEJA 1IONA 3K0FB 1UMCB 3M5PA 4D96A 3HYSA 2WD8A 3QY0A 3VNQA 5CA1A 4S05A 3TZ6A 1NU6A 5CRIA 1Y7PA 3C5EA 3RU9A 2WHXA 2Z8YM 3HEMA 1BCSA 2FJ0A 3KQSA 1E3WA 2DUUA 2LXNA 1UMBA 3FJYA 3LKZA 2BJVA 3NATA 3OJCA 4FTWA 1W73A 4JJFA 2FPMA 2WYVA 2ZYGA 4GL2A 4JUBA 1V5IA 3FYTA 3A32A 2H7XA 4FDUA 3URMA 1EHIA 5TDHA 4EHNA 1TQ8A 1DIRA 2OBBA 1P61B 3ROZA 4OJQA 4DLBA 3WLHA 4W5WA 4LKRA 3GVCA 1AKTA 3FUCA 4RFVA 3D59A 2Q6KA 1Q22A 4UXJA 2PUVA 5BXQC 2BHNA 1S4QA 2LGJA 2ZRAA 3HMQA 1HG1A 1BKSB 4RD6A 3U81A 3WWYA 3KHSA 4A6PA 3UC5A 4ZJPA 3HI6A 5I7OA 4HH3C 4CMJA 1E1RD 3OZUA 3V55A 4YO7A 1DEXA 3KJIA 3AEUB 3FF1A 4F60A 4B6JA 3JVIA 5AR1A 2D3WA 3RC9A 3DULA 4G5RA 3HA3A 3AEZA 5FTKA 4MIOA 1NR5A 4R41A 1VE1A 3IYLW 1TT5B 1WV0A 3E5RA 1LUAA 2FLVA 3HY6A 4LY6A 1O95A 4FGKA 4DR7B 1SN7A 2X2FA 2Q3DA 1YCDA 2F8MA 3B6IA 5KQGA 2QMZA 3WDMA 1SG6A 2DQ4A 5CCDA 2XEXA 3I53A 2ONZA 3NM6B 5G40A 3MJRA 1K06A 4DDWA 5EYPA 4GOOD 2NIPA 4TXHA 1QTNA 3F6CA 1JLSA 4HH4A 2XWSA 2OP0A 4BZWA 3ZU2A 5TY0A 4PM4A 4IWXA 3U16A 3NDJA 2HDHA 1P60A 1SD5A 5JCJA 5DX0A 3OT1B 3T3IA 2WINI 3GFGA 2OD7A 4LHWA 2WBLC 2XZOA 1Z6PA 3QU9A 1VBNA 2WTMA 3OSUA 4M9RA 2R6R1 5ESXA 1HWYA 4CR6A 3L9XA 1M6VB 4B4VA 1RWNA 4QRHA 2XLCA 4H0CA 4X41A 4AT1A 2IUSA 4H1HA 4R0NA 1TZKA 5DP2A 3THXA 3C6QA 2Z2JA 2W2VA 5CYFA 2VZ9A 1SHTX 3DZFA 5AK3A 5I9MA 3SJZA 1JLLA 4US0R 4D9HA 5J2UF 2DBRA 3L7JA 3QM1A 4ES6A 3BREA 1MMFB 2MMCA 3V1TC 3G9XA 4WZAE 5LA6A 4MVJH