3ZWAA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
727
structure length
727
Chain Sequence
VPRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 271
structure length 727
sequence length 727
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwaA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwaA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwaA01
3ZU5A 1YB5A 2NACA 3AFNA 5IDQA 2HJRA 1P3DA 2Y99A 4CMAA 1J5PA 1PIXA 1QSGA 1D1TA 1ZK0A 1NVGA 2D4AA 1Q0HA 2FPIA 2Y1FA 3RSTA 3ADPA 4ND4A 4NBUA 3OECA 1QLHA 3QWBA 4PFJA 3A06A 2A4KA 1V6AA 4TWRA 5L51A 3VPXA 1XNWA 3EVTA 4JYLA 2NM0A 3MEQA 1HZDA 2O4CA 1I8TA 2ZJ0A 4ELSA 3OJFA 3I9NA 3ONDA 3RWBA 4OG1A 2GN4A 4DMMA 3TNLA 4IY1A 1MFZA 1CEQA 2XPCA 3C1AA 3OJEA 2OP0A 2OGUA 4XIYA 1NASA 1Y6JA 3CZRA 4O59O 1B16A 3PGJA 2AQ8A 4L75A 4BNHA 5CDYA 1LLDA 2DT5A 2ZKLA 1I2ZA 3KUXA 3ZN2A 3F46A 2V6GA 3MJ4A 4OJNA 5H83A 4HBGA 3DZFA 3LSYA 2DFDA 2DU8A 2W8ZA 4KTTE 1B2LA 3IUPA 1ADGA 4HNGA 4JJIA 4WEQA 3GLQA 1NR1A 2PR2A 4RYFH 1BWSA 2BLLA 4BQPA 4YRBA 1YQDA 1D7OA 4XYGA 4CM5A 3ZZNA 1KEWA 2PK3A 2PZKA 5ADHA 4RGBA 4B7UA 5DCWA 2JD2A 5JO0A 1NHGA 1DIGA 1T4BA 3L6OO 3INTA 4WLEA 3RJ9A 2VRCD 4CODB 2GZ1A 5B4UA 5EN4A 3Q9NA 4RL6A 4E2XA 3A4VA 4HFNA 2PTGA 3GVPA 3WB9A 5LC1A 1DEHA 3GZ4A 2P2SA 3QLJA 2X8LA 1LNQA 2VUUA 3OIDA 2A81A 1F8FA 1O5IA 3L4SO 4IDAA 3RASA 3WG9A 4IZBA 1YONA 2NVUA 1EQUA 1PJ4A 3RIHA 1YG6A 1EZ4A 4Z9FA 2BGMA 1DJNA 2Y68A 4ZGWA 4XDYA 3ITKA 5T57A 3Q0EA 2AG8A 3S2IA 4YXFA 4OMRA 1U9JA 3AI1A 3KTKA 4GSLA 4CM8B 4P4LA 1N8KA 3PE8A 5CAEA 4DQXA 1KETA 4DMLA 2JD1A 3H2ZA 5JAZA 5DN9A 3KZVA 3EYWA 4S1VA 3ADOA 3GGPA 2Q4BA 3W8DA 1F14A 1XKQA 4IXTA 3KTGA 4NK5A 2POQX 3PFWO 4A26A 5L7YA 3PRJA 4C7JA 3BIOA 4OKNA 1ZEJA 3SLKA 1E1KA 2RHCA 3GC6A 3O38A 1B8PA 2HMVA 4GAEA 4LK5A 4IJUA 2FN7A 2X5OA 4R3WA 4Y6RA 1B15A 1GEEA 2IZ0A 1DFIA 2VT2A 3WQRA 1LBEA 3GKBA 4WPGA 1RJWA 3CXRA 7ADHA 2VHZA 4WOKA 3H4VA 4EDFA 2RBEA 2VYND 2B35A 1PGOA 4GWKA 3M2TA 4IXWA 3V5EA 4EMMA 5T64A 1PGNA 2O3UA 1GU7A 4Y9DA 3O8QA 4NU6A 5IFLA 3KYCA 1NVMB 2D2IA 4BO6A 2G76A 3O03A 4MDHA 4NJMB 1S6YA 3VHRA 3ROQA 5DU4A 5HA5A 3AU9A 4N54A 5IZ4A 1CWUA 1T4DA 4WLUA 5AXBA 1ONPA 1CF2O 3WBBA 1U4OA 4G5HA 4D46A 2C5EA 1QORA 5L9AA 3Q2IA 3PLNA 5JE8A 3ONEA 1IYZA 1JA9A 5IZCA 1E6UA 1PGQA 4R5MA 3DOCA 4Y98A 2O3SA 3F4BA 2VWHA 3PP8A 3HB4X 3U4CA 4WEOA 4R16A 2DBZA 4J9VA 3VPGA 4E5YA 3QWHA 3M6MA 2CDCA 4DYDA 5TNXA 5IXSA 1Q51A 3JV7A 2ZATA 3E5RA 1OZAA 3OBBA 4IDDA 2GZ3A 1XQ1A 1BXZA 2YW9A 5KDRA 1GQYA 2VUSA 3TF5A 3FF4A 2P4HX 4K3WA 4F6LA 1H6AA 4WNCA 4FZWA 4WCFC 1KIFA 1KEUA 2V7PA 5AXDA 1GZ3A 3FI9A 3HG7A 1VKOA 2Q50A 2VHVA 3PIIA 3OM9A 4BV8A 4NU5A 4FDAA 1N6EA 3FN4A 1B26A 2IXBA 1I2BA 1JKJA 1ULSA 1J7XA 4BNXA 4GWGA 3TZ3A 2HUNA 3WYCA 1LRKA 1YH3A 5JMPA 3EC7A 1X0XA 4TQGA 3RFTA 3C1OA 1TYFA 1ARZA 3T4EA 4RJTA 4J4TA 4NNQA 2WMDA 3RAJA 1ZKMA 2J5RA 1NPDA 1I36A 3S2EA 1Q1NA 1GV1A 4QT0A 4Z0MA 4XCVA 5IKLB 4XRGA 4Q0GA 4FS3A 2FZEA 4PLPA 3HN7A 2G17A 3HNPA 1EBFA 3PHHA 4IDEA 1C3VA 1K2WA 1NAIA 2AXQA 1E3JA 3P2YA 2PPYA 1N1EA 4JFCA 4JLWA 4XZ3A 4ZDDA 4L4SA 2YDYA 3PZKA 2LDXA 4UVEA 3GN1A 4YT8A 3DBHA 2VT3A 7MDHA 1KC1A 1LSJA 1NTOA 3D5TA 3O26A 4BS9A 2BFAA 1HLPA 1O89A 3JQ9A 4M89A 4TZKA 4WASA 1LDGA 1DC5A 3DMTA 4NMHA 1A5ZA 4R1UA 2C0CA 4TRRA 4IGEA 2X0NA 1DC6A 1FK8A 3BEZA 1B3BA 3R9TA 1N7HA 2PV7A 1GYPA 3SJ7A 4E2WA 4PLCA 3C7DB 1H9AA 4GVLA 4Z0HO 3HRXA 3JYOA 3UHAA 1BXGA 3NRCA 4HP8A 3MOGA 5F1OA 1UJMA 3BYZA 3CEAA 4J6FA 1PJ3A 1Y5RA 4BMSA 1P0FA 3F1LA 5I9LA 1DDOA 2I3AA 3GY0A 1E92A 4F47A 4BGIA 2P9CA 2NP9A 1E7YA 3OICA 5ICMA 2BF7A 1NM5A 1DIHA 3MJSA 4N5LA 4HFRA 3WMWA 4CMCA 1YL5A 1UYRA 1QLJA 4JK3A 2P5YA 4GVXA 4L0QA 5GZ1A 3TZCA 5CDSA 1K6JA 2DLDA 2VRCA 2PKRA 4R01A 1AHIA 4WCFA 5ILGA 1GY8A 4B4VA 3DR3A 2J3HA 2FW2A 2P9EA 3B6ZA 4RDHA 1EBUA 4ALMA 3QREA 3ETGA 4KQXA 4MP8A 4KUEA 4PG6A 4GGPA 2YHIA 4ZRMA 3IMFA 1W0CA 2J5IA 3R1IA 3V2GA 2E37A 3OQBA 3BTUA 4OGWA 3OJLA 4NBWA 4N5NA 3UXYA 4OMUA 4EEXA 5DNAA 3T7EA 3WGQA 2OHXA 4TSKA 4U0GA 4Q3DA 3G0OA 4FFPA 1QV7A 1RKXA 3I83A 4IDGA 1YE3A 1KVQA 3Q1LA 4FPXA 4M86A 2B36A 1HDXA 4OLQA 1MXHA 5LDGA 2OOSA 3F1KA 1RM3A 3H0QA 4YJFB 3L77A 8LDHA 3ZW9A 5KKAA 2NWQA 4NK4A 2F1KA 1CJCA 2F9IA 4BQRA 3EUWA 1SPXA 1KBZA 2BFMA 2PZJA 4EW6A 4D45A 4ZU2A 3BF0A 5CG1A 4JVTA 1C1XB 5DBGA 1NAHA 5AXCA 2W2KB 2FMUA 2OBNA 3FBTA 3GEMA 4U7WA 5ENVA 2PZLA 1HYGA 1GTMA 3E9QA 3WJAA 1PJBA 1UZLA 1FJHA 3CIFA 3JCZA 1XDWA 2CY0A 3F3SA 4FSHA 4OH1A 4CUJA 3IC5A 1MGOA 4DPMA 4AJ1A 1GCOA 1Y7TA 3RU9A 1DFGA 4BUCA 3EK2A 2I6TA 5CDTA 4B7XA 2JD0A 4NIMA 3ULKA 5FFFA 3WYEA 5EINA 4DL9A 4E2YA 5JPIA 1B14A 5G4KA 2F9YB 1PEDA 4DIBA 3KO8A 2GO1A 4BNFA 4FW8A 4ZDFA 4ALNA 2DFVA 2IYPA 4YAEA 4ALKA 3D4OA 1WZIA 4TKMA 3AW9A 1SB9A 1MA0A 4PZDA 1DIAA 2X5KO 2JCYA 3EGOA 4RO0A 3ZW8A 2DPGA 3R6HA 2JAHA 3ASUA 5L53A 3ZCXA 4K28A 3GZNB 3MCVA 4UVGA 1CYDA 4E21A 4BNMA 5F3RA 4D7AA 3VPFA 4OKIA 1AHHA 3LC1O 4DIOA 5JCXA 3VH3A 4FJWD 2ZJ1A 3FBGA 1HNUA 2FR8A 2VHYA 4GLLA 2XAAA 1T2EA 3DORA 4N18A 3JU1A 4CQMA 4LK3A 5L3ZA 3IBBA 3TWOA 3FNFA 3CE6A 2PD3A 3ORFA 1I24A 2EJWA 3JQBA 1N1GA 3LLVA 4FN4A 2GRAA 4E2ZA 2FSVA 4URFA 2FHSA 3I9OA 3VH1A 4FBGA 5C3MA 2HCTA 1PL8A 1V9LA 3KV3O 4TRJA 3SLGA 1O6ZA 2VSUC 4ASIA 2J5KA 2FR1A 3B70A 4ZN6A 2W98A 1PSDA 1P45A 3U9SB 2UAGA 2DQ4A 4ZDEA 5TJ9A 2GGSA 2J6IA 4P38A 4YDRA 2JL1A 1GYQA 1HDOA 2ZQQA 3QA9A 5BR7A 4J4HA 1R12A 4MVJA 3JQ7B 3DBVO 3WFIA 4IDBA 1XELA 3N7UA 1WZEA 1U4SA 3P19A 4INAA 3N6RB 4L73A 4FD3A 4DC1A 4L8VA 4N7RA 1PR9A 2GF2A 1HYEA 3QIVA 3IKTA 3TLFA 1R16A 4GMFA 4LSMA 5I7FA 3K92A 3GRPA 1IL0A 1N2SA 4E4YA 2Q2WA 4O5OA 4YWJA 3UF0A 1EK6A 1PJQA 1LQTA 4AJ2A 1HE3A 4MVJF 2DUBA 5A1TA 5B4TA 1E6WA 4D3SA 3DL2A 1YOVB 1T25A 2Z95A 1UP6A 5BSGA 1OI7A 4IS2A 5A9TA 3UFXA 4S3MA 1GUFA 3H81A 4FNDA 3FPCA 5A03A 2YV1A 1WDMA 1FDVA 3SBOA 2O7QA 1NNUA 1R37A 3P5SA 3E18A 1W73A 3EZLA 4O6VA 4ESOA 3DOJA 2GDZA 1Y1PA 2FWMX 1ZK4A 3JQAA 4BNGA 4JJTA 1ZJYA 2QQ3A 4KUGA 4E6PA 1X1EA 1OMOA 4E12A 1LDYA 1A71A 2Q1UA 1PL7A 1LDMA 1LC0A 4R51A 1F06A 4E33A 5JAQA 2EKLA 3Q9UA 1GR0A 2NSDA 4B8WA 4GI2A 3QQPA 3TRRA 3HJAA 4CM8A 4YT2A 1GUYA 1JAXA 4EI2A 3K50A 4YT5A 2YV3A 3CPSA 1GL3A 1C0KA 3EY4A 1UUFA 1I3MA 3I52A 4AICA 2FY8A 3C24A 3JQEA 5JDIC 5IDYA 3JYPA 3E82A 1VRGA 2R6JA 1C14A 4NR0A 3U4HA 2NNLD 3HE2A 4KWIA 1WP4A 2QIOA 2VZ0A 3CH6A 2DUWA 4TRNA 5DZSA 5T8KA 3UUWA 4JOTA 3K8ZA 3R3JA 5DOZA 3GEGA 4WNIA 1Q7GA 2PY6A 3KTIA 2NU9A 4MO2A 3SXPA 1E3WB 2GR9A 3E1KA 1PWZA 1NQOA 4QFDA 3M6NA 5E0SA 3QYRA 2HMUA 3CZMA 3QXIA 4XQCA 3H9EO 1MUUA 2AG5A 3RJ5A 2ZTUA 4J7UA 4ZDCA 3I23A 3NDRA 3U4IA 4L74A 3GG9A 2Y1EA 1I2CA 1SMKA 3QVTA 3GNTA 4GX1A 4HKTA 4JGBA 4HFMA 1RM4A 2VOJA 4WJZA 4YJHB 4CR8A 2A9FA 2CVZA 3G17A 1HE2A 1PZFA 1NR7A 4IPTA 1Z82A 3DOOA 4YVFA 3K6JA 4YTEA 2X9NA 1HKUA 4I9HA 5H82A 4DRYA 4NFYA 4NJMA 5CPBA 4JXKA 2X0RA 3PQDA 2ET6A 3AY6A 1H0KA 3H65A 4CLRA 3GF7A 2FP4A 2HU2A 4BO7A 1E7QA 5G0WA 4ONEA 4B4UA 2PGLA 4M8SA 4O0LA 1V3VA 4GPD1 1A7AA 1LSOA 3E48A 1EUCA 2HRBA 1HF3A 1XWFA 4IQ8A 5INGA 1JAYA 3O4RA 2NTVA 3GF3A 4RPJA 4NNJA 1I3NA 3G64A 2P9GA 4W9NA 3RC1A 4MVJG 3UICA 4P8RA 1YDWA 3ZNNA 5FEUA 3ZNOA 2Q35A 4MXIA 3CKYA 3RBXA 4AJNA 3VPSA 3WMXA 1QXSA 3TFQA 8ADHA 9LDTA 1FCFA 1WDKA 3GA0A 5KTKA 4B4WA 3E9NA 1P1FA 2OO5A 2CD9A 4BKPA 2YFHA 1AUPA 3KSZO 2W2LD 3UVEA 4D43A 9LDBA 4EJ0A 3GUCA 3GMDA 4XJTA 1HNOA 1KYQA 2DTDA 2VWPA 3OH8A 4CM4B 5DTWA 4AJEA 3CSDA 3WFJA 2PD6A 3GOHA 4JCRA 2IRWA 5EPOA 2H6EA 3IAHA 4PG7A 1CERA 1GZ4A 4BL5A 4D0RA 1B7GO 3PEFA 1K39A 1MP0A 1ISHA 1HDZA 1EK5A 3PJEA 5IN5A 5COBA 1TT5A 3AUTA 3HDHA 5C9GA 3GVHA 5INFA 2EW2A 5I9MA 1PWXA 3ANLA 2CMDA 2VQ3A 4W82A 3WG5A 3RUAA 5JS6A 3RUEA 1KERA 2GTRA 3ZWCA 3GR6A 3H9QA 1DPGA 1R4NA 3I9MA 1YWGO 2VHXA 1F17A 3C1TA 3DBRB 4J90A 3VZQA 2Q4EA 3S2FA 3VZPA 2NQTA 3NJ4A 3E6AA 3RQSA 5ILOA 2BKAA 5DP2A 3IAVA 3PTZA 3U9RB 1BW9B 2FBMA 3PDUA 3TVWA 4MKRA 2IODA 4XRRA 4ID9A 1YVEI 4FQ8A 4CMHA 2IE0A 4LRSB 1YBMA 4RF4A 2ZK7A 1BTOA 3KXDA 2OZPA 4PLHA 4RVFA 4LVCA 1VJTA 3WNVA 2G82A 3BMOB 4BMNA 4D44A 3MFMA 3LT4A 1GYRA 3C85A 1C1DB 4FFLA 3ZH2A 4AG3A 5CFZA 4R9SA 3VH2A 3F4LA 5JBXA 2CBYA 4BO5A 3RUIA 3V2HA 3U0BA 3PWSA 2E82A 1EFKA 1XA0A 4O1MA 3WGGA 1WW8A 3LKEA 5I9NA 3DZKA 1LI4A 3HN2A 4ELWA 1JU9A 1E77A 4P4GA 4WLNA 2AE2A 5EJ2A 5I7VA 4CV2A 2J5GA 4JQCA 2XOXA 1PS9A 3VTFA 2E49A 1VL8A 3WSVA 1T2DA 4OQZA 3PYXA 1R15A 5LCXA 4R68A 4RCVA 2AW5A 3L9XA 1PIWA 1V8BA 2YJZA 2HK8A 1LXCA 3TZHA 5DU6A 3DWFA 4CMIB 2WD7B 4AJLA 1E7RA 3ZNPA 5JY6A 3HQ4O 1TT7A 1WMAA 3DBLB 2AQHA 4U8GA 2YHUA 1TA4A 1YQXA 4E0BA 4R3NA 1IPEA 5G0UA 4NDNE 1YBVA 2GASA 5THQA 3MYBA 1LJ8A 4EJMA 3DAGA 1SC6A 4Q39A 4KQWA 3DZJA 1A7KA 1TVEA 5C7LO 5ER9A 3I9JA 6LDHA 4M55A 1LTHR 1W2XA 3T3WA 1WDLA 1OAAA 4JCSA 4ITUA 1AN9A 1PJLA 1XSEA 4X54A 4YJFA 3UCXA 3FHLA 5EERA 4MOWA 5CTCA 2X0JA 2C29D 4OM8A 2I66A 4CM6A 2B69A 4HWKA 4JBGA 1EVYA 5K0ZA 2C5AA 3HE3A 3SEFA 1KEVA 3KSDO 2ZB3A 1BVRA 1LC3A 3UH1A 4EUFA 1DAOA 1C1XA 1UR5A 2W2KA 4FGSA 3VDRA 4K1LA 1NVTA 2C7VA 3O9ZA 4YRAA 1LU9A 3M1AA 4DPLA 4OAQA 1U7HA 5KJEA 4BOYA 3PPIA 3TZ6A 5TJHA 4OHUA 5CG2A 3Q0JA 4I9NA 1WWKA 3KB6A 1I33A 1DOHA 3W6UA 4CLEA 2NVWA 3ZHXA 3PI7A 1Y7OA 1UDCA 1NX6A 5IZCC 5KIAA 4UVHA 3UW3A 1XHLA 3QVXA 4W99A 3FWZA 2WTBA 1FDUA 1YQGA 1UAGA 2F9YA 3OJ0A 1NWCA 3DAPA 2H63A 4CLXA 2D8AA 2CSUA 4CLOB 1H9BA 3I6IA 3ON5A 3RKRA 3ROKA 1KVTA 2JJYA 4DPKA 1XO6A 1DLIA 3T89A 3GVXA 1XIVA 3FTNA 1X0VA 2VZ9A 1HZZA 4RVUA 4FZWC 4KPKA 5GY7A 3GZNA 5DT9A 4XYLA 1ZSVA 4XYEA 4B79A 1XU9A 3CTMA 4U6SA 2JKVA 2DTXA 1GPJA 5EL0A 3GAZA 1PS8A 3HSKA 1UYVA 1M76A 3QK8A 2WYVA 2O4UX 1LRLA 4J0FA 1H6BA 3N58A 4J1SA 4UEJA 4DVJA 2GSDA 1RYEA 3OQ6A 3WX0A 5JYEA 2EHDA 1HSOA 2BZRA 3OFSA 1AXEA 2X1HA 2E6UX 4J9UE 3F5QA 1VC2A 2W2LA 1DHRA 3DFUA 5U9CA 1U8XX 4B3JA 4W7HA 4ND2A 3GVIA 3IDSA 4MVJP 4M49A 1E5LA 5DBIA 2JFHA 4DLLA 2HDHA 1NFQA 2EG9A 3JQ7A 2GN9A 1OOEA 2VZ8A 4HX5A 5A9SA 2OXIA 5MDHA 4BB6A 5BSHA 4GKBA 3DAFA 3OF2A 1E3LA 1E5QA 1G0NA 5THKA 3JQ9C 3KTDA 3X2EA 2EJ5A 3DMTC 3I4CA 3GFBA 1M2WA 1RPNA 2GNAA 3H0JA 1RJNA 3W4KA 3KTJA 4L4RA 3OC7A 3L0DA 4IJVA 4HC8A 4R9RA 4J3FA 4B7CA 3UKOA 3FDUA 3R9QA 4RLSA 4XGNA 3GLMA 2B5WA 3OEWA 4J16A 3WXBA 3MT6A 4IBOA 4JIGA 4GX5A 3ZHZA 4YACA 3HFSA 3IJPA 3AJRA 4NBVA 4KOAA 4BNIA 2Y0DA 1ZH8A 1EUDA 4EMPA 1T24A 2G5CA 3GHYA 2HAEA 4E32A 3QWDA 1RWBA 2QYSA 4Y8VA 1T26A 1VJ0A 4R5HA 1EUZA 3DZIA 1TEHA 1AXGA 5L4LA 2A94A 5LDHA 4LISA 1EFLA 1U8FO 4PIVA 4KP7A 4ALJA 1HDGO 4BB5A 4D79A 2Y1OA 1EY3A 2OL4A 3TDCA 4UVIA 4N5MA 3D7LA 2FZWA 1S7CA 4CV1A 1IUKA 4DTIA 3KQFA 4OOFA 2WEKA 4R1SA 3P7MA 3KEQA 1DHTA 1EE9A 4HUJA 4JNKA 1J4AA 1SNYA 2AEMA 3JQ8B 3ENNA 4XQ9A 3MTGA 4NFSA 3WR5A 3QP9A 4OOEA 4PLVA 3GG2A 2JFGA 4BO2A 3K2EA 3JD3A 1XNYA 4H15A 4CJXA 3GFGA 4D42A 1U3UA 3RUFA 2VTEA 3G1TA 4QXMA 1P44A 1ZSYA 2AHRA 4ND5A 2ZQRA 4U0KA 2I3GA 1MFPA 1Y8RB 1C0LA 2Q45A 1M75A 1CQIA 3ZWBA 5BSFA 4YRDA 4RZHA 1X13A 4LMPA 4MIOA 5CDUA 3IQDB 2SCUA 4TMFA 5IDWA 2ZQZA 2WDZA 4FGWA 2C20A 4OXNA 4CUZA 1K32A 4UUPA 3E5MA 1CIVA 1XEAA 1B0AA 3QSGA 3AU8A 4YJHA 3BMQB 3W8FA 4BO0A 4AJ4A 1UAYA 1VKNA 1UZMA 1PZGA 1Q0QA 3GEDA 3NUGA 4U19A 3P2LA 2DPHA 1U5AA 1RYDA 1NXQA 4KDFA 3GPIA 3RC9A 4XR9A 2O2YA 4BO9A 4ZVVA 4RQUA 4NQZA 3HLN1 2X6TA 4WK6A 4YCAA 2ZCVA 3SC6A 4Z3DA 2X24A 3G49A 4DREA 4GHNA 1P1KA 2XF8A 1H2BA 2YUTA 3D1LA 3H7AA 5AOVA 4BNUA 2J5SA 4OSOA 1HDCA 2QZ9A 4MVJM 5JXWA 2AA3A 4JBHA 2I65A 3FNHA 3NGLA 4B3HA 5KJFA 1LLUA 3UN1A 3L6DA 5G2OA 5C5IA 4UUOA 3HDQA 3QVSA 1PJSA 1N9GB 4QEDA 3R0OA 3UGKA 5TT0A 3ZNQA 3M2PA 3BTSA 4QFCA 5HRUA 1Z75A 1EQ2A 1W4ZA 1R4MA 4RQTA 4BO1A 4F3YA 1E1MA 4I08A 4KD6A 3RUHA 3BAZA 4YJDA 3D3WA 4BHTA 1PGJA 3PHIA 1DXYA 1ULUA 3RFXA 1LLQA 3Q1TA 3JQBC 3AUSA 5I7SA 4CL3A 5MGBA 4NEKA 3LU1A 3L07A 4HXYA 3RSHA 1LDEA 1LRJA 3AY7A 4JROA 3W6ZA 4A10A 4MP3A 4RV9A 4ZD6A 3ZU2A 2G0TA 4R1TA 3SLLA 2XXJA 4XGKA 3QW2A 1FXSA 4R4JA 1WXDA 3JQ6A 4RVSA 3H0SA 1V35A 3DBRA 2WE8A 4D3FA 1FC7A 3QRWA 4J4BA 1N6DA 2V65A 3X2FA 4FFNA 1GV0A 3MOIA 4M87A 1SB8A 1K3TA 4JYJA 3KYBA 4I5DA 4NHEA 2FSSA 3W4IA 5HM8A 2Q34A 3AM3A 4MJLA 1P1JA 3STHA 3WTCA 4DA9A 2O48X 5C7IO 2YDXA 1O9BA 4JJFA 4TVOA 5EQFA 2O23A 4BGEA 4D3DA 5FYDA 3H9UA 4Q3CA 5G0TA 3RC7A 1EE2A 1U2GA 5L7TA 2HRZA 3OIGA 1HXHA 3C7AA 1E7MA 3RI3A 1SO8A 2VYNA 3TZKA 3DZGA 1G6KA 3PZBA 5DKPA 4FJ2A 4GKVA 4QTZA 3TZQA 3GHHA 3ITDA 3ZU4A 1NQTA 1O8UA 1E1NA 3WSWA 1NBOA 2ZL0A 4K6CA 2Z5LA 3GDOA 4MPDA 2O7SA 2HLPA 2VN8A 5HS6A 1UXGA 4QIIA 4H16A 2ZB8A 2IEXA 4PZCA 4Y6SA 5GZ6A 2GZ2A 5BT9A 1A9ZA 4IZDA 1Z73A 1H2HA 3TOZA 1UZNA 3PZRA 3UCFA 3VAZA 1J0XO 3VOSA 1JDJA 3BMNA 4A2CA 3MJEA 3KYDB 4KNPA 3RSIA 3IJRA 1YO6A 3KLPX 4QUKA 3H9GA 5TQVA 4KMSA 4BMVA 5JO9A 2VCYA 3ST7A 4GBJA 5BSEA 3K8XA 2I5PO 3VVCA 2VREA 2X23A 2QZZA 3NGXA 5COQA 5ENDA 4RVGA 4CMIA 3WDSA 1ZZEA 2B4TO 4LN1A 1HDYA 5T67A 5AYVA 5T8KC 5DUCA 4Z3KA 4IS3A 3H9JA 4FCCA 3HINA 4JCQA 2IEBA 1HTBA 3FSRA 3K30A 3B1JA 5GMOA 3TV5A 5DOVA 5DDIP 1D3AA 3ANNA 4JX8A 5IG2A 2BFPA 4P4NA 3BTOA 1YS4A 1MLDA 4D41A 3AOEA 4AJIA 2PH3A 3QKAA 3MZ0A 1Q0LA 1WNTA 3D5QA 1BG6A 5A3JA 1L1FA 4ELXA 4BKOA 1LDNA 1IY8A 1ZSNA 3GPDG 2D0IA 4W6ZA 3U5TA 3LLSA 3NJ8A 1C0PA 5EIOA 1GPDG 2B4RO 3HADA 4YQZA 3BXXA 2EJVA 3PVZA 2YQ5A 2EF1A 1ID1A 3TRIA 1VL0A 2Q3EA 1PX0A 2Y05A 3PEAA 3WS7A 3ZWOA 3QVOA 3S8MA 4DYVA 1XU7A 2EERA 3PGXA 3LYLA 1NQ5A 2NQ8A 4JP2A 2WM3A 2V6BA 1DRWA 1C0IA 3TT7A 3UOGA 1U1IA 4YJGB 1P1RA 2WE7A 3ZHYA 3E9MA 1Q2XA 1XG5A 4GMGA 2Q46A 2DBRA 4K29A 5DZKA 1ZNQO 1ZMTA 1DSSG 5T5QA 2EWMA 3TOXA 2JCVA 3FR7A 4CR7A 3OMEA 4FFOA 4FOOA 1I10A 3NAQA 4LMRA 3U49A 2GN8A 1U3VA 3MJCA 4W9NC 1ORRA 1KY4A 4RYFA 4WYOB 3OQ1A 2H5LA 2PZMA 4MIYA 4KZPA 2FZSA 3O8QB 2DBQA 2EP7A 3ROPA 4HFJA 5A5FA 3KYCB 1SZJG 3RBZA 3RUCA 2OORA 1EVIA 1GZ6A 3AI3A 2RAFA 5L4SA 3TJRA 4NBRA 2A92A 2GN6A 3GNQA 2DKNA 1GFSA 4XEHA 3VKVA 4YEDA 3OEYA 4CMJA 1NZYB 1OFGA 2J3JA 3MTJA 4EJ6A 5JSFA 4Q3BA 1HYHA 4O63O 4U5QA 2PG8A 5COAA 1X15A 1B8UA 3T88A 5IXYA 3H0UA 1GD1O 3H5NA 4ZQFA 2Y1DA 1UXKA 3DO5A 1GUZA 4PCVA 2VWQA 3NYWA 2B4QA 1N5DA 3OMLA 5KDRB 4BGVA 1X14A 3NTOA 4DUPA 5JYDA 1LSUA 3RUDA 1IZ9A 1FMCA 1VM6A 3DMYA 2HMWA 4YYZA 1XNVA 1H6CA 3FWNA 3GNSA 4WLFA 1RM0A 3H5RA 2DUUA 5L7WA 1GQ2A 2NADA 1HDRA 2NU6A 5TSDA 3C7CB 1X7DA 3K2BA 1PTJA 2PH5A 4EZBA 3PJDA 3HB5X 2VSSA 3Q0GA 4FOSA 1LQUA 4NZ9A 2JHGA 2A35A 3C8MA 2CFCA 1JWAB 1LDBA 1R0SA 4RF5A 2P5UA 5L45A 1U3TA 3ENKA 3OHSX 2YY7A 4TKLA 1O94A 3HFGA 3K96A 1K89A 4LGVA 3Q2KA 4XDZA 1PGPA 5DULA 2QYTA 1Q7BA 1YRLA 3DFZA 5FWNA 1E3SA 1XCBA 1UDBA 4HV4A 3K73O 5JLAA 3DTYA 2VSSF 2BI7A 3IS3A 5DBFA 5BNFA 1PR3A 3GH3A 3GT0A 4EGFA 5G1RA 2C2YA 3L4BA 2AMFA 1MV8A 2ZYDA 5JAMA 5K6AA 1YL7A 1JWBB 5CEFA 2TMGA 3G1UA 4QSMA 3KETA 3M1LA 4IJWA 5JAIA 5IJZA 1JQBA 4PLGA 5FF9A 1U3WA 5INIA 3GDGA 4UREA 3DHEA 1UXHA 2Q2XA 3PXXA 2PWZA 2VYVD 3ZWXA 5HTOA 1W8DA 2R00A 5IF3A 1CQJA 3ISAA 3R0IA 2I76A 3AUAA 5TLSA 4KTVE 1BXGB 1MC4A 3MJVA 3NV9A 2OFPA 4Y6PA 4ZQGA 3COSA 5A02A 1I30A 1ZXLA 1HLDA 4Z0TA 5FUSA 5G4LA 1YDEA 4L9RA 1U5CA 1PJTA 3RC2A 1B8VA 1OC4A 3F47A 4FJ0A 5FI5A 4DGSA 4RCNA 2DEOA 2PNFA 4XB1A 5KJPA 3W1VA 3QE3A 4XA8A 4OO3A 5IDXA 1HWYA 3MOYA 4YPOA 1LA2A 4FIZA 4PG5A 4CR6A 5DZKH 1KOLA 4ZQHA 3LC7O 4WCFB 5G0SA 4A7PA 1G1AA 4J1NA 2ZTVA 2Y66A 4ZRNA 3T7CA 4BKQA 1EMDA 1NP3A 3WOHA 3OA2A 3BMQA 1K6XA 3E03A 3WQSB 2IZ1A 4UVDA 1G0OA 2PBPA 4U0GH 5IN4A 2J5IB 3U3XA 4FB8A 2E48A 3I3OA 4LSWA 3WYBA 1XX4A 1WAMA 4I42A 4MIEA 3U9LA 1DCIA 1ISIA 4FJ1A 2ILTA 3BZUA 3KEOA 4JP3A 1JKFA 1QP8A 3ICCA 1PJHA 3NEPX 1PZHA 3NDJA 1ZEMA 3NT5A 2Q2VA 3I9LA 2A7SA 1H5QA 3WGOA 4Q3AA 3WGZA 4QFEA 2CZCA 4H3VA 4BO3A 1OD2A 1Y81A 1SBYA 3S55A 4BIIA 4PRKA 4MP6A 2F9IB 1JLLA 5CTBA 4LRTB 4IDFA 1NQAO 3NTQA 1T2AA 4YB8A 4GH5A 2B0JA 1EF8A 4B3IA 1SAYA 1HE4A 2NUAA 4MOUA 5BNTA 3QY9A 2ZCUA 2VSUE 3SJUA 3DC2A 4R54A 1N9GA 3PLRA 3GMAA 1UYSA 1HRDA 1ZK1A 3OA0A 4BNNA 5C7OO 2QQ5A 2ZTMA 3VC7A 4AJKA 1IZ0A 1T2FA 2YQ4A 4G81A 3DTTA 3FF6A 1IHYA 3EDMA 1PQWA 4J2HA 5FIFA 1PL6A 4J2OA 1W6UA 1KEPA 3I6QA 4NH4A 5F1PA 2AQKA 5G4KB 1QMGA 2VRBA 1D1SA 3HHPA 1ONNA 1JKIA 4HNHA 4A5OA 1DIBA 4JJGA 5KVCA 2O3QA 5JFOA 3ZV4A 4B8ZA 1IULA 2PKQO 3GMSA 4U0JA 4DWVA 5KVVA 2VUTA 3H6KA 2GD1O 4R69A 1EEHA 4II2A 3K5PA 4CMGA 3HP0A 3ZV3A 4B4OA 3WGIA 1WVGA 4DLAA 3AWDA 1IOLA 2JAPA 3HUDA 2W90A 4AJOA 4CM3A 1ZBQA 3RD5A 5F5LA 1K6IA 4CQMB 2VX2A 3I47A 2CNBA 4CMEA 2ZB4A 4JBIA 1YBAA 2BELA 3N74A 4MVJH 1NFRA 2XXBA 4EMLA 3KSUA 3FPLA 3I9KA 3LDHA 2WSBA 3JD4A 3DHYA 2Z1MA 2P91A 1HETA 4BV9A 5A06A 2B5VA 3GGGA 3ST9A 3PGQA 4WECA 3KHUA 4IIUA 4FC6A 3RCBA 2OBYA 1DRVA 1SCUA 3EVNA 4XWYA 2BH9A 5A5EA 3PYLA 3BTVA 2X0IA 3AY3A 1BRMA 1XYGA 4MKZA 4OQYA 3V2UA 4GM2A 4CLDA 1EF9A 1YJQA 3JQFC 3NT2A 2QHXA 1ISGA 4F45A 3KYDA 4K2NA 5KJ1A 1HSZA 3R6DA 2EKPA 2RIRA 1ENOA 5U1PA 5G1SA 2IZZA 4ROSA 4KWBA 4H7PA 4QO8A 1VPDA 4BNWA 2GUGA 1M6WA 3LT0A 4UEKA 5TS3A 1YB4A 1X0UA 4EUHA 5L40A 5A9RA 3ASVA 5KWEA 1ML3A 4QX6A 2BGKA 1MC5A 4BNZA 3AM5A 1ZCJA 3NT4A 3ZHBA 3JD2A 4DBZA 2BD0A 3R3SA 4IDCA 4Q1IA 4NBTA 4BKRA 1VSVA 3L6EA 5FI3A 2UUPA 1L7EA 2VYVA 3JQAB 4IM7A 1A9YA 1NWHA 4NJOA 5EESA 3IB9A 3S2GA 4CM7A 4WKGA 1MX3A 3SX2A 1MJ3A 4CQLB 4OXKA 1GAEO 1LX6A 1X7HA 5B12A 1ZJZA 4G2RA 4PZEA 1EDOA 4GL4A 1OD4A 4ZICA 4YLHA 1Y5MA 4F6CA 1N92A 1PJ2A 2P68A 3U09A 3LZ6A 4WZ8B 3WNQA 1E6EA 5I8ZA 2CE3A 3BHIA 5KOIA 1K5HA 3HWRA 4J91A 3Q11A 4IZHA 3D4PA 2HO5A 4YAGA 1I3LA 2CUKA 5E0SH 1K0UA 2EXXA 4E5PA 2X5JO 5JDCA 2FPGA 3DEYX 4R41A 2BMAA 4PGFA 4IZIA 3PYMA 4ZQEA 2HSDA 2F00A 3A28A 3MWEB 4WE3A 4G65A 4E5MA 2RHRA 2VTDA 3CINA 3OP4A 1SOVA 4YJGA 3OT6A 4U0HA 2I99A 3JSAA 2B83A 4ZU3A 1YOVA 2JFFA 3H5AA 3LT2A 4TRMA 3A9WA 3TL2A 4EEZA 1QG6A 5I8WA 4L8KA 4RF3A 1CRWG 2P4QA 3WGHA 5BQFA 1O0SA 3NDIA 3WWYA 4WOJA 2ZTLA 2G1UA 2JHFA 4XB2A 2YV2A 1KVSA 2V6MA 2OMEA 4EYEA 3PQFA 1RJMA 4LCJA 2DM6A 2Y1GA 2DTEA 4K9DA 4NFHA 4XQEA 3P85A 1VL6A 3I1JA 2X58A 1ZVMA 1U7TA 4ZJUA 5L4NA 3JQFA 5K9ZA 1NYTA 4CLRB 4I4ZA 3P5MA 2VOEA 6ADHA 5BNIA 2FR0A 4CUKA 1PQUA 1NZYA 4ZDBA 3U4DA 3QWFA 1XLTA 3EMKA 1WZ8A 1QYWA 4WCZA 2V6FA 3AK4A 1FDTA 2ZL4A 5A05A 2D1YA 3LVFO 2AEFA 3BMCB 3FR8A 3WIDA 4MKXA 4I8XA 1F8GA 4XYMA 1UP4A 1FC6A 2EP5A 2D5AA 1XR3A 4PLZA 2HQ1A 3QXZA 1M67A 1A72A 1E3WA 4CQMD 5JY1A 5KVQA 4XD2A 4BVAA 2EKQA 1T2CA 4YAJA 3UAGA 4F46A 2ZL3A 4DI1A 2X9VA 1R0KA 1X7GA 4QECA 4MI2A 5CHEA 3FNGA 3T8BA 3QVWA 5B4VA 2CDAA 3B20A 3KVOA 1BVUA 3T4XA 1Z7BA 1I01A 2O50A 3CUKA 3KRTA 4P22A 3U9TB 2BRUA 1PQPA 4MVJD 1V0JA 1ENPA 2C54A 2ZIZA 3ETDA 4WGGA 3INRA 3JYNA 2DVMA 1SEPA 3SVTA 4J1QA 1TT5B 3I5MA 3ETEA 4M1QA 3H2SA 4FFMA 4CMBA 4CPDA 4JCTA 1ONOA 1YB1A 3B1FA 1ZK3A 2O2SA 3GAFA 4U6QA 1P77A 4I5EA 4KUHA 3PK0A 5TX7A 1D8AA 4M54A 4PVDA 3DZBA 2BGLA 5DF1A 1R66A 1WPQA 3LK7A 2Y0EA 3DDNA 1Z45A 1R4NB 5HS4A 1T1SA 3EZYA 4BNVA 4DBVO 4I5GA 1DRUA 5JBWA 5TF4A 4RZIA 2J8ZA 3W8EA 4W7IA 1HL3A 2J3KA 2Q99A 1CETA 4ILKA 2GLXA 5KCZA 4RLHA 4A73A 5TIIA 4BO4A 1E3EA 1HE5A 5TT1A 4DIFA 4TVBA 2H9IA 1CDOA 3P2OA 1HZJA 3GUYA 3JQAD 4PG4A 1JXZA 1XGKA 2D3TA 2C2XA 4TROA 3TDKA 3ZV6A 5DL1A 2W3PA 1NPTO 1A27A 3K31A 1JVBA 3U62A 2EGGA 4CM4A 1P1IA 3ZWYA 1NPYA 3JQDA 3KLMX 3HDYA 2Q1WA 4HADA 4BNTA 4ALLA 2AEJA 3ZU3A 5DUFA 4E5NA 3Q7HA 2QG4A 4CV3A 3FD8A 4LCEA 4DC0A 3T8AA 1X1TA 3KOUA 4AJHA 4CM9D 2NTJA 3I4FA 2UV8A 4IQ0A 3OIFA 4EITA 3QWIA 1E1LA 4BNJA 4GX2A 4UULA 1YXMA 1VSUA 3TSCA 3WIEA 3AOEC 3ZDFA 3MJTA 1OBFO 4YQYA 3PWZA 4I9UA 5DTPA 1MXFA 3WGTA 1B3RA 4GX0A 4R1NA 3S1LA 4OIMA 5JMWA 1DJQA 1P0CA 1PZEA 5GZ3A 1VI2A 2RH4A 3JQGB 1KY5A 2TMDA 3DZHA 1V3TA 3ZWMA 2C82A 3RROA 5CDGA 1Q7CA 1ZK2A 2PLAA 1Y8QB 1BW9A 1PS0A 4Z9YA 3TN7A 3VKUA 3GGOA 1VLLA 1T1RA 1P33A 2QW8A 2IXAA 4PRLA 1ISJA 1DAPA 4IJKA 5JW6A 4II3A 4A0SA 1TB4A 3GRKA 5ER6A 4PLTA 5JC8A 1TG6A 1ADBA 4XYBA 5T6BA 3BMOA 3OETA 3GDFA 2NU8A 4BGUA 3TT6A 4XIJA 2WD8A 1V3UA 5CPFA 1C1DA 1Z74A 2NTNA 2WJPA 5F5NA 3FNEA 4IZCA 3CMMA 1I3KA 5ICSA 4E30A 1EDZA 1IB6A 2WYWA 5AVOA 3PQEA 4EUEA 1ZW1A 4BO8A 3TFOA 1SG4A 1DC4A 3GVCA 4OSPA 2QRLA 2PFGA 3IP1A 1DC3A 3H3JA 2Q1SA 2HKIA 4XQGA 3DJAA 1AGNA 1GEGA 1NFFA 1P1HA 5H81A 4OL9A 3L3SA 1BHSA 4J43A 5TGDA 2H1SA 4G2NA 2UUOA 3FRJA 3F9IA 3KM0A 2Y0CA 4DQVA 3TL3A 3PJFA 3CMCO 4JWVA 3PHGA 2HMSA 1IHXA 5AXAA 3ROMA 1O95A 2ZB7A 2EW8A 3JD0A 3QHAA 4K26A 1ADCA 1O8CA 2WD7A 4CL8A 1FDSA 2RCYA 5C37A 1Y9AA 1QYCA 3B1KA 2HMTA 3DBLA 3H8VA 1JVSA 3IL2A 1E7SA 2I9PA 2UVDA 4YBZA 3JQCA 2CVOA 5KKCA 1PJCA 1ENZA 3LAOA 2BI8A 1SZOA 3WLEA 4QQRA 4AFNA 3PWKA 3JTMA 2NVUB 5A3VA 2NV6A 4I52A 3AM4A 4L4XA 3LC2O 1YKFA 3ZGYA 4D0SA 4CM1A 1OC2A 2Y1CA 5JCJD 4GSKA 4FR5A 2QX7A 3D0OA 1ON3A 3EAGA 2A7KA 2D59A 2DAPA 2R2GA 1H6DA 4I5FA 3GK3A 4QIJA 1I0ZA 5HWSA 2GCGA 5DP1A 1P31A 2FPPA 3K9QO 2PGJA 1TLTA 1P9LA 3HDJA 5TRTA 4U18A 3GN2A 3IUSA 2GERA 1ZFNA 3DHNA 5JC1A 3PDJA 3KBOA 1KVUA 3AI2A 1Z6ZA 3Q6IA 4HY3A 3WBFA 4J1TA 3M6IA 4ZHSA 2NU7A 3ZI0A 4CMKA 4Q3NA 4ZA2A 3PJGA 5KVSA 4J7XA 2QRKA 3STAA 1UYTA 2C7GA 4AJPA 1FDWA 1IE3A 3MWDB 5A9SB 1SOWA 5ES3A 1LSSA 3L4BC 1A4IA 2X22A 5K6AC 2BFOA 4AVYA 3Q3CA 4E13A 3VDQA 3JYQA 4CLOA 4Q3EA 1J6UA 3IIEA 3UCEA 3BPPA 1HT0A 2HK9A 5AQ1A 4JCOA 1KS9A 5EMHA 2HW5A 4FN7A 3A1NA 2PKQP 2C59A 4L76A 3HZZA 2R00C 3ZWVA 2EEZA 4FB5A 3RKUA 3L9WA 1ISFA 5KJCA 3G3EA 1DO8A 3V8BA 1KVRA 4RPGA 3VVBA 3INGA 2PD4A 1QRRA 4LVUA 1M6HA 2UYYA 1Q52A 2J5GD 1P74A 4UEOA 4C4OA 2RH8A 2J5QA 3QMJA 2VNSA 2WYUA 2Q2QA 1I5RA 2X4GA 1BDBA 3G79A 3PFFA 4CQLA 2J3IA 2X9GA 1ISMA 3F5SA 2IEDA 4I1IA 3E8XA 3OSUA 1NHWA 4IINA 4ND1A 1R6DA 2JCXA 4ND3A 5CEEA 3VZSA 1A4UA 1YG8A 1QV6A 2Y67A 2Y93A 4YAKA 4Y67A 1QR6A 1F0YA 4MINA 4RDIA 4J0EA 2X86A 2OP1A 4IIVA 1YJ8A 1UH5A 1BXKA 4E5KA 2J5II 2DBVO 4DXHA 1ZMOA 2CF5A 1E3IA 4YR9A 4CLHA 4CM9A 2PA3A 2UDPA 5F1KA 3DXFA 3ZWWA 3TVUA 1ENYA 3JD1A 2CDBA 2I67A 3DB2A 3LF2A 3H02A 3ZWAA 1DFHA 3EW7A 2PGDA 5KNLA 5ITWA 1EVZA 5I7EA 2NLOA 2GYYA 2X7HA 4YT4A 1BGVA 2EGHA 3NKLA 2HK7A 2F6IA 2VSUA 4OXYA 5C90A 4GLOA 2ZYGA 3ABIA 3PHJA 4E3ZA 3NTRA 1QKIA 3RFVA 5ITVA 3EHEA 3V5NA 4WCDA 2Q49A 4DLBA 1GCUA 4XKJA 3DBHB 3H3FA 1ZXBA 3V1YA 1ZIDA 2BHLA 2NVBA 1Y9EA 5F21A 1DBVO 2YFQA 2Z1NA 1R0LA 1D4FA 1LLCA 3WWZA 4EBFA 2VSUF 5B1YA 4XR4A 1L7DA 3WICA 4KWHA 1JW9B 3WQQA 3WTBA 1LEHA 1YL6A 4MVJE 1SEVA 3R9SA 1IPFA 1WLYA 3JQ8A 5DCUA 1EVJA 3PHLA 1RM5A 4NI5A 2QRJA 3ANMA 2HJSA 4Z9XA 1E7WA 4FFRA 3BMCA 2B37A 4QO7A 4CV0A 1GQQA 4RPHA 4WUVA 4WLVA 2IDZA 4RORA 3ZWPA 1JTVA 1TXGA 4KDEA 1MG0A 4PN3A 4XGIA 1PU2A 3IOYA 1E0DA 1F12A 4IUYA 3QV1A 4XJSA 1N6FA 1TI7A 2C07A 2EV9A 3FTPA 1VRWA 1BMDA 3AFMA 4PG8A 2FRDA 3SC4A 4FNBA 3GQVA 3V5IA 1DUBA 3VH4A 1Y8RA 1GADO 3QJ5A 4Z0PA 4JN6B 2IYOA 3W4JA 2WWRA 4C7KA 5G1QA 4FN8A 5E0NX 3WGYA 4BNYA 3KTHA 3ONFA 3D64A 2DC1A 2YYYA 4IMPA 1R4MB 3V1UA 3VIVA 5J23A 4LW8A 4GGOA 3D3WB 4UUMA 5JDIA 4AL4A 2Q1TA 3SWXA 2C8TA 4WLOA 3ICPA 4RVHA 1AE1A 2E4AA 3DQPA 2EIHA 2GPTA 4J7CA 4CMEC 4NPCA 1FC9A 2YHIB 3C3XA 2D5CA 4PLWA 1BSVA 2ZYAA 3BHJA 5CEJA 5JCJA 1ON9A 4MVJI 4W4TA 3F6YA 5EQDA 1U2DA 1I32A 3BA1A 4J49A 3OJOA 1ZUD1 2UZFA 3VPHA 1UXIA 3NJBA 4YAIA 4Z6KA 3FCOA 1UIYA 5KJ6A 1HEUA 2W4QA 3D3EA 5L95A 1MG5A 4L6WA 2LDBA 5U4QA 2CF6A 5JBIA 2O3TA 3GF4A 2AQIA 4Q9NA 1DLJA 1LUAA 4IGFA 3A14A 2O3JA 4BKUA 1Z7EA 1J49A 2CVQA 1N7GA 4ALIA 1ZO8A 1KC3A 1UXJA 4BNLA 2FOIA 3IKVA 1QYXA 1VJ1A 2VHWA 3AUUA 1YGYA 4HNKA 3JYLA 4RPKA 4RPLA 2OUIA 4TZTA 3VTZA 3ZWNA 3VZRA 4GQAA 4U1AA 1GDHA 3IP3A 4RVDA 4A27A 5DCYA 1DIRA 2YZ7A 4E31A 2VSSE 3RVDA 4XX0A 3AOGA 2VWGA 1UP7A 4PLFA 4YA6A 3WJ7A 5IAAA 1VE9A 5G0VA 1JN0A 1WMBA 3V1TC 2VNAA 3NJDA 4UUNA 2O3RA 3QWAA 4NG5A 3BHMA 4PLYA 3RBVA 4A03A 4BNKA 1QYVA 5DU8A 5CP8A 4DQUA 1H93A 1U28A 2ZQYA 3ZV5A 1QYDA 2AE1A 1BDMA 3NX4A 1UDAA 1M66A 3RRVA 3TQHA 1XQ6A 5TC4A 5JNLA 3BMNB 4IMRA 3D4NA 3TPCA 5HBRA 3LF1A 5A04A 4IQGA 3JQGA 2ZL2A 1FF9A 4JSBA 3WLFA 4AJJA 3PIDA 3RU7A 1DB3A 4PVCA 3LT1A 4ZQBA 4FC7A 3LQFA 5A4DA 1MB4A 4K6FA 1Y8QA 4UAGA 2F6QA 4OYRA 3DONA 4RF2A 1H94A 1ADFA 5B37A 5JDCC
chains in the Genus database with same CATH superfamily
2NNWB 3NEAA 3HM2A 1RP1A 4RU1A 3LFHA 1J5PA 1PIXA 4M0LA 2WA1A 1QSGA 1SQFA 3O93A 5EOVA 3TQTA 3PJRA 2XBMA 1DINA 1J21A 1L6IA 5DT2A 1PR4A 2D4AA 1Q0HA 2FW9A 1CB0A 2YOGA 3LRPA 3ADPA 1U63A 5DJ5A 3RSTA 3D7NA 1W6RA 3R0ZA 2PUAA 6NULA 1QLHA 3QWBA 1EVLA 2BZ0A 1LBIA 4TTVA 3HGTA 2PZEA 4HEA1 2A4KA 1PZXA 1V6AA 4FDMA 5K3FB 1DS6A 1OLXB 4BFYA 3D6TB 4JYLA 2NM0A 4BLWA 1UBHS 2OZLA 4XWOA 2ZJ0A 4P36A 3ONDA 4WNYA 1CUGA 5P8WA 4UE6A 2GN4A 3BSYA 1XYVA 2IHUA 2AB0A 2XPCA 1CEQA 1W9MA 2OP0A 3DEFA 2AFHB 4E1VA 1JP7A 3P0HA 4XIYA 1SXPA 1HORA 1Y6JA 3M6VA 4IYRA 1B16A 4O59O 1XMSA 5DM4A 5H3LA 4ER3A 1LLDA 5CDYA 4J0QA 2FMTA 3E8MA 2VPZA 2JFWA 1G2IA 2ZJAA 5BYAA 1NC3A 9ABPA 2R6HA 1XZKA 4X7RA 2OCXA 5LNK6 1ADGA 4HNGA 1NYRA 4H1HA 1J42A 5K3OA 3CNOA 2PR2A 3GLQA 3LCRA 4V3BA 3ZLVA 4BQPA 3PXBA 1PG0A 5GJWC 1D7OA 3GLFB 3PC3A 2N1MA 1U0LA 4CM5A 4RGBA 4B7UA 4IG4A 4M46A 3WLTA 5JO0A 5GIOE 1NHGA 3L6OO 1E63A 3GWGA 3INTA 4IDHA 4WLEA 2VRCD 3MAJA 4CODB 4F84A 3SJAA 1XNGA 3HI4A 1MDBA 1C9YA 5EN4A 4JEHA 3A4VA 1J70A 2FE1A 4RV4A 4I50A 1THGA 4M1EA 5KTNA 1LVHA 3C6XA 4BCCA 4F8EA 3ZGXA 1Q1BA 1LJLA 3I2HA 2ZI7A 3D59A 5EPEA 5FPKA 1LJUA 1FSZA 3ELDA 1I1HA 1PJ4A 3AESA 4QDKA 3RIHA 4IRUB 3QPAA 1JG1A 2NZJA 2RHTA 2Y68A 2ZG6A 3BWMA 3H0EA 3EISA 3ITKA 3Q6NA 5IU6A 1U9JA 2VBCA 5AJUA 3PE8A 1MAHA 3L18A 4RZQA 1WSDA 3ROTA 4DQXA 4WXRA 2Z8ZA 4DMLA 2EQBA 2JD1A 2JJ2A 1YK1A 4AU1A 3KZVA 3EYWA 3ADOA 1K7EB 3C45A 4DA8A 1YI0A 3IBGA 2VZLA 3N2IA 4OQLA 4YCBA 4CHGA 4M6WA 4GUAA 2AR7A 1T36A 4CU5A 4B9AA 2RGBA 1P2BA 3E7WA 3PRJA 4Y7DA 1K86A 4C7JA 2QRGA 2XUPA 3OLWA 4MLZA 2DQYA 3RAGA 4DQLA 3SLKA 3V7NA 3O38A 1JSCA 4LTNA 2HMVA 2NU9B 3G5AA 4IJUA 2J48A 4FIDA 1PW7A 2C4KA 2VDPB 1B15A 2IZ0A 3CHYA 3VNQA 3MBKA 3G9ZA 3EEYA 1AUVA 4JLSA 2VT2A 1LBEA 3ZCTA 4CTOA 2A14A 5BMOA 2C7QA 1R6UA 4DCGA 2CC2A 3C3EA 4H17A 2VHZA 4P4SA 3OE7A 3ZDAA 3H4VA 2ZRKA 2QU8A 3HBLA 4Q7JB 1EFTA 2J9ZB 4MCIA 3QE9Y 1NZDA 1RKVA 5IWCA 4CEJB 4FZ3A 1PGOA 4PFQA 4GWKA 3IESA 1YGPA 3M2TA 3AERA 3PDIB 5HMMA 4ENVA 3V5EA 4EMMA 3AR8A 1PGNA 2O3UA 3H5WA 4OA5A 2P1ZA 4Y9DA 2GH1A 2X76A 1GLVA 3SJZA 3KNZA 5HIJA 4EATA 1NVMB 2IYNA 3VU9A 2G76A 2HRCA 1ODTC 2A1TS 3QELB 3B8HA 3CGGA 3CBGA 1CLUA 4F7WA 3VHRA 3SSAA 3Q7PA 3IQIX 3RNLA 4K2AA 2ENWA 3FYSA 4JC0A 5HA5A 3TPZA 3W9YA 1QCDA 4TZ6A 4WLUA 1T5OA 4PXSA 4AQDA 4D46A 1CF2O 1VFPA 5C80A 2JIRA 5JJ5A 2O19A 1QORA 4RK6A 3TJZA 5JZOA 4B43A 3PLNA 2OFFA 5E9WA 4EHHA 1IYZA 1T10A 1WXEA 4A2CA 2GSWA 4WBNB 1GA1A 4JSRA 1P2UA 1PGQA 1LY1A 4JL6A 4ED9A 1LZKA 1XMQB 3PP8A 2X2PA 3B2NA 2GCPA 2GD2A 1M8GA 2D5BA 4WEOA 4R16A 1W94A 2O0KA 4J9VA 3AHFA 3M6MA 2CDCA 2OHVA 2GDJA 5TNXA 1Q51A 4HDTA 2FEKA 1OZAA 3OO1A 3DNMA 3P20A 4D9BA 2GZ3A 1PLKA 2H1IA 1KEEA 1AH2A 3UMJA 3CCCA 1TU0A 2ZVQX 4KE6A 4OQ4A 2OGTA 3TF5A 4OLHA 1UT8A 4AKEA 3AB7A 1GG2A 4A8PA 3GLHE 3EG5A 4FZWA 2C4TA 1G59A 1RXSA 1XQXA 3FI9A 1V9CA 3OLZA 4TM8A 1VKOA 2Q50A 1LF0A 2PMFA 4IILA 1JE1A 4BV8A 3Q8LA 2PUFA 3ZU6A 1D5CA 4MQLA 5IT0A 1YC2A 5JIBA 5GIPE 1LWOA 2RSLA 3K70D 2XXAA 4GWGA 3BRQA 2IEIA 4TN5A 1LRKA 1YH3A 4EGQA 3EC7A 4NZOA 2V45A 4TQGA 3C1OA 1O2DA 4KR2A 3WB2A 1TYFA 2WTNA 4NNQA 1VMKA 2QM7A 2WMDA 1ZKMA 2VTKA 1R9GA 1I36A 3D43A 4IXMA 5AVYA 1Q1NA 1YJBA 2N75A 1ZA2A 4QT0A 5IKLB 3GARA 4DHWA 2K5UA 4FS3A 4Z53A 1Q21A 5B1EA 4B3FX 4AN1A 2AXQA 4ZOCA 3W8RA 3WRXA 3CLUC 2ZBGA 5ALTA 1ZUHA 2J5XA 3C1UA 4XZ3A 2Y1XA 4ZVOA 3UAXA 1F4PA 3TLGB 1ZMBA 3ZCPA 3W5SA 2YDYA 4DDWA 5K0TA 1N2BA 4OKSA 5H9WA 1X42A 2LDXA 2B82A 4UVEA 3WP0A 4NICA 3EX7C 2LCQA 4RCYA 3T9FA 1SKAA 2VT3A 4JYPA 3S5JA 4TMYA 5EVCA 3D5TA 3H8WA 4HB3A 4JQZA 3ZZMA 1KMIY 1U0FA 5AJYA 2V7QA 1VIVA 1O89A 3DM9B 3JQ9A 4M89A 2C5GA 3NH9A 4R8SA 4WASA 1V8OA 5FPTA 5TQ0A 3VR5D 4QHYA 4UE2A 4F11A 2RGWA 4RUKA 1A5ZA 3UK6A 2B1JA 1R50A 2C0CA 4TRRA 4DT1A 4IV0A 2XZLA 1RBZA 4CIDA 1FK8A 3W3ZB 3P26A 1B3BA 1XJ5A 2UZIR 3D02A 2COUA 4P4UA 1N7HA 5EIBD 1USGA 1OD6A 1K97A 1KFCB 4TQAA 5TPZD 1P18A 2EZ8A 1EK2A 2JFOA 4IWXA 4MQFB 5BN3B 1H9AA 2RARA 3BCUA 3HRXA 3K0HA 3T1QA 4UE3S 1BXGA 3AJ8A 3TH5A 4DLYA 2RHJA 1Q74A 1TLLA 2R8OA 4GMHA 5F1OA 4E09A 3CEAA 1DAGA 1ZD1A 1XMJA 2R48A 1QG0A 1Y5RA 1LVUA 3NYQA 2ZZKA 4MUIA 2V5UA 1DC8A 1DDOA 1BU5A 3FUCA 2WTUA 1PWHA 5BOSA 3S5UA 2X0EA 3UOWA 5EY5B 2N42A 2P9CA 1Z4LA 2BEVA 2GAOA 4HZUB 4N5LA 3A2KA 1F6BA 1BH6A 3G2LA 1JAHA 3V1LA 3ZR4B 3O1HB 1QLJA 3AEQB 5BWMA 2CL5A 5B1DA 2J0VA 2I7XA 3IBYA 4GVXA 2D3WA 3T61A 3TZCA 5EKUA 5EP4A 4GYKA 1EK0A 4WIAA 4FTWA 2XYVA 2D06A 3LFUA 1QBKC 4N65A 1TEZA 4LF5B 2WU4A 2FW2A 2O5EA 5E4TA 2HCRA 2P9EA 5HIIA 1ECLA 2QZJA 2QZPA 3ONWA 3QOYA 2VJCA 3B7PA 4L8LA 3ETGA 4ZRMA 10MHA 3ONNA 2B7CA 3V2GA 2F1JA 3P2EA 2YWEA 3BTUA 3OJLA 4LQDA 4OGWA 3GW8A 3L04A 3UXYA 4BYGA 3GOQA 1QGOA 2OD2A 1RLTA 2GN1A 4S1PA 4RPIA 4B6PA 4U0GA 1CRZA 4B2YA 5F35A 5HM6A 2QQ0A 4FFPA 4WQMA 5FOSA 3TKLA 3QYRA 2YXPX 1ZPDA 1YE3A 3Q1LA 4M86A 4MW0A 4ZVPA 4OLQA 3VJMA 4MYTA 3C87A 2L18A 2IKSA 2VJBA 3ETLA 3PXGA 2PJRA 1AQLA 2XECA 2ZJYA 1PV4A 1RM3A 1IZ8A 2AN5A 4YJFB 3C0KA 4FDUA 2Q3LA 2XNCA 1MJGM 3BGIA 1UBMS 4WXHA 3V7UA 4X60A 2WHPB 4X1IB 2F9IA 2PEZA 1JIIA 3H5TA 4BQRA 1TQ2A 5I9IA 2AGVA 1KBZA 1LPBB 2PZJA 1ABFA 3ZIAD 4D45A 3DLHA 5KSOA 4FCVA 2F1IA 3FCSB 3HBNA 4LGYA 4YHBA 1R8SA 2J4FA 3CF2A 3ZS9A 3FETA 1NAHA 1PNQA 5AXCA 5TPWA 2HADA 3OUZA 2MDTA 3ZJUA 2VQFB 4EF4A 3E9QA 3IOEA 3VZDA 4ESHA 3AFGA 4V2IA 1X7YA 1FJHA 4QASA 1XMIA 5E6SB 5JQGB 1CR0A 3CJQA 1GCAA 3IC5A 3RVMA 1XRLA 4NVRA 1WUHS 4BUCA 2EDAA 1TJ5A 2JD0A 1ZXXA 2WB2A 1K5PA 1QZUA 3E9CA 3ULKA 2PMEA 5FFFA 5EINA 4BWFB 3EWIA 1YQEA 2F9FA 1W88A 4B6JA 7AT1A 1J22A 2DHEA 1OFHA 3KXIA 4URHA 1TAQA 2F3SA 2FF7A 1EWQA 2FWJA 2GX6A 1IY9A 4PZYA 5AW8A 1WXHA 2W71A 1ORIA 4R71A 1A7UA 3KHKA 4ALKA 1W1IA 1O7JA 2XLBA 3AW9A 4NHOA 3RYIA 4A1FA 1RQ7A 2X5KO 4RKRA 3EGOA 4RO0A 2X9LA 2DPGA 3QYAA 2JAHA 2CV2A 1G4HA 2DG2A 4K28A 4K7JA 1GKIA 1VIYA 3BXGA 4H27A 4E21A 1H2ZA 1JYSA 4LX8A 4QFBA 2QBYB 4NZZA 1AHHA 1XEXB 1JPUA 3LC1O 1KYWA 3LUAA 3NNSA 3FYUA 3O4IA 4LYEA 1N2CB 4S0XA 5CM8B 2PYDA 4CIYA 3VH3A 4NSNA 2YYZA 2VHYA 2B61A 2NZ8A 3JWIA 4KR9A 4DCOA 1FZTA 1T2EA 3DORA 1A95A 4KYTA 4LK3A 5FFMA 3IBBA 2OPBA 1XJWA 1BEUB 3V55A 3LLVA 2QR3A 4JC4A 1N1GA 4O33A 4CDMA 4MDEA 4E2ZA 4ENQA 1FRFS 3I9OA 2R1TB 1E8DA 2QPLA 3NC0C 5HJEA 1RPZA 1CJUC 4IDQA 1PL8A 3KYIB 2WSLA 3OZGA 4TKZA 4TRJA 1GT91 1MA3A 5DLQC 4IEIA 3SLGA 3B13B 1P45A 1H5NA 3N8KA 4NTZA 4AUNA 2UAGA 4BLPA 3T3EA 4ZDEA 2GGSA 4G5GA 4PAMA 4KFCA 5AD1A 2C2GA 2BN4A 2ZQQA 5BR7A 3VNUA 4MVJA 4QYIA 2GI4A 2ZJ4A 4IDBA 2JVJA 3AETB 3QVKA 2XYPA 2QRHA 3JW8A 5DGTA 5HFAA 1ECBA 3S8YA 3F6PA 2WG0A 4FD3A 3UHJA 2J33A 5CT9A 5ALQA 1FLDA 2ZVJA 1ZRMA 2GF2A 3FKJA 1YIDA 4PIMA 3P9XA 1TTQB 1J39A 1YZYA 3P2JA 4ZEOA 1TO6A 3ZDQA 4U7DA 4XDGA 5TVKA 3QEOA 4HRVA 3OCXA 3GRPA 3IILA 2Q2WA 4IXDA 3AF0A 4UTOA 3FDIA 1PJQA 1LQTA 1U2RA 1WF3A 4YWJA 1HE3A 2DUBA 5GTDA 2HJ9A 1VKHA 4FSDA 3C5EA 1E6WA 2XEXA 4D3SA 4GOJA 4F4DA 4MGIR 4UC0A 1T25A 2Z95A 1QGDA 2GILA 3SSOA 4PSVA 1JHMA 3L7LA 4S3MA 3BX1A 2PL3A 4DLPA 5KU7A 2BGGA 4DA7A 1HLGA 2Q9BA 4WERA 5B3AA 2O7QA 4WA7A 2AVNA 3EZLA 3TL6A 1PLLA 2E55A 2J0EA 3L5OA 1UMDA 4K6GA 4KH0A 2DP4E 3JQAA 3BK1A 1G4AE 5NULA 4A8TA 2QQ3A 4KUGA 3JS5A 2R44A 1RQNA 4G1MB 1OMOA 1AQYA 1QZZA 2FRDC 2V9ZA 3FUVA 5G1OA 5AI9A 5JCOC 5ED4A 2HQSA 4C3UA 4LKRA 4TKUA 1PL7A 1K1EA 1T5SA 1RT9A 3E9YA 3IMEA 4R51A 1Y1KE 3THWB 2YOHA 3EYAA 3EBPA 3VTAA 1DARA 1RRVA 2KWIA 4A2QA 2OAP1 1KGDA 3CEPB 3TRRA 3FTCA 4FOTA 4EECA 3WIUA 5H70A 2BR4A 5AJWA 3BXHA 2K7ZA 4QJIA 5ECWA 2YV3A 3MTQA 1UUFA 1U2PA 4POAA 5A3QA 5JDIC 2HSEA 3LG2A 5JH7F 5AVSA 1C14A 1UIMA 5K5EA 3HE2A 4JH0A 1II8A 2QM3A 5DZSA 1IJBA 3CH6A 2CJXA 5DGXA 5T8KA 1RWKA 5IKPA 5KQRA 4M0DA 3UXMA 1N5KA 2OHGA 5LQAA 3F2IA 4EZEA 4WNIA 1Q7GA 1JIVA 1FX1A 1R0RE 2ZAOA 1SBNE 1UBGA 2H1FA 5KYYB 1MO6A 3QHPA 3KTIA 4EVSA 1I51A 1E3WB 2H2DA 3QI2A 3PNYA 3R09A 4G0OA 1L7RA 4IH9A 4WZAB 4NCIA 1R6BX 4ZOBA 3M6NA 1Y1QA 3EAFA 3OBIA 4QHSA 4C6HA 1L0BA 2XCRB 3CZMA 4JYBA 2II6A 2VNJA 3GRRA 4J7AA 1AKMA 4K88A 1CJTC 1EWYA 4HH0A 3V1MA 5KSWB 3URMA 3DAYA 1JYFA 4ZDCA 5EP3A 3NDRA 3U4IA 4TL6A 5KREA 4L74A 1FUYB 3GG9A 1AS0A 2R8ZA 5CJJA 4OXXA 1I2CA 1JUDA 3QMMA 3QVTA 1KIAA 2Y0PA 4C04A 3GNTA 2MYUA 3NOXA 3ZHTA 2EJCA 4OVKA 3FUTA 4G5FA 5GONB 5HE9A 1ZH0A 4LHZA 1W35A 2A9FA 2PXAA 1HE2A 5A0VA 4IPTA 4UJ3A 2HSZA 2JCSA 2ODTX 3DOOA 1VRVA 3LVRE 4AK9A 5MN5A 3M81A 1HKUA 4I9HA 4C7MA 4DJTA 4DRYA 3HU5A 4NFYA 2NIPA 2G0AA 4CEIA 1N3LA 3FPAA 1TM2A 5D3MB 1Z34A 1MO5A 1GN8A 3PQDA 1H0KA 2NO9A 3H65A 1N6IA 1T3GA 2PRIA 5F33A 2B1GA 4N82A 4Y18A 4A0RA 4TXLA 2VSQA 1YZTA 4ONEA 5G0WA 4B4UA 2I03A 4JSTA 4M8SA 2O8BB 2BMWA 4D8TA 4GPD1 4LUCA 3EG9A 3CZPA 2UZ1A 3VI3B 1LSOA 1J97A 3JAWA 1T3ZA 1XWFA 2R5FA 3TE7A 5IX8A 1SK9A 2CUNA 5LYJF 3HDTA 2F8MA 2QD5A 4I1YA 1UMKA 4RPJA 1SY7A 4NNJA 2OYRA 2EX4A 2YS6A 4LF8B 1I3NA 1BKSB 1JJAA 1II0A 3UICA 5JNSA 1HR0B 1Q0UA 4HMOA 3WMXA 3TFQA 5AUOB 8ADHA 3NASA 3MTAA 5GGYA 1WDKA 3GA0A 4B4WA 3LO8A 3E9NA 1P1FA 2OO5A 5FTKA 4B3RB 1AUPA 1OILA 5LOVA 4K0RA 2W2LD 4HDQB 5AK6A 3G2KA 5EXEA 4PNZA 1PNVA 3QGMA 3AXSA 3UVEA 4D43A 2X2EA 5EJGA 1W7AA 1HNOA 4F3KA 5KTRA 2VWPA 1RJEA 3FIUA 2IPXA 1D2AA 3C3WA 4KEAA 2QNRA 2ZEJA 3V46A 1D6SA 2LRHA 1H0HA 5D6OA 1WUKS 4FNAA 5EPOA 1CERA 3QBVA 5K4GA 5GPBA 3F6SA 1KTVA 2XB2A 2CMFA 2ZDQA 1X1AA 1FJGB 5K8TA 5KNDA 1U5BA 2WPDA 3MTIA 3HDHA 2B8WA 1RJFA 4LGCA 3DDSA 4PQGA 1ISRA 3DNPA 4LC0A 3RFFA 4QGHA 2C04A 4OQPA 3MRXA 4RA6A 3TCXB 4BRZA 4YCCA 4P0TA 2VQ3A 1NE2A 2AF3C 3VTKA 2H2IA 2HT1A 2PSSA 4O0MA 1UM9A 3D5EA 3HXQA 3FLMA 1XN1A 3FCYA 4PYQA 2P27A 3UHOA 4YJDA 3GR6A 1W5AA 3I9MA 1R4NA 4KBYA 1JPVA 1KSFX 2Q4EA 2WW8A 3R76A 2MHCA 2X2OA 3VZPA 3RQSA 1EGMB 4MUFA 5E0KB 2BKAA 3BH0A 3ROXA 1IWBB 4GOND 2ZJOA 5SYNA 4F1KA 1UKBA 1PBTA 2ALJA 5CAEA 1JI0A 5CX1B 1Z6XA 4RETA 2FFRA 4LXXA 5TGZA 2AJ8A 5F7XA 1UC9A 5HBGA 4L85A 2J45A 2D2XA 3CUTA 1SKUA 3DUFA 5IBQA 3KXDA 3RVQA 6CHYA 2OZPA 3R74A 4PLHA 5JVDA 1TD1A 2O2IA 3IQWA 3KT8A 3M49A 4RVFA 1ZR4A 3LKVA 2JAUA 2ZXEA 1C80A 1X38A 2IEGA 3BMOB 1OWNA 3T0GA 4D44A 5KSZA 3RAEC 1MB3A 2D5IA 3MFMA 1GRQA 4V03A 2XRYA 4EY7A 3OQNA 1C4OA 4AS3A 4O2BB 3KX2A 3TLXA 1H3NA 4ITRC 4KQCA 2FX2A 4AB1A 2GCIA 1AKNA 3VH2A 5CFZA 3F4LA 3MMNA 2CT8A 2CBYA 2R6GA 4BO5A 2WUGA 3RSFA 3Q5DA 2E82A 4MUXA 1L1RA 1PVVA 2XWQA 1EAYA 4A92A 3IXLA 3DZKA 5E6UA 3WKAA 1YDMA 1HL7A 1E77A 4P4GA 3K6SA 2ETXA 5ERYA 2Z6UA 1U04A 4V1CB 4ZAYA 1JS1X 1PR0A 3FKSD 5JZSA 2ZSEA 4CV2A 3KQOA 1IXSB 4JQCA 3VTFA 1TM5E 4F4JA 4D2IA 1FVHA 1GVNB 1RQXA 3VO8A 3PYXA 1YVUA 4RCVA 1H2XA 3L9XA 2COEA 1V8BA 2YJZA 4OF4A 3I2KA 1LXCA 2Y0BA 3TZHA 3DWFA 4CMIB 3L7DA 3I1FA 3PUKA 4AJLA 1HYBA 1EHYA 1SA0B 4J2UA 1I0LA 4N5DA 4KR6A 1Y9ZA 1KO7A 2EFGA 2VP3A 2AQHA 4JEUA 4U8GA 4RM3A 4D4LA 1YQXA 4E0BA 2QX4A 5G0UA 4GOLD 4HI0E 4QOGA 3T41A 1V41E 2Q5LA 3MYBA 1QQ7A 1TJYA 5SY4A 2ADMA 5FOWA 3DZJA 3EFOA 3SE7A 4K9NA 5E7QA 4M55A 4OI1A 3U37A 1GDTA 3L0OA 3TBKA 4DFDA 1W2XA 4MV9A 1BQ4A 2TMKA 1AM4D 1AN9A 1T4CA 3TECE 5C8YA 4KGVA 5TR9A 5CTCA 5EERA 2P4UA 4OMFG 1O08A 1OH5A 4OM8A 1DCKA 1CX9B 1C8LA 1R6VA 2B69A 3MXOA 3HU1A 5JRDS 4RTKA 3IEIA 4MQ5A 1NNSA 2HW8A 1IVYA 3RGGA 1EBBA 2Z2ZA 3WRYC 4UCWA 4RH0A 4UM5A 4LXYA 3C3PA 3A1EA 3KSDO 3UH1A 2OBLA 2GBPA 4DLKA 2H48A 1I4TD 2DFPA 1FPMA 3O9ZA 1THTA 3PKIA 3VZCA 4OQEA 2GOYA 4CKXA 3KSBC 1YT5A 5I4CA 5JAOA 1ITZA 2VDJA 3PPIA 4OHUA 2A9OA 2IHJA 4PX2A 1U3CA 5DIZA 4I9NA 3G5MA 3BRSA 3HA5A 3QKSA 4CNBA 3KB6A 3BXFA 3Q0JA 3W6UA 3M34A 2NVWA 4UMEA 3ZHXA 1MHTA 2BHRA 2WMYA 2H3HA 3UW3A 1SHZA 2Y1KA 3I42A 3OICA 4P1ZA 5JYBA 2BKEA 4EARA 4GNRA 3WE7A 1FDUA 4PPGA 1UAGA 3TW8B 2JGFA 2IU0A 3OJ0A 2AW3A 2HA4A 1NWCA 1JHAA 2H63A 3DAPA 4REQB 4C7OA 4CLXA 1IJFA 1DJOA 3O7WA 2XGSA 2BCJQ 2ZJZA 4OX9B 4CLOB 3G8YA 1H9BA 5KEIA 3ON5A 1XO6A 1CP3A 1V5EA 3V34A 3I2JA 1DLIA 2O8FB 1Z0AA 3T89A 1XIVA 3C8UA 3TOCA 3EH2A 1X0VA 4B0PA 4ZEMA 4IVRA 1HZZA 3AC0A 4GKJB 1OLSA 3KPUA 4HDNA 4FWBA 4OK3A 4RVUA 3ABOB 3TD6A 3USES 2I55A 4DWJA 3C48A 3BEOA 3QMVA 4U6SA 5IYZA 1RRCA 1AG9A 1C7EA 1M6YA 1PHPA 1ZD5A 1INLA 2NYUA 1JRLA 1UBSB 2MYTA 2PT6A 2QJTA 3HSKA 2GWHA 3QVGB 4L6AA 1UYVA 1VG1A 4BPBA 1TMKA 2O4UX 1L7AA 3E7DA 1J56A 4TWZA 1K4YA 4G0PA 3N58A 3DDWA 4R9VA 2GSDA 1A9OA 3HYRA 3OQ6A 4D8XA 2ZGVA 5BMVA 2EHDA 1HSOA 2P90A 2V6IA 2JGJA 4MW7A 2WJWA 2XNHA 4K87A 4ZHQB 3KTFA 1F2UB 5AJVB 2Z3WA 3KC2A 2N3ZA 4FFWA 4MRRA 3DMGA 3T0FA 1KQFA 5F9HA 4P34A 4B3JA 2FXIA 3QX8A 4DUYB 5CNIA 3QU9A 2JFHA 5B2ZA 2F7SA 2BC9A 4N12A 1U7DA 4OHKA 3UNXA 2HDHA 2BY4A 3MELA 3JQ7A 2CLSA 4FCTA 1EX6A 2FSUA 3OZWA 5FUBA 5CIYA 4P5DA 1GKYA 3JXEA 3CW2A 1NI4A 2AZ4A 1YDGA 1DKUA 3I4CA 3LECA 3EPKA 3AFOA 1JTEA 3IURA 3W4KA 4GL2A 1RJNA 5AVWA 3ICQB 3H0JA 2Q9UA 3CX8A 1J5XA 1P4RA 4C89A 1XTBA 4J3FA 4G0NA 5AM5A 1BYUA 2GJAA 3R9QA 4IJQA 1REQB 3WY9A 3EW9A 1GITA 1T9BA 2B5WA 4Z4EA 2BWJA 1VMDA 4FGJA 4LZZA 1M2VB 3NAGA 1XXLA 4P7JA 4HJXA 3VX4A 1XDGA 4XYLA 5DLPA 3AJRA 1GL7A 1TCUA 4GMDA 4RWZA 4LFAB 3BFKA 4MQEA 1ZH8A 3TQCA 1TE2A 2HSGA 1Y3DE 1FTNA 2QYSA 1T26A 4N0DA 2OFXA 2IHVA 1F2DA 3HCAA 4C3OB 4DR4B 3D4BA 1S4MA 5EE9A 3T3MB 4Y1FA 2J5BA 5M29A 3UUGA 2OC9A 1L1EA 4RL4A 1N6NA 4QVIA 2XNJA 2JI4A 4BB5A 3K8QA 1EY3A 4D79A 1Q2UA 3GDHA 4HK4A 2XCIA 2F59A 4KI7A 3QEMA 3ZVMA 1S7CA 4WZBA 4LZWA 2EKZA 4HXFB 1CEXA 2GZSA 2Q5CA 4QVKA 5BYBA 4BNYA 4DADA 5DYWA 3X1ZA 4E7OA 3KQFA 2QVGA 2WEKA 4R1SA 2J0UA 3NHUA 4XD7A 1WZNA 1ZD3A 4Y1GA 3I04A 2CHFA 2PSFA 3FDZB 4HAVA 2GYVA 3D9QX 3RHSA 3UV7A 1J20A 1J4AA 1Q3HA 1SNYA 1SU7A 2JS7A 1JDSA 3PNVA 4LYGA 4NYIQ 4XM0A 5EUBA 2C96A 5FPHA 3UAVA 3VR2A 2ZWOA 4Q37A 1RZRA 3BERA 4UQPA 5I4KA 2ZSHA 1MO2A 2JA1A 2JFUA 3A9SA 3BK7A 4GFDA 4OOEA 5HF5A 4JJEA 4BO2A 2XRFA 3IPYA 5D5QA 1UEXC 3P0RA 2ZIWB 1XNYA 1TJ4A 4EJSC 4Z0NA 2XUDA 1GU1A 4D42A 1V4VA 2HU5A 4KWEA 1KIMA 4YIKA 1G20A 2AHRA 1NR5A 1G8GA 5C7YA 5JD5A 1RQLA 3RH0A 4ARAA 1D0IA 1XCJA 1RZ3A 3EDRA 3WOVA 5EIAA 4N5IX 5T4HA 1Q6ZA 2HZBA 4LZLA 5D3QA 2HJGA 5BSFA 4J07A 4QPNA 3J80A 3F7OA 1CVLA 2ZKIA 3IIIA 1JDNA 3O84A 2HUPA 4KI0A 1IMJA 4Z8XA 4AMUA 1IM2A 2NG1A 4TMFA 4CUZA 1KDTA 4FGWA 1V71A 2C20A 2ERYA 4UUPA 4X7BA 1CIVA 3RRBA 1GR1A 3QSGA 2IXDA 5ALLA 5CXSA 4BO0A 2X40A 4ISCA 1T9GS 4W5QA 3I6ZA 3A9UA 4UUQA 5DHPA 1Q0QA 4NARA 4Z49A 3NM5A 5EIWA 1Y80A 5A5GA 4U19A 1U0NA 3EDCA 4EQZA 1JR3E 5KWVA 2UU9B 4KDFA 3TR6A 3EQ8A 3GPIA 4NZYA 4KLCA 5MN6A 4YCAA 1UBOS 2ZCVA 4RTRA 5LLSA 2QROA 3GLGB 1TF7A 1A97A 1HTWA 3FW1A 4PTYA 1E79D 1NUHA 3P96A 1Z0FA 4MUKA 1SURA 5AOVA 2J5SA 4J29A 4HDAA 4OSOA 3S7TA 5K3AA 1ZU4A 2QZ9A 5D6NA 5BQ3A 4YXWA 2AA3A 4JBHA 4PYNA 3CONA 3KXPA 3FB4A 4RD2A 2NN3C 1BS1A 3KEGA 2PWYA 5LMNB 3W77A 3CTVA 5KNCD 3BIJA 1DAFA 4KJZA 1CSEE 3IDFA 5G2OA 4UUOA 5AW4A 3Q15C 3ETJA 3HDQA 3RVNA 5EPUA 3KQYA 3TDNA 1ZUNB 4MEBA 1PJSA 3IV9A 5ECDA 5A2GA 2GYWA 3M2PA 1QGUA 4ARUA 5C1PA 5I7WA 4QFCA 4RK0A 1Z75A 1L5MA 4A23A 2E18A 4YV7A 4JC8A 2FR8C 4I08A 3TSWA 1M2NA 2Q6OA 3D3WA 1A69A 1FNMA 4DIDA 1TVKA 1U1GA 2HHLA 3TRDA 3VDMA 2PIAA 5CLLA 3BJIC 3SM3A 2GXUA 4L51A 1L5HA 3CLSC 3HR8A 5JSQA 3H1TA 1N7IA 5JG7A 1P2VA 5LN1A 1TVCA 1CW2B 3M6XA 3VC1A 2XCTB 4NEKA 4AIRA 3EXHB 3IQEA 2GCOA 4IVPA 3X1DA 2OR3A 2BTOA 3W6ZA 4XLLA 5EWJA 2Z4RA 3FM9A 4EJSA 3MAGA 4ZYTA 4W1RA 3U3OA 3CVJA 4G36A 1FL9A 1D4ZA 2G0TA 4QPJC 3TLAA 5IVIA 5C0OE 1VLHA 2XXJA 4K5QA 3IB6A 1G8AA 4RHEA 1N0WA 1YR9A 4MR9B 4R4JA 2R66A 4E5SA 1GZUA 1WXDA 2VT7A 1DQPA 1YCDA 4G97A 4Q1EA 1KE1A 5ARBA 3H0SA 3S1AB 4J4BA 1QRDA 2V65A 1GV0A 3MQFA 3QXXA 3MOIA 4LYFA 2IEAA 2PA0A 3MMXA 4HDRA 3ZE6A 4C78A 1VGRA 1OYWA 4XEUA 3FTDA 1Z47A 4UBIA 3STHA 3WTCA 1T2VA 4TXNA 1M9NA 3T1YB 4D3DA 2XHEA 3O75A 4JLBA 5FYDA 4KOEC 2R7NA 4IJ5A 2HRZA 2XSZD 4ARCA 4EMLA 4LHEA 4AF7A 4CKWA 3C7AA 3WC4A 4TMXA 1Y6FA 1E7MA 3FZEA 4K8RB 2XB9A 4CF6A 3LVBA 2YZ2A 1SO8A 4X92A 3TZKA 2X0KA 2AL7A 2P9JA 5BXYA 4EOGA 3A9VA 4FJ2A 5AW9A 5LQCA 1JQ3A 4QTZA 1EVQA 2RJOA 4LE1A 5AIAA 3ZU4A 1E1NA 1R0BA 2IWRA 1EWVA 3SIPA 4ZMRA 2QV0A 2P1RA 2Z5LA 4Q18A 1O4WA 4MPDA 4QLBA 5IC6A 4CT5A 4EG7A 4HNAA 3I6MA 2G04A 5C4GB 1NSTA 5HQJA 3RB8A 4ARZB 1EFHA 1ONBA 2VDQB 3OPXA 1ELOA 3L8DA 6REQB 2ANCA 1XB2A 4Y6SA 5GZ6A 4YO7A 2GZ2A 3NANA 1A9ZA 1EM8B 2WRZA 1MAWA 2YR0A 3D8NA 4E11A 3CKKA 3DDZX 1M6EX 3PZRA 3FLBA 5LB4A 4BVKA 3V48A 2XMQA 1F6WA 3MLEA 4ECEA 4KNPA 3CR8A 2UYOA 5EJFA 1TW2A 4JX9A 3PQCA 3NS7A 1QHHB 1N6LA 4OJMX 5BN4B 3H9GA 1P4AA 3U7RA 2HWWA 2VCYA 3ZYCA 5IAKA 4U9UA 4IIEA 2OGSA 4YK7A 2CNWD 3WMEA 3TIGA 2AYXA 2CN1A 1HDYA 5AYVA 3UKJA 2CLKB 4Z3KA 5A6SB 1WXGA 1WIWA 3JYHA 3KJHA 2XODA 4I6JA 3H9JA 1XNQB 4AZVA 4FK8A 4UOZA 1BA2A 1H3FA 2FMHA 1NQVA 2IEBA 4DIUA 4EX7A 5AJTA 1CUDA 3AVUA 3OC6A 3G02A 1E2GA 1E9FA 2BFPA 1TO1E 1U3DA 1XJ0A 4P4NA 5E9QA 2P40A 2QL6A 2RHHA 2HY7A 3QKAA 4LF7B 3SX4A 1L1FA 5B6IA 1K7YA 2NSHA 2O7RA 3H3XA 3Q0IA 5LBTA 3R7LA 3SXJA 3WLLA 5IKMA 4ARIA 1GUAA 1L4UA 3OT1B 2MCFA 1I4EB 3LZDA 1C81A 2CV1A 3BFVA 5LZ7A 3EAQA 4JA2A 3HADA 3BXXA 1VZ3A 2DGDA 4FZRA 4LJSA 4RZSA 2NXWA 3PQ8A 2EF1A 1ID1A 4QOHA 1HQKA 2QXYA 3GRCA 3IAS6 4QDXA 2Q3EA 3HSSA 3PXAA 2NZXA 3DVRX 4AQYB 1YA6A 3DM5A 1RWVA 5TGTA 3KUDA 3ZWOA 2HRRA 2C83A 3LYLA 1NQ5A 1KZ9A 3WZ2A 3U1BA 2BDUA 3QVJA 5AT1A 2GQ0A 3PCRB 1G21E 1P1RA 2Q5OA 1Y7HA 4Y2JA 1WY5A 3E9MA 1G9XA 3M33A 3LE8A 2GJ4A 1BS2A 2DBRA 2Q46A 1OROA 3GROA 4HS4A 5T5QA 4B6EA 4QXAA 1KZ7B 4CFYA 1DTWA 5A3RA 1YFJA 1ABEA 4WV3A 3J81A 2JCVA 4CR7A 4C29A 2GETA 2E9SA 3DJYA 5EYPB 2JLYA 2A6PA 1MTOA 1LBSA 1JALA 4FOOA 4RV5A 1WM1A 2AOVA 1TMOA 2C2MA 4EP1A 3K71B 3ROZA 4M7OA 1ZNZA 2HRDA 4Q19A 1J33A 1HNWB 2WFMA 5ERXA 2FZCA 2ARKA 2DBQA 2Q3CA 2ON6A 3KYCB 2BZGA 1XRJA 2HSWA 5JROA 2XNDD 2RBKA 2V55B 2W0SA 2ZRFA 1WMDA