3ZWAA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
727
structure length
727
Chain Sequence
VPRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
total genus 271
structure length 727
sequence length 727
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwaA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwaA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwaA01
2IZZA 3GF7A 1LNQA 1OMOA 4EJMA 1K6IA 3JQ8B 3RD5A 2IZ0A 1NVMB 3L9WA 3NAQA 3JD3A 5TC4A 4BV8A 2C20A 3JD1A 3C1AA 3GF4A 4FB8A 3QP9A 4CMIA 4Q0GA 2DUWA 3GOHA 1KVSA 2QX7A 4FPXA 2QHXA 2CMDA 4PRKA 1E7QA 3RKUA 4RZIA 3LT0A 2HMVA 3DZIA 3IUPA 2GTRA 4FD3A 4I9UA 5B1YA 1JDJA 3TRRA 4J0EA 2OBNA 1O0SA 2UVDA 3JQ7A 5CAEA 1O6ZA 2FN7A 1OBFO 1WZ8A 4U0GH 2TMGA 1AE1A 3W4IA 4K2NA 4DA9A 1DIAA 3AM4A 2X58A 3IJPA 1ML3A 2EXXA 1LC3A 3HG7A 4WCFC 4A0SA 2ZTVA 1J5PA 3OIFA 4GMFA 4Z0TA 2BGKA 1M2WA 4FOSA 2JKVA 3SBOA 3F5SA 4RL6A 1ZW1A 3TN7A 4QO8A 3MT6A 2DLDA 3P7MA 3IDSA 3UAGA 1A71A 2O48X 4JOTA 3GLQA 4WEOA 3KYDB 4RF4A 1PJCA 4Q3CA 4XGIA 3GLMA 1CQJA 2LDXA 3VHRA 1MC5A 3PZRA 3ABIA 4QQRA 4TMFA 3U09A 1HSZA 1E3LA 5INIA 3DBHB 1RJMA 4LCEA 4IDCA 1YRLA 2GN4A 1EVJA 5A3VA 5L7TA 4FQ8A 2FR0A 4BNNA 2ZJ1A 4UREA 3FDUA 3DHYA 1JKFA 2AQIA 2ZATA 4HKTA 3RC2A 2D0IA 1GEGA 2FPIA 1U3TA 2ZB3A 2CSUA 3HJAA 2RCYA 5ITVA 7MDHA 3GMSA 2B4RO 4CM4B 1X15A 2W98A 3MOIA 4GSLA 1R0KA 5AQ1A 1ZK4A 2R2GA 2VT2A 3WYEA 1YL6A 4ALJA 1HDCA 4AJPA 4Y98A 3HHPA 5L7WA 8LDHA 2G82A 2AEFA 4ID9A 5KDRA 1DRWA 5GMOA 1UXJA 4N7RA 5E0SA 3GVCA 3ETDA 3RBVA 2V6GA 4I8XA 4KTVE 5KNLA 1JLLA 4HFRA 2HJRA 1QYXA 4ZDDA 1ZMOA 3S2FA 3PRJA 3U4IA 3ZWAA 1QXSA 4Q3NA 2B5VA 1GUYA 3HDJA 1CJCA 1I2CA 4RVUA 5LDHA 4JBHA 4G2NA 3PPIA 3K96A 3TZCA 2YHUA 2VHZA 4RLHA 5TSDA 3FNHA 3H4VA 3TZQA 4YAGA 5HS4A 5JBIA 3OMLA 1YQGA 4AJLA 3RC9A 1AXGA 3U0BA 2X1HA 5CDUA 1KC1A 5CPFA 4CL8A 3JQ6A 4KP7A 3C85A 2ZL0A 1HDOA 4BO8A 4GLOA 3E18A 3IC5A 3MOGA 1MLDA 4PG6A 3UH1A 3G0OA 1U2GA 5INFA 1AUPA 3JQAB 5C9GA 4Z3DA 4R1UA 5DZKA 3VKUA 1V3TA 2EW8A 5LDGA 1E3WB 4B4UA 3TDCA 4IQ8A 4Z3KA 3JQBA 4PRLA 5KVVA 1NQTA 3ZWOA 1N6FA 1KC3A 4NFSA 1NM5A 1UAYA 4A2CA 1QYDA 3E5RA 2ZYAA 2HW5A 4J3FA 5B4UA 1YBVA 3ONDA 4RO0A 4YWJA 3DBLB 2GN9A 3UN1A 4CLRB 5CDTA 5BNIA 5KJFA 1OD2A 4RORA 2B35A 1B16A 2CDAA 4OJNA 1E3WA 3JQGB 4JQCA 3N58A 3NJ8A 3LF1A 3QIVA 3K73O 1PIXA 2VSUE 1PGPA 4B4WA 4B7UA 5CTCA 2YJZA 3MTJA 4QFEA 1O9BA 4P8RA 4L0QA 3A28A 1WNTA 4TRMA 4WOKA 2JFFA 3AUAA 3M1AA 3T4EA 3BEZA 3WMWA 2CNBA 4NZ9A 3IKVA 1ZXLA 4CUKA 4IJKA 4CMHA 4D3FA 4DBVO 4CV2A 4RYFH 1EUCA 5KJCA 1I2ZA 2ZJ0A 3VAZA 3WBFA 5BNFA 4DYVA 1T2CA 2PD4A 1Y8QA 5KJ6A 2VRCD 1LU9A 2HMWA 3TFOA 1Y7OA 4WK6A 1MJ3A 3IL2A 2VSUF 2JAPA 3AI3A 4ZDEA 4GWKA 3G79A 3NGXA 4M89A 1EFLA 3JYNA 3WXBA 3DOOA 3U49A 4EMLA 3JD4A 4CR6A 5TX7A 2R00C 3KM0A 5GY7A 1UP6A 4ZRNA 5JMPA 2DBRA 1QV6A 2VHWA 4AJKA 3NJ4A 1R66A 3KTDA 5CDYA 2PV7A 1GL3A 3MWEB 3EZLA 4J4TA 5AOVA 1MXHA 5IZ4A 3QXZA 5E0SH 1GPJA 4YJFB 1TYFA 5H82A 2PZKA 2IEDA 4UAGA 1EF8A 2NTJA 1XHLA 3CH6A 2VQ3A 5A5EA 4QXMA 5KJPA 4YT5A 2W2LA 5TJHA 5U9CA 5JAQA 4D3DA 3CMMA 1N2SA 1NR1A 2X0JA 4EZBA 4PZDA 2CVOA 3ZNQA 4H7PA 4KWHA 1SEPA 4EBFA 4MI2A 1ISJA 2CD9A 1NFFA 1P1FA 1UAGA 3PJEA 2AG8A 1E0DA 4IPTA 3PQDA 1SZOA 4II2A 2NVBA 1EK6A 5T8KA 4BGVA 3AY3A 5F3RA 3WQQA 3P2OA 4MIYA 4NK5A 4XEHA 4B7CA 4KTTE 4UUPA 3M6IA 3OJLA 1WMBA 2WD8A 3G64A 3ICCA 1O89A 1C1XA 3AOGA 3C8MA 5ENDA 2EWMA 3I4FA 3A06A 1YJ8A 2YV2A 4RF5A 2SCUA 3D3WA 3VZQA 2WJPA 3Q0GA 3TT6A 4ALLA 1JVSA 2HQ1A 4XR9A 1GYQA 4K1LA 5ER6A 4H3VA 4XB1A 1XLTA 3H5NA 2VYVA 3EY4A 4BKUA 2VYND 4TSKA 4Q39A 5C90A 1CIVA 3CMCO 3MJTA 5JAIA 2LDBA 1PJTA 3DFZA 4LSWA 3U9SB 4INAA 3EDMA 2VYNA 2AMFA 2BZRA 4FNDA 4WLUA 1JKIA 1QYWA 1BDMA 4BNYA 1SOWA 5JDCA 1W73A 2NV6A 1GZ3A 3DFUA 4IZIA 1P33A 1JKJA 4D3SA 3GNTA 3U9RB 2HKIA 4MKZA 4KWBA 1KVUA 3AY7A 1ISFA 5TF4A 2X8LA 1DUBA 4RVGA 4UVIA 2NLOA 3RBZA 3P85A 2AEJA 4L9RA 1SC6A 4AJNA 1PTJA 2FY8A 2WYUA 1VJ1A 3DBVO 2Y67A 3VZSA 1U8XX 4CQLB 1B15A 3EC7A 3V2UA 2NU7A 3HADA 5KOIA 2OBYA 3UVEA 2AXQA 2YDXA 1DCIA 1FCFA 1HNOA 3H02A 3DAGA 3ZWVA 5JO9A 4J4HA 3H2ZA 2WMDA 4L4XA 3ON5A 1SMKA 4I5FA 4DC0A 1DIRA 3DONA 1AGNA 1I36A 2DT5A 3CZMA 4CODB 3WLEA 4UVDA 2J3IA 1RYEA 3MJCA 3RFXA 3OP4A 1H2BA 4JP2A 3BHMA 5FIFA 2GPTA 3TNLA 5JLAA 5DDIP 3EVTA 1Q7CA 2PH3A 2WWRA 3DORA 3FWZA 1Z82A 4J43A 1ENZA 2FZWA 3TVWA 4HADA 2X9NA 1ENYA 4AJ1A 4C4OA 3DMYA 4BNLA 5LCXA 4IGFA 4CUJA 4E5YA 3EAGA 1Y81A 5CDGA 1IUKA 5IJZA 3T89A 4LCJA 4QO7A 4U6QA 3PQFA 3VDQA 3RROA 5IXSA 1EF9A 2PGJA 2W3PA 3T7EA 4IIUA 3HDHA 1NVTA 1JN0A 2GD1O 5AXBA 3WMXA 5F5NA 4E2YA 1X7HA 1DB3A 1EEHA 2FBMA 1ZJZA 1E7RA 1HWYA 2GLXA 1R4MB 4TKMA 1XX4A 1U9JA 4MVJF 3UFXA 1LDYA 5EESA 2IEXA 4BKPA 1C1DB 2NM0A 4TZTA 5CG1A 2IZ1A 3RVDA 1HZZA 1VL0A 2EKQA 3OIGA 4NFHA 1GUFA 3H7AA 1PJBA 5JNLA 3ZW9A 2PKQO 1MV8A 3KV3O 4Z6KA 4GLLA 1S7CA 3RAJA 2VRCA 2EF1A 5THKA 1SG4A 1Y8RB 1CYDA 1HYGA 4AVYA 4EJ0A 4WYOB 4J7CA 3L6DA 5THQA 4KUEA 4TWRA 2NU8A 4Z9YA 3ZNNA 2A9FA 2Q4BA 4GAEA 2NP9A 5HS6A 3KSZO 4JJTA 4OAQA 1ZKMA 2YHIB 3U5TA 2G0TA 1IY8A 1EMDA 4Y6PA 3HE2A 2VSSA 3F1LA 3BMOA 4BB5A 4CLEA 1HYEA 1DRVA 1ULUA 5K9ZA 5DULA 3ZW8A 1E5QA 1PZFA 1FDSA 3OH8A 5DU4A 1KERA 3IB9A 4LN1A 1HDZA 2VZ9A 4JBIA 2EP5A 3PFFA 3RFVA 1YVEI 5DZKH 1PJQA 1LBEA 1SAYA 1DHTA 3ITKA 4IM7A 3GZNA 3NTOA 4JP3A 1I3NA 3X2EA 2GN8A 2XAAA 5FUSA 1RM4A 2O3TA 2DPHA 1I33A 3GVPA 3GC6A 2Y1GA 4XKJA 2IDZA 1P0CA 1BTOA 4BMVA 1Y8QB 4R68A 2WDZA 1Q2XA 1HDRA 4GX2A 4BNFA 3QLJA 5TNXA 1E5LA 4LMRA 1GQYA 2V6MA 3WLFA 2H9IA 2P4HX 1C0LA 5A9TA 4AJJA 5IZCA 1NTOA 4E3ZA 2VSUC 5ES3A 4IZBA 5DOZA 1DO8A 2CY0A 2IE0A 4WLFA 3PTZA 5TGDA 2VHXA 2FOIA 1Q0QA 1YH3A 5JDIA 2JJYA 2QQ5A 3L4BA 3FTPA 3NGLA 2PPYA 1XU7A 4YDRA 4MKRA 1NWHA 4DLAA 4NEKA 4CM9A 4HP8A 2O50A 4OQZA 4XR4A 1ENPA 3GPDG 1BXZA 4HUJA 1ISIA 3INGA 3TOXA 4B8WA 4CMBA 4WCFA 4BNVA 2Z1MA 3I9NA 3WIEA 4A03A 3JQAA 4XA8A 2HO5A 4E31A 4UUNA 3GRKA 1ZVMA 2Q4EA 1UYRA 2E48A 3ZU5A 5JPIA 3GGPA 5F5LA 1DIHA 1GZ6A 4AJOA 1LI4A 4BNKA 1KVRA 2YHIA 4Z0MA 1X1EA 2FR8A 3I5MA 5CG2A 4JWVA 4MO2A 1PJ4A 2O3UA 1PJ3A 4MPDA 1GQ2A 4B8ZA 4ND4A 4JJGA 1T24A 3CE6A 3U4DA 1NX6A 2XPCA 4LK5A 3JSAA 5G0UA 1R16A 1ZIDA 1Q0HA 1PZEA 4GX1A 1WLYA 3WGHA 5G1RA 4XQCA 1Y8RA 4RPLA 2CVQA 2HSDA 4R1NA 1T1RA 3WGYA 3INRA 4KPKA 1LLUA 5G4KA 3IP1A 1R15A 4LRTB 2RHCA 2PLAA 2X0NA 3GNSA 4CQMB 4DTIA 3UICA 1DC5A 4CV0A 4CM7A 1VSUA 1DLJA 1PR9A 2A94A 4FFRA 4IDEA 1HZDA 4MOWA 1KYQA 5H81A 1T1SA 4CJXA 4E12A 1PX0A 2AEMA 2VN8A 4RQUA 4E2XA 5G0VA 3H9UA 1TB4A 3JV7A 1KETA 3NTQA 2PR2A 3OFSA 3SJ7A 2PD6A 3IJRA 4YJGB 4LVUA 2C7GA 4UEOA 2PG8A 2X5JO 2QYSA 3VIVA 3FNEA 1QYVA 2HK9A 2PWZA 1FK8A 1CEQA 2F1KA 5I7SA 1FC6A 2ET6A 3RSHA 5TT1A 4Y6RA 3FHLA 3H9QA 3TPCA 5AVOA 3I23A 1E77A 2PFGA 3UCEA 2DFVA 2FPPA 4NBUA 4MVJI 3ANNA 5DN9A 5KDRB 3F1KA 1E6UA 5JDIC 3GH3A 2CDBA 2IYOA 1N9GB 2Q1UA 4YQZA 4PLCA 1ZFNA 1RKXA 3V5IA 4JYLA 1ISHA 1SZJG 3ENNA 4CLOB 2RAFA 2YFHA 3WTCA 4ZN6A 4ELXA 1NHGA 1U8FO 5JDCC 3H3FA 3E9QA 4EDFA 1V0JA 4IDGA 4UEJA 4WLNA 3GHHA 3JQ9A 4PLZA 1HLDA 4H15A 4XWYA 3LAOA 2QW8A 4NJOA 1FDVA 2DFDA 4PLVA 4DI1A 3H3JA 4W4TA 2VUSA 5HWSA 2C5AA 3VZRA 2J5GA 1RM5A 5GZ3A 1I3MA 3R0IA 4JCOA 4M86A 4L8KA 1DLIA 3RRVA 4MOUA 1ZBQA 3OJ0A 1G6KA 3JQ7B 4FDAA 4IQGA 9LDBA 3V5EA 2VHYA 3H65A 1NNUA 1SPXA 4LW8A 3AWDA 2QRLA 3I4CA 4DVJA 4OHUA 4FJWD 3PXXA 1V3VA 1V9LA 1ZXBA 1F0YA 3D1LA 2Y0EA 3AM5A 1RPNA 4J90A 4CMJA 3O03A 3ZWCA 2A35A 4F45A 5IFLA 2O2SA 3G1UA 5J23A 2W8ZA 2GASA 1VRGA 1C3VA 4KNPA 4KQXA 3H9JA 3LC1O 4BO4A 4C7KA 5KKCA 3MYBA 5DCUA 3DOCA 4XB2A 3VH4A 1HNUA 4RPKA 5BR7A 1I32A 4JCQA 5C7OO 3IAVA 4IZHA 1HZJA 1QRRA 4OM8A 4YCAA 5L3ZA 2Y0CA 3DEYX 4ZQGA 1P44A 3H9GA 1M76A 2B69A 5KJ1A 1WXDA 4U8GA 4BO6A 4R5HA 5I9LA 1YG6A 1EFKA 3AUUA 1HT0A 3BTUA 1OFGA 1QV7A 1R0SA 3CXRA 4RPJA 4ROSA 5TQVA 5I8WA 1U1IA 4BO7A 5EMHA 3O8QA 4HV4A 1KEUA 2XXJA 5BQFA 2UUOA 1R12A 3MEQA 5EPOA 1OC2A 3B20A 1PGNA 3ZNPA 4CM9D 4EI2A 3VKVA 2AHRA 3R6DA 3KQFA 1KEVA 2Q50A 1DOHA 1E6EA 1JVBA 1Y9EA 3I83A 3TOZA 2AQHA 2J5GD 3WSVA 1QP8A 4YJGA 4Y6SA 1M67A 5T67A 3U62A 1WW8A 4NH4A 4BNZA 1H93A 1MA0A 4E33A 5L40A 3ZWWA 1IZ0A 4I5EA 1FDWA 1W4ZA 4RDIA 5EL0A 3RU9A 3W8EA 3A9WA 1N6EA 4GGPA 4HXYA 4MP8A 3MZ0A 2ZL3A 3RSIA 3L0DA 2YYYA 4P4GA 4R16A 1N7HA 3GF3A 4JFCA 3ASVA 1OOEA 1X0VA 2F9YA 2YY7A 3ZHXA 1DJNA 5JS6A 1ZH8A 3NX4A 4EITA 3GN1A 3QKAA 4XYLA 4NBRA 3JCZA 3IQDB 1MFZA 1CWUA 3NT2A 1EE2A 1DFHA 4E2WA 3PIIA 3K2BA 5KCZA 1UZLA 1PL7A 1E1NA 2JD2A 4BNMA 4N5MA 2WE7A 3IOYA 4MVJG 2NU6A 3U9LA 5CEJA 3R9QA 3GRPA 1P74A 3PJFA 4RPGA 2P5YA 3FCOA 4GX0A 4KWIA 4A73A 3BMNB 5C3MA 4U18A 1CQIA 4IUYA 1ZCJA 4EUEA 2UUPA 3GZ4A 3LC7O 1NWCA 2DVMA 1CF2O 4Z9XA 3VPSA 7ADHA 5HTOA 4E13A 3TVUA 3K8XA 4O0LA 1BSVA 2BGLA 1XDWA 2J3JA 3FR7A 4YR9A 1LXCA 1BDBA 4CUZA 3BMQB 5IDWA 4QECA 3KTIA 3RSTA 3FNGA 4TVBA 3GZNB 4N5NA 4KDFA 2DAPA 5KVQA 1MUUA 3DAPA 1GV1A 3ZGYA 3QWAA 5G0TA 3F5QA 2J5QA 2IODA 3KVOA 4I5DA 3JQBC 4EJ6A 3HINA 3KYCA 3DC2A 4OIMA 1JWAB 1DC3A 4GVLA 4IS3A 4PVCA 2HK7A 4ZQBA 1LUAA 3T4XA 4D44A 4OO3A 4OLQA 3EW7A 4LK3A 3K2EA 5JCJA 1JW9B 3CKYA 2W2KB 1NAIA 2I65A 4JX8A 2CBYA 5DNAA 2BRUA 4OSOA 1FC7A 1ONOA 1EBUA 3Q0EA 4BNXA 1XNVA 1I3LA 1SNYA 5COQA 3L07A 2ZB7A 3JQFC 4BNUA 3LVFO 4GX5A 2Q1TA 1H6CA 2VWHA 3ZWMA 4BQPA 2JCXA 2GR9A 3RUIA 1B8UA 2RBEA 1K6JA 3GQVA 4GM2A 1VJTA 1Y1PA 3ZDFA 5IDQA 4DQVA 4WLOA 1M6HA 1ONPA 1SB9A 4YAJA 3SXPA 4U1AA 1R0LA 3PEFA 2D4AA 1F06A 1PS9A 3OT6A 4B4OA 1NQAO 3LLSA 1P3DA 2IEBA 2F9IB 1DEHA 1HE5A 4HC8A 1HF3A 4XCVA 1BXGB 3VH2A 3NTRA 4N54A 3NRCA 2JHFA 2O23A 4AJIA 2BFMA 3BXXA 4E21A 1VJ0A 4BNTA 1YB4A 1YDEA 3DWFA 1IB6A 3RASA 4PGFA 5A03A 2E6UX 2Y1FA 4ZD6A 4YPOA 5A9RA 1H9AA 3EYWA 3L77A 3RJ9A 5JCXA 5CPBA 4YAIA 3DXFA 4R4JA 5ADHA 1K39A 1PQWA 4MDHA 4RYFA 1S6YA 3CIFA 4AICA 3ENKA 3GFGA 3K8ZA 3O4RA 2W90A 2GYYA 5EN4A 3H0SA 2G5CA 3HDQA 3GR6A 4W7IA 5MDHA 2HK8A 3ASUA 3T3WA 1ADGA 2E49A 2J5II 4DGSA 4MKXA 4Y67A 1UXGA 2BMAA 1GPDG 1EVYA 4M87A 3BTSA 4WLVA 1B8PA 3CUKA 1D8AA 4ZRMA 3K92A 3GEDA 4R69A 2Q35A 3GN2A 4CQMD 4NNJA 3ZU3A 1N1GA 2FW2A 2P2SA 4GSKA 3PHJA 4BQRA 1UP4A 3GK3A 1ADCA 4UEKA 2J5IB 1ENOA 4ALNA 2AW5A 5H83A 5JMWA 5IZCC 3JD0A 5A02A 3EMKA 4RVDA 3U9TB 5FEUA 1D4FA 1I8TA 3KTGA 5B4TA 2EKPA 3GEGA 4XIYA 1EQUA 3AM3A 1HE4A 1ID1A 5L4NA 2VOJA 4FFMA 4I52A 1F12A 4M55A 1PQUA 2B5WA 4RF2A 3ROQA 4J1TA 4Q9NA 3LT4A 3A4VA 3RUCA 4NI5A 4ALIA 2Q46A 4UUOA 1BG6A 1FF9A 3QWBA 2I3AA 1N6DA 1Z74A 3VTZA 5BT9A 3NDJA 3ZU4A 1X13A 5C37A 1DXYA 2RHRA 3ZWPA 4G2RA 4O63O 3Q3CA 3A14A 5I9MA 5ICSA 3QV1A 4GQAA 4XRGA 1W2XA 4A5OA 4HNGA 4IGEA 3KETA 2QZZA 1TI7A 2BFAA 5IKLB 2HLPA 2GDZA 5IN5A 1TT5A 5JY1A 1H9BA 1HDXA 4CQLA 3HFSA 2PZJA 3V1UA 3PJDA 3UW3A 1K5HA 4LMPA 1UP7A 1ONNA 4QIJA 2PZLA 4BKOA 3KTHA 3ZWYA 4K3WA 4HFNA 1UDCA 5DUFA 3D4NA 2V7PA 4XJSA 3TL2A 1UXKA 4CLOA 2NVUA 3GVXA 2J6IA 4E30A 4DL9A 5JBXA 1KIFA 3W8DA 5I7FA 2QG4A 3GHYA 1UJMA 1PJSA 3QVSA 3RUAA 3PHLA 3WYCA 4WPGA 2WYWA 3H5RA 4N5LA 2AQ8A 3LF2A 2XF8A 4M54A 2VREA 1QSGA 1B7GO 1E7YA 2GZ3A 4IXWA 3PZKA 4PZCA 2QRJA 2D5CA 4CMIB 1LC0A 2Q2XA 1DJQA 2B0JA 2IYPA 2BF7A 3GAFA 3VZPA 4IDBA 3PYLA 4XD2A 3W6ZA 3GNQA 5CEFA 1UYVA 4RLSA 2PBPA 4NJMB 4GHNA 4FFOA 1WDLA 4UVGA 4BNHA 3GA0A 1YGYA 4K6CA 4O1MA 1E1KA 3L4BC 4OSPA 4XDZA 4CLDA 3H81A 3WGIA 1YO6A 4F6LA 1G0NA 1DFIA 2VT3A 1YB1A 2BKAA 3F4BA 2NTVA 4LSMA 1T26A 2FZSA 4YTEA 2RIRA 4BGUA 1E1MA 1QKIA 2EERA 4YYZA 2X9VA 1PL6A 2Y99A 5DZSA 1PGQA 1SCUA 3E48A 5HM8A 5JE8A 1MG5A 2POQX 4CM5A 1SEVA 2BD0A 1NHWA 3GEMA 4FGSA 1ARZA 1YL5A 5ENVA 1NVGA 1BHSA 3T7CA 2HMUA 1WZEA 4XRRA 4EMPA 4BO1A 2VUUA 1E7WA 3QVOA 2C2XA 3ZI0A 1GTMA 1EVIA 1UXIA 2HCTA 4OMUA 4OOFA 3ROPA 3ETGA 3TF5A 4E2ZA 4ZDBA 3GT0A 4RPHA 3TQHA 4K6FA 2QQ3A 2ZYDA 2O2YA 3GY0A 4YQYA 5F1PA 4P22A 2W2KA 4YEDA 3AI1A 4YJHB 3LQFA 3P2LA 3UF0A 1L7EA 1C0KA 1W0CA 4KZPA 1MGOA 3QWFA 4PLWA 1NZYA 2VHVA 3E82A 3QVTA 4TZKA 3ROKA 1HXHA 4EEZA 2XOXA 5FWNA 4WLEA 1AHIA 2AE1A 1E92A 4DQUA 2ZIZA 1W6UA 1PGOA 2P4QA 2PZMA 5CP8A 1IULA 2H1SA 3RQSA 2D1YA 2JAHA 4CMEC 3QVWA 3P5SA 4DBZA 1XNYA 4FOOA 1LTHR 4YT4A 3D0OA 1GD1O 3HUDA 4YRDA 4DC1A 3JTMA 1B0AA 2JHGA 2ZQRA 5I7EA 3FI9A 4FBGA 4PVDA 4BHTA 2Y66A 3RUFA 1PZGA 4WECA 3L6OO 5A4DA 4I4ZA 3I47A 2EGGA 4S3MA 2YV3A 4RJTA 4A10A 2O4UX 4B3JA 1H0KA 1HYHA 2G17A 2DBQA 5JAMA 3ZWXA 4AL4A 4RF3A 3ORFA 3TZKA 3KO8A 3KYCB 4ZQHA 3WIDA 5C7LO 4AG3A 3RUDA 2EG9A 3H0QA 1QG6A 1SB8A 5CEEA 3I6IA 3MWDB 2ZTLA 3BPPA 4ZA2A 4K9DA 4FZWC 4ASIA 3C3XA 2W2LD 4YJHA 5FI3A 2GN6A 2ZK7A 5B12A 1C0PA 1KY5A 3ST7A 3BMQA 5JYEA 1EUZA 3V8BA 2DTEA 3OC7A 2ZB8A 1DC4A 1YBAA 1X7GA 4FNBA 3V1YA 4E6PA 4J2HA 3DHNA 4FC7A 2JCVA 1K0UA 1E7SA 3ADPA 3V2GA 4FFNA 1K2WA 2QIOA 4FS3A 4NBTA 1M6WA 2JCYA 2UDPA 4KUGA 2O3SA 1WPQA 4ZU2A 3W8FA 4BO5A 2WYVA 4XYBA 4KMSA 3OQ6A 2YZ7A 5C7IO 3OJFA 5K6AC 4FW8A 1D3AA 3QSGA 1EK5A 3OIDA 1NR7A 4I5GA 3I9LA 1P1KA 4CMCA 1YS4A 2OL4A 2BH9A 3KYBA 4RZHA 4LISA 4WJZA 4IDDA 4ZDCA 4JGBA 1VLLA 1I10A 4BGEA 2X7HA 4QEDA 4BNIA 3D5QA 1CDOA 2J3KA 5F1OA 5ITWA 2D2IA 3MJSA 1WWKA 1WVGA 1RWBA 3NDRA 1T4BA 4CMEA 1D1TA 3D3EA 4JJIA 2HDHA 1R4MA 5G1QA 4RVHA 2I6TA 3RU7A 4D0RA 3QA9A 3PHHA 3OHSX 3LDHA 5I8ZA 1LLCA 4B79A 2VSSF 4ZHSA 3PEAA 5GZ1A 1H6DA 4I08A 2C54A 1LSOA 4FC6A 5DU8A 2A4KA 4RDHA 1U7TA 3V1TC 4DPKA 4J0FA 3WNQA 2V6BA 2PNFA 4IXTA 3KLMX 1DBVO 3ADOA 3I9JA 4JXKA 3UOGA 4QIIA 3WGGA 2VTDA 3ZH2A 1XKQA 1VRWA 3F47A 5T8KC 2Y05A 4BS9A 2NNLD 1J7XA 1UXHA 3OQBA 4NHEA 4AJ4A 1G0OA 3KB6A 3D4PA 1UDAA 2Q2WA 1UDBA 3CEAA 3I1JA 2QRKA 2I99A 2WTBA 2V65A 4YLHA 4GMGA 4D7AA 2OHXA 1E3JA 1BVRA 4CLHA 1XA0A 2A7KA 1A9ZA 2DTXA 1B3BA 2J5KA 3RCBA 4W99A 4YACA 2VOEA 4I9HA 1J0XO 3KYDA 4WZ8B 4WE3A 5ICMA 2FSSA 3IS3A 2PA3A 3L9XA 4RGBA 3ZWBA 1FDUA 1R37A 5I9NA 5A9SB 1A9YA 3TFQA 3WYBA 5TJ9A 3MCVA 3I52A 1TT5B 4U6SA 3SVTA 1DDOA 3CPSA 3STHA 2ZL2A 4GBJA 1GAEO 1AXEA 4ELWA 3GDGA 1EQ2A 3ZV4A 2GZ2A 1FMCA 1K6XA 1JU9A 4A27A 1SOVA 4BVAA 3LLVA 4DYDA 2CDCA 4AJEA 1LA2A 2DBVO 1NFRA 3Q2IA 3GUCA 3TZ3A 3JD2A 4ILKA 5EQDA 5DP1A 2EJWA 4J9VA 1BW9B 4BMNA 3F6YA 3U4HA 1HKUA 4J16A 1HSOA 2DUBA 1W8DA 3COSA 3TSCA 1VM6A 3SC6A 3AU8A 1MXFA 4CV1A 3AUSA 1FC9A 3MTGA 3PVZA 1P1IA 3KTJA 1C14A 2DM6A 5EJ2A 4M8SA 3SLKA 1HE3A 4YRBA 5DOVA 1M66A 4J49A 2I3GA 1ZK3A 3TZHA 3JU1A 3S2GA 4CR8A 1R4NA 4ZQEA 3F3SA 4Q3EA 5JFOA 3QREA 4KQWA 5K6AA 4P4LA 2HMSA 2P91A 2DBZA 2Q45A 1XSEA 4G65A 2EIHA 4YT2A 1TG6A 1YJQA 4YVFA 3RUEA 5TLSA 1XELA 3H8VA 4CM1A 2PGLA 3LU1A 3PWZA 4R9RA 3EK2A 5A5FA 5A05A 1UYSA 1YOVB 4CQMA 3HN7A 4D46A 3HP0A 4FFLA 4K26A 4L73A 4L75A 4XJTA 4DLLA 1J6UA 4PLFA 4XGKA 5KIAA 3ANLA 1LRJA 3I9KA 2R00A 4ONEA 3R1IA 4R54A 2WD7A 1JAXA 3JQDA 1ZK1A 3OSUA 4IDFA 4YAKA 4R1SA 5KWEA 2ZQQA 5TS3A 1Q7GA 5GZ6A 4WOJA 5F21A 3DZJA 4U5QA 4B3HA 2Z5LA 3D3WB 4GI2A 5BNTA 1GADO 3DZFA 3LZ6A 4MVJE 3EHEA 3QRWA 3G1TA 4OG1A 3PLNA 4RVSA 3FNFA 2WE8A 3OEWA 4S1VA 1DSSG 4HBGA 1ZUD1 3E6AA 3R3SA 1RYDA 1LQTA 5I7VA 2F9IA 3TV5A 4PLTA 4ZICA 4R3NA 2BELA 1WP4A 1KBZA 4L6WA 1JWBB 1LSSA 1QYCA 1PWXA 1VKOA 3PWKA 1OD4A 3PJGA 4BMSA 3PDJA 1IPFA 1NPTO 1U5AA 1D7OA 5EERA 2I9PA 3GMDA 3UUWA 4E5KA 3PGQA 3GGOA 3ULKA 4D79A 2PD3A 3FWNA 4ESOA 4WNCA 1Z73A 5JYDA 4IIVA 4WCDA 5DBIA 2VWPA 4G5HA 4GL4A 3RKRA 1GU7A 3BZUA 3FD8A 3MOYA 3DZHA 5CHEA 4URFA 4KOAA 3B1FA 3DBRB 5L45A 4DREA 5EINA 1O5IA 2BI8A 3NJBA 4E5NA 4PG7A 1B3RA 1PSDA 3DQPA 3JQCA 3ONEA 4YJFA 3K6JA 3GGGA 3O26A 1QORA 4QT0A 1YB5A 1G1AA 3QE3A 2O4CA 1B2LA 2NUAA 1EDOA 3Q6IA 1LX6A 1Y6JA 5TIIA 5JXWA 2ZYGA 3D64A 1I01A 4NNQA 1UZNA 4YAEA 2GUGA 1H5QA 4P4NA 2J8ZA 4XQ9A 4D0SA 5IXYA 1T2DA 3WDSA 4BL5A 4IINA 2BFOA 2D59A 3RC1A 4TROA 3PLRA 3BA1A 1ORRA 4BO9A 1F17A 1P77A 1VI2A 3KEOA 4RV9A 2O3RA 3WB9A 3H5AA 4AFNA 4BNGA 1NAHA 4E5MA 2F6IA 2GCGA 2WM3A 2J5RA 4L76A 3C7AA 4CR7A 3WTBA 4OL9A 1GUZA 4JN6B 2Z95A 1Y7TA 1LSJA 4J1NA 1X1TA 3PI7A 3DZKA 4MP3A 3VH1A 1VL6A 1JA9A 2FP4A 2BFPA 5AXCA 2OXIA 4BIIA 1NQ5A 3BHJA 3Q7HA 2Y93A 1YQDA 4R9SA 4C7JA 1XG5A 2OMEA 1NYTA 1CETA 4IMRA 2EGHA 5A3JA 3WGQA 3H0UA 4XIJA 2D8AA 3DOJA 4JCRA 4HY3A 3H9EO 3K9QO 3W1VA 4CLRA 1GCUA 5MGBA 1GFSA 4CMKA 1XGKA 1IHYA 1QMGA 2ZQYA 3HE3A 3SJUA 3WSWA 4DIFA 5CDSA 4U0HA 3GVIA 1N5DA 4TKLA 3IIEA 1ZO8A 2OO5A 4Y8VA 4YJDA 3S2IA 4MVJH 5DCYA 1JXZA 1XNWA 2OOSA 3INTA 3LT1A 3OICA 4I9NA 4L8VA 1KOLA 5L53A 2Q34A 4WCZA 1PQPA 4IJUA 3M1LA 4MINA 4LRSB 1EVZA 3PHIA 4FSHA 4HNKA 2X23A 4JJFA 4N18A 2Z1NA 1P1HA 1GY8A 2BI7A 1ZK2A 3PHGA 1YWGO 3WJ7A 1OZAA 2BLLA 4ITUA 4CM4A 2C5EA 2OUIA 5DU6A 4ELSA 2C82A 4CLXA 5CTBA 2NADA 1J4AA 1TT7A 1TLTA 2PTGA 2VTEA 2OP1A 2D3TA 2DC1A 2VWQA 1YDWA 1IZ9A 2ZCVA 3H6KA 1OC4A 1PGJA 3MJ4A 5AXAA 1BRMA 3P5MA 4J9UE 3K5PA 4XX0A 3TJRA 2R6JA 2HMTA 4B7XA 1PZHA 2O3JA 4J7UA 4FJ0A 3ST9A 2D5AA 4QTZA 4EUFA 1DFGA 3BF0A 3WQRA 2YQ4A 4HNHA 4ZDFA 3KZVA 4QX6A 4RCVA 2EHDA 3JQ9C 4HFMA 4KD6A 4EGFA 3I9MA 3WG9A 1GZ4A 2C07A 1BMDA 4FN7A 3VDRA 2NVUB 3D7LA 2X24A 1IL0A 2JFGA 3WR5A 4BGIA 1Z7BA 1M75A 1KEWA 1A4IA 2ZQZA 1HDGO 4UULA 5C5IA 3ANMA 4JYJA 4CM3A 1TA4A 4BKRA 1XU9A 2P68A 4IJVA 2P9GA 2WD7B 5G0WA 1O8UA 3FBTA 1DAPA 2VNAA 1GR0A 2XXBA 4FZWA 3GUYA 1VL8A 3R3JA 1ISGA 2IXBA 2G76A 4MVJM 2HRZA 3M2TA 4W7HA 2FWMX 5DUCA 4EW6A 1GCOA 1HE2A 2YDYA 3C1OA 2DPGA 3O8QB 1X0XA 1PEDA 2UV8A 1CRWG 5AXDA 4FCCA 3UXYA 2RH4A 3PQEA 2EEZA 3I3OA 1KY4A 1ZEMA 1EZ4A 3C7CB 2VYVD 3DO5A 9LDTA 3K50A 1I2BA 4R01A 1UR5A 2X22A 1HTBA 4MXIA 3B1KA 4CPDA 5FYDA 3VVCA 5A1TA 3ZCXA 4NBVA 4WASA 3B1JA 2DQ4A 1XCBA 3PGXA 4JROA 5DT9A 1K3TA 3ZV6A 4IZDA 3JQ8A 3NUGA 5EIOA 4TQGA 2YUTA 4HFJA 5IDYA 3NV9A 3AFMA 5L95A 1LEHA 4IJWA 3N7UA 3S2EA 1J49A 2FRDA 4J4BA 3O38A 4K28A 1BW9A 4XYEA 3RIHA 3TLFA 1NP3A 1QLJA 3HN2A 4NU5A 3E8XA 2JL1A 3TRIA 1U28A 3W4KA 1Y5MA 2C59A 3MJEA 4RVFA 3WGOA 5KTKA 3Q0JA 3AU9A 3PGJA 1E6WA 3Q1LA 2BGMA 5T6BA 3IKTA 1ZEJA 1U3UA 1RM0A 3D4OA 3PK0A 5G4KB 2OORA 2P9EA 4R3WA 3RUHA 2CFCA 4HWKA 4EEXA 2Q3EA 3ONFA 4W6ZA 4L4SA 3A1NA 1UIYA 2EV9A 2VSUA 4TRNA 4JSBA 2Q49A 4FJ2A 2HAEA 3AOEA 5JCJD 4OKIA 2J5IA 5A9SA 3VOSA 2P5UA 2W4QA 1V8BA 3OECA 5FFFA 1ZSVA 3F9IA 3F4LA 2EW2A 4PG5A 2C2YA 2J5SA 2NVWA 1H6AA 2OFPA 4CL3A 1SO8A 2IRWA 4PFJA 4W9NA 2UZFA 3ZHBA 1UZMA 4GVXA 1LDEA 2B36A 2OP0A 3AOEC 2ZTMA 3PIDA 1KEPA 1E3EA 4U0KA 2Y0DA 3C24A 2HJSA 3OA2A 4MJLA 3W6UA 1BWSA 4R41A 4BO2A 3T8AA 1VC2A 2E4AA 1SBYA 1WAMA 5JC8A 2CZCA 3Q9UA 2NTNA 1NPDA 4M49A 4W9NC 3MJVA 2PKQP 4D45A 3PZBA 4DUPA 4F6CA 5DCWA 1CERA 4F47A 3JYQA 4DPMA 4IS2A 5T5QA 3DTTA 4NR0A 2O7SA 3Q2KA 3HWRA 5COAA 4BB6A 4IMPA 1TVEA 3P2YA 2Y1OA 1YE3A 4NQZA 1U2DA 1KVTA 2PK3A 3VC7A 1E3IA 4XDYA 2VZ8A 4Z9FA 1I0ZA 3JQAD 2NACA 3Q9NA 4II3A 4OXYA 3R6HA 4Q3DA 4ALKA 6ADHA 2X86A 1BGVA 5IG2A 2B83A 3VTFA 3R9TA 1PS8A 5JC1A 4OH1A 4OXNA 3QHAA 4Q3BA 4B3IA 3OMEA 4Z0PA 2VX2A 1OI7A 3HSKA 4NPCA 1P45A 3R0OA 4WCFB 2NWQA 3JQGA 2CE3A 1YONA 4IQ0A 4AJHA 1ADFA 3EVNA 2C8TA 2IXAA 3N74A 2CF6A 3E5MA 2WSBA 3DBLA 4UVHA 3SEFA 1ON9A 1Z7EA 2NQTA 1ZJYA 4YBZA 1U4OA 3GG2A 1T2FA 5JSFA 3ZN2A 5G0SA 2C0CA 1DAOA 3NYWA 4XQGA 3WJAA 3VPHA 1ISMA 2AE2A 3HB5X 3OEYA 1XQ1A 1Q1NA 3T8BA 2FSVA 2NU9A 2YV1A 4YA6A 4TVOA 2O7QA 5HA5A 4LVCA 3C7DB 4YRAA 4MIEA 4GGOA 3L6EA 2H6EA 5KVSA 3CINA 1EUDA 5G4LA 3KXDA 3KRTA 4Y9DA 4G81A 3WNVA 3B6ZA 4EMMA 1WDKA 1ZSYA 3ZWNA 2JD0A 3H0JA 1U4SA 4DXHA 3ZNOA 3NKLA 4R5MA 1P1JA 4RCNA 1BVUA 5HRUA 3QWHA 1KVQA 4D41A 1JQBA 1FJHA 3I9OA 1TXGA 4FIZA 3QY9A 3UCXA 3RBXA 2A7SA 3FR8A 4QUKA 1PIWA 1B8VA 4XGNA 4J1SA 4IZCA 3VPGA 4QSMA 1DPGA 4ZU3A 1I3KA 2ZCUA 3IP3A 4EUHA 4CV3A 3HB4X 4BKQA 4ZQFA 5IN4A 1B26A 3ZHYA 5T64A 3WFJA 4FN4A 1A5ZA 4NFYA 1GQQA 3P19A 1OAAA 1P9LA 1IYZA 3RJ5A 2GRAA 3FPCA 3BMNA 5DTPA 5T57A 4FFPA 5JW6A 4R1TA 3E9NA 1IOLA 1RJNA 2Q1WA 1MP0A 1LRLA 2OZPA 3I6QA 3ETEA 3ROMA 2ZTUA 2DEOA 1XQ6A 4WGGA 3DBRA 4BNJA 3IMFA 4PIVA 4NJMA 1L1FA 4CM8B 2RH8A 1FXSA 3RWBA 3Q11A 4CM6A 2X0RA 1U3WA 3DB2A 4PN3A 1LLDA 2DTDA 3LKEA 4E4YA 4MVJP 3JYOA 2EP7A 4DLBA 4MVJA 3LT2A 5B37A 4JCTA 3KLPX 4KUHA 4GWGA 1H6BA 1PJ2A 3FN4A 4TRJA 3S8MA 3FF4A 3B70A 5L9AA 2I5PO 1Q51A 1IE3A 4DWVA 5INGA 1ZMTA 3S1LA 1GDHA 3GDFA 4U0JA 5COBA 3UKOA 4L4RA 3GG9A 3WICA 5IAAA 1YKFA 2GF2A 2F00A 3QJ5A 4F3YA 2JFHA 4QFCA 2PKRA 3ZV3A 4MIOA 3BTOA 3CSDA 3GPIA 1UH5A 4BOYA 2FMUA 5EQFA 1A7AA 1EDZA 1ZK0A 4IBOA 1DRUA 3K31A 3LSYA 2P9CA 3AW9A 3N6RB 1WMAA 1PJLA 1ZNQO 5HBRA 3NT4A 1A72A 4BUCA 2X9GA 3AFNA 1RJWA 4OMRA 4ND2A 3PYXA 3AK4A 3M2PA 4YB8A 3KUXA 3PWSA 4JIGA 2AQKA 3GVHA 4ZGWA 3GKBA 4WKGA 2PGDA 1ULSA 4GKBA 4K29A 1V3UA 1O94A 1WZIA 3TZ6A 4A26A 5DL1A 3SX2A 1LDGA 4MP6A 4UUMA 2Y1DA 5L4LA 1V35A 2DU8A 3WBBA 1PU2A 3M6NA 3R9SA 4DMLA 2HRBA 2JD1A 4P38A 2VCYA 3EUWA 1TEHA 2YFQA 3OETA 1DC6A 3HZZA 1MB4A 5L4SA 1YL7A 3CTMA 5FI5A 1GV0A 1XWFA 2I66A 5KJEA 2BHLA 3QQPA 5L51A 3BMCB 3OA0A 2GZ1A 1EBFA 3M6MA 3GDOA 1XYGA 2YQ5A 1GEEA 2H63A 1GYRA 3HLN1 5E0NX 2E82A 1IPEA 3L3SA 3UHAA 5TRTA 5BSEA 4ND5A 4HX5A 5DBFA 1UUFA 1HLPA 3RI3A 4O5OA 1O8CA 1X7DA 1MFPA 2QYTA 1B14A 1A7KA 3NT5A 1ZZEA 4JVTA 3WG5A 4PLYA 1F8FA 1FDTA 2PH5A 3DDNA 3BMCA 2CF5A 3JQEA 3WFIA 1DHRA 3D5TA 5IF3A 3ZHZA 5CFZA 2YW9A 1N7GA 3C1TA 4JBGA 3QMJA 2GERA 1U5CA 3UGKA 3VH3A 2J3HA 3NDIA 1Y9AA 1HETA 1AHHA 1C0IA 3IUSA 3KBOA 1LSUA 5DTWA 4J7XA 2AG5A 3FRJA 1XO6A 1U3VA 1KS9A 1D1SA 2G1UA 3WOHA 4DPLA 2VUTA 2X5KO 2ZB4A 3Q1TA 2ILTA 3DZBA 2FR1A 1N9GA 3AI2A 3WGZA 4M1QA 1EY3A 1X14A 1NASA 2X4GA 5KVCA 1JTVA 1YQXA 4OKNA 1MG0A 1NXQA 4OXKA 4U7WA 3DTYA 2FZEA 3HNPA 3EGOA 1L7DA 1NFQA 3T88A 4DQXA 4PLGA 3E03A 3HRXA 4NIMA 3PYMA 3GMAA 3KOUA 3PP8A 2DUUA 4O6VA 2TMDA 3IAHA 1DIGA 1Y5RA 2UYYA 4OOEA 1BXKA 1IHXA 4AJ2A 5A06A 1K32A 1I5RA 3HFGA 1N8KA 4I42A 1RM3A 5DKPA 1Z6ZA 3DZGA 5DP2A 4PG8A 5AYVA 1C1XB 3FF6A 4UVEA 3KSDO 5K0ZA 1PL8A 3OF2A 4FN8A 4IY1A 1BXGA 3TWOA 1HDYA 4ND1A 4PLPA 4NG5A 3DR3A 2FHSA 3HQ4O 4B4VA 4FB5A 3X2FA 3ISAA 3FTNA 5ILOA 4ALMA 3GFBA 1P0FA 3F46A 4FGWA 3KTKA 4XYGA 3NJDA 5JAZA 2GO1A 5U4QA 1LDMA 1VPDA 1UYTA 2UAGA 3O9ZA 4J91A 4YXFA 5A04A 1YG8A 1XR3A 3FSRA 1LQUA 3V5NA 4R51A 3RFTA 4CM8A 4YT8A 4MVJD 4FR5A 3IBBA 2NQ8A 3JYLA 5DBGA 2O3QA 3U4CA 4ZVVA 2AA3A 1K89A 2Y1EA 1A27A 3CZRA 4PCVA 3RC7A 4J6FA 2VWGA 4PZEA 5U1PA 2VRBA 2HUNA 2Q2VA 1VKNA 4O59O 1LJ8A 1NBOA 3DAFA 4NMHA 5B4VA 2Y1CA 4L74A 3BTVA 3G17A 1PJHA 2A81A 3U3XA 4JNKA 2X0IA 2E37A 4TRRA 2GSDA 1Z45A 4WUVA 4RQTA 3QW2A 1HEUA 1Q52A 1F14A 4PG4A 3BYZA 2C29D 4XZ3A 4BV9A 4ZJUA 3AUTA 1DIBA 3DMTC 5JO0A 1LDBA 2I67A 3VPXA 1EE9A 1T25A 1P31A 4JK3A 4DRYA 2V6FA 2H5LA 1I30A 2Q99A 1GYPA 3OQ1A 5LC1A 3KSUA 3SLGA 1QLHA 2CUKA 4WEQA 2FPGA 5JY6A 2ZL4A 1T2AA 1E3SA 2X5OA 5G1SA 2C7VA 3PE8A 4Q1IA 3WWYA 1PS0A 3L4SO 3DMTA 4BO0A 2GNAA 2EJVA 1A4UA 5KKAA 5TT0A 3JYPA 2EKLA 3BIOA 3ZZNA 3ICPA 4GH5A 2NSDA 3KEQA 3W4JA 2A92A 4H16A 3WQSB 1NQOA 2F9YB 3G49A 3VPFA 4PLHA 3WS7A 4D43A 4GPD1 2B4TO 4A7PA 4BNWA 1V6AA 1YXMA 3STAA 3JQFA 3PDUA 5F1KA 2Y68A 4LGVA 3TDKA 5DF1A 3QXIA 4DIOA 4U19A 1Z75A 8ADHA 4IDAA 1NZYB 3MFMA 5BSHA 5JBWA 3E1KA 1H94A 1PWZA 4BO3A 3KHUA 4WNIA 3TT7A 3FBGA 2HU2A 2X6TA 4XQEA 3WWZA 2F6QA 4U0GA 5G2OA 3SLLA 6LDHA 3PFWO 3VVBA 1HL3A 3V2HA 1X0UA 1P1RA 4E0BA 4Z0HO 4JCSA 1YBMA 4X54A 3FPLA 3H2SA 3NEPX 4F46A 1I24A 4E32A 5BSGA 2GGSA 4Q3AA 3HDYA 3G3EA 3GAZA 3EZYA 1LRKA 4J1QA 1MX3A 4JLWA 1VE9A 1N92A 3ZV5A 3AY6A 3E9MA 4CMGA 2ZKLA 3BMOB 4DMMA 3QYRA 1N1EA 2VNSA 2VZ0A 4CMAA 3OBBA 4GKVA 1HRDA 1LDNA 2CVZA 1T4DA 1R6DA 4OGWA 3DHEA 1PR3A 2B37A 3OJOA 1R4NB 3QVXA 3QK8A 1O95A 1LLQA 1ON3A 1U7HA 2OGUA 3SWXA 1E7MA 2I76A 4D42A 3S55A 5ILGA 3ITDA 1AN9A 3DL2A 3TL3A 3QWIA 3WX0A 4FJ1A 3DJAA 5FF9A 1XEAA 3QWDA 5BSFA 3SC4A 4NK4A 2Q1SA 1ADBA 1QR6A 3OM9A 1Q7BA 4NU6A 2VSSE 1H2HA 4J2OA 1E1LA 4XYMA 1JAYA 3DBHA 4NDNE 4ND3A 1C1DA 3BAZA 1XIVA 1Q0LA 1YOVA 1ZSNA 1T2EA 1MC4A 3OJEA 1WDMA 3LYLA 4KDEA 4E5PA 3WGTA 2B4QA 3BHIA 2PY6A 3AJRA 2WEKA 4DIBA 1VSVA 2DKNA 3ZU2A 4OYRA 4OQYA 4QFDA 2EJ5A 2Q2QA 4W82A 4EYEA 4I1IA 5IDXA 4NBWA 3LK7A 3UCFA 2QZ9A 1F8GA 1NPYA 5L7YA 5ER9A 3LC2O 3K30A
chains in the Genus database with same CATH superfamily
4J1TC 1RRKA 1G6OA 1LNZA 1LNQA 1OMOA 2IZZA 2W37A 3EJ6A 4TLBA 4YRJA 2ZR0A 3T7JA 2WI8A 4EJMA 5DNYB 1FIUA 2VP2A 5JAUA 3B3JA 2HCFA 2HA0A 2C9ZA 3CCBA 4BV8A 2QTGA 4RXMA 2BV3A 2W8BA 1MT3A 2IPAB 2VPXA 2VNKA 2ZYIA 2DUWA 3B53X 3EC2A 2CYBA 1Z4OA 4FHCA 4GXRA 4OJQA 4MGIR 4RKWA 3TRKA 1OLXA 1W9HA 3OM1A 5FBWB 1ZJ4A 3DDSA 4FPXA 3N53A 1YFJA 5KTOA 4PRKA 3AX6A 3SOPA 4Q9HA 4JY7A 2ZIAA 2LCIA 2HMVA 3GUVA 3IUPA 2WTEA 4FD3A 3ZIUA 4I9UA 4DUZB 1JDJA 4J0EA 1O0SA 3U7HB 2OFOA 1QF7A 3PUWA 2OVBA 1WZ8A 3W4IA 1M2OB 2JJ2D 3GUHA 4OF4A 4X1OA 3GLFB 3ENVA 3IJPA 4A23A 2IEZA 1HOTA 1H22A 2ADMA 2I29A 4FFSA 4XWWA 1J5PA 3UBTA 3UGQA 2PR7A 4C4SA 2JIZD 2BGKA 2ZT6A 1O7JA 1FS4A 4FOSA 2JKVA 4H7FA 3WNCA 1GNRA 2WT9A 1JSXA 1V1RB 1ZW1A 2Z30A 3TN7A 1W0JD 2C2KA 2DLDA 3E1GA 1IQ0A 3HKEB 3IDSA 1Q1AA 4JU9A 1A71A 4JB8A 5EWJA 1G98A 4ENRA 3KYDB 1PV4A 4MGEA 1PJCA 4RF4A 4WRRA 4XGIA 4AIRA 5HJ5A 1JR6A 4KLNA 1GZVA 2XDWA 5ALZA 4DA8A 3DFFA 3X3HA 2R7MA 3BQNB 4QQRA 3ZHOA 1HSZA 2X9QA 1NQUA 4RTQA 2E4UA 2YBDA 3CBQA 4Q9DA 2XRZA 4MWCA 1YRBA 1NNEA 3GQBB 2A59A 3IE2A 1HL7A 2GN4A 3SYNA 4XVQA 1EVJA 5L7TA 1PN3A 2FR0A 4C3ZA 4UJ3A 1FVXA 2AKAB 3NI2A 3SIPA 1RJEA 1EDBA 1G8KA 2AK2A 4UREA 1RYHA 3EBOA 4IILA 1RU3A 1RAGA 3NHKA 3ICWA 3UWOA 1YZHA 3DO6A 1U3TA 3TQTA 3A9SA 4EHHA 2JBHA 3U4QA 3V7FA 4RX1A 1XL0A 4TS1A 5ITVA 1C4OA 1N2JA 2J3QA 2H7YA 2I8AA 4GSLA 2R2GA 2HOQA 4DSUA 3MWFA 3PFHA 4CU5A 4N01A 4RULA 2Z0MA 2B78A 1MOZA 4RAQA 4CDRA 2I6SA 3HHPA 5L7WA 1XK7A 2G82A 1U9IC 2WWXA 1DRWA 2RGXA 3ESRA 5GMOA 3JAKB 1UXJA 3VZBA 3K9CA 2WV9A 4HDSB 1TYBE 4HH3C 4E03A 3ETDA 1XZDA 5E0SA 2I3BA 4B09A 2VHUA 2G6BA 2VPQA 4XARA 3QTLA 3UHOA 1BXRB 1QYXA 3U4AA 2NT3A 2P0EA 5BSUA 2QVCA 2IYSA 1JDUA 3PRJA 1QRTA 5DCUA 5JG7A 2Z3WA 1UPUA 1QLWA 3HNOA 4TM7A 5LDHA 3I92A 4G2NA 3WK7A 4B33A 5C2JB 4CN8A 2DHDA 2VHZA 5CK4A 5D5QA 5BORA 3H4VA 3PITA 3TZQA 2HJGA 3WLPA 5JBIA 2R1TB 4AJLA 1SUDA 3DV0B 5IBRA 2X1HA 4GLJA 4JXZA 2JFWA 5CPFA 3SOZA 5JSUA 3JQ6A 2YWHA 1VPTA 4R8VA 3W79A 4F2PA 3SIWA 1CUWA 4BO8A 4ZT5A 2QS9A 4NYJR 5FLKA 5DMHA 2NZUG 2WSMA 5EG5A 2XW6A 3RS8A 1S9DA 4D8TA 2HJWA 3UH1A 1GG9A 2EX1A 1U2GA 2L69A 5INFA 1DXHA 1R0BA 1AUPA 3JQAB 3D3KA 3HP1A 4P5PA 4RXUA 3C97A 2WF7A 3G0HA 3SMVA 5DZKA 2YL2A 4Q34A 2C9MA 2QTHA 4L50A 2HBYA 1ZC4A 1R18A 1QVAA 2Z43A 2QRQA 5T4EA 1TVKA 3EZGA 1BZYA 3T5TA 5KVVA 1CNMA 3E8MA 4G3XA 2C5HA 3JZFA 1UAYA 2DFLA 3E9RA 4A2CA 2PWAA 1S3GA 3M5WA 5FFMA 2L17A 3G13A 1RAHA 3LRTA 5I6DA 4TQAA 4YWJA 2C3YA 3DBLB 5EEHA 4QHTA 2A9RA 2Q1XA 3UN1A 3W9SA 1JV2B 5CDTA 3L8YA 3SF0A 1C3XA 1B16A 3FOFC 5CFOA 2XDQA 1OBCA 1F9EA 3L05A 4C0WA 4G09A 2GKSA 4OJNA 1E3WA 2J4FA 5IKMA 1QU2A 3G5LA 4NESA 4B7UA 1AS0A 2V7UA 4H18A 2GN0A 4WN3A 4Q4AA 4P8RA 4X61A 2RI6A 1OFVA 3LHFA 4TRMA 5TQ0B 4E2FA 5M7EA 4DM4A 3LQ2A 5CX1B 3ND6A 1J2JA 1F5NA 1JI3A 3WMWA 5BW8A 4CCSA 4DBVO 2XMGA 4LVNA 4CV2A 1EUCA 4JB3A 3KSBC 2IITA 1P0IA 1XTBA 1EB8A 2HNAA 2XOKD 4KAFA 4CETA 3WBFA 3EPRA 4DYVA 1T2CA 2P78A 1H69A 3EIFA 1UCFA 1PZXA 1LU9A 1A9OA 1C8VB 1UOOA 2GAAA 2ID8A 2IPLA 2VRCD 3E7PA 4KVAA 4WK6A 4XGQA 3CUUA 2JAPA 3AI3A 3DKPA 3NGXA 4M89A 5EXSA 4B43A 4F11A 3DOOA 1U0JA 4O08A 4N6GA 4QLOA 3GCZA 3AI7A 4J0GA 3KM0A 2P69A 2Z2XA 4GKJB 2EKZA 1GN8A 2H48A 3NKFA 3FB1A 3KALA 4ACAA 2QP9X 4PCUA 2DBRA 5AW7A 4AJKA 2YWRA 3NJ4A 3KTDA 3UA3A 4C6RA 2J0QA 5CDYA 4DT1B 4UDXX 5H16A 2VH5R 4LHXA 1GL3A 3NBMA 4FKBA 4OJTA 4P36A 4UBNA 3EZLA 5EHGA 3W90A 4YUXA 1MXHA 5AKIA 5J58A 3UMVA 3SQLA 4RTKA 1A04A 1TYFA 3IPXA 1N5RA 2FQWA 2IEDA 3VVLA 1GPAA 2NTJA 3E7DA 1MVOA 1SRRA 1ZNYA 2C92A 2VQ3A 2ZUVA 2XQFA 4XLTA 2YICA 3RH0A 3ZIAA 3L0IB 1FSGA 1TMKA 5JAQA 4D3DA 1E3MA 4OGFA 4MGHA 2MR5A 2B7BA 4GOKA 2ZOSA 3VJLA 2JAQA 2ZSJA 1AO3A 4KWHA 5AK3A 3SNHA 1LGYA 1A9QA 3DPUA 1ISJA 4OBEA 4QXRA 4DBLE 4MI2A 3K0HA 5ADVA 1UAGA 3SHQA 2QMEA 3PJEA 2R84A 1TCVA 1VIDA 3PQDA 1FU7A 3CO5A 2OCLA 2I54A 1V8PA 3C3YA 3AY3A 1PNTA 1L0BA 3P2OA 1FVHA 3H84A 4LPSA 3KKEA 3A2NA 5TVGA 3OJLA 1WMBA 2WD8A 3AB7A 1C9DB 3ICCA 1WSAA 3HABA 1C1XA 2QAJA 3FOWA 1O87A 3A06A 1YJ8A 1XWIA 2PUEA 3HFJA 4IO1A 1LBHA 1PQ4A 3Q0GA 4ALLA 5FX2A 4AY3A 1I80A 3PC8A 5FAXA 3X0DA 4ZCMA 4BWFB 3TAUA 4XB1A 3H5NA 3LHDA 1V96A 1RLIA 1A82A 5CFPA 3CMCO 3MJTA 2LDBA 1R74A 1BDIA 4RK6A 3H04A 1T8TA 3OTQA 4LSWA 1GA1A 4MQEB 4QDUA 2NXWA 3CW9A 1JHZA 1VZ2A 2VYNA 2AMFA 3EDMA 3MNFA 3PL5A 2OHHA 4JLDA 3GI1A 1JKIA 1QYWA 1BDMA 4IFIA 4W63A 4BNYA 4TZ6A 2EZUA 5JDCA 1W73A 2NV6A 4BEJA 3D3JA 1L5ZA 2J6BA 3KV1A 4IZIA 2C8KA 2HKIA 4BB0A 3AWIA 1E5XA 2X3FA 3JVIA 5E9QA 5FQOA 1KQFA 3DTNA 4ECEA 5EPUA 2PS1A 3RRFA 1Z6YA 2HLNA 1IBCA 1EGVB 2ECFA 5EWJB 4RVGA 4UVIA 4WN9A 3SGLA 2C4MA 3P85A 1CUVA 3OZCA 1CE8B 4CKWB 3PX3A 2WYUA 1C3LA 1JP7A 2Z5VA 2Y67A 2IBTA 3VZSA 2IPOA 5I45A 2TMYA 3LKBA 4TMZA 4X1IB 4FU0A 4CQLB 1B15A 1GAJA 5KOIA 3VHQA 3OCJA 1DOAA 2AXQA 1EDDA 2B20A 5D84A 2W4IA 4NBKA 5I7AA 4EA9A 1HNOA 1U4NA 1JFTA 2HDOA 1L5FA 2CCJA 3Q9LA 1LPPA 4HAIA 3Q5GA 4E11A 3H2ZA 2XTJA 4L4XA 2VJPA 3EA4A 1X8XA 1SMKA 4I5FA 4WZBE 4YRKA 3RADC 2GKOA 1M6YA 1DIRA 4E3WA 3DONA 1AGNA 3NASA 4MMZB 1DU4A 1FNMA 3CZMA 2E21A 2YCBA 3O21A 4KBYA 4YONB 1Q0TA 4UAVA 3A31A 3OP4A 1JTEA 1H2BA 3CRRA 4HN9A 1WPRA 4JP2A 2CVFA 5KHOC 3EVTA 3KQSA 3KOWA 3CH4B 1TAGA 5AK4A 3QUCA 4F5YA 2CLLB 1HMYA 2FPWA 3A3KA 2WJIA 3PC4A 8MHTA 5F76A 1NW8A 3L0SA 3KXKA 1Y3AA 2VI5A 3A1WA 1NZDA 3CNLA 4HADA 1NMXA 3R9KA 4QYTA 2GYWA 1OU4A 3LO8A 2HRRA 4Q7LA 4XX0B 2X76A 4IIGA 2QN7A 3URMA 4JUBA 5PNTA 1ENYA 3VSEA 2RB5A 1IMOA 2VLIA 4OH7A 2CE2X 4HGZA 3AC0A 3PU6A 4TUYB 4C4OA 4CUJA 3EAGA 1UANA 2P9FA 1IUKA 2XMQA 3KKZA 4YUVA 4AKEA 5CDGA 2IH5A 1HY3A 3GJ8A 3BB4A 5BUQA 3PQFA 2ZCJA 2COKA 1MR3F 2BFDB 4FWTA 4LWOA 2QGZA 3T7EA 1ZJJA 4IIUA 1JN0A 2QEQA 2NO7A 2R85A 2XR1A 3PRKE 4IEEA 4JENA 1IOZA 2KMLA 5F5NA 1UBUS 1EEHA 3FOCA 3G0GA 3ILHA 3L40A 3BEDA 3B6KA 4FR2A 2JC3A 2Y9YA 1XAIA 3L0ZA 3L8EA 4TKMA 4UMFA 4W5TA 4M1SA 4IZDA 1LDYA 3WL5A 5EESA 4ZPXA 1NBHA 2H17A 1NRIA 2NM0A 3MIZA 3N3AC 4BKPA 1X9GA 5CTAA 4TXMA 5CG1A 4NFHA 1US8B 3OIGA 1P7PA 2J45A 2FN3A 1ZGGA 2W22A 3H7AA 1Q0RA 3WGKA 4PNPA 1MV8A 3KV3O 4G23A 3X1MA 1XEXA 4Z6KA 3RAJA 3N2GA 2EF1A 1VBNA 2WIDA 1SG4A 3IT3A 3TW6A 2VJLA 3R77A 4FKZA 4G4SO 3L6DA 4P7FA 4P3KA 721PA 2O8FB 1ZCFA 3P96A 3ZNNA 3BRWD 3A27A 2Q4BA 1EA7A 5KYWA 2MINA 3AXTA 4BQIA 3MT0A 3BOSA 4JJTA 4PWYA 2CLSA 4Q7JB 2H31A 1ZKMA 2YHIB 4OAQA 1DCTA 2G0TA 1IY8A 1EMDA 1NXVA 4Y6PA 4YJ2B 2N0SA 2FMKA 2M6KA 2I7TA 2VP9A 3PQ3A 1L7MA 1HYEA 1DRVA 1ULUA 3O47A 3SXJA 1E5QA 1AA6A 1PZFA 1FDSA 3OH8A 2PG3A 3WK5A 4DHWA 4OQPA 4L08A 4OXXA 5DU4A 1KERA 3O75A 3L1HA 3LQRA 1FMJA 4NZPA 1HDZA 2JARA 2WW8A 3C8HA 3OMWA 2DP4E 4R1PA 4AROA 4XX1A 2OD2A 3MRTA 2C58A 2YC2C 3PRYA 2ZSKA 3QFFA 2J59A 3ANXA 3LCVB 3NTOA 1I3NA 1MDFA 3QXXA 4XVCA 3NBUA 4FLFA 2O3TA 4MQ6A 3QVGA 2W2OA 3EIUA 4KXFB 4NS1A 5CLHA 5LXTF 4LE2A 3GVPA 2AB0A 2H29A 4JZYA 5EWLB 1FXWA 3REOA 5HKBA 1GTVA 2ZSIA 2CJXA 4RY8A 1JJFA 2NZWA 4QNRA 1WL8A 2WDZA 2Q9CA 1FNCA 3T3GA 1Q2XA 1NVEA 3I6BA 3ADBA 3D2BA 1XXLA 4ZAGA 2EHJA 1NMSA 4MGKR 4L5CA 2DYKA 2O1WA 3N76A 4QT4A 2ONJA 1YZ3A 3QV2A 3ZE9A 1BDJA 1FSSA 2YWDA 3FPAA 4QBKA 2P4HX 4YMSA 1R2QA 1JB9A 2V5VA 3A1CA 1CYEA 5IZCA 3TM4A 3T95A 4R2MA 4WFIA 2VSUC 4MI9A 4MQFA 1N4DA 1CHDA 1TDJA 1DO8A 1YJAA 5DOZA 5CA1A 4YRGA 3UGJA 2UYQA 4JB0A 3PTZA 3HVUA 1LPOA 1IDN1 3OY2A 2P2GA 1XT6A 4IUBS 3TI9A 4JR2A 3D7NA 3F6CA 4KN9S 1SPBS 4RWZA 5E1OA 2Y2UA 3LBAA 5JDIA 3TFWA 3L4BA 1USGA 3FTPA 4ZI7A 1WB9A 4OLFA 1J7KA 4YDRA 4MKRA 3A0UA 2J6CA 4PO3X 4MR9A 5M34A 1QU3A 4NEKA 2C31A 5BO5A 4K9OA 3F3YA 2PSHA 4E07A 2X5NA 4EHDA 1ZCZA 4XR4A 4HDTA 1E98A 1ENPA 2V8BA 4PAMA 4YMWA 1BXZA 1Q44A 1FCJA 2DULA 5NULA 1ISIA 3TOXA 2Z8YM 1N2CA 4LDZA 3HSYA 2E7ZA 1A8SA 1JL3A 4MR7B 4CMBA 2Z1MA 3VYUB 1PW5A 4A03A 2ZT8A 3JQAA 4MMYB 3EPPA 4B84A 1SK8A 1X77A 1AKQA 4EY3A 3GRKA 2J09A 3KSRA 4K8RB 2AI3A 1KQ3A 2DR2A 1NKTA 2QV7A 4BNKA 1KVRA 2ORVA 1MO3A 2BJVA 1ZITA 2IU0A 1X1EA 3RRYA 4F7WA 3S6JA 1ZM4A 1HQDA 2QD4A 2YHSA 4LMAA 2O3UA 4ZCQA 3QHQA 3AHJA 5TPWB 3LX6A 2J41A 4H77A 3DKIA 4MV5A 4AU1A 4B3MB 4JQSA 4REQA 2Q4OA 1LF5A 3O92A 4YO8A 5ALDA 2H0RA 2I3ZA 4AF7A 4EHNA 4LQLA 2XBUA 4FI3F 3F98A 4Y2SA 3VR4H 4PBRA 1C7JA 2DHQA 3QKSA 3ESZA 5CFRA 3S8YA 4JQOA 1D7AA 3OOYA 1A96A 3INRA 2IW3A 2FXVA 3DYIA 4IDPA 4PC1A 3RFCA 3WGYA 3SCZA 5B1EA 1E79A 2WZBA 3D6VA 1KZ7B 2PSEA 3HI6A 3IELA 4LRTB 5G4KA 1FU8A 1Z3IX 3RBAA 4DUYB 4DFDA 4JLSA 3TDMA 2F6RA 3REQB 3HMQA 4EPXA 2C96A 1DC5A 4CV0A 3O8OB 4OA8A 3S40A 1VSUA 4B3RB 3U7GA 4IDEA 1S8NA 2ZRPA 3AFHA 3WLJA 1L4HA 2BEVB 1MHPA 3DPSA 4LJ4A 2AEMA 4RZUA 2HY7A 3D8UA 2VN8A 4FEAA 4JUFA 4AECA 4BTLA 5IUJC 5FJJA 2PANA 3RREA 4QXOA 4WSOA 3NHYA 1X7WB 4JC0A 3FUCA 2MR6A 4IDOA 4RESA 3SYRA 2QD5A 1CQXA 1AUXA 5TQ2A 5C35A 3IJRA 1O77A 1RRMA 4MQUA 4UEOA 2V9PA 1XJ0A 1CUDA 2JCBA 2QYSA 4GOMD 3O4FA 4H6WA 4XGRA 1YCDA 1A5TA 2F2TA 1QO9A 3I5YA 2AN1A 3VIVA 2V59A 1CEQA 4I4IA 2CXTA 1ST3A 1M2OA 4W5JA 1AMNA 2V96A 4MLZA 1YVDA 1VE5A 4MUHA 1ICEA 4Y6RA 3TPCA 4BJHB 4IVPA 5DK4A 4GI3A 1WKCA 2PFGA 4DCVA 3E61A 3BE4A 3RSLA 3U1TA 1E6UA 4CI9A 2R1VA 1KYXA 1U8UA 1IEVA 4PSKA 3QQ5A 1EFCA 4C1BA 1TTTA 3UHFA 4FB4A 3I2KA 3L41A 4R6XA 2CEAA 3D8TA 3SDSA 3GARA 6Q21A 1OLXB 1R7RA 1NBMD 1F1JA 1SUAA 2G70A 2ZI5A 1MDBA 1PTKA 3H3FA 4W5WA 1QH1B 4S0XA 4EDFA 3USZA 4I5IA 4WW0A 2IV2X 4HDNB 4H15A 4XWYA 1XDZA 4IV5A 2AC2A 4EMTA 5IULC 4NJOA 1F0PA 1FDVA 1OPRA 2V7VA 4JOTA 1N3IA 2QR3A 3BRSA 4GYYA 1BCSA 1E79D 3D7MA 4JCQA 2Z4TA 3NWEA 2X3UA 4K40A 3L8MA 3R8XA 4ZQCB 3KS9A 1J00A 4L8KA 1DLIA 3LOPA 1TMYA 3JQ7B 9LDBA 1UIMA 2VK8A 3V5EA 3K9WA 2V7TA 1XC7A 3EJWA 4UZFA 1NNUA 4FUTA 4NU0A 4HUTA 4L5JA 3DL7A 3QKUA 4DJEC 3ASYA 5SZJA 3G9XA 3HCOA 4E1VA 4O3MA 5B30A 4BFSA 2JKZA 4OHUA 4FJWD 4V39A 3PXXA 1DEKA 3D1LA 1YQEA 2AN5A 1OXTA 5FA8A 1KO7A 2RONA 3IUMA 5ABPA 4AKIA 2I33A 3J80A 1DTSA 2XMZA 1ZN7A 3E70C 2O2SA 4HXFB 5LOVA 3H99A 5J23A 2EATA 3OWHA 2W8ZA 3KU4A 2BGTA 2NPOA 4YCNA 4KQXA 1O3YA 4G4GA 4K9SA 4BO4A 4C7KA 2NU7B 3BDVA 2HNBA 3DOCA 3CU5A 4XB2A 1ITZA 2FQXA 3EIEA 1VP3A 3IOMA 3M1IA 2PXXA 1I32A 2WV7A 4RPKA 1ODKA 2WU3A 4RA6B 2IUUA 3SD7A 5BR7A 3HH8A 5C7OO 2WICA 1KO8A 5DYNA 5B1SA 5L3ZA 1NVVR 3WMEA 1P44A 3OIUA 4INOA 1TX4B 2XB9A 3IAS6 4U8GA 3IUBA 1FJ2A 4G9GA 4BO6A 4N8DA 3CSUA 3CV3A 4MMXB 1EFKA 4DZTA 1T9ZA 5K0EA 3FGNA 1QV7A 3IQFA 3BCHA 4WK0B 4WBNA 4KPUA 3AFGA 3MLBA 4BO7A 2JLBA 3CWQA 1X7ZA 2G1AA 2GEBA 2QE7A 5HM6A 2UUOA 1RJDA 4ZIRB 1R12A 3FM9A 2WJ4A 3P9PA 4I1SA 2F64A 2IF0A 1XDGA 3DE0X 5EQTA 3ZNPA 2UXDB 3O9VA 2QX6A 3AFOA 3VKVA 5CB4B 2ENUA 3R6DA 1KI8A 4HSGA 4YV0A 2P3SA 5C8YB 1DOHA 4YAFA 3GO4A 3I83A 3GELA 3C6QA 5IAOA 1V26A 2IDMA 3CX4A 1A9XA 4I3GA 1AZSC 1UPTA 4RJ2A 2QL5A 4DLSA 4Y6SA 2PRIA 2RBKA 1EK0A 4MUKA 5GV8A 1YV9A 2QTWB 4HXEB 4BNZA 5I4CA 3F7MA 1XCMA 1QGAA 4RELA 1C7FA 3RU9A 1L4EA 1FDWA 1VJDA 1W4ZA 2B8TA 5JASA 2GH1A 1N6EA 4MYDA 1Z39A 2QVXX 3MZ0A 3RSIA 2C7RA 3PG5A 1XF1A 2WSLA 2Q7OE 1BDHA 2FP4B 4XOIA 1F3LA 1QNLA 1YS9A 4I81A 1OBVA 1Z0UA 4P4GA 3BXHA 3N8IA 4Y30A 1MPXA 2HTEA 3J7TA 4DC9A 3GF3A 4JFCA 5G3YA 2AFIA 4HRYA 1ZLXA 4N49A 3UJNA 4DMKA 1HBJA 3QKIA 3S0JA 1BKSB 2WUWE 2HV8A 2YVAA 3GN1A 3MS7A 3QKAA 4GMHA 2ZXUA 5CVTA 3K5WA 5DSXA 1GNTA 1XXHE 2XGOA 3JCZA 3C7KA 3I2IA 3KAPA 4BC0A 1XD2B 3TMAA 4G1UC 3BH7A 1ZN9A 4ENTA 5KCZA 2KPOA 1O57A 1PCXA 2VF7A 1EHCA 1YRHA 1E1NA 2EFYA 2JD2A 1IVSA 2Z8ZA 2R8EA 3E1SA 4JGGA 4N5MA 2EQBA 2NYVA 4IH9A 1K8ZB 1ES9A 1OIWA 1GP2A 4NPAA 2GOYA 1GRNA 4CG3A 5LPNA 4LJYA 1EAYA 2CE7A 4ZOLB 3IESA 3E3NA 1B2RA 4KWIA 5E0OA 5CB8A 3ZOKA 2AUTA 1QGED 4URZR 4C0AC 1ZQ1A 5EUCA 4U18A 1CQIA 2ACWA 2BEWB 1SU8A 3L6BA 4EUEA 2WSSD 3GZ4A 4NOJA 2NO9A 1XLVA 1YR8A 2GZAA 3CLRC 5EJFA 4FUQA 5DHPA 1EXMA 4PNHA 1XDSA 1UK9A 2OCXA 3RVMA 5JAPA 3NMUF 1LW7A 3GU3A 3LFTA 3R7DA 3T3MB 3K8XA 4F2HA 1FS5A 1MABA 2J3MA 3D0QA 4OGKA 3FR7A 2B6HA 4FBLA 3V7UA 1LXCA 4YR9A 2XLBA 3NVMB 4GEGA 1F2UA 1K0FA 3OPYB 4NDAA 3G2JA 4NAHA 4QECA 3FNGA 3OF5A 1D2CA 4TVBA 2PJRA 4D4HA 2DAPA 3LVRE 1GV1A 4ZAYA 1QP4A 3ZGYA 4R83A 5ARBA 1FYWA 2G5PA 3UJDA 1P9NA 2J5QA 3U4MA 2H2AA 2BEWA 4MAFA 4I5DA 3LO5A 4NYJQ 3DF7A 2ZYHA 2Q3LA 3AF5A 5HMLA 3VR0A 4QXPA 1E0AA 2XMDA 3O0DA 4LHYA 3R5HA 4X20A 4CKCA 2OKCA 4HN2A 4RNDB 4S1OA 1OXVA 2HK7A 5LBTA 1LUAA 3T6KA 3T5MA 1W2GA 1ZUWA 4OO3A 1CUGA 4Z86A 3JATA 3CKYA 2X42A 2I65A 3QNMA 5CBPA 4B80A 2CBYA 3MGKA 3DVAB 5AJTA 4JJ7A 4Y9RA 5EWLA 3NDPA 1Z38A 4PAQA 1HTTA 3OLQA 4HNTA 5U4XA 1SBHA 4LG1A 3NXKA 2MSEB 1KQPA 2WKSA 4V1CI 1TA0A 3L07A 3JQFC 4B3TB 2KJQA 1IEWA 1WCWA 1F4LA 2JI6A 1H6CA 2VWHA 1JIUA 3GRUA 4ZP1A 1P3JA 4L5BA 2JCXA 1A2QA 5C81A 1B8UA 1HEYA 1PE0A 2RBEA 1Z0DA 2X1MA 3SSOA 1OH5A 1AQJA 4GM2A 3V00A 5IDQA 4WLOA 2OXTA 4QBGB 1O54A 1US8A 2VKQA 3SXPA 2PQMA 2WTXA 1R0LA 4D26A 1QIIA 5BWLA 1JDTA 4B4OA 2X2OA 2WFLA 2F9IB 1GPLA 4LTDA 4G0OA 1KK2A 3WLTA 2V7EA 4NCJA 4KACA 4MGZR 5GINE 1M74A 4LE0A 4YJKA 3WIUA 4QTXA 5CB6A 2B1JA 5LQCA 1A8PA 3DWFA 3KCQA 1IB6A 4R8RA 4PGFA 4R8KA 5JRDS 1PFGA 3IEUA 4ZD6A 4GSYA 1YUMA 1H9AA 3EYWA 1QK4A 4KQ1A 4BRWA 2WQ6A 1N77A 2I7DA 1WX1A 3IDOA 4R4JA 5C1DA 3OVMA 1JEYA 4MDHA 4RYFA 4AICA 1GPNA 1AU9A 3O4RA 2HMYB 3DEJA 1RFGE 2OM6A 1T8WA 2IDJA 2OO7A 3OUTA 3HDQA 3HUFA 3SSMA 5BOSB 1B0PA 5MDHA 1L4LA 1I7NA 2HK8A 4DV0B 3OLVA 2J5II 1SKYB 1OIVA 4RD1A 2QD2A 2YJNA 1GPDG 3E5NA 3U39A 4RLQA 4HC4A 2M6LA 4M87A 1H23A 3ZZ1A 3STTA 1R3DA 2UVPB 1N6IA 1Y3FE 3LCRA 3TKYA 4LF9B 4IGAA 4MWEA 1WSBA 2HK6A 3ELDA 3N2EA 2WBLC 2X4LA 3RB8A 1C81A 2IF2A 1UODA 2WZDA 1SUIA 1D1QA 1V16A 5AIAA 1XX6A 4AMGA 2F3TA 3PHJA 4GSKA 5JVDF 5F73A 4M1KA 5F9FA 5CDHA 2PX6A 1ENOA 1F0KA 3COWA 2AW5A 4ALNA 3Q7SA 4CEJA 3R4VA 5F33A 4OXQA 2ZRHA 1SKMA 3FFBA 4HRVA 4GZMA 3L8HA 3ZDDA 3F6PA 3U7QA 5B4TA 4IMJB 4DMFA 2WP0A 3GEGA 1U0SY 4UOZA 1HE4A 3B1WA 1XHFA 3EWAA 3AG5A 2PX2A 3FYTA 3ROQA 1CE8A 4CKWA 5HIKA 3KC2A 2WPNA 3FYDA 5KSYA 2WA1A 2W2MA 3A4VA 1U2QA 1G19A 3QWBA 3TR5A 1N0VC 2XB4A 4D57A 3G2LA 4H35A 1Z74A 2H5EA 2R751 3VTZA 4DCOA 3WWOA 1NM5C 4FWIB 3HPRA 1XVVA 1M2HA 1SHTX 1X13A 3FAZA 3WJ1A 4C7VA 1DS6A 2B7CA 3ZWPA 3FCEA 4B82A 1FTYA 1NBAA 1V37A 2AC4A 13PKA 2REBA 3OZTA 4FFBA 1V1RA 3RAGA 1BU8A 2VP6A 4RD2A 4TTVA 4K8OA 2NAFA 2OCKA 1EGAA 2BGJA 3MYRA 3SZUA 4A5OA 4L22A 4EB0A 1JQ3A 1FFAA 2QZZA 3WLHA 4PSDA 4ASUD 4Q4HA 5IKLB 2IBSA 1PT9A 3QBEA 3ZHTA 1QB7A 1TT5A 4BMOB 3PDWA 1HKHA 3LUPA 4CDGA 2PZJA 3K2IA 4Q1VA 1Z5PA 1KK3A 3FVTA 5EXPA 5FPPA 3S29A 1UP7A 3NHAA 3UW3A 4ZYVA 1ONNA 3W6OA 2DWUA 3HA5A 4BKOA 3BULA 3DB1A 1EG7A 1ABFA 3MCTA 1A7UA 4HFNA 4LCBA 3HCNA 5DUFA 2OYSA 1UOQA 4CLOA 3ILYA 4X93A 2XUHA 1AZTA 3CLSD 4JH0A 2NP7A 3TW4A 1FUKA 2M6RA 2PZBA 2ZYRA 2FFRA 3PC7A 3GHYA 4XCXA 3W8DA 3QVSA 3D1VA 4ZI2A 5CA0B 1II9A 5IK2D 1L2TA 1UFKA 3N39C 5DLYA 2B98A 3H5RA 2XF8A 1J22A 2FWBA 4Q00A 3T3OA 3RAEC 1NXSA 4ZAWA 2ZUEA 4KHPB 4PZCA 2QRJA 2YVLA 2D5CA 4GR9A 5F7XA 4P53A 4ON9A 3CRQA 1DJQA 4GOXA 2IYPA 5JCOC 3GAFA 4WY2A 3GPBA 2FA9A 4RFVA 1DZIA 2WKWA 2JIMA 3THXA 4ZVQA 3GNQA 1DEXA 1O58A 1JSRA 5KOJB 1Q77A 4FHZA 5FIUA 5D1HA 1Q6YA 3OE4A 4U7JA 5TQJA 1T8RA 2FETA 5BN4A 4XDZA 2B4YA 3L82B 2PLWA 3PCXA 4QQ8A 4DRXB 2PUCA 4GKKB 1DFIA 3KKLA 5EFOA 4YUAA 1M0EA 2J0SA 4LSMA 2V45A 1EGMB 1B00A 2WM2A 4NY1A 1AF4A 1REQB 4JR0A 3PJRA 2IOFK 1SCBA 2UVPA 3SIXA 2CHGA 4OBWA 2HPHA 3H1GA 3KKKA 1PL6A 1QCCA 4I6GA 1QGYA 1PGQA 2FEOA 1PV2A 3BXEA 3E48A 3MWGA 5TEWA 4MA0A 3RG2A 5JEDA 2G63A 3H7IA 4UM9B 5DI3A 3HKDB 5ESWA 4AG5A 4N41A 2Y4OA 4G0UA 3UC5A 5ENVA 4W5RA 1WZEA 4EMPA 4BO1A 2REQA 2O8DB 1E2KA 3KYJB 4NENA 1KH2A 4Q66C 1PEAA 2XT0A 3ZI0A 1BROA 2OCYC 5EOVA 3TF5A 3IEKA 4E2ZA 2VSQA 5LMNB 2C95A 2H06A 4AQYB 3GT0A 4Y2XA 4YCBA 4DUGA 3JVDA 3T5CA 2O2YA 2QQ3A 4YQYA 5AM2A 1VL5A 1J5EB 2W2KA 3LPDA 1QH8A 1Z0AA 3ABQB 4KIGA 4KO1S 4HAWA 1W5SA 3K0BA 3K20A 1ISSA 1MGOA 2CCKA 4V24A 4XUEA 2X6QA 5AM0A 2EBHX 3ROKA 2ZR9A 2VCHA 1T5TA 2XOXA 4OMDA 1FMFA 1AKRA 4WLEA 1TEZA 4TWZA 2IU6A 3AHCA 2P3QA 2JG3A 1W6UA 5KDOA 2JCGA 2A0UA 5CP8A 5BVHB 3LP5A 3IUEA 1XU4A 1KSHA 3N2IA 2P6PA 1TGVA 4CMEC 1L8XA 2MWMA 3LVQE 1SUEA 1VCNA 2H1WA 5UKDA 5KNDA 1I7SB 4YT4A 3DW3X 3HM2A 3ESBA 3ZYCA 4YRDA 3MD9A 3FUXA 4IWNA 2JHGA 2ZQRA 4ANFA 3QLEA 4D1YA 4BHTA 1JU4A 1K7XB 5IT0A 2O6HA 2Y66A 1S4QA 4Y2TA 3N7AA 4BFXA 1LV8A 3WKAA 1HUQA 5A4DA 2VS1A 2EGGA 2XUAA 4RL4A 4OAOA 3RRZA 3S5JA 1KXJA 4DKJA 4B3JA 1H0KA 2XYHA 4ZCSA 1NW3A 2BZ0A 5ECYA 1GRCA 2V6IA 3QELA 1PDOA 2DQSA 1FRZA 4RF3A 3MJHA 5CXSA 4CIVA 4GPZA 4QC2A 3KYCB 1HQKA 4ZQHA 1KOJA 2ZBVA 3P26A 1YZGA 3H0QA 2AX4A 5CEEA 1L6IA 2I1WA 2WFAA 3OE7A 4OHYA 2I4RA 2W11A 3QBJA 2GVZC 2W2LD 5FI3A 2W6QA 1J0DA 2ZK7A 4QDKA 4E6EA 1NJ6A 4DHEA 5B12A 3ST7A 3WB1A 3OPYA 5JYEA 2P9YA 3V8BA 3VTAA 2X14A 1U1GA 3CJQA 1QHYA 2MJLA 4MWGA 4OI4A 5EWMA 4BBJA 5CB0A 1NDHA 5KI6A 4NENB 1M2KA 3I2JA 5GOZA 5FLXA 4LYAA 4J2HA 1Z5UA 2OYCA 4FC7A 3PT5A 1FSZA 4KLCA 3BJEA 4QDZA 1K0UA 2IIBA 3ADPA 1E7SA 2D1SA 1BN7A 3LYAA 4FFNA 5CT9A 3QX9A 4V2IA 1SXJA 4CFZA 2P30A 4FS3A 5JECA 2LKCA 1S5PA 1TO6A 2JCYA 2UDPA 5HRAA 2WLTA 3DO8A 1U65A 2HO4A 4H3HB 4UQOA 5CW2A 2A14A 4ZU2A 4BO5A 1YJBA 4H17A 1ZIPA 4XYBA 2XMBA 2FPXA 3H0KA 4O5AA 2C5BA 2Q6IA 3G23A 3OJFA 2E85A 1CUZA 1XXHA 4FW8A 4X1KA 5IT4A 1EK5A 5K6AC 1TQHA 2J32A 2W6NA 4I5GA 5LQMA 1E4OA 1RQPA 1YS4A 2X8JA 1AKYA 3AGPA 3VSAA 1W96A 3ISTA 2QRGA 5EIBD 3F8TA 3UV7A 4RGVA 4F4JA 1AJEA 3K4QA 4PCLA 5SZHB 1MO5A 4BGEA 3ZVLA 4JI6B 4Q37A 5F1OA 2J3KA 3CNNA 1JEJA 2HNKA 4QREA 3WA6A 1I14A 3MJSA 3ZTYA 5AR1A 5JAHA 5KS2A 1W49A 1BQ3A 4FSDA 1RWBA 3TSOA 1E8DA 5EIFA 1T4BA 2K4MA 1D1TA 5KX5F 2JGLA 4CIXA 5A3SA 3GWZA 3E9CA 5B6JA 1ESCA 1RBQA 2IYLD 2VCEA 4N0MA 3UKJA 4MS1A 3SFTA 3QA9A 2HYDA 3R9XA 1JFLA</