3ZWAA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
727
structure length
727
Chain Sequence
b'VPRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 271
structure length 727
sequence length 727
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwaA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwaA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwaA01
1Z45A 1I3KA 2OFPA 2NTVA 1GZ3A 2YJZA 9LDTA 1PL6A 1CQJA 2PLAA 5BNIA 4GL4A 3PHHA 3WYCA 4CMKA 1I36A 3JCZA 1PGPA 2HK7A 4CV1A 3BTVA 3ZWNA 4U6QA 1JKIA 3MJEA 2B5VA 3SVTA 1T2EA 3DQPA 1MB4A 1K6JA 2J3KA 4ID9A 1FJHA 4EBFA 3KETA 2OORA 3JQ9A 2I66A 3JQ9C 2IEBA 2FZEA 3GFGA 4TKLA 2VSUA 1F8FA 3PHGA 4PIVA 1SB8A 4XA8A 2BKAA 4YAEA 3JQAA 4YCAA 3ANMA 5CEEA 2YQ4A 2JD2A 4XDZA 2AEJA 2PD3A 2UAGA 3U49A 5ADHA 3H6KA 4OQZA 4WE3A 1V9LA 3K92A 1XR3A 3GPIA 4OXKA 3V8BA 2VWHA 2P2SA 1YQGA 3VHRA 1KY4A 4URFA 4DPKA 3L77A 4PLWA 3R6DA 2I9PA 2Z5LA 4RDHA 4ZICA 1GAEO 5TX7A 3C7DB 1G0NA 4Z0MA 3K73O 1U8FO 2CY0A 5L4LA 3ZCXA 2O2YA 4J7CA 1LBEA 4UEOA 1R16A 5AVOA 3JQBA 3JQBC 1YKFA 1EZ4A 4QO7A 4CUZA 2V7PA 1Y8RA 4RVFA 1T2CA 1YRLA 2HU2A 2Y1OA 2BGLA 2YV3A 1Y1PA 3VH1A 3JD4A 4R69A 4D46A 2I3AA 4CV0A 4J1TA 2DTXA 2UUOA 1AE1A 4MOUA 3NV9A 4CR7A 1PIWA 5EN4A 3UCXA 1N7HA 4RJTA 1E1NA 2I5PO 4UUOA 3QVWA 4L75A 4EMLA 4QQRA 3ZW8A 2HKIA 4CUJA 1H6BA 3TOZA 3R9QA 5IKLB 1E3SA 1QYWA 5KTKA 4CQLA 1E7QA 3RFXA 1DC6A 5TIIA 1WDMA 1NHWA 3HQ4O 3U0BA 4Y9DA 2NLOA 4XX0A 4XJSA 4KQWA 3VOSA 3WWZA 2OGUA 1SO8A 5H83A 2CD9A 3E9QA 2VSUE 4FN7A 1CETA 4BNFA 4PN3A 1EMDA 4A26A 3PHJA 4E2WA 2AG8A 3ZNNA 2HMTA 3TZKA 4U7WA 2PBPA 2VCYA 3H5AA 5F1PA 4PGFA 3UOGA 5I9MA 4ALLA 2BF7A 4YEDA 4XYGA 4GAEA 1N6DA 1XQ6A 4PFJA 4D0SA 4D3DA 2NNLD 4LRSB 4M87A 1C0IA 3QVSA 1XLTA 2UZFA 3IUPA 1QYCA 1JXZA 1AXGA 1G6KA 4YQYA 2OHXA 5IN5A 4O6VA 1Z6ZA 4MVJF 5KCZA 4HWKA 2IEXA 4IDGA 1UYVA 4O63O 3ON5A 2EP7A 4XB1A 4DQXA 1NAIA 2ET6A 3DBRB 2XF8A 1L7EA 4XYEA 1KOLA 1IB6A 4J3FA 3ROQA 4NJOA 3EUWA 5TJ9A 3BHMA 4IZDA 3CINA 1HT0A 4NR0A 5IXSA 2VWPA 3O4RA 5KVSA 1Q1NA 1IULA 2Y1DA 4W9NC 4MIYA 5ITVA 1XELA 3OJEA 1ONPA 4YT2A 1X7DA 2BGMA 4LGVA 4ASIA 4XR4A 1W4ZA 3MTGA 4PZDA 2FPIA 4RPLA 4XYBA 3RQSA 2ILTA 2W3PA 4GMFA 4DLAA 3GGOA 2YFHA 5U4QA 4D44A 2GTRA 1XCBA 2DQ4A 2ZKLA 3RD5A 3PJEA 3QRWA 3UH1A 2CZCA 3WYEA 3GQVA 2FR0A 2UYYA 3PLNA 2BI8A 4J7UA 3QMJA 1GYQA 3GMAA 1PGOA 5KJFA 1RM5A 4MVJD 5JS6A 3GVPA 2GF2A 4GMGA 3GEGA 4R3WA 3TT7A 3KRTA 3L3SA 4RLSA 3GAZA 1N1GA 3DZIA 8LDHA 2ZL2A 5JW6A 2AMFA 2B4RO 2FR1A 3GGPA 3OH8A 1FCFA 3JSAA 4ZDCA 2XPCA 4WPGA 5A05A 4N5LA 3CKYA 1K6IA 3WYBA 5FF9A 2O3UA 3RIHA 5DN9A 3KSDO 4CMGA 5JCJD 1V0JA 1YJQA 5JBWA 1R12A 3SXPA 2Q2XA 1HE2A 4BIIA 2VYNA 3WJ7A 2HJRA 4D3SA 4IGEA 1YDWA 4MOWA 3W8DA 4IXTA 3RUCA 3DONA 2D8AA 1FC7A 2PGJA 1NPTO 1AXEA 4K3WA 3T4EA 3MYBA 2OUIA 3E5MA 5U9CA 1N9GA 1PGNA 3C7AA 2QQ3A 3JQ6A 2PK3A 2ZTUA 1MC5A 4YJGB 4NFYA 5T64A 3QVTA 4Z3KA 1ZSVA 3L9WA 3Q6IA 4K26A 5F1KA 3DTTA 3K30A 5JFOA 4U0GH 2GASA 1ZW1A 3UCFA 1HE3A 5JDCC 2CVZA 3DHNA 3OT6A 2IEDA 1F12A 3ZV4A 3V5EA 1EQ2A 1KC3A 1QLHA 3PIIA 3PEFA 3HNPA 4FJ0A 4MI2A 2F6IA 4PLPA 1WLYA 4JLWA 5A03A 3WSWA 3NJ4A 1Y8QA 2JAHA 3H2ZA 3KTKA 2GN8A 3OA0A 3ST9A 4K2NA 3WG9A 4C7KA 4FZWC 4XDYA 4LSWA 4GHNA 4JSBA 4ZU2A 3HJAA 5G0WA 5DT9A 3A14A 4QO8A 1Q7GA 4P8RA 1P74A 4CLDA 5AQ1A 1XNYA 5F5LA 3L4SO 3ONFA 1OD4A 4EMMA 3LF2A 1B16A 1D7OA 2P4HX 3TNLA 2FW2A 3NX4A 3VVBA 3STHA 1YE3A 1T4BA 3HWRA 3PFWO 2VREA 1X1EA 2XXBA 3K5PA 2PY6A 4GKBA 4J16A 3WJAA 2HUNA 1BTOA 2CDBA 2EIHA 1HDXA 2X5OA 5JC1A 2J5KA 1UXGA 2GN6A 1YBVA 1V3VA 3GG9A 3O38A 4XQEA 1MXFA 5THQA 3NAQA 1R4MB 2H1SA 2P9GA 2G5CA 4YAIA 4JCSA 3M1AA 1R0SA 1P0FA 5IN4A 4L74A 4YDRA 1T24A 4PG4A 4I52A 1ZEJA 2AHRA 4H7PA 1V8BA 1EUDA 3GF4A 4CMAA 3DBLB 1WZEA 5JBIA 4W99A 1H5QA 1DAPA 1ZK3A 2VQ3A 3DBVO 1LX6A 1W73A 3WFJA 4DGSA 5DU4A 3DMYA 1YBAA 1I8TA 4QXMA 3ROKA 2PH5A 3QYRA 1PJBA 2DUBA 4L8KA 1QRRA 3U3XA 2J3JA 3EMKA 5A5FA 3F6YA 4AJLA 1IE3A 4H16A 1M6HA 1ZJZA 4BO7A 1AN9A 2QZZA 1UDCA 4EZBA 3Q2IA 1QG6A 3I83A 4M89A 3WLFA 5JAZA 1TI7A 1PWZA 1ON3A 3S2EA 4Y67A 2EWMA 2Q4EA 5CEFA 2G1UA 1N8KA 3D1LA 2YV2A 2F6QA 4FR5A 2CBYA 3K50A 4FN8A 1NXQA 1PQPA 1UJMA 4UVDA 1EQUA 3Q9UA 4PRKA 3RUHA 1WVGA 3K6JA 3OFSA 4AJJA 3MOGA 5JCXA 4XGNA 5CPBA 3M6MA 2NU9A 3AUSA 3PQEA 1HDGO 5FFFA 3T89A 3UW3A 3M6NA 3OBBA 3D5QA 1C1XA 1JAXA 3KM0A 4FBGA 1DSSG 1HRDA 3H4VA 1H0KA 3ZNPA 3DZGA 3NGXA 3TFQA 3E1KA 2UDPA 4NBWA 4OM8A 2VOJA 1KY5A 1LLDA 3C3XA 3PP8A 3DZHA 3RC9A 2PGDA 3LC2O 1NNUA 3E9MA 3D0OA 3GT0A 1H6CA 4K6FA 4LSMA 3WICA 4ZGWA 3RSIA 4FB8A 4PLCA 4ALMA 5CDSA 3FWNA 1SC6A 4GVLA 4WKGA 5JYDA 3IC5A 4AICA 5L7WA 2EJVA 6ADHA 1DIHA 2NTNA 3U62A 3U4HA 1A27A 3AI2A 5B4TA 2VYND 2GYYA 3TN7A 3PGXA 4WCZA 3R9SA 3TDCA 2JFFA 4NH4A 4ZRMA 3N7UA 4BQRA 5BR7A 1DUBA 3I4CA 1R4MA 4NU5A 5AXCA 2WD7B 1HYEA 1F14A 3MTJA 2I99A 4J6FA 3PJDA 4KQXA 3DEYX 3OSUA 4XCVA 4OO3A 4DREA 3F1KA 3T7EA 2NU8A 4FFOA 4NEKA 4TRMA 4GGOA 5EQDA 1ZJYA 1O95A 2EKPA 3L4BA 5C90A 3L4BC 4MVJM 1DEHA 1DFHA 3MJVA 4CV2A 1BHSA 1IOLA 3ZW9A 4OSPA 1BSVA 1TLTA 2PGLA 3G1TA 5A4DA 3EVNA 4D7AA 5DBIA 3O8QA 3RBZA 3DMTC 3QA9A 2C07A 3F4LA 4QT0A 1Y6JA 4Z3DA 2V6MA 3RKRA 2QRJA 1PZHA 3BA1A 3DJAA 4WYOB 3FNFA 3QQPA 3QWBA 3QXZA 4NK5A 4YT5A 5DZKA 4CLOA 1H9AA 1VM6A 4PVDA 2X1HA 1PS0A 2WYWA 4RPJA 1BXGB 2RHCA 3F46A 4R01A 1W2XA 1MFZA 4DMLA 5KVCA 1VRGA 2FBMA 3FRJA 5HM8A 3PZKA 1LA2A 1K2WA 1BVUA 1D4FA 1C0PA 3D3WB 3JD1A 2NP9A 4CM3A 2JCYA 2OL4A 3DZKA 3DZBA 2ZCVA 4MIEA 3RWBA 1YG6A 1CF2O 3WGGA 3SLLA 4QECA 5JAMA 3OMEA 2D1YA 1U7HA 2ZIZA 3VIVA 1DRUA 4WEQA 2W98A 1XNVA 2E49A 4LCEA 5G1SA 4FNDA 2HLPA 3EZYA 4UVIA 2Q2WA 5L9AA 1UIYA 5DTWA 1A72A 4XEHA 4Z0PA 4MO2A 3WS7A 4OSOA 2X4GA 3I1JA 4UEKA 4S1VA 3ZU2A 4E5YA 2X9VA 3BIOA 4R9SA 4TRRA 4XIYA 2J5RA 4MVJG 5TC4A 5U1PA 3MEQA 3B1FA 2BGKA 1EUCA 3ZWOA 1ONNA 3TT6A 1NWHA 4KZPA 3ST7A 3VH2A 1M2WA 3QK8A 4Y6SA 3HFGA 5DULA 2BH9A 3T8AA 1P0CA 2HMWA 1E3WA 4PLVA 4CM9A 1P33A 2O23A 3AU8A 1R0LA 2AA3A 1EDOA 2BZRA 1T1SA 2WD7A 3G3EA 4YPOA 2F9IA 2PV7A 3QKAA 4IBOA 2C7GA 4XIJA 1ZIDA 4DQUA 1DIAA 3FF6A 2WE8A 3DHEA 1ONOA 1D1TA 4E5MA 4YJFA 1ISMA 9LDBA 2CUKA 2O4CA 3ASUA 3IKVA 3OC7A 4OIMA 4RGBA 4JROA 4AJHA 4IDAA 1EFLA 5JDIC 5HBRA 3ZWYA 5FUSA 3M6IA 1PJTA 3A9WA 1I3MA 3NKLA 3PYXA 3PZBA 4XGKA 4BNYA 2DBZA 4R3NA 1B14A 1I01A 2AE1A 4CM6A 3I47A 5TT1A 5G2OA 4HY3A 4RCVA 3INTA 5DL1A 3PIDA 4J2HA 2J5QA 1LNQA 3H9QA 4ZQGA 4WZ8B 2YDYA 3RBXA 5G1QA 1ZFNA 2B69A 2D5CA 2QQ5A 4CM1A 1JW9B 3H9GA 5FI3A 1HLPA 1PJ4A 1GL3A 3PDJA 5FI5A 4KUHA 3DZFA 2Y1CA 4DLBA 3GK3A 4LCJA 4PLGA 1DB3A 4WCFB 2XOXA 3ZGYA 1TYFA 2ZQRA 5E0SH 1LSUA 2DAPA 4BV8A 2GUGA 4QIJA 3NUGA 4FFLA 4IUYA 4IXWA 3QVXA 4W4TA 5A1TA 2VWGA 3T3WA 4WECA 4BB5A 4BNZA 2QYSA 1EF8A 2EW2A 3P2YA 3PHLA 4WNCA 1FDVA 3UUWA 3GEDA 2ZATA 4HP8A 3CXRA 3A06A 3RCBA 1ZMOA 4FDAA 3F47A 4JOTA 2OBYA 1ZH8A 4NBVA 4BO1A 3BPPA 3GVHA 4LMPA 2PZLA 1U9JA 1ORRA 5JY1A 1PJQA 1IL0A 1B8VA 1U3TA 1NPYA 3JD3A 2PNFA 3N74A 4MVJI 4B3IA 3INGA 4IMRA 1V35A 1FXSA 1J0XO 2O7SA 4U0KA 3DOJA 1XGKA 4PCVA 2P9CA 3GRKA 3C85A 1A4IA 5IZCC 1NQOA 1XU7A 4ELWA 2EKQA 3HP0A 1WMBA 2EKLA 5IJZA 1IPFA 4BL5A 3LLSA 4ND3A 1KVUA 1E3IA 1X13A 5C37A 2EG9A 1IY8A 1Q0HA 4R1SA 1I10A 3G79A 3QY9A 4Q3CA 5B1YA 3NJ8A 1LDBA 3H8VA 2NTJA 1DFGA 4NMHA 4CR6A 4PLHA 2D2IA 2X9NA 1WNTA 1WAMA 5TQVA 3TLFA 4I5DA 3E82A 2JCXA 3GZ4A 3F9IA 3KXDA 3WX0A 3N6RB 2J5GA 3KYDB 4FZWA 1BRMA 2NU6A 3T4XA 5ENDA 3NTQA 2RAFA 3W8EA 4YT4A 2J5SA 2PG8A 2Y1GA 1U8XX 3NT5A 2PPYA 3KTJA 1S6YA 4GX5A 3HE3A 1E6EA 1HETA 2ZB4A 4A10A 1SPXA 2BD0A 3RSTA 5I7EA 3ANLA 1UDAA 1D8AA 3I9KA 4ZDFA 4B4WA 2YDXA 1SNYA 4IPTA 3DAFA 4JBHA 1HDYA 4FN4A 1NVGA 2EGHA 1B3BA 4R1TA 4U8GA 4XRGA 4CLEA 3SBOA 4E21A 1U2GA 2X0NA 4UUMA 2CVQA 4D79A 4WCFA 1MP0A 2C5AA 5JYEA 1GQYA 3DBHB 3FSRA 5CHEA 1PSDA 3LSYA 5A9RA 2R6JA 3P2OA 4QIIA 3KEQA 5DP1A 2UV8A 3ICCA 1HLDA 4FFRA 1NZYB 4ITUA 5TJHA 3B6ZA 5F21A 4CMHA 4WUVA 2OMEA 5I8WA 1JDJA 4DI1A 5L4NA 1E77A 2VUTA 4FJ1A 4CM9D 1T2AA 3JQ8B 4JIGA 4LRTB 1GV1A 1R37A 3ZHZA 4CQMA 4PVCA 2OP1A 1DAOA 4YB8A 3LQFA 1J6UA 5EQFA 5A02A 5B37A 1ULSA 1QP8A 3BMQB 5BNFA 5JPIA 3OP4A 3EW7A 4ND2A 1IHXA 4L4RA 3WG5A 4JWVA 2VSUC 3JYLA 3ZHBA 2GERA 4BNUA 4G2RA 2Q2QA 4BKOA 3WGIA 5L45A 3P7MA 4R5MA 2Y1EA 3TRRA 2GPTA 3NDRA 4RPGA 2V65A 4ELSA 2FSSA 4AL4A 1VL8A 3RUFA 5ITWA 1I30A 1O89A 2EERA 3HN2A 2WD8A 2G0TA 3OEWA 3OIDA 4YJHB 2ZB8A 4R68A 2Y0CA 1E7YA 1HNUA 1VKNA 1NM5A 2PZJA 4FD3A 4D41A 2ZYAA 1DC4A 4RVHA 4Y6RA 2ZJ1A 1U3UA 4DPLA 2ZQQA 2D4AA 4KOAA 1GYPA 1QORA 4NI5A 4NHEA 1ENOA 4RO0A 1PR3A 2VSSA 2HCTA 3WMXA 3ASVA 3Q0JA 5KKCA 4CM7A 3R9TA 3GF3A 3KYDA 4K1LA 4NBRA 1W8DA 4RLHA 4TMFA 3LC7O 3MWEB 2VHVA 4PRLA 4Q3NA 1AUPA 3ROPA 4YAGA 4DLLA 3F1LA 2JKVA 4N18A 2VUSA 3D4OA 1OMOA 3OICA 4IDCA 5CDUA 3I9MA 4JCTA 4ZD6A 4B7XA 3RUDA 1X14A 3C7CB 2GDZA 1SB9A 3RU7A 1NR1A 2PD4A 2YZ7A 3DBHA 1UYRA 4CM4B 4P38A 5ER6A 3FTNA 3H0SA 4ZQEA 3T88A 4GPD1 4KWHA 4FCCA 1WP4A 2VRCD 3CPSA 4GKVA 4AVYA 1LUAA 3ETGA 3D3EA 3QWAA 3VC7A 3GAFA 4R1UA 3JQ8A 5DTPA 1EK6A 1VKOA 4RVUA 2O3SA 2FZSA 1PIXA 4UVHA 4OGWA 1BDMA 1PS9A 2X23A 5AXDA 1O9BA 1ADCA 4LN1A 1I5RA 4Z6KA 1UH5A 1GDHA 3KUXA 5HRUA 3G64A 3JYOA 3BMQA 1IZ9A 5E0SA 2XAAA 5IFLA 1O5IA 5G4LA 3BMCB 1I0ZA 2CF5A 4IS2A 3RC7A 3U9LA 5LDGA 1GFSA 1ZVMA 4F3YA 4HX5A 2X5JO 5GZ6A 4NJMB 2X9GA 4NIMA 4WOKA 3RFTA 1XHLA 2C2XA 3R3SA 5L40A 5LCXA 4BGUA 4JJGA 5F1OA 1EVYA 5IZ4A 5IG2A 4DVJA 1LLCA 2HMUA 4FNBA 1SBYA 2VSSE 5KJPA 5C5IA 2VSUF 2CMDA 1D1SA 3ZU3A 3GG2A 4IY1A 4NFSA 1GPJA 4JXKA 3LK7A 1HDRA 1TXGA 2W2LD 3JYQA 1FDTA 1MC4A 2EJWA 1WMAA 4OKNA 1EBUA 5DOVA 4TVBA 4J43A 3JQGB 3Q3CA 1QR6A 4NG5A 4XZ3A 1LDYA 2Q1SA 2OP0A 1A71A 3IDSA 1E5QA 5DF1A 1D3AA 1HNOA 1DIRA 5CPFA 4R51A 4CV3A 4RYFH 3NTOA 1PL7A 3VKVA 1C14A 3L0DA 2VTDA 2PKQP 4QX6A 4UAGA 4BS9A 1XO6A 2OZPA 3GR6A 3KO8A 4K29A 3N58A 3DXFA 1DPGA 3GHYA 3T8BA 2W90A 4ZHSA 4DUPA 3HB5X 3WMWA 3BMNB 4G2NA 3MCVA 4PZCA 5TSDA 4HNKA 3ZI0A 1M67A 4CQMD 3Q0EA 4HFJA 4U18A 4CM4A 3KTGA 1JWAB 1A5ZA 3RUIA 2QIOA 3QREA 2NVUB 1P44A 3WTCA 4Q3AA 3GDOA 5A3JA 1NBOA 1HTBA 1Y81A 4IIVA 3HDQA 4YAJA 5T5QA 4OG1A 4HV4A 3JQAD 2QX7A 1HDOA 4UVEA 2VNAA 5CP8A 3QWDA 4ZU3A 1HYGA 3I9OA 2DTDA 3S55A 4IINA 4GWKA 1K89A 3BTSA 1LLUA 3IUSA 3JYPA 1T1RA 4WK6A 1UAGA 3ZWWA 5H82A 1F0YA 1IHYA 5TS3A 3D64A 2DC1A 3BMCA 4WLVA 5KJCA 4II3A 4ND1A 1YB1A 4PLTA 2DKNA 1H6DA 3V5NA 2A7SA 3AOEA 4GSKA 3MJTA 4NQZA 3H0QA 4CR8A 5IXYA 1R4NB 2VHXA 5HWSA 2J5II 3AUAA 4JYLA 2P5UA 2D59A 5KIAA 4P4NA 3SJUA 4L0QA 3VH4A 1RKXA 3UFXA 1XEAA 2Z1MA 4BNHA 3AUTA 3B1JA 4II2A 1VLLA 3LAOA 4J90A 1P1JA 2JD1A 3E9NA 4TROA 3BAZA 1BGVA 5FIFA 1DCIA 3KOUA 4OJNA 3QWHA 1DLIA 5FWNA 2B35A 1RWBA 3DBRA 1F17A 1VC2A 1NX6A 3SEFA 2ZQYA 3S2GA 4EITA 5KWEA 4FFNA 4FSHA 4CODB 2Y0EA 1U4SA 1PEDA 2J5IB 5FYDA 1JVBA 1EY3A 3CMMA 3RSHA 4KTTE 5DNAA 4B7CA 3RBVA 1MG0A 5ILOA 1TB4A 2O4UX 2RIRA 4IDEA 3WB9A 1GD1O 4CJXA 1DRWA 1CERA 4B4VA 4J1NA 4QSMA 1L7DA 3RJ5A 3TZCA 3I6IA 3UN1A 3DR3A 3OMLA 3AY6A 3A4VA 4GX2A 3EHEA 4F47A 2C7VA 3I9LA 2F00A 3BMNA 4N5MA 4E30A 1DJQA 1VJTA 4J1SA 3BZUA 1Y5RA 4MP6A 2AE2A 2NUAA 5GZ3A 4XKJA 3VPHA 4ND5A 2ZB3A 4CMIB 2NVUA 2HRZA 4DYVA 1ZK0A 4ESOA 5TGDA 1ADBA 1YG8A 2Y67A 3U5TA 4QFCA 5COQA 2YHUA 3F3SA 3DHYA 2B4TO 4A7PA 4HNGA 2WYUA 3LVFO 3AY3A 3ICPA 3ZH2A 3G49A 3JYNA 4B79A 1L1FA 2A4KA 4MIOA 2YW9A 3WBBA 3UVEA 2VYVA 3QWFA 4UULA 3ULKA 1B26A 3IKTA 4HNHA 2C59A 3QSGA 1ZK4A 3FNGA 3U4IA 1QYVA 3GDGA 2NV6A 3H65A 4Y8VA 1IUKA 1UXHA 2P91A 1YL5A 5COBA 3IIEA 4M54A 3RKUA 4U0HA 1P1KA 3WBFA 2VN8A 2C54A 4JYJA 3GKBA 4J49A 4WLUA 3OJFA 2LDBA 3GVXA 1QXSA 4M1QA 4FJWD 3WIEA 5L53A 5TLSA 4EDFA 3WWYA 1SCUA 4LISA 1UZMA 2E4AA 3LT1A 1SAYA 3EGOA 5C3MA 4L4XA 4R16A 3KTIA 1LRJA 3U09A 5IAAA 1BVRA 2BFAA 2PFGA 2JD0A 4YJGA 4L6WA 3Q7HA 5BSEA 3RVDA 1HF3A 1OC4A 2AEFA 3SWXA 4AJ1A 3BYZA 3L6OO 1XNWA 4Q0GA 3TFOA 1R66A 1K0UA 1E1MA 4TQGA 4W82A 1RJWA 4IZHA 1KETA 1UDBA 2DBVO 4PLFA 3GEMA 3KLMX 1ZMTA 1BDBA 1OBFO 2I76A 4RDIA 2JCVA 4HFMA 4EUHA 3FF4A 4BGEA 3H7AA 1PGJA 3HZZA 4DIBA 4XYLA 3WGYA 4FC6A 4KDFA 2HRBA 1NFFA 1QMGA 2HK8A 3QLJA 4LK5A 1HEUA 4BMSA 1X0UA 3SLGA 4JCOA 1YONA 5KVVA 5A3VA 2Y99A 1JLLA 1KERA 3UCEA 3FD8A 5CEJA 2GN9A 5BT9A 4H15A 3V2UA 3JD2A 1WXDA 4FFMA 1FMCA 5EMHA 4FPXA 3ORFA 4IDFA 3K31A 4K9DA 1I24A 1KVQA 1HSZA 4ALKA 2DU8A 4TRNA 3WGHA 3VKUA 4DQVA 2WMDA 3A1NA 2GO1A 5A5EA 4B7UA 2EXXA 1HYHA 1Q52A 3ITKA 4KWIA 5AOVA 1F06A 4M86A 2XXJA 1LU9A 4DIOA 2I3GA 4TSKA 5C7LO 3VTZA 2HAEA 3RFVA 3TDKA 3H02A 3S8MA 4PLZA 1A9ZA 3LF1A 4RF4A 4CL3A 1E7RA 1MUUA 4BO9A 3W8FA 4BKUA 4BNNA 1PJLA 3GN2A 2BFOA 4L8VA 4OYRA 5KJ1A 1U4OA 2VZ8A 2BMAA 1BG6A 3DBLA 5JAIA 1UP7A 4ONEA 5LDHA 2A7KA 1JTVA 4ZQHA 4KP7A 3UKOA 3DC2A 3WQSB 4N5NA 4ELXA 1GPDG 4J4TA 4RPHA 1XA0A 4GVXA 2WTBA 2FOIA 1Y5MA 2BRUA 4RQTA 4B3HA 4G81A 4YACA 3VPXA 4YT8A 1Q51A 1BWSA 1P1IA 1VI2A 4KNPA 2AEMA 3BMOB 2X22A 4P4LA 5ILGA 2UUPA 2BFPA 8ADHA 3P2LA 4IZBA 3MT6A 4NBTA 4A0SA 3G1UA 1EFKA 3TL2A 4K28A 1DIBA 2F1KA 1RM4A 2GZ1A 3S1LA 3VPFA 1GADO 3F4BA 4D0RA 4Q3EA 2YHIB 1LEHA 2IDZA 2RHRA 4OOEA 4D45A 4BKRA 1Q2XA 2C82A 5DOZA 4ZA2A 4KPKA 1NAHA 3H3JA 4FOOA 1JQBA 4KDEA 2P5YA 1NASA 4CLRB 5HTOA 1A7AA 4ZVVA 2GLXA 1LLQA 4C7JA 3H9EO 1CRWG 3PK0A 1EE9A 2JHFA 3A28A 4RL6A 4AJ2A 3PGJA 3C1OA 2WEKA 3AM5A 3VPSA 4FJ2A 2RBEA 4R4JA 3L6EA 5IDYA 4YXFA 4RCNA 1Z73A 2NQTA 1XSEA 1NWCA 4U0GA 1C0KA 2E37A 3FI9A 4I9NA 1LC3A 2CE3A 2VYVD 5G0SA 1DIGA 1SZJG 1DXYA 1ZXLA 3WNQA 3HHPA 4FW8A 5A06A 4I1IA 4RF3A 5K6AA 5K6AC 3G17A 3ETEA 3AFNA 4YA6A 1PJCA 3T7CA 4JX8A 4IQ8A 4XJTA 1PS8A 1PGQA 4BNVA 4EJ6A 3AFMA 1PL8A 3OM9A 1LDNA 1MGOA 3KLPX 5I7SA 5A9TA 4MJLA 4BNWA 4ZDEA 4MVJH 2QRLA 3D4NA 4XGIA 4DXHA 3WGQA 1PJSA 3FTPA 3Q9NA 3R3JA 3Q2KA 5CDGA 1ISJA 3WGOA 3ROMA 5BNTA 2PTGA 5CDTA 3ZHYA 1FK8A 4MKZA 1E5LA 2YY7A 2DFVA 2AQ8A 3KB6A 3TV5A 3CZMA 4JJTA 4HFRA 3U9SB 2VRBA 2WE7A 3VH3A 3AI1A 4F6LA 2GCGA 4H3VA 4Y98A 5THKA 2Y0DA 2W2KB 4TZKA 4Z9XA 3HADA 3TPCA 1PU2A 3ZNOA 1B7GO 4E0BA 4IGFA 2PZKA 3PWSA 3Q0GA 4EW6A 1N6EA 2Y05A 4XRRA 4ZQFA 1QSGA 3AJRA 1T2FA 5G0UA 1GUYA 2YHIA 5BSFA 2GRAA 3W4JA 3HFSA 4BMNA 5ER9A 5G1RA 4EMPA 1BXGA 1GR0A 5C7IO 4ZRNA 1SOVA 4R9RA 3PGQA 1TEHA 5AYVA 2FY8A 1NFRA 1VPDA 2NSDA 2NVBA 3D3WA 4HADA 2NU7A 1QKIA 2JHGA 5IDXA 4GM2A 4A03A 1ZO8A 2PH3A 1BXZA 4I9HA 1Y7OA 3LYLA 3X2FA 3QHAA 4R1NA 1X15A 3ZWMA 3AM4A 5T6BA 1E3EA 3AY7A 4KUEA 3OA2A 3OJLA 3GUCA 2F9YB 2B5WA 4YR9A 1G1AA 3R1IA 3STAA 2GZ3A 1KEUA 1X0VA 2IXAA 4FOSA 3BEZA 3I6QA 4EEZA 5HS4A 4FS3A 4EYEA 4AJIA 2YFQA 4U5QA 2PKQO 3BHIA 1TT5B 2O48X 1ZK2A 4BNJA 1CWUA 2FR8A 3GOHA 5TT0A 3CE6A 5CAEA 4BUCA 3H0UA 4OQYA 1ADFA 2C20A 4NU6A 2FPPA 4PLYA 2PR2A 4JCRA 3GNSA 4GGPA 3ISAA 3H9UA 1NPDA 1P1HA 3L9XA 5A04A 1Y7TA 1GV0A 3JQ7B 5IF3A 3AK4A 3C1TA 1ZUD1 1H94A 1NQTA 5TNXA 5KNLA 3PYMA 1Q7CA 2Q35A 1MXHA 1YDEA 3I9NA 1SEVA 4YYZA 5JAQA 1H2BA 3RJ9A 1HZDA 4IQ0A 1JWBB 3NT4A 4BNTA 4WJZA 4PG8A 3FDUA 3OEYA 3TJRA 5DU6A 1ZK1A 5BSHA 4RF5A 4EGFA 1ML3A 1B15A 1XDWA 1LC0A 5KJ6A 3QJ5A 2D0IA 1Q0LA 4IMPA 3DOCA 4BVAA 4J4HA 2I67A 5AXBA 1T4DA 4CLHA 1VL0A 1A7KA 4GLLA 4E13A 3TOXA 1AGNA 4FQ8A 1UAYA 3DOOA 4E2ZA 1Q0QA 2JFGA 4ZQBA 3L07A 3V1TC 3OJOA 3GDFA 3F5QA 3FNEA 5TRTA 1GUFA 3R0OA 4EUEA 3TZ3A 3KV3O 1XWFA 4X54A 3CH6A 4GSLA 1UR5A 1FC6A 1ON9A 4R41A 3FHLA 3MZ0A 3BF0A 2DVMA 4CL8A 3OQ1A 3GMSA 4IJVA 4WLNA 4NZ9A 1P1FA 5EL0A 2J3HA 2UVDA 3C8MA 2CF6A 4CMCA 3MJSA 1ISHA 3KBOA 1YQXA 1KEWA 1HL3A 3FCOA 3WFIA 1KC1A 3VVCA 1B2LA 4ALIA 3TZHA 4HUJA 4YRBA 1YL7A 4W7IA 2AG5A 3WQQA 4BO6A 4WCFC 2H63A 3VZQA 1I2BA 2WJPA 3ZHXA 4MKRA 4E5NA 5JMPA 1BW9B 5T57A 2H6EA 3WGTA 3WDSA 5KDRB 4KWBA 1EDZA 1U5CA 2EEZA 4EEXA 1U2DA 5AXAA 3PQFA 3GHHA 5CG2A 4JNKA 2F9YA 4M8SA 1HWYA 1P45A 2DUUA 1LI4A 3Q1LA 4D42A 1PZFA 3CZRA 3GY0A 3TSCA 1H2HA 5CFZA 1PQWA 3HE2A 1Z7EA 1J7XA 2X7HA 4CLXA 3VTFA 3NJBA 4XQCA 3UGKA 1TT5A 5EPOA 2Q1TA 3EDMA 5JLAA 4XQ9A 4RVSA 1XQ1A 4B4UA 2H5LA 1H93A 4LW8A 1J49A 1KYQA 2H9IA 2Q4BA 4JN6B 3VAZA 3SC6A 4CQLB 3RRVA 3FPCA 1XIVA 5KVQA 1ISGA 1YOVB 1N1EA 3CTMA 3NGLA 4UVGA 1S7CA 3JQ7A 5INGA 1KEVA 3IAHA 4GWGA 1TVEA 4A27A 2CSUA 4B8WA 7MDHA 1PZGA 2YV1A 1GY8A 2Y68A 4PG7A 1BMDA 4BHTA 2A94A 1KEPA 4KMSA 2IRWA 1OFGA 2RH4A 3PJGA 2EF1A 3W4IA 5I9LA 2HMSA 3EY4A 1QYXA 1KVTA 3O03A 2CFCA 4A73A 3WXBA 3V5IA 4RQUA 2P68A 4WLEA 1I32A 3MWDB 1R0KA 5DCWA 3GPDG 3S2IA 4Y6PA 1B8PA 5DBFA 1P1RA 5JE8A 4MVJA 4JQCA 5EESA 4YRAA 4M49A 3NDIA 1RYEA 4P4GA 1M66A 4U19A 4TKMA 4MVJP 3B1KA 3OIFA 1GQQA 4I5EA 4NDNE 1QV6A 2Q2VA 3ZWPA 3ZWCA 1C1DB 4DA9A 4RPKA 2RH8A 1W0CA 1VE9A 7ADHA 5K0ZA 2O3RA 3IP1A 1GZ6A 3JV7A 3TVUA 2RCYA 3C1AA 4XB2A 5B12A 3M2PA 1Q7BA 3NRCA 4XQGA 4B4OA 5JBXA 2LDXA 1EVIA 1WDLA 2C29D 4OLQA 3ITDA 3HDYA 2ZB7A 5JCJA 1X7GA 1YQDA 3TVWA 4J4BA 4DYDA 3WQRA 2OXIA 4BO4A 2X0IA 4LK3A 3C24A 4EUFA 1N7GA 1T2DA 1J5PA 2Q49A 1BW9A 1YB4A 3PJFA 4LMRA 4Q3DA 5JC8A 5ICSA 3UXYA 5KDRA 2X0RA 5G0VA 3PPIA 3GUYA 2HMVA 1NZYA 2Y66A 3GC6A 3FR8A 1JAYA 2R2GA 3EZLA 5JMWA 3V2GA 3WR5A 1LDGA 1I33A 1B8UA 1AHIA 2JFHA 3MOYA 5JO9A 3SLKA 4O1MA 5DU8A 3GN1A 1UZLA 3JQEA 4BGIA 4Z9FA 3WIDA 3DZJA 2VHYA 2Y93A 4L4SA 3AUUA 5BSGA 3AI3A 1I3NA 4BO3A 4RV9A 2X8LA 3JQFA 1YOVA 3JQFC 3QIVA 1NR7A 3K2EA 3ABIA 3ZV5A 4R54A 4IQGA 1TT7A 1WW8A 2A9FA 2FP4A 3KHUA 5DDIP 1YB5A 1Z82A 3ENKA 3H81A 3NJDA 2R00A 2FRDA 1UYTA 2R00C 4WEOA 4MVJE 2IZZA 2ZK7A 4K6CA 4YTEA 1UZNA 2J5GD 3AWDA 2FWMX 2PD6A 3ZWBA 3UF0A 4Q1IA 4YJHA 2YQ5A 1FDSA 1X7HA 2AW5A 3QWIA 5JNLA 3ENNA 4WCDA 3PHIA 3PTZA 1KS9A 1GCUA 4OOFA 3RI3A 1LDMA 2PA3A 1JU9A 1I3LA 4OKIA 4ILKA 5JY6A 4YRDA 3PZRA 4BNXA 1DDOA 2HSDA 2ZYDA 3GMDA 2X58A 3TF5A 1Z7BA 4PG6A 5E0NX 2C8TA 1V3TA 2P9EA 1C1DA 1K6XA 3GRPA 2IZ1A 3Q1TA 4CM8B 1DRVA 2C0CA 4BKPA 3ZDFA 1CJCA 4CMBA 3TWOA 3GLQA 4YWJA 1K3TA 1ISFA 3H2SA 2GZ2A 4OMUA 2NACA 4F6CA 3D4PA 2VSSF 1DOHA 3CUKA 1M76A 3ONDA 4Q9NA 3RUEA 3ZZNA 5CDYA 1GEEA 2GGSA 3DTYA 3DO5A 1N9GB 4OAQA 4WLOA 2FPGA 4RF2A 5IDWA 5G4KB 5I8ZA 4RORA 2J6IA 3IL2A 1NFQA 3K8ZA 5DZSA 3GLMA 2B36A 4W9NA 4AJNA 3ADOA 1FDUA 1FC9A 2POQX 3JTMA 1Z75A 2DTEA 2Q1UA 4FGSA 5JSFA 5I7VA 4JBIA 1T26A 2VZ9A 1T25A 3PXXA 5C7OO 3DB2A 1E7MA 1DC3A 3LT0A 1CYDA 4DWVA 1XKQA 1Y8QB 4JJFA 4FC7A 5J23A 4QFDA 4JFCA 3PI7A 1GEGA 4YBZA 2C5EA 1EVJA 2IZ0A 5BQFA 1GQ2A 1MV8A 2GSDA 5HS6A 3OF2A 1ZKMA 1U7TA 3D5TA 4NK4A 1X1TA 3DORA 3FPLA 5CTCA 1ARZA 2Q1WA 3P5MA 4DC0A 3UICA 3VZPA 4NJMA 3P85A 4A2CA 3AU9A 3AOEC 3QV1A 2CDCA 2E48A 1SMKA 4UEJA 4DMMA 4Q39A 5GY7A 2VX2A 3I23A 1NVTA 2VT2A 4AJ4A 3UHAA 2VTEA 5GZ1A 5DBGA 1LSSA 1M6WA 4G65A 3HN7A 4DIFA 2ZL3A 1PQUA 3TZ6A 4E6PA 1PX0A 4QEDA 3H0JA 1Y9EA 2QHXA 5JXWA 1LJ8A 2ZL0A 1HXHA 2QRKA 3JQCA 4BKQA 2DPHA 4B3JA 3QP9A 3H3FA 2FSVA 1ZCJA 1GYRA 3JQGA 1B3RA 2ZCUA 4YAKA 1W6UA 4HBGA 4ALNA 1U1IA 2ZTVA 3P19A 3O26A 1IZ0A 2GNAA 4IIUA 5EJ2A 4GQAA 3PRJA 4QUKA 4HFNA 2W8ZA 4MP3A 1OD2A 3KSZO 3E6AA 4TWRA 3W6ZA 1B0AA 1GCOA 1MA0A 1WDKA 3KSUA 3BTUA 3OJ0A 3UAGA 4CM8A 4F46A 5DZKH 3U4DA 4Z0TA 2VHZA 2DFDA 2O7QA 3EYWA 4QFEA 5INIA 3MJ4A 5B4VA 4J9UE 1QV7A 1YWGO 2O3QA 5F3RA 4W6ZA 2QW8A 4IDDA 1LDEA 4HKTA 4AJEA 1HE4A 3CEAA 3QXIA 4LVUA 1HKUA 3DFUA 1IYZA 5G4KA 3WNVA 4YJDA 2B0JA 4XYMA 1LRLA 1EVZA 2B37A 4OH1A 1ZSYA 4INAA 2JL1A 3B20A 4Z0HO 3K9QO 3GF7A 2FZWA 2ZYGA 2PKRA 6LDHA 5JDCA 1ENYA 3CSDA 1A9YA 1MG5A 3RC1A 2Q3EA 2V6GA 2VOEA 1E3JA 1ENZA 4RVDA 4W7HA 4KD6A 2IXBA 2VZ0A 2VNSA 1C0LA 1ENPA 1FDWA 4L9RA 5EERA 3GA0A 5G0TA 3OQBA 1BXKA 3PWKA 1GUZA 4IJKA 1ULUA 4LVCA 4AJPA 4JP3A 4D43A 1C1XB 2ZJ0A 1ZNQO 3GZNB 4FIZA 4IS3A 4JP2A 4BNKA 2DUWA 2EP5A 2D5AA 3HDHA 3GFBA 4XD2A 1TG6A 2V6FA 2SCUA 1C3VA 1MFPA 3LU1A 2FMUA 1P3DA 1YXMA 3WLEA 4OXNA 4I08A 4E31A 2A92A 3LT2A 4MKXA 1H6AA 3RASA 5L4SA 1JA9A 2HDHA 3VZSA 4BO0A 4BB6A 4ZDBA 1EUZA 3KEOA 3U4CA 1HE5A 1U3WA 1XX4A 1R4NA 1KVRA 4C4OA 4O0LA 5TF4A 3H5RA 2DT5A 3OHSX 1P9LA 4QTZA 4U6SA 5KOIA 3QVOA 5ENVA 4JCQA 2YUTA 3U9RB 4UUPA 1YH3A 2E6UX 4ZDDA 4J0FA 1OZAA 4DBZA 2NQ8A 1JKFA 4DC1A 5JO0A 3QE3A 5K9ZA 3E8XA 1E92A 1N92A 4IZIA 3CIFA 4DPMA 1IPEA 2QG4A 4IJWA 1SG4A 5CTBA 4E5PA 2HQ1A 2EHDA 5ICMA 4FGWA 2J5IA 3DL2A 2J8ZA 1DHRA 2D3TA 3GVIA 3PWZA 1E7SA 4YVFA 4E3ZA 1KIFA 5GMOA 3ZNQA 5F5NA 4RZIA 2X5KO 3WOHA 1UUFA 2O2SA 2AQIA 3I9JA 1EE2A 3IQDB 4BO8A 3WTBA 5C9GA 4BMVA 3TL3A 2NADA 2CNBA 4PG5A 4BQPA 3D7LA 4MPDA 3OETA 1X0XA 3P5SA 1R6DA 3F5SA 3JU1A 2WM3A 2VWQA 5I9NA 4E4YA 3O8QB 1PJHA 5T8KA 1SOWA 1V6AA 2Q46A 4MINA 5T8KC 3VZRA 4RYFA 3EVTA 2I65A 4CMIA 1ZEMA 1YS4A 3NYWA 1UXKA 4I42A 3OECA 3COSA 3I3OA 4CLOB 2GD1O 4WASA 5INFA 2JJYA 5L7TA 4BNGA 1G0OA 3IJRA 3M2TA 1UYSA 1LSOA 1WWKA 3HG7A 1NQ5A 4I9UA 3ETDA 4I8XA 3GZNA 5DUFA 1OI7A 3KQFA 3HB4X 4BO2A 3KVOA 1O0SA 4E5KA 1SZOA 1I2ZA 1EBFA 4I5GA 1P31A 4TVOA 2BFMA 5DCYA 2ZQZA 4J9VA 2TMGA 3IB9A 3U9TB 1RM0A 1E0DA 1V3UA 4J2OA 4WGGA 2BELA 3ZN2A 2HW5A 2AQHA 3MOIA 4F45A 1XYGA 2O50A 3JD0A 4M55A 2A81A 1UXJA 1YVEI 2AQKA 1E3WB 3O9ZA 4TZTA 1UXIA 1ID1A 2Y1FA 5I7FA 2DM6A 3W4KA 3KYBA 4IZCA 4GX0A 3KYCB 3BXXA 3S2FA 1TA4A 3ZU5A 2F9IB 3RROA 3B70A 4MDHA 4O5OA 3LKEA 3LC1O 4GH5A 2O3JA 1J4AA 1LQTA 1YJ8A 3ZWXA 2A35A 2Z1NA 4NBUA 5KKAA 1K39A 3SC4A 4YJFB 5KJEA 1JVSA 3KZVA 3GGGA 4ROSA 3FBGA 2Q45A 3ZV3A 1N2SA 5T67A 2WSBA 4E2XA 2Q50A 3V1YA 4UREA 2HK9A 1JKJA 2ZTLA 3X2EA 2EW8A 1MLDA 1NTOA 4J0EA 4U0JA 3DMTA 5MGBA 5LC1A 3WGZA 4L76A 5IDQA 2YYYA 3H9JA 1HSOA 3I52A 4BV9A 4KTVE 1LQUA 2B83A 2IYPA 5ES3A 3PLRA 3E03A 1JN0A 4BNLA 3DAPA 2HO5A 2NM0A 3MJCA 5DUCA 1QLJA 4NNJA 3IOYA 4CMEA 4CMEC 1O8UA 4AJOA 1WPQA 2W4QA 4P22A 2DBRA 4J1QA 3OIGA 3EK2A 3R0IA 1DFIA 1E6UA 2G17A 2VHWA 2DPGA 2X6TA 3L6DA 1QYDA 4JVTA 4EI2A 5L3ZA 4IJUA 1Z74A 1OOEA 3PEAA 2HJSA 3GVCA 4NPCA 3M1LA 1DLJA 5MDHA 3ANNA 4G5HA 1KBZA 3ONEA 4YLHA 2OOSA 4E12A 1MX3A 2NVWA 3HUDA 3TRIA 1LRKA 4KUGA 1E6WA 1OC2A 2EV9A 1SEPA 2QYTA 4J91A 4BNIA 1LXCA 3DWFA 4S3MA 1RJNA 4A5OA 5L95A 1EK5A 1GU7A 4CM5A 1OAAA 2IODA 3DFZA 1FF9A 2VUUA 5DP2A 3IMFA 5DCUA 2G82A 4ZJUA 3HINA 3ZWVA 1YO6A 5COAA 3KYCA 1ZSNA 2DBQA 5HA5A 2DEOA 3ZV6A 3JQDA 4JK3A 3BMOA 4TRJA 3E48A 1P77A 1N6FA 2TMDA 3PYLA 4NNQA 1H9BA 1XG5A 1PJ3A 3LDHA 1UP6A 1K5HA 3ZWAA 1PTJA 2FN7A 3AW9A 3IAVA 5DKPA 1K32A 2PZMA 4I4ZA 1R15A 3GNTA 5JDIA 1DHTA 4FFPA 5L51A 3MFMA 2CVOA 1DC5A 2JAPA 2Q99A 4CLRA 5FEUA 1LSJA 3Q11A 4OXYA 4OMRA 2ZL4A 4FB5A 1PJ2A 4GBJA 1RPNA 3RU9A 1ZBQA 4I5FA 3IS3A 4D3FA 1GZ4A 4WLFA 5A9SB 4GX1A 4ND4A 3NEPX 1NQAO 4XR9A 3LT4A 3WSVA 2Q34A 3IBBA 4OHUA 2EJ5A 3OQ6A 4CMJA 1NHGA 4HC8A 4MP8A 1VSVA 1RYDA 5B4UA 4E33A 2I6TA 3K96A 1AHHA 1F8GA 1HZZA 3E5RA 3DDNA 3IJPA 4OL9A 1VL6A 1CEQA 2WWRA 2QZ9A 3PDUA 1O8CA 1VJ0A 5H81A 1WZ8A 2X24A 3FWZA 4BO5A 4RZHA 1O6ZA 1RM3A 3INRA 3NT2A 1PZEA 2G76A 3HRXA 1Y9AA 3NTRA 2ZTMA 3HLN1 4CUKA 2P4QA 3RUAA 3K8XA 3KTDA 3W1VA 3V1UA 4EJMA 1YBMA 3I4FA 4WNIA 2BI7A 1E3LA 3FBTA 4IM7A 1E1LA 4YQZA 1MJ3A 3GNQA 3QW2A 3PFFA 4JBGA 4ZN6A 4GLOA 3RC2A 4Q3BA 4BOYA 3SX2A 3ZU4A 4CQMB 1PWXA 1N5DA 4PZEA 2OBNA 4DRYA 1VRWA 3PE8A 4R5HA 2GN4A 1U5AA 1PR9A 3RAJA 1U3VA 3PQDA 4CPDA 2WDZA 2EGGA 2GR9A 4JJIA 2VRCA 4U1AA 3BHJA 4N54A 2B4QA 1DO8A 4DTIA 3HSKA 3JQAB 5EIOA 2W2KA 3LLVA 1O94A 4JGBA 1ZZEA 2V6BA 1XU9A 2WYVA 4E2YA 2BHLA 3DAGA 4BGVA 5IZCA 1DJNA 3CMCO 2NWQA 3ADPA 4Z9YA 3V2HA 5EINA 4DL9A 1GTMA 2O3TA 1UP4A 4ALJA 1DBVO 2PWZA 4AG3A 2J3IA 4DBVO 1ISIA 1YGYA 2AXQA 1ZXBA 2BLLA 1M75A 1VJ1A 1YL6A 3NDJA 4UUNA 5L7YA 4AJKA 5CG1A 1U28A 4RVGA 4NFHA 3E18A 4B8ZA 3GH3A 3HDJA 1CQIA 1E1KA 2X86A 2X0JA 4AFNA 1RJMA 4IDBA 3W6UA 2CDAA 1NVMB 3AM3A 4E32A 3FN4A 3VDRA 2E82A 4BNMA 1HZJA 3EAGA 1E7WA 1NP3A 1LTHR 2FHSA 5A9SA 3KTHA 3AOGA 1WZIA 3IP3A 3FNHA 1Y8RB 2OO5A 2IE0A 3BTOA 2C2YA 3LZ6A 4L73A 2DLDA 4EJ0A 2VT3A 2W2LA 4GI2A 1I2CA 3H5NA 4MXIA 3G0OA 2Z95A 3FR7A 1EF9A 3VDQA 4N7RA 1HDZA 2IYOA 3K2BA 4XWYA 3TQHA 1CIVA 4HXYA 3SJ7A 1VSUA 1ADGA 1A4UA 3R6HA 3VPGA 4WOJA 3I5MA 4O59O 4J7XA 1EEHA 3PVZA 1KVSA 3TZQA 3EC7A 1NYTA 1CDOA 1HDCA
chains in the Genus database with same CATH superfamily
2V9PA 3CURA 1UOEA 3O8CA 2NUBA 3UAWA 2NTVA 1CQJA 1E6KA 5LMUB 5BNIA 2XTJA 2HJVA 2XEXA 3WYCA 1LK0A 4OI2A 3AR9A 3CUEF 2HNBA 2RKWA 2W8BA 4CV1A 2WT4A 1JKIA 3IHTA 2H85A 4JV5B 5ITZA 2B5VA 3WZLA 4E5SA 4Z49A 5IS2A 4N65A 4NEGA 1CRQA 2UXCB 2H1HA 5KZMB 2ZL3A 1NKSA 2VBGA 1VGRA 1G8JA 3AL2A 3JQ9A 3O21A 3JQ9C 2YWDA 2IEBA 1DXOA 2FZEA 4MWGA 2DPXA 2XKAA 4ZDJA 1SB8A 4I1SA 4KR9A 1SUDA 3V4SA 2H2IA 5B2ZA 4KIFA 3ANMA 3D2BA 1G20B 4AY4A 4XDZA 5ADHA 3QXJA 3MMNA 3IEXA 4OQZA 2BGNA 2Z58A 1L7BA 2O0JA 1QQAA 4C21A 3K92A 1XR3A 4C3UA 2PO5A 2QJFA 1Y63A 3GPIA 4G5XA 4QEKA 4KJXA 1V9SA 5B53A 3OTHA 1KY4A 2HX1A 1WY5A 4JXJA 4PLWA 1E9BA 4RDHA 5KOJB 2F1RA 2Z5LA 1Y1QA 3DC7A 1GAEO 5A2QA 1EFDN 3C7DB 4Z0MA 1ML4A 2CY0A 2I55A 3DE6X 5F9HA 1Y3BE 4WI1A 5BN5B 4J7CA 3BWXA 5I7HA 1T36A 3OCUA 4FS8A 3JQBA 2P6UA 3EZXA 3JQBC 4GS5A 3ZQ4A 4QO7A 4EB6A 5JNUA 4AO7A 1L3BA 4FE3A 3IOEA 5EFOA 4IOKA 2OD7A 1WVIA 4MPJA 1EHIA 4KNYA 4MCIA 4X20B 4C78A 4N3NA 5JLJA 3VH1A 1FA9A 1IPHA 2ILVA 2I80A 2IX9A 3WRVA 4D98A 4HS9A 2CLFB 3P9IA 4BLOA 4BNDA 2AFHA 1Z2PX 3NV9A 3L7JA 4OBWA 1K4KA 4V39A 1VCNA 4BMYA 1BQEA 2VDMB 3AERA 3ZW8A 4N3GA 2BDEA 2HKIA 2VA8A 3LO8A 4OUDA 2JASA 4JLMA 3G0CA 3H6HA 1AQJA 1W36C 1QYWA 1RD4A 5KTKA 1E7QA 3KOMA 1BYUA 1KI6A 1QVAA 1A88A 4M9SA 4GDMA 2ZSKA 3ELDA 4WKBA 5L3VA 1TK9A 4RTRA 1DC6A 5DM60 3N53A 5TIIA 4JOCA 3U0BA 3IAAA 1WHSB 5DNEA 1IK6A 4XX0A 4XJSA 2VJMA 4YRTA 4KQWA 3PT9A 3JRXA 4CEJB 1T4GA 3E9QA 5FT9A 2JIBA 1P5HA 1EMDA 2W2NA 4X00A 2VPZA 1TC1A 1YQEA 3ZNNA 4Q93A 3TZKA 1FNDA 4XSHA 4ISCA 1D04A 2HCFA 2Q28A 3ZHUA 1VFPA 2C3UA 4I8IA 4PGFA 5I9MA 3SSNA 2RHWA 3SSOA 4B9EA 4D57A 4F97A 3CF0A 1G19A 2F3RA 1VPWA 3B1XA 4DA0A 4KREA 4BFCA 5IH7A 2XWQA 2QKYA 1N6DA 4EZIA 4PFJA 721PA 3AP3A 5B58C 5IF9A 3F5FA 1HEYA 1X7WA 3GL9A 1EFUA 1D6SA 1M2FA 3LVRE 4JKIA 5FUXA 1E9EA 5HJ7A 2XYHA 2Q8PA 3MSCA 1XZDA 3KPVA 1QYCA 4Q3OA 2BFNA 3Q8LA 1T3GA 2SNIE 1SG6A 1V5FA 2IKQA 9MHTA 3I32A 5GGXA 2OHXA 4DR5B 2XMGA 2YIVX 9ABPA 3H16A 1Y6QA 2PA0A 2GT1A 2FZVA 3SYMA 4EA8A 3C3WA 3TLKA 2QAIA 5AJZA 1R6UA 4P36A 3SVLA 1A3CA 3N1UA 1YZYA 2ET6A 1IN5A 2P4UA 2Z30A 3FAKA 2XF8A 4UNNA 4AUKA 4WZZA 1L7EA 4YMWA 4D25A 3ZCVA 3L1UA 2CUNA 4X8OA 1CUHA 3I2YX 1XL0A 2FPKA 3LFUA 4J3FA 3KTAA 3MAAC 4CTJA 2KLHA 3BWBA 3F73A 3LFTA 5DJ5A 1Z08A 1IULA 2Y1DA 4V02A 4AU1A 1L8LA 4LZWA 2G70A 4S24A 3PJRA 4OKSA 3AGPA 1N3YA 4YT2A 5GV8A 2W2MA 1W85B 5EUCA 3EDCA 4CIDA 5JMTA 1R5NA 2H17A 3H8JA 2GTHA 3LIPA 1JIKA 1O03A 2ILTA 2ZI7A 2I22A 2J0VA 2AJTA 2XYQA 3GGOA 1NN0A 1IQPA 3ZEAA 1OU4A 4G8BA 3B60A 5CK5A 1RVV1 3I8XA 5FOTA 1XQWA 3GJ5A 1JG2A 5M7EA 1S8FA 1J9EA 1XCBA 2C03A 2ZKLA 2MTBA 3RD5A 4A16A 5JHHB 2OE2A 3TX2A 2Z9CA 4US1R 3GQVA 3HBJA 2NUAB 5KNCA 2NMVA 1FQKA 2JLRA 4Q1AA 5E6RB 4HXFB 2ZJ7A 4MLCA 3ABSB 5FB3A 2J6CA 2VTBA 2VAVA 1KYTA 5D3MB 3LVBA 4QXQA 2HTEA 4MVJD 1A2KC 4L8YA 3SAJA 1CNEA 1Y4DE 3EX7C 2A0YA 1Y6FA 5FTJA 3T3EA 2YHAA 3KRTA 3M3PA 2A5GA 3N05A 5IAJA 5CFMA 1IG3A 3I0ZA 4QBHA 5DNVA 3DZIA 4AC9A 4Q48A 4AP5A 1PZMA 3FHJA 2AMFA 8LDHA 2ZL2A 4WA8A 3G7SA 4C0JA 2V7EA 5K6AA 2WWTA 3K9CA 1V25A 4XE5A 4M0DA 4G97A 4HOYA 4UD2A 5EA2A 3JSAA 3NWOA 5K6AC 4WPGA 4ZDCA 4I46A 4N5LA 3CEPB 3C2QA 1PT5A 1K6IA 4GMKA 1ZUIA 3U7EB 4Z4EA 5DN9A 1YQUA 3OCXA 4F21A 4CMGA 1E9FA 2QMEA 3RNOA 4FONA 5JCJD 1DELA 5IM4F 1G9TA 1ZUNA 1WDTA 4QZVA 2WA2A 5JBWA 4FUQA 2H4WA 2HCJB 2DMRA 1MVOA 1XTKA 2V7TA 3SX4A 3D8HA 2Q2XA 1IDN1 1ZS9A 3AXTA 4PS0A 5F2KA 2V55B 3D0QA 3ENZA 3R0QA 4HQ6A 4QULA 2BFBB 3O8DA 4WBNA 3OAAD 4XGRA 2JF0A 5EHQA 4DMFA 2D8AA 1R50A 4TXHA 4V24A 5A7FA 3KZOA 4C0KA 3EARA 3T0GA 4EX6A 1XRPA 1NBHA 1AXEA 1Q19A 4Q47A 5LQRA 2X3UA 3MYBA 3E5MA 3O8OA 3OCWA 1N9GA 3ZY2A 1A2OA 3HCPA 4PV7A 4WAUA 3SF8B 5E9AA 2BR3A 4Q02A 3DMDA 3WYDA 4FHCA 1KWKA 4JYAB 1SVMA 3QVTA 3HKBB 3CRQA 4RV4A 5DT2A 2QR2A 2Z9DA 1FUUA 1HE3A 4E51A 5E0SA 4QJ3A 3P27A 2CVZA 1OGJA 1ECLA 3OT6A 2H0AA 4NULA 3FGPA 1C4KA 1ZH6A 3N6XA 3Q3EA 4MW0A 1UBRS 3BFJA 1EQ2A 1VI5A 3PEFA 2PWYA 4FJ0A 5EWLA 1CQWA 3F9RA 4KRFA 1QE3A 4PLPA 4JLWA 1FYVA 1FSFA 4TUYF 3ESXA 5TPWA 4EL5A 3WLKX 4OFWA 3ZXYA 2ORYA 3N75A 3KTKA 1BJKA 5LA6A 2ZJZA 5H3HA 4V1CI 2W6PA 1KK1A 4GE3A 2EX4A 4C7KA 4PYJA 4MQ4A 4LSWA 2CEKA 3IJEB 4JSBA 4UASA 2IP2A 3K0CA 3R3WA 3R5FA 3K0CC 2P9BA 4K6HA 2J46A 5G0WA 3TEJA 3ZY6A 5DT9A 1L5HA 5KQRA 1N5IA 1EHCA 4POAA 1YC5A 3A14A 1TCCA 4CLDA 5I7WA 2W71A 2ZWPA 4CE6A 4QYTA 1G8KA 1T0UA 4QWWA 2FDCA 3JU3A 3LF2A 1WCIA 4YAOA 1W88B 2RGWA 4MRSA 4HRXA 4LF9B 3T3NA 2FW1A 1TGVA 2K2WA 4YRNA 1GRQA 1L5KA 3F6EX 2E21A 4R6WA 2YRXA 3EZ7A 1NU8A 1FQWA 5EYPB 4Z7NB 3U7FB 3EWIA 4ZVRA 4CDNA 2PY6A 3NOQA 4MV4A 2H3EA 1C7FA 1UMKA 2ZSUA 4N7BA 5E7QA 2OV6A 1N33B 1MU0A 4LY6A 1RHMA 2J5KA 4Q1FA 3IIKA 3O38A 1V3VA 3JZMA 4TXLA 4EMTA 1EM8B 4YO8A 1R4MB 2H1SA 4XFJA 3VOBA 4YAIA 4JCSA 4NL4H 4Q4HB 1YR9A 4O4IF 2QSJA 3QX9A 3TS1A 5I4CA 4L74A 2FG5A 2BI4A 2HF2A 5IN4A 3RHTA 1Z8NA 4I52A 1I7LA 4O2RA 1ZEJA 2CFIA 2AHRA 7GPBA 4K05A 1EUDA 5CBKA 1V5IA 4NV1A 3GF4A 2BHNA 3TZEA 5AVXA 2JHAA 3E9YA 1DAPA 2VQ3A 4RGYA 4YJ2F 2PIDA 3DBVO 3E3NA 2XZTA 3OUTA 1N5LA 4HNAA 3C6XA 4DZZA 4IHJB 1YBAA 1JIJA 1JEYB 1V6CA 3RYFB 1J8MF 4MTLA 3ROKA 3WQHA 1J8QA 4EG8A 4UNRA 1FFXA 4L4UA 1ZU5A 3IQWA 3U3XA 1HNOA 3B9PA 4A6EA 2AOUA 4AJLA 1IE3A 4GOND 2IGBA 2VDNB 3KBBA 3MK31 3CM0A 3OZ7A 1WBDA 6REQA 1UDCA 5B55A 2V7GA 4K9QA 1MHPA 1JPUA 2EEPA 3LMKA 4F1WA 1E98A 3DF9A 1TI7A 3PD0A 5EVJA 1ON3A 2H2FA 2K5UA 1T6ZA 1G8YA 2PMKA 4RD1A 4Y67A 3HGTA 3BD9A 5CEFA 5I45A 1TVKA 1I9CA 1N8KA 2FX5A 4MB0A 2ORVA 2CBYA 2OOKA 1JG1A 1P3JA 4ZALA 5TQ2B 3DCYA 4MGHA 1M6VB 1EJ0A 4RK5A 4A8JB 3MOGA 1JLSA 3OMXA 4M98A 4M1KA 4XGNA 3FHCB 3VU0A 3TTTA 3H5TA 3AUSA 1U3GA 2JS7A 1HDGO 3I04M 3PQEA 3QUBA 4N5DA 3C87A 5FFFA 1VLJA 2C9MA 1XMJA 3OPVA 4CIXA 3D5QA 1QCYA 5FHQA 3KM0A 3G2QA 4MS4A 5KHAA 3RSZA 1HRDA 2BZSA 1H0KA 1SA0A 4GHWA 4GVPA 4L0DA 4OHBA 3CKKA 3G5MA 3TFQA 1Y33E 4ERNA 2Y9ZA 1KMHB 1NJ6A 3B9QA 1KY5A 3BB1A 3HCNA 4P4TA 4LY0A 2I2WA 2N42A 3E7DA 3WY9A 3ZE6A 1UPXA 4RNDB 1XNQB 2ZI3A 5DYGA 4LSMA 5IMBA 1B0PA 1RABA 1U0TA 1FVOA 4GVLA 4WKGA 1ZUWA 3T3IA 1M83A 5JYDA 2OKCA 5L7WA 2O8EA 2PXHA 1DIHA 3UOWA 1ZGAA 2FU5C 1VA4A 3PEYA 1BNCA 3BH6A 5HDBB 4B82A 4G0XA 3NJRA 1UOQA 1WCWA 4X6LA 5B4TA 1N1MA 2VHQA 5JJCA 4DNFA 1R0XA 1FFGA 4IIGA 3DCIA 3GA5A 1GITA 4KFTA 2A1UA 3TN7A 4RTJA 4FOLA 3SR4A 2JFFA 4DIDA 2HWKA 2HRCA 4NH4A 4WUTA 1DUBA 3R9SA 1E5TA 1BMFA 4CG3A 1V8ZA 4Q4JB 1AS0A 3KOWA 1ZC4A 1OFUX 4GRAA 4RD4A 3MTJA 3AETA 4RCNA 5WRFA 3EXFA 4YCLA 3A4MA 4RY0A 3EXG2 2G9NA 3UJ9A 2XSZA 4FFOA 2WUWE 5AW1A 4NEKA 5BSKA 2V96A 1Z56C 4KXVA 3L4BA 2Z6QA 1VXOA 3L4BC 1DEHA 2IYLD 3I6BA 4OGLA 1DFHA 4IH4A 4I2NA 4CV2A 1VE1A 4BEBA 4KRYA 3HA7A 2ZIVB 2D1TA 5BSMA 4OGFA 1BHSA 1IOLA 3ZW9A 3C6BA 1AB5A 2A58A 4ZXPA 2YXDA 4BFZA 4RMIA 2GPYA 3HEAA 4J03A 2IF2A 3EA5A 3A9UA 3VJKA 2XUKA 4CCYB 3MELA 4D7AA 5B6JA 5ALLA 3W2GA 3BFPA 2YWJA 4ZPJA 1Y48E 3O8QA 2X8BA 3CWCA 3RBZA 1TEXA 1S8AA 1FUEA 2C07A 1Y5IA 1Y6JA 3VMFA 1WKCA 1NIPA 3JRWA 3AB7A 1T29A 4BTLA 1DEKA 3QQPA 2XGOA 3QXZA 3AHHA 2IYRA 3GRUA 1M34B 3PKIA 5DNWA 1J42A 5AUOB 4HB2A 3F46A 4MAFA 1C7IA 1GGKA 5KVCA 4LF5B 2FBMA 1SZPA 3PZKA 5H1YA 4DMUB 3WKDA 1DTSA 221PA 4WN9B 1LA2A 3GLGE 3U44A 1D4FA 3D3WB 2P6PA 3C5HA 3RRXA 1YNSA 5CXQA 2FWBA 1VE5A 2JCYA 3V6MA 2OESA 2WZDA 1VOTA 1TM3E 1YRAA 3LX4A 3RTBA 2JH3A 3WGGA 3CKLA 4Y1FA 1QG4A 4RETA 3L8CA 4MLZA 1U7HA 2AXPA 2ZIZA 4OQPA 5FR1A 1QF6A 4ZP1A 2BR5A 3FDJA 1YUMA 4LCEA 2ONJA 5G1SA 2WF5A 2HLPA 3EZYA 3LPAA 2Q2WA 3O0DA 3OOJA 4L51A 4MGIR 5E6UB 4C0BA 5DTWA 1JEQB 4PBRA 4RXTA 4GM4A 4WOBA 3QKUA 4XEHA 4HH4A 2BUAA 4IHKA 4MO2A 3WB1A 4UEKA 2X4GA 3I1JA 3KU4A 1RZRD 2XGJA 2X9VA 4CHTA 2DHRA 1RAFA 3MWGA 5EGSA 1Y1KE 4XIYA 4MVJG 5TC4A 2NZUG 2C31A 2JI8A 2WP8J 3B1FA 3MEQA 1RDFA 3HKDA 8AT1A 3CN9A 2F1JA 1M2WA 3QK8A 2Z6VA 4Y6SA 1ZGZA 2GHIA 3HFGA 5E1OA 4EYSA 3DE1X 1SD5A 4BZWA 1P0CA 2JFBA 2WRZA 3ZDAA 4PLVA 3HJTA 4W8GA 4CM9A 1M0EA 1UL1X 1EDOA 5EPUA 1T1SA 1OH5A 3PI6A 3ED5A 3G3EA 4G9GA 3P0EA 2G36A 4DIUA 5KYWB 5FUYA 3QKAA 3CB4A 1ZH4A 4U3JB 1ZIDA 4Q18A 4XIJA 4K2HA 1V96A 5EMNA 4LF4B 1TZBA 3CRRA 2KJQA 3FZNA 5DLDA 3FRHA 4DUZB 2Q5CA 3FF6A 3QU5A 4MR8A 2AOVA 2VJAA 1D1TA 4Y2RA 3X1MA 3AR4A 4OXIA 3SIPA 5IKOA 1NUAA 3UOAB 2X77A 4AJHA 2IUUA 1GPYA 1Y7HA 3IUQA 3ND7A 1E1QD 2V4UA 1M5UA 5DU2A 5JDIC 2FZLA 4UPVA 1TJPB 4M0CA 5ALHA 5BWMA 4R3NA 1NT2A 2OEPA 3IILA 3I6ZA 3O74A 2AE1A 5CVVA 4Z3OA 1PKEA 3TLJA 5FFMA 4HY3A 5DL1A 2WHPB 4RZSA 4J2HA 2XVXA 3CKMA 1I1NA 4Q0MA 3COWA 4XOUA 5FBQB 4ZT5A 3T7DA 2BCJQ 4LC0A 3TE7A 4WZ8B 1J2UA 2YDYA 2ZU6A 5G1QA 4PTLA 3C6QA 5LZ2A 3T1OA 1JU4A 4RYLA 4CM1A 2CT8A 3H7IA 4NE2A 1JGTA 3D6JA 2V4ZA 3ER8A 5MN6A 5JD6A 4DBLE 1SIBE 1GL3A 5FPHA 5A7HA 2W2VA 3V7YA 4KUHA 1U8TA 2BYTA 1Z6TA 5EJ9A 4MA0A 4DLBA 2AJBA 4PLGA 1DB3A 3U40A 2UVPB 4E1AA 1MJFA 5A4MS 3SWWA 1HX7A 3WK7A 3FIJA 3ZGYA 1UJCA 4TKUB 4C5BA 1TYFA 1K06A 3EVZA 2ZQRA 5E0SH 2GUGA 3RSSA 1VA5A 1M2OA 3UMBA 4DE5A 2V1XA 3NUGA 4IUYA 1J2YA 2HU8A 3QVXA 5A1TA 3L0PA 3NM6B 2VDWB 5LKRA 4AMZA 1O0CA 4WECA 1BHQ1 1TRHA 2GKSA 2C4HA 2EW2A 4JP8A 4WNCA 3UUWA 3PR1A 2HQOA 4HP8A 1JDBB 4NAVA 5B2EA 3UA4A 5GAJA 3CXRA 3T7KA 5ICEA 5JH7A 4PSCA 5CNJA 4C0LA 2D54A 4FDAA 1XTPA 3L43A 1CLUA 4YAWA 4WNAB 4OU4A 2OBYA 3GOQA 1QBKC 2MR5A 3QK7A 1ZH8A 3HVHA 4DB4A 3BPPA 1U9JA 1PJQA 5G1PA 5E4FA 2X7JA 4KNWA 1U3TA 2H2AA 1L4BA 4PQEA 1EWTA 2C3PA 5JSUA 2BFDA 4LJ4A 4R8SA 4WRRA 3BXOA 1FOEB 3OT5A 1DKMA 1TYDE 4P7BA 3T1YB 3B8EA 3GRKA 1YB2A 2C84A 4I4TB 2XI4A 2MIIA 3B52X 4JOQA 2G9ZA 2EKQA 4L0CA 4EHHA 2YMPA 3HP0A 2XIJA 1EBBA 4AP9A 2IY9A 3V8QA 2GCOB 2QP3A 3LY9A 1TDJA 1QDUA 4HBZA 1QPBA 1IY8A 1ECCA 4R1SA 1P61B 4U2FA 1FPMA 5B1YA 3E61A 3WMGA 5JSYA 4NMHA 1RFLA 1B93A 3D02A 1QE0A 1QIMA 2AFIE 5HPYB 2A9VA 3IHWA 4QG7A 1F9AA 2PMFA 5FPTA 5TQVA 1EGHA 2IHVA 2XE8A 1F8YA 3GZ4A 1X2EA 3F9IA 3HJBA 3KXDA 3WX0A 3PUHA 5BWCA 4LYHA 4WY5A 4YCMA 4NCNA 1YZTA 2FTKE 2NU6A 1T9BA 3DMGA 2J5SA 1M1UA 2Y1GA 3NT5A 3SNKA 3QA3E 4JUBA 1E6EA 3RFFA 1HETA 4FFDA 4RXMA 3RARA 2I1QA 1F8UA 3U2QA 4A10A 1SPXA 1CULC 4XVQA 1PI3A 3C45A 1QGUA 4BB0A 4X8MA 5I7EA 1C29B 1K88A 2FP3A 1DG3A 3IP6A 4YRKA 4EGJA 1O4VA 3A1FA 1JIUA 1SNYA 5GADl 1MW8X 1HDYA 2EFGA 4UM7A 3ET4A 1VLQA 4N4AA 5FHRA 3SBOA 2D1RA 2WA1A 4D79A 2CVQA 1PHPA 3ZD8A 1BH6A 3PENA 4WOCA 3UPTA 1YT5A 3DBHB 1SFRA 2DX7A 3AUXA 3UMJA 4MV0A 2MT9A 3JAWB 2BFEA 2VKQA 1E0SA 4F06A 1P9WA 1BYIA 3KEQA 4HEA1 2B34A 2UV8A 4AMVA 1O58A 4YHHB 2QV7A 5HZGA 4FMDF 4HWPA 3DLIA 1L9XA 2R8EA 4CMHA 3HXPA 2OMEA 2RKOA 5K3FB 1JG4A 1JDJA 3RLIA 5L4NA 1OXKB 3MRTA 5LQUA 3N0WA 4B2LA 6AT1A 2FWRA 3KFXA 4TTJA 5CIYA 2BT4A 1GV1A 1R37A 4LRTB 4QPNA 5AJUA 4CKBB 2OP1A 4PYRA 2D06A 2I3ZA 1M2VA 4YB8A 2C4VA 2A9KA 1J6UA 5A02A 3ZBQA 4HNTA 2LIPA 1T34A 4LTNA 4Q7MB 4DHWA 2PUBA 3MAGA 4RMHA 5JPIA 2QRGA 3BZBA 2XADA 3OQVA 4F71A 3F6BX 3U16A 2Q5EA 4JYPA 4OHMA 4Y9UA 3ZHBA 1N5KA 3W5UA 2XECA 2ONKA 3K0FB 1IC6A 1DJLA 3RS9A 4IJ5A 2A2ZA 5L45A 2FP4B 2VP5A 4R5MA 4Z4QA 4FEAA 1YDGA 2AJCA 5JRJA 2GPTA 3NDRA 4RPGA 5JSHA 2PX6A 2OM6A 3LD9A 3ZLVA 2GPAA 1UWCA 1U02A 4ESEA 1BQ4A 3RUFA 4F93B 5ITWA 3M8KA 2C9OA 2N3ZA 2WD8A 3OIDA 2DSTA 2ZB8A 4JA0A 2Y0CA 1J00A 1E7YA 2WABA 3NYRA 4FYMA 4R68A 1NM5A 1HNUA 1NM5C 3KKPA 4EARA 1F3OA 1TF7A 4K81B 1OQAA 2JIZA 1DC4A 4HDOB 2ZJ1A 1FFBA 1YA6A 4NI5A 1WO8A 1X7ZB 2IY8A 4NHEA 4RO0A 4UW9A 1PR3A 1JSLA 3WIBA 2FZ4A 1SK9A 1H4QA 2Q3DA 3WMXA 2P8JA 3ASVA 2Q7DA 4B46A 1H1LA 2P9ZA 2XGSA 3N6RA 2QSUA 1WB5A 4YGYA 3E1GA 1YFJA 3MRSA 3EXAA 5TVGA 4I3GA 4AQDA 5BWLA 4KR2A 5DBOA 1RHRA 3ZDRA 2IXDA 2H5EA 4BJHB 1H0RA 3DO6A 1JWLA 4Q3NA 2BSQA 4NBKA 1SHTX 3O8NA 2J3EA 3D6FA 5A62A 1MH1A 3NVAA 2IX3A 1ZCFA 1TJ4A 3D4OA 1OMOA 4IDCA 2WJ3A 5CDUA 4UEQA 2QN9A 1NVWQ 3I9MA 3E4DA 1FNNA 4ZD6A 1D6NA 4NMLA 3ZE7A 5FH9A 5LQSA 2GDZA 3ELWA 4TKZA 2W6JD 3HRIA 4DR4B 3UWMA 2YZ7A 3CEMA 2PJZA 4F72A 1XPJA 3S8EA 1UYRA 1QC5B 3PPWA 5K1ZA 3EQ8A 3OPNA 1XXHA 4JC8A 4W5HA 5AD1A 4XIGS 4RE6A 2R7KA 2XRFA 1JXQA 4KWHA 4GYWA 1NLMA 5HE8A 4FYWA 4HDRA 2DQSA 3AONB 4YMVA 4PGGA 3IESA 1LUAA 3RRNA 4I4LA 2BCEA 4RIIA 2ZIWB 5IBRA 2CXOA 5CU7A 3EXEA 3GAFA 4AF8A 4QUEA 5DTPA 1EK6A 1O94D 2VJDA 4EFLA 4RVUA 2GM9A 4R2JA 1T15A 3DV9A 3JALB 4HLDA 4DMGA 3VBCA 1HORA 1IU9A 1BDMA 3LHIA 4RA6A 4XWTA 4D8WA 3MINA 2HA6A 3F7TA 1I5RA 3E23A 5GWXA 1ZIXA 3ND6A 3IPLA 5IFLA 3TW8B 5FLXA 3AKZA 2ODQA 3UNXA 1I0ZA 3ZHVA 4JT9A 3RC7A 4RGQA 3RAPR 1IY2A 1QYRA 3PSAA 2GPSA 4DJAA 5IK2D 1O6CA 4QL3A 4ZEXA 5GZ6A 3R8CA 2I4LA 3FM9A 2X9GA 4NIMA 1G2IA 4OQMA 3UGQA 1BU5A 5BWNA 5DHTA 1N5JA 2C2XA 3R3SA 4PQFA 4D0GA 2W11A 1Q1ZA 1N0UA 3OE1A 3QLUA 5LCXA 4JLNA 3OX3A 5F1OA 1Z28A 1VKJA 1LLCA 4D4HA 3JWEA 5LQCA 1Z9BA 3FFXA 4N0MA 5EEHA 1TM7E 2ES4A 3IT1A 1JILA 2CMDA 3LUAA 3A3PA 4WA7A 5L3QA 3N5KA 3W77A 3GG2A 4KAAA 4UE2A 2HHLA 2QZ4A 1WLSA 5K8VA 3C7TA 1TXGA 1GGEA 2GK3A 1MC4A 4HG2A 4OKNA 5JRZA 5A0FA 1EBUA 1MF7A 1HO3A 1EFAA 2WAOA 1DC8A 4QOGA 1M2KA 1USVA 2F3TA 3ZC3A 3H2GA 2JLVA 1LDYA 1M6EX 3A9SA 4NFLA 5D5HA 3T61A 1R9JA 2QD4A 5DM70 3IDSA 1E5QA 4YMLA 5C9ZA 1IN7A 3PC8A 5F12A 5FADA 3OLXA 3PC8C 2WF7A 5ECWA 1OKKD 3N8GA 3VR3A 4RYFH 4MPTA 3NTOA 4UHJA 3M5PA 1WZUA 1VMKA 2MINB 3NORA 3QI7A 1JJIA 5D86A 4C0HA 5AVYA 2OAEA 3RSCA 3QLVA 4QX6A 1ITZA 4WCFA 1XO6A 3GR6A 1LNZA 3KO8A 1KXJA 4K29A 1JF8A 3NHJA 4WXPA 2H59A 2W90A 3OKCA 3T8BA 3BCUA 4X44A 4Q6WA 1E3DA 3AR7A 5AR1A 3WMWA 5DGIA 5BMVB 5C35A 5HHTA 4G2NA 1J2JA 4R0NA 2AOTA 3ZU6A 4ENQA 2Q6OA 1KNQA 1NUQA 1AA9A 2XB4A 3M82A 5FV7A 3Q0EA 4HFJA 2A9PA 2RC6A 4MS3A 4CM4A 1S4MA 1UPTA 3DMHA 4K6OA 4X45A 4BQQA 3RUIA 4EGSA 3N2GB 3NDPA 1EX7A 2AMVA 2F3PA 2PZGA 3ZBUA 3FYCA 5K0NA 5C1DA 1S1CA 1Y81A 2DP4E 3HDQA 1AF4A 4IIVA 3P9CA 4UAJA 5T5QA 3UBMA 4RIEA 3EVCA 2NV2B 3T8AA 2IZ6A 4MUFA 4PNZA 1VBKA 3SKXA 4MUJA 1QHFA 3MGGA 2WUEA 4UVEA 5REQB 2VNAA 3HMKA 4ZJYA 5CP8A 1I13A 1XUOA 4ZU3A 1HYGA 3UV7A 2AF4C 3S55A 3ONVA 4LY9A 3RWOA 1DEOA 1K89A 3BTSA 3NIDB 3FKJA 4DLUA 1LCIA 4WK6A 3N2IA 4KH0A 3G5LA 3H86A 4IX1A 1O97C 3ZWWA 5H82A 1F0YA 1IHYA 4DJDC 3D64A 4WLVA 1L4LA 4IDHA 5HIMA 1BFDA 1Z6GA 3C0KA 3WGVA 1R9MA 4RKRA 3W5BA 4OXXA 4ZEWA 2A7SA 1G5HA 3RV3A 3V8MA 4KK4A 2OWDA 5EJAA 5HWSA 3WA7A 4RMJA 1F2TB 4JL6A 5JSZA 521PA 1KYYA 1SCIA 2XQVA 1RYFA 3AF4A 2JIDA 3F6PA 1PYOA 3TTUA 3UFXA 3VNSA 3ZQKA 3TBKA 4B3BA 3DDOA 4BNHA 4MV9A 1KPGA 3IOCA 4KPGA 1FP6A 4G5YA 4B5LA 1Y0BA 3LAOA 4LZZA 5C8DA 3IKJA 3ZVLA 5TB5A 1R6TA 3CVUA 1SCUB 5FIFA 5M04A 3D7RA 1H0HA 1ORIA 2F55A 1YZFA 3DBRA 3CG4A 4JH0A 3RNLA 1F17A 1L5ZA 1VC2A 4ZAGA 3CR3C 1NX6A 1UM9B 2JIMA 3SEFA 3S2GA 1W8IA 2WYOA 3H11A 2E89A 3I1FA 5FA8A 4EITA 5KWEA 3QKRA 2J67A 1UT8A 5D3ZA 2JCBA 1OLSB 1PEDA 1UJNA 1I5OA 3OLCX 1EY3A 3CMMA 3RSHA 4KTTE 4Q1CA 1KP2A 4CU5A 1SVSA 2R6GA 4I55B 5CR9A 4MW6A 3SQMA 1JQ3A 4JJKA 4IR7A 4W1RA 5A3SA 3WB9A 3I5AA 4G4GA 2I2BA 1DRWA 1CERA 2OK7A 2RB5A 1IUPA 4J1NA 4QSMA 5DTQA 4OAPA 3RJ5A 3DR3A 3R5SA 4GX2A 1C7QA 3EHEA 4O4JF 1OROA 1XD2A 1KY2A 2GESA 1MO2A 1WE2A 2Y1XA 3BMNA 3MQ4A 5LBTA 4E30A 5BQPA 4BRZA 5GV7A 4AP6A 1MW9X 3RU2A 1VJ5A 4F9EA 4GPBA 4GI1A 2JEYA 4YALA 3AY0A 2I9KA 1XCMA 4ND5A 2A5YB 1JT2A 3DDHA 2ZB3A 4IWXA 1F4PA 3OFJA 4P2GA 4RY9A 3P97A 3M5CA 2O7RA 1U6KA 3AKCA 3OWHA 3ZS8A 5KYVA 3JYHA 3F3YA 1YG8A 5JS2A 1PWYE 1WHTA 4QFCA 1XKLA 1Z17A 4X6XA 5COQA 2VATA 4Q4AB 2YHUA 4PYKA 3S40A 4EPVA 3C3PA 2E4ZA 1AXRA 2ECKA 1IEWA 1YZNA 3ICPA 4HNGA 1NSYA 5FCDA 2YVLA 3ZH2A 2FFHA 2ZWOA 1VG1A 3AJAA 2GM3A 3BRWD 4DS3A 4TVKA 4BAZA 4V1CB 5JI3E 5TGZA 1CR6A 4TSFA 1UQTA 1SBCA 2YW9A 5EIBC 4JOSA 3UVEA 5TMDA 4EPWA 5FOVA 1GSOA 1H69A 3B3GA 1H8EA 3ZK9A 2WMYA 1MABA 1U1DA 4KLNA 4KAXA 3HLTA 1QYVA 3H65A 5CTJA 5JWOA 1DBIA 1AKRA 1BKSB 1M1YB 1YL5A 3LHKA 4M7RA 5LYYA 2JDID 4PXAA 1P0PA 2FLKA 3RKUA 2RC5A 4U0HA 3RH0A 3WBFA 2VN8A 2YFKA 3CUVA 4OI1A 4BN4A 3DV0A 4HR7A 1FRFS 4HGRA 1A82A 1QNLA 5E1MA 1AZWA 2JGDB 3T7JA 4KSBA 4FJWD 4IUBS 1R3UA 1W9MA 3TRFA 1AS3A 4BP8A 2PTHA 1IQ0A 3LHSA 4PNEA 5ECDA 2FK7A 2JBAB 1X77A 1LRJA 2R65A 1WOYA 4C6TA 3U09A 3E7WA 4NCXA 3QU7A 5E3IA 4DV0B 4L5AA 4RSRA 2BFAA 1NN5A 2JD0A 1TIKA 1EGVB 3L05A 1LTQA 2IU0A 3BF7A 3Q7HA 2QUHA 2YVKA 4BMCA 2GUWA 3SWXA 3AVTA 4AJ1A 4R98A 3MD9A 2IEGA 1L7VC 1SIOA 2WVGA 4JEIA 3UGJA 2PHZA 2QN8A 1W0KA 4W82A 5CW2A 2VP4A 3OZAA 2DBVO 4D4JA 4TQUS 1E0KA 1ZMTA 1X80B 1EA7A 2NIPA 1S9HA 3EOBI 3KLMX 4RLFA 4RDIA 2D6FA 2JCVA 2QM8A 4HFMA 4LX8A 4BGEA 1GTVA 1NW8A 1F2UA 3DEAA 2E4YA 4CW7A 3OKPA 3NKFA 1I80A 4XYLA 2XE6A 5E2IA 2D5IA 3RTCA 4RIFA 5CNIA 1PTKA 4PINA 2J9XB 4G4JA 1Q7EA 3RIXA 3TTSA 1SQ0A 4B83A 4OLHA 4LK5A 4Y9RA 4O4HB 4LDJA 5I9IA 1X0UA 5K7SA 1JLLA 1KERA 1RRCA 4Z9AA 2WWVD 3FD8A 5CEJA 2ZRPA 1L7AA 1UMDB 2ZYSA 1E9VA 4FFMA 1V2HE 2B4YA 3BJIC 3ICQB 1TUGA 1USGA 3UK1A 1HSZA 3WGHA 2R1TA 4M37A 1T6NA 4FGLA 3OF5A 4DDUA 4BP1A 3OFND 5KAMA 3VU8A 4JLKA 1EUQA 2EXXA 2FFAA 5AM5A 4XVCA 1LBHA 2B92A 3HU1A 2HYDA 1Q52A 5THXA 2C5BA 2PL5A 1P72A 5K3SA 1XTBA 4ZCLA 3OY2A 4R9UC 3S1AA 4CZ2A 3FTDA 1WRBA 3FETA 3UMGA 1NMXA 5C7LO 1U0NA 5K01A 1AKQA 1ISRA 2HAEA 3QELA 4CKYA 2CXTA 2XCUA 3RFVA 1Q0UA 5HMMA 4M4SA 1CDZA 3TDKA 4B44A 4NXMB 1T5DX 4LPSA 5H4HA 1VG9B 2A9JA 4IIJF 1EIWA 3MUOA 1XZKA 3IPAA 4F60A 1BCRA 4WXMA 2OENG 4MNTA 2ZFUA 2OLEA 1QTNA 4A0HA 1AV6A 3KC2A 2J9YB 4C4AA 3TL6A 2GCPA 5JRDS 2QE7D 1T0HB 4OIFA 4UZEA 4GXQA 2BIFA 2G71A 4NMWA 4TN1A 5ALPA 5HG0A 4BFUA 2ZCJA 3T3WA 4ELXA 4LXQA 3N8IA 4RPHA 5CYGA 1LWOA 1L8QA 4IW3B 2YYZA 1Y5MA 1COWD 1PHRA 2J9FB 1Q2UA 4PPQA 4M8IA 4L5YA 3C3EA 1EWQA 1WQ1R 2CDRA 1CDEA 2Q9AA 4RULA 1ZGBA 3DP7A 3BMOB 2X22A 1TZJA 3R0JA 4LV6A 1IWOA 4ZWNA 5ILGA 3PSHA 3Q7RA 4IZBA 1NI3A 4NBTA 3ETJA 3TL2A 1KQOA 4D9NA 1RM4A