3ZWAA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
727
structure length
727
Chain Sequence
b'VPRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
molecule tags Oxidoreductase
source organism Rattus norvegicus
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
total genus 271
structure length 727
sequence length 727
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwaA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwaA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwaA01
5LC1A 3CH6A 3HN7A 4GMGA 4IBOA 2BFMA 4QECA 1UZMA 1HKUA 3A14A 5H81A 2Q4EA 1MXFA 4ALNA 3QV1A 3RU9A 1IULA 3BMQA 4YEDA 1I3LA 3PEAA 4A27A 3HDHA 3GEMA 1SB8A 5FEUA 3RRVA 1PR3A 2GSDA 3DC2A 3CINA 4BHTA 1KOLA 3F3SA 4WCZA 3PK0A 3RUIA 3ZHYA 3U4IA 3JQGB 3R0IA 5THQA 3VTFA 1LDBA 4H15A 1BXKA 4AVYA 4I9UA 2VQ3A 3GLQA 2AEJA 3JQ6A 3DBLB 1NFQA 4QT0A 3ETEA 4U7WA 2UUOA 1WZEA 2HMTA 1T25A 2J5GA 1DJQA 1SMKA 3HNPA 1VSVA 1I3KA 1P0FA 5DDIP 2CSUA 4MOUA 1N1EA 4AFNA 3E03A 1NWHA 2CZCA 3O4RA 1ON9A 5G0WA 2HKIA 5DCWA 4ALKA 3QP9A 1HL3A 2VWHA 1EFLA 3ONDA 1ISIA 1E3SA 5DU8A 1JKFA 2AEFA 2ZK7A 1U7TA 3L4BA 2Q2WA 3QVTA 4L6WA 2YQ5A 1I36A 3TZ6A 4BQPA 2ZQQA 3ZI0A 3HG7A 1LRKA 4RPGA 3T7CA 5JDIC 1MG0A 3DHYA 4TRJA 1DRWA 2Q4BA 4G65A 2Y1FA 2DM6A 1K89A 2DTXA 3WSVA 1AUPA 4PG5A 3V2GA 4OXYA 3WG5A 4MI2A 3AOEA 4HADA 4XGNA 3VKVA 1A4UA 3A1NA 4PG8A 4BOYA 5JY6A 1EE2A 1VRWA 2GN8A 4TQGA 2X5JO 3DEYX 1CWUA 5AQ1A 1TG6A 8ADHA 3PDUA 3R3SA 4J91A 5DULA 1QMGA 3L4SO 3C7CB 1N92A 4FFPA 4FIZA 3VAZA 4M86A 3GZNB 4PN3A 1DXYA 3GVIA 2F6QA 1EQUA 1ZK2A 3VPHA 4ZRNA 4HUJA 3GY0A 5T67A 4IMRA 1HYEA 5COQA 1I33A 1LLCA 3ADPA 4NJOA 3TF5A 3MJTA 4E3ZA 1GV1A 4AJJA 3ON5A 3CEAA 2WDZA 3DBLA 3F5QA 1YOVB 1DAOA 4AJEA 4E5MA 4HFJA 2P4HX 4DMMA 4P4LA 2FR8A 5FF9A 2IYOA 4DIBA 1U8XX 4R54A 1Z7EA 1H6DA 4FD3A 2VSSA 2FPIA 4IXTA 4BMVA 5GY7A 1I3NA 3I6QA 3C24A 5H82A 1OBFO 1VPDA 2C29D 1LX6A 3WFJA 3GGPA 3ZHBA 3G3EA 1HDGO 1T2FA 2I6TA 4HWKA 3T7EA 3DL2A 5EQFA 4A7PA 1K3TA 5T8KA 4DGSA 4CV3A 3VIVA 1LBEA 4GQAA 2YHIB 4NZ9A 3ZZNA 4WCFA 1I30A 1TXGA 2C0CA 1IZ9A 4WLOA 4J4BA 3ONEA 1RJWA 1Q52A 3ZCXA 2ZQZA 1CEQA 4D3SA 2H6EA 5MDHA 4OKNA 1N6DA 1U1IA 2Z1NA 4D3FA 4WLUA 5DP2A 2ZYAA 4RDIA 4FFNA 2VSUF 1NHGA 1X0XA 2NV6A 3FWZA 3WSWA 4LVCA 1M75A 3H8VA 2ZIZA 1DAPA 2JAPA 1C1DB 3Q0JA 1PIWA 2ZCUA 1DPGA 2NU9A 8LDHA 3S2GA 4KUHA 4BNVA 3P85A 3KEQA 3WJAA 1D1SA 3OQ1A 5TT0A 2BI7A 2Q45A 3PTZA 1BDBA 3K8ZA 3S55A 4D0SA 2LDXA 2O50A 1Q7GA 3ZU3A 1KEWA 5DZKA 3K8XA 4OLQA 1OOEA 3HHPA 2GO1A 5JPIA 1QYWA 2BFOA 2PK3A 5C9GA 2VSSF 5KJEA 4XB1A 2A7KA 3R0OA 1HTBA 3FCOA 1I8TA 1PL8A 4DA9A 5I9NA 3T3WA 4J7UA 1ZMOA 3ZWNA 1BWSA 4UVHA 2YJZA 4RVHA 3ANMA 1HE3A 4NK5A 4BKRA 3GH3A 4LISA 3WYEA 4YJDA 2P2SA 3GMDA 1GU7A 1H6AA 3M1AA 3DZFA 2OORA 2AMFA 3ZWMA 3JD4A 3ZGYA 3DZKA 5AVOA 4J7CA 3D4OA 3GNQA 3KLMX 3GDOA 1HDRA 1CIVA 1Q0HA 3U49A 3RUCA 5E0NX 1TI7A 3AM4A 3ZW9A 2VT3A 4PFJA 2FP4A 1HRDA 3DQPA 1RJNA 4D45A 1R15A 1GV0A 2DFDA 4NBTA 1HZDA 3HB5X 5A03A 1WZIA 3Q7HA 3G1UA 5CP8A 3WQSB 2PBPA 3NDRA 5LDGA 3I4CA 1DSSG 4CR6A 5K6AC 2FW2A 3RIHA 1DHTA 3DTYA 4R1TA 2OP1A 4PLGA 4PVCA 2GTRA 3DFZA 1E3IA 4NQZA 3MTJA 2PPYA 1GEEA 1PJ4A 1J0XO 2WEKA 3B1KA 3E5RA 1U3TA 3JYNA 4OMUA 5FI5A 4ZGWA 3BMOB 3DBHA 4BMSA 4YCAA 3HDYA 3B20A 4UVIA 3SC4A 5CTCA 3ST9A 4B4WA 2G76A 5L95A 4JYLA 2PGJA 5A04A 4YJGB 1YL6A 4P4GA 2HMVA 2DLDA 4GPD1 5J23A 1R4NB 1HWYA 1FJHA 3PHGA 3GA0A 4RCVA 4ZA2A 4CR7A 2E37A 1ZK0A 2GASA 4UREA 1Q7BA 4XIYA 4B3JA 1IY8A 1Z75A 4YTEA 3UGKA 4E31A 4ONEA 1HLDA 2NM0A 4YRDA 1ZVMA 4CMEC 2D5AA 3GKBA 1Q2XA 5JSFA 3VVCA 1EMDA 2PNFA 4HKTA 4HFMA 4I08A 1JW9B 4XYLA 2Q46A 3CE6A 3VPSA 4U5QA 2Y1DA 3LK7A 1B16A 4J1NA 2G5CA 3EY4A 3OP4A 2DC1A 2AQHA 1K0UA 1N2SA 2B5VA 2ZB7A 4A0SA 4CLDA 4F3YA 1EVJA 2W90A 3A28A 1LUAA 3E9MA 3K73O 3RBZA 3VZRA 3KTKA 1B8UA 2XXBA 1MG5A 3IIEA 1JQBA 3I9MA 1G6KA 2VRCD 4DLBA 5A1TA 5JNLA 5INFA 3DOCA 3W8EA 1YDEA 1ZJYA 4NDNE 2WYVA 1BRMA 3KB6A 1NBOA 4NHEA 3I83A 4CMKA 2NU8A 2PZKA 3GF4A 3RC7A 4B8ZA 4TWRA 4IQ8A 3PRJA 3ETDA 1E3WB 3DOJA 4L74A 3ZWAA 3WQRA 4U0GA 4BNLA 2GZ1A 1UXJA 7ADHA 2VYVD 2W2LD 4BO6A 1H9BA 4PLPA 2EIHA 1UDCA 1R4NA 3K2EA 1CERA 3PJFA 2OOSA 3UF0A 5L4SA 4FN7A 4FFOA 1UP6A 3PDJA 3ZWVA 1U5CA 1OD2A 3N6RB 1BTOA 3SEFA 2HU2A 4RVFA 1B26A 5JYEA 4WCFB 3H4VA 3BMOA 3DBHB 2WYWA 3QQPA 5KWEA 1SBYA 5KKAA 4ZU3A 1F8GA 2JCYA 4YJHB 4F45A 3WIDA 3HSKA 3G17A 5C5IA 4X54A 4Y98A 1ML3A 3R6DA 1XA0A 3O9ZA 3WB9A 1Z74A 4EGFA 2B4QA 3PWKA 2YQ4A 1QP8A 3Q1LA 3S1LA 5L51A 4CUJA 2AG8A 3UCXA 4Z6KA 1ADFA 4FB5A 3ZHZA 1M6WA 3L4BC 3PLNA 3TV5A 4ALJA 4RPJA 5KVQA 1XELA 4FS3A 4XKJA 1N6FA 2TMDA 1NNUA 4KPKA 1PGQA 3ZNNA 1A72A 1DC6A 1V3UA 1PL7A 3FPLA 4WLFA 1IPEA 1EQ2A 3NTQA 1B8PA 1Y9AA 2H5LA 1KVSA 1PTJA 1GADO 5IN4A 3RI3A 4CV2A 1UYTA 4FB8A 1DLIA 2DU8A 1D4FA 2NQ8A 2TMGA 1P31A 2DVMA 2J5IB 2AXQA 3ICPA 3R3JA 3M2PA 4RVUA 2G17A 1NZYA 1K6IA 1XO6A 2BMAA 4OOEA 4KDFA 1CYDA 3FR7A 4RDHA 3LKEA 1F06A 5CAEA 6LDHA 1GR0A 2X0RA 5I8ZA 2YV3A 5IAAA 4ZHSA 1EEHA 1F17A 4EUEA 1ADBA 1PJBA 4ND3A 4Y9DA 1YONA 4BKOA 1HNUA 4PZEA 1OFGA 2VTDA 5TF4A 5CG2A 1Q0LA 1ZCJA 4NFSA 3TJRA 1NWCA 2YFQA 3QY9A 4NBUA 4OYRA 1EVIA 4NFHA 2JD1A 1JXZA 3LLSA 2JFGA 3D5QA 1EVZA 3I9NA 4JROA 3SX2A 4IZHA 3IS3A 4DTIA 1FDTA 1U4OA 4UUOA 2X0IA 3ZWCA 1OD4A 2Y0DA 1AHIA 1H5QA 2A4KA 5IF3A 1E0DA 1XHLA 4CMIA 2JL1A 4Z9YA 5FIFA 3V1UA 3JD0A 3L07A 4E30A 3GR6A 3QW2A 2IE0A 3PXXA 3FR8A 1XWFA 2ZB3A 3TOZA 2RAFA 2Y68A 3C1OA 3G1TA 1A7AA 1BGVA 1EBFA 2F00A 1K39A 1EK6A 3TDCA 1YJQA 3NJ4A 4N54A 5HTOA 4Z0TA 2VYND 3DJAA 2O3SA 1VKOA 1PGNA 1AN9A 1KC3A 1KEVA 3S8MA 4OSOA 4P8RA 5DBGA 1GAEO 5KIAA 1U4SA 3TT7A 3TN7A 4BO7A 1MP0A 2VNSA 3B6ZA 1K2WA 4FFLA 4JJFA 1ZSNA 5I7EA 2JHFA 4ZD6A 4C4OA 5COAA 5KVSA 4B3HA 4KQXA 4CMIB 3AU9A 1JA9A 3WMXA 5L53A 2J3IA 4MKXA 1H9AA 1K5HA 3JQFA 3OMLA 1OMOA 3QWBA 3ADOA 4I9NA 4P38A 2F9YA 3WTBA 3P5SA 3BMNB 3DMTA 4AJ1A 2VZ8A 3KYDB 4J9UE 1ONNA 1DOHA 2VUTA 1JAYA 1Y8RB 4ZDDA 1H94A 3E1KA 4LN1A 1AXGA 3ZHXA 4YAGA 4B8WA 4I52A 1O8CA 1LSJA 1PSDA 3JTMA 5THKA 3DZHA 1T2DA 3M1LA 5C90A 3DBRA 2PKQO 3GHHA 3U4HA 3QRWA 4NK4A 3GN2A 4LRTB 1R16A 2BFAA 1E7SA 4OIMA 4K6CA 3IKTA 4UUMA 4KNPA 2PKQP 2D8AA 4FNDA 2EGGA 2P9CA 2Y0CA 2VT2A 3KYCB 3OHSX 3HLN1 1X0VA 1DCIA 2FY8A 1ZEMA 3P19A 2EP7A 1ZZEA 4W9NA 4EI2A 1XCBA 2RHRA 2WWRA 4GVLA 3FDUA 4Q3NA 3P7MA 4EUHA 2CF6A 1FF9A 1LRLA 4R1SA 2H1SA 4FZWC 3S2FA 4E33A 3IUPA 4QTZA 1GL3A 2J3KA 4KWIA 1JN0A 1TVEA 2FRDA 5ER6A 3HDQA 4GX5A 1SAYA 3H5RA 1WW8A 1ONPA 2WD7B 4UEKA 4BO9A 2EG9A 2PG8A 1RM5A 2VCYA 4BO8A 2W98A 4JFCA 2YHUA 3V1TC 3JQAA 1HDOA 2GCGA 4NPCA 1N9GB 1YGYA 4II2A 3BTVA 2GERA 4O63O 4B4OA 4GX0A 3I23A 1YQXA 2SCUA 1Y6JA 1O8UA 4MVJG 4E2ZA 5ITWA 1V6AA 3LSYA 4L4SA 1KC1A 1DRUA 3NGXA 2VSUE 1XYGA 4A2CA 3RWBA 3MZ0A 3QYRA 3JQ8B 1P1KA 1EE9A 1E5QA 2RHCA 4NFYA 4PIVA 1E6WA 2ZYDA 2EP5A 3GUCA 3W4IA 1TEHA 4YJHA 4JSBA 1XQ1A 5L7YA 4RCNA 3VPGA 3TRIA 4YYZA 3NRCA 5HS6A 2DUWA 4JQCA 3ZWWA 4BNNA 5KOIA 1XX4A 3I4FA 2V6GA 4EUFA 1HF3A 2GR9A 1YVEI 3JD2A 4ZJUA 1GQ2A 3GMSA 4I42A 2GD1O 1KIFA 1LA2A 3F1LA 1DIGA 4MVJI 2YY7A 4BUCA 3PI7A 2F9YB 4XGIA 1QG6A 3K9QO 5IDXA 5A02A 3IKVA 5CPBA 1LSUA 3LC7O 2BFPA 2H9IA 1E92A 3LT2A 1LDNA 1MFPA 4CR8A 5DBIA 1OZAA 5ENVA 4GWGA 1XDWA 3RSTA 1MUUA 4BNTA 3NKLA 5TJHA 1DIHA 4RPHA 2PZJA 3F6YA 1XEAA 3TZCA 3EUWA 4J4TA 3VZSA 1R0SA 4RJTA 1NP3A 4JXKA 4CM9A 4Y6RA 4BO4A 4O6VA 2C59A 5G1QA 4E32A 1PQPA 4DYDA 4K3WA 4EYEA 4L76A 5JC1A 2A7SA 1W73A 5JYDA 1WDKA 3HINA 5DCUA 1NVMB 2AEMA 5DU6A 5EPOA 5T57A 2ZKLA 1LDYA 3JCZA 3X2EA 1NVGA 4LK5A 4FZWA 4J7XA 4MKRA 4F6CA 3O03A 3OH8A 1N8KA 4RVSA 9LDBA 4PLCA 3TOXA 1LU9A 2O4CA 3F4BA 2HMSA 1Z73A 1NQAO 5U4QA 3TRRA 1MC4A 3H65A 1I01A 4K26A 1XG5A 4HNKA 1E1LA 3GDFA 3DOOA 4R01A 3R9SA 4BNGA 1C1XA 2G0TA 1BG6A 1YG8A 1H6CA 5JAQA 5IDWA 2DUBA 3PVZA 2R2GA 3PYLA 5DZKH 3ZWXA 1PJCA 2I9PA 5TS3A 1NXQA 1MFZA 3ST7A 2EKQA 3W4KA 5JW6A 5DKPA 2QRKA 1W6UA 3OM9A 1VJ1A 2G82A 3IJPA 3JQEA 4IS2A 4RZHA 2OMEA 3P2OA 1WZ8A 2B37A 3H6KA 2FN7A 1PZGA 1ZUD1 3VH1A 2NLOA 3AWDA 3EK2A 1EVYA 4XZ3A 2RBEA 4DRYA 1BW9A 3JD1A 2W4QA 1DC4A 1A27A 1I2ZA 3RKRA 1D3AA 4EJ0A 4OMRA 3QWDA 3ANLA 3IBBA 2Y05A 2Q1UA 3I52A 5TSDA 2O7SA 1T2CA 2D1YA 2ILTA 1K6XA 2P68A 1U28A 5KVVA 4FOOA 3JQ9C 2BGLA 5KNLA 1QV7A 3K2BA 1YDWA 4YWJA 2ZJ0A 3E9NA 2UAGA 3MTGA 4TZTA 4E2YA 1E1KA 4XQEA 2WD7A 1RPNA 3WWYA 3H5NA 1E7RA 3H9GA 4QFCA 4ZRMA 3MT6A 4WOKA 3KM0A 2QRLA 4NBWA 4KD6A 5G0SA 4JJIA 1EDZA 1B8VA 1U8FO 4I9HA 4M89A 4TZKA 3RBXA 1VLLA 4FN8A 1O95A 4YT5A 4OSPA 1UR5A 3TL3A 3AUAA 4CM6A 3ROKA 3KLPX 4FC6A 3DZJA 3S2EA 1VC2A 3BMQB 5ICMA 1NM5A 4TRMA 4Y67A 5IFLA 2NU7A 2OZPA 3CSDA 2QW8A 2WJPA 3WGTA 3WS7A 2HW5A 2AW5A 3NT2A 4AJKA 4R41A 4DC1A 5IZ4A 3V5IA 1EF8A 3T89A 4BKPA 1PS9A 4DQXA 4YJFA 4PCVA 3GPDG 2ZB4A 2HUNA 1R66A 3EDMA 4RGBA 4AJOA 5IDQA 5CPFA 3N74A 4R5MA 2EEZA 2VZ0A 3FNGA 5COBA 4WASA 2OBNA 4LSWA 3RUDA 2NACA 3L6DA 4YACA 4R16A 1PWXA 1NPDA 4CV0A 4FBGA 3NGLA 3E9QA 2HQ1A 4E13A 4MKZA 4WLVA 3BMNA 4KOAA 4PLHA 2X24A 1C3VA 1B15A 1U7HA 1ENZA 3KETA 3ENNA 3ONFA 2GN4A 3B1JA 4MIYA 5CEEA 3ROPA 3T8BA 1VSUA 4BNHA 1EBUA 4INAA 1TYFA 2Y99A 4L9RA 1EY3A 1IYZA 4WUVA 4BV9A 3RUHA 4E5KA 5TC4A 5JCJD 3P2LA 4AJNA 3WBFA 5GMOA 1G1AA 3HB4X 4DI1A 1ID1A 3WMWA 4QEDA 5U9CA 2OL4A 3JQ9A 2BD0A 4JP3A 4YAJA 2NNLD 2H63A 2HJRA 5DT9A 1NVTA 1X7GA 3D1LA 3ZV5A 4Z0PA 4NMHA 3K96A 3Q3CA 3EAGA 2BHLA 3EYWA 4JCQA 4TVOA 3U4DA 1FDUA 2VHVA 2I3GA 1ULUA 1XQ6A 3KEOA 2Q49A 3AI3A 1BW9B 2O3UA 2P5YA 2CDCA 3FWNA 1UYSA 2NADA 3RSIA 1D7OA 3C8MA 3D64A 3MYBA 4EJ6A 3B70A 4WEOA 5KJCA 3GQVA 1H2HA 2O2SA 3FD8A 1CQJA 1N1GA 1X13A 4LMRA 4RYFH 3T8AA 1B0AA 5C7LO 1C1XB 3KTHA 2UVDA 2CVQA 1C0IA 5C37A 1KEUA 1T4BA 5F1KA 3ZV6A 2J6IA 2E4AA 3QVOA 3WYBA 2VOEA 3PEFA 3NV9A 4BKUA 1YB4A 4Q3AA 1MA0A 3VH2A 3Q2KA 1NR7A 4IJKA 2C07A 4NBVA 4CL8A 2OXIA 1W2XA 4JCSA 4YRBA 2IZ0A 3KSDO 3MJ4A 4M1QA 4PRLA 5K0ZA 1JAXA 5E0SH 5TGDA 2YDXA 4GH5A 2OGUA 4J4HA 4UAGA 5B12A 4YQZA 2P91A 3ABIA 1R12A 3TQHA 4TKLA 4RLSA 2DT5A 3RCBA 4U0HA 4OL9A 3ZW8A 5JFOA 5KDRA 3GK3A 5HBRA 1DFGA 3SXPA 4LSMA 3LAOA 4GI2A 1FDVA 3K30A 5T6BA 1ZEJA 4NJMA 4GKVA 5BR7A 2PGLA 1F0YA 4S3MA 4MP8A 4GL4A 3VHRA 1IB6A 2VSUA 4UVEA 5DN9A 1I2BA 1NASA 1IL0A 5BSGA 3BZUA 5DTPA 4NIMA 3RUAA 2JFHA 1YL5A 1JVBA 2VRBA 4U0KA 1P1JA 3IUSA 3VPFA 4A03A 1BHSA 3WIEA 2B69A 1LNQA 2YW9A 1MGOA 4XIJA 3FTPA 3RC2A 3WOHA 2VHZA 4J49A 3Q9UA 4ESOA 3HJAA 4J90A 4J6FA 3U9TB 3UAGA 4D42A 1VRGA 4CLRB 3EMKA 3GRKA 1XU7A 4WEQA 2CMDA 3QVXA 3TPCA 1GYQA 2AQKA 2HRZA 5DBFA 4PLZA 3M6MA 4MVJA 3TVWA 1YBMA 3NJBA 2DEOA 3VZPA 5JE8A 3U9SB 3HQ4O 4XJTA 1S6YA 4FGWA 5IN5A 4DBZA 2BZRA 1PGJA 4R1UA 2IEXA 2Y1GA 5FYDA 2I66A 2IZ1A 4TROA 3P5MA 1LDMA 5IG2A 3D3EA 1YS4A 2AQIA 2BI8A 3V5NA 3Q0GA 3QWHA 3IAHA 3EVTA 4PLTA 5KKCA 1DLJA 1KY5A 5I7FA 2PR2A 3UICA 4ZQGA 3WX0A 2NP9A 1PS8A 3H9JA 3ITKA 4XCVA 3X2FA 2DTDA 2AG5A 4B79A 3NAQA 3QLJA 1Y81A 2I99A 3GEGA 1QLJA 4J1SA 4D3DA 5HS4A 3BA1A 2CVZA 2P4QA 1HNOA 1WMAA 3CUKA 5DOZA 3RD5A 2B36A 1GUYA 1P3DA 4K28A 3WICA 4CLHA 4FJ0A 3ROQA 3HUDA 1P44A 2FBMA 3GFBA 4EZBA 4J16A 4ELXA 3AUUA 3PYXA 2GLXA 1F14A 1MV8A 5CDSA 3W6UA 5TT1A 1B2LA 3AM3A 1GCUA 4JGBA 1H0KA 3CMCO 4WKGA 5JXWA 3Q0EA 5JO0A 3VOSA 4MO2A 3OA0A 1B14A 1UYVA 3RC1A 3RFXA 2I65A 3DHNA 4IIVA 4BNMA 5TNXA 2R6JA 3KV3O 4R3WA 4CQLA 3EHEA 4Z3DA 3T88A 4CUZA 3I3OA 5CFZA 2NUAA 3ENKA 3E18A 4BO3A 2W2KB 5ES3A 4ZDCA 2PZLA 2ZTUA 4AJPA 3IQDB 4LK3A 3VH3A 3NEPX 1UZNA 3DBRB 3OJ0A 2ZJ1A 4ALIA 1BDMA 4O5OA 3JYLA 3KTGA 2J5SA 1YG6A 2Q1TA 2GGSA 3OQ6A 3WGZA 3HE2A 5AXCA 3WDSA 2NTJA 1S7CA 1UIYA 1PEDA 2Z5LA 3BHMA 4FW8A 4HV4A 3GNTA 3BF0A 4CM7A 3HDJA 4J1QA 2E6UX 3O26A 4D41A 3SLKA 4RLHA 4BNIA 3QKAA 5TJ9A 1K32A 4E2WA 2QYTA 4B4UA 4JN6B 5EN4A 4GAEA 3SBOA 5A4DA 1RYDA 4CLEA 5JLAA 4GVXA 1QSGA 1UXIA 5CG1A 1O5IA 1WAMA 4E0BA 2ZCVA 1E7WA 3AK4A 5AOVA 3ORFA 1TLTA 4II3A 4AJIA 2ZTLA 3RJ5A 4B3IA 3PJEA 4I8XA 4BB6A 3BIOA 3V1YA 4YLHA 1PS0A 2CF5A 3PGXA 1PJ2A 1B3RA 4L4RA 3ZWYA 1PJHA 2W8ZA 1FMCA 3SWXA 2OP0A 5EIOA 5JCXA 4R9RA 1NPYA 4R68A 1RJMA 5KVCA 1T24A 4J0EA 4BGUA 1WVGA 4LCEA 3ICCA 5JC8A 1GQYA 3R9TA 3WGHA 4A26A 3UHAA 1ARZA 2IZZA 3C7DB 3OECA 4WJZA 1QYCA 5DUCA 2C54A 4XDZA 4AG3A 5G0VA 4CLRA 1U3UA 1DBVO 2FOIA 4UUPA 4BNKA 4I4ZA 3QIVA 4FJ1A 4RL6A 2CDBA 1DUBA 3PLRA 5BSHA 1I2CA 3AOEC 4FC7A 1M66A 2X8LA 3BTUA 2W2LA 1LLDA 3T4EA 4R3NA 3TT6A 5IXYA 2W3PA 5DP1A 3LF2A 1ULSA 4M55A 4BO1A 3GG9A 4BNXA 1ZSVA 1P0CA 4XQGA 3ZNOA 4IS3A 3KZVA 4U6SA 3GAFA 3I9LA 1AHHA 3UVEA 3H5AA 2Z1MA 3CIFA 4EDFA 1XNWA 2A35A 1GDHA 4CMAA 2C2XA 3QMJA 5A9RA 1DO8A 3GGGA 4NJMB 2CD9A 2EWMA 4NH4A 1QRRA 3V5EA 5KDRB 4A73A 1NFFA 2GPTA 3PQDA 3STAA 2E48A 4QSMA 4QXMA 3ZU5A 3DZGA 1SPXA 4E5PA 3DMTC 2X86A 1O89A 4R9SA 2VSSE 1P1HA 4JIGA 5TRTA 4AJ4A 5CDUA 2NTNA 1LLUA 3INRA 3TDKA 1KEPA 2NVUA 3GOHA 3ITDA 1UH5A 2PGDA 4RF4A 1XKQA 4Q3EA 3WG9A 1TB4A 4YA6A 3IB9A 3FNEA 5EL0A 4L73A 3MJEA 2ZL4A 1KVRA 2X9GA 3I5MA 3PIIA 3ZV4A 3EGOA 5CTBA 3PHIA 4E2XA 4N5NA 1WWKA 3KTDA 4UUNA 1UP7A 2EW2A 1ZK3A 3PQEA 4QFEA 1PJ3A 2X0NA 4UEJA 3RQSA 2X9VA 4EJMA 3L9XA 5L7TA 3A06A 1T1RA 4IPTA 2X0JA 1UAYA 3JQAD 3ZDFA 3IAVA 3WTCA 4IZBA 3PP8A 2VWQA 3UUWA 4QO8A 3DHEA 3DBVO 1HYHA 2GYYA 1DFHA 2W2KA 4XEHA 5T5QA 5DU4A 1BVRA 5K6AA 4DXHA 4IDDA 1OC2A 3M6NA 3GGOA 1UDAA 1GFSA 3B1FA 3ASVA 4BNYA 3MWDB 4GLOA 2CDAA 4ZQFA 1LSOA 2P5UA 5I7SA 4M54A 2C7GA 5KTKA 5AXBA 3RKUA 1HSZA 4XR4A 3U09A 1OI7A 2GRAA 1XLTA 3DO5A 2B83A 1NR1A 1OC4A 4YR9A 4J0FA 2X58A 1E7YA 2DBZA 2X23A 2V6BA 1GCOA 2IODA 1KVQA 3FPCA 1UXHA 4YVFA 5G0TA 3ZWPA 4WECA 1B7GO 4YAIA 4BGEA 3EC7A 5I7VA 4QUKA 4JJGA 3VDQA 1U5AA 3PWZA 3HE3A 2DPGA 1M6HA 4BNZA 3H0QA 5F21A 2FSVA 2ZTVA 3HWRA 3JQCA 2PFGA 4IM7A 1LTHR 3EZYA 3CMMA 3OQBA 4CM1A 4Z3KA 3GFGA 3D0OA 2HCTA 3LF1A 4MP6A 4I5DA 4CMJA 2J3HA 4XQ9A 3PJGA 3PYMA 1ONOA 4CLOB 2AE1A 4LW8A 3RJ9A 1NTOA 2B4RO 2HMUA 3TVUA 1HLPA 3NJ8A 1SG4A 1ZFNA 3KYCA 4OG1A 4CODB 2J5GD 2BLLA 4YT4A 3RAJA 4CM9D 3ETGA 4S1VA 1U3VA 3L6OO 2V6FA 5BQFA 2PD4A 3U9RB 1CDOA 4F47A 1HE2A 4K29A 1YXMA 3FF4A 2YYYA 1Y5MA 3EW7A 3K92A 2G1UA 3GVCA 5ER9A 4I5GA 2YZ7A 5JAZA 3CPSA 1ZKMA 2PY6A 3PGJA 1E7QA 2D59A 4OXKA 2XF8A 1BVUA 4ILKA 5G1RA 5TX7A 2NVBA 1ZBQA 5B4UA 4BO2A 4IZCA 1X15A 4D43A 3RBVA 2Q50A 2IXAA 4YBZA 4Z9FA 1JKIA 5AXDA 2Y93A 1RKXA 1WXDA 2JFFA 1HE5A 3OIGA 3H3FA 5A3JA 5TLSA 4K9DA 3H0JA 3R6HA 2DFVA 1VI2A 4ZQHA 4EMMA 1VE9A 4ZN6A 1YJ8A 4IGEA 4J2OA 5L4LA 4OO3A 1ZMTA 2VN8A 2ZL2A 1BXGB 3VPXA 4TVBA 3UOGA 3WNVA 4J3FA 1XNYA 1Y7TA 3E6AA 1HDZA 1DIBA 3G79A 1A71A 1DEHA 4LGVA 1ZK4A 3IMFA 3JQBC 2A94A 1GUZA 1IHXA 3U62A 3IOYA 3L77A 3UH1A 4BGVA 4HNHA 4E6PA 3GPIA 1NFRA 3D4PA 3WGGA 3MJSA 4L0QA 4U8GA 9LDTA 4U18A 4KTTE 2PWZA 3GHYA 3GZNA 2CBYA 4YAKA 4BO5A 4BS9A 3QE3A 1YRLA 2VYVA 5L9AA 4JJTA 2UYYA 1CRWG 4RPKA 4MIEA 4RZIA 1I10A 2QZ9A 4RYFA 7MDHA 1KERA 3NT5A 4GWKA 3QXZA 3TWOA 1KY4A 1T1SA 2D5CA 4JNKA 1A9ZA 1HDYA 2FMUA 3MJVA 1PIXA 5DNAA 4OGWA 3KBOA 4RF2A 4D0RA 4NNQA 1C1DA 2XPCA 3ULKA 3W6ZA 2WE8A 4JP2A 1LXCA 1HSOA 3UW3A 5CEJA 2JHGA 3PZKA 4CMBA 2AQ8A 4XX0A 4D44A 1IZ0A 4ZDFA 1PJLA 1R6DA 3PE8A 4JBIA 1LI4A 3QHAA 4IJUA 3UXYA 4A10A 1VJTA 3LT4A 5A05A 3E8XA 4EW6A 1IE3A 1G0OA 1E77A 4EMPA 2GUGA 4MVJD 1WDLA 3F5SA 3DMYA 1ZK1A 1FDWA 3DORA 1J4AA 5GZ6A 4TMFA 1V9LA 2ZB8A 2GZ3A 2CVOA 2J5KA 3HZZA 2O4UX 4WCDA 3AOGA 3H81A 4CL3A 4GX2A 4IDAA 5A5FA 3LQFA 4IJVA 4FGSA 3QJ5A 1D1TA 1V35A 5C3MA 3WGYA 5L4NA 3AI1A 3TLFA 4QQRA 3DZIA 3JQGA 3L0DA 3C85A 3FBGA 1O6ZA 2FR1A 3D7LA 3F4LA 1EK5A 5I9MA 1E1MA 3F1KA 3FF6A 4OXNA 3OEYA 2VSUC 1FC6A 1W4ZA 1NQOA 4DUPA 1T4DA 5KJFA 4YT8A 5KCZA 3GF7A 2B35A 3D5TA 3IP1A 4U0JA 4JBHA 2O3QA 1OAAA 2DBVO 3OF2A 3U5TA 1M67A 3NTOA 4CM8A 4G2RA 1JDJA 3TSCA 1AXEA 3C1TA 3QREA 4OJNA 3N7UA 5AXAA 2VHXA 1Q0QA 2DTEA 3OSUA 4WE3A 3ZU2A 2GN9A 4IDCA 5L45A 2Q2VA 1JWAB 2IRWA 4BVAA 1ISJA 1MC5A 1NPTO 4NEKA 1KYQA 1MXHA 3PHLA 3R1IA 4RQUA 2VHWA 1DJNA 3S2IA 2JKVA 3BMCA 4N18A 5INIA 4TRNA 4H3VA 3TFQA 3GRPA 3ZNPA 4BL5A 4H16A 1R4MA 4CLOA 3I9KA 4HXYA 4KDEA 1XGKA 3C1AA 4ZDEA 4PG4A 3E48A 4MDHA 2EXXA 3HADA 4KTVE 2YV1A 3GT0A 1VL8A 5K9ZA 3DB2A 3H9UA 1DC5A 3RFTA 4EITA 1DIRA 4R51A 4BB5A 2Q2QA 2VWPA 3VTZA 3QA9A 2HK9A 1SB9A 1QKIA 3MOYA 4DL9A 1SZOA 1YWGO 3ZH2A 4FDAA 5FUSA 3H9EO 3NT4A 1Q7CA 3DDNA 4PZDA 3JQFC 4HY3A 1V8BA 4XR9A 1A9YA 3OFSA 4XYGA 5G2OA 4MPDA 3QWFA 3MOIA 1FXSA 4DPLA 3NUGA 2Q1SA 2VREA 2OUIA 1Y9EA 2ZL0A 1QYVA 3OBBA 1RM0A 1GYRA 3I9OA 4M87A 3PJDA 3W1VA 3WQQA 1SOWA 4CQMA 3A9WA 3MFMA 3OEWA 2AHRA 2X4GA 5LDHA 1GZ4A 1VL6A 2WSBA 3FHLA 4CMHA 2YFHA 3AM5A 1E6UA 1PZHA 4WNIA 5EINA 4PLYA 4RV9A 1CJCA 4ND5A 4D46A 1M2WA 1CF2O 2PA3A 4FPXA 4R5HA 1CQIA 1Y5RA 5JBIA 1Z45A 2WE7A 4KMSA 1FC7A 4DLLA 3BXXA 4JVTA 3PIDA 3JYOA 3U4CA 5G4LA 4YB8A 3NDJA 2C8TA 1GD1O 2EF1A 2HLPA 3FN4A 4U19A 4AICA 2PZMA 1H2BA 3O8QA 4O0LA 4AJ2A 3GEDA 2IEBA 4N5MA 3LVFO 3LC1O 5JY1A 1X0UA 1PQUA 5JMPA 1SNYA 1FC9A 2Y1OA 1Y1PA 4E12A 3GMAA 5CEFA 4OM8A 4B7CA 2QYSA 2C82A 1PR9A 4MVJP 4KWBA 3PFWO 1UYRA 1T2EA 4PRKA 4MINA 1LDGA 2HRBA 2AA3A 1GQQA 1X7DA 3WWZA 1I32A 3H2SA 2CNBA 3FNFA 3H9QA 3JV7A 2XAAA 3H0SA 2NSDA 4O59O 1QLHA 1E7MA 1WMBA 4IDBA 4IXWA 3Q2IA 5ENDA 4FQ8A 4ND2A 4R1NA 3RROA 3RU7A 3D4NA 2FSSA 1P33A 5JBXA 4BIIA 3KTJA 1L7EA 1V3VA 3AUSA 2Y67A 3R9QA 4UULA 4CM4B 3GN1A 4ROSA 1VM6A 2A92A 4NU5A 3IC5A 3DAGA 1NYTA 4KP7A 1ISGA 1GY8A 3Q1TA 2X1HA 4ASIA 3ZNQA 3FI9A 1I3MA 1WPQA 3DAFA 3H7AA 5BT9A 4FNBA 4QIIA 4P4NA 5G4KB 3PPIA 2UV8A 4CMCA 2I5PO 3H2ZA 2X5OA 1F12A 3GDGA 3NYWA 4PG6A 3BHIA 3ZU4A 5B4TA 3PGQA 1QXSA 5F1OA 2DAPA 5EERA 1EUZA 4XGKA 4MIOA 4NU6A 4RO0A 4RVDA 3GNSA 3KSZO 3F9IA 3H0UA 3G64A 1KBZA 1GZ6A 1X1EA 3GAZA 4NBRA 5C7OO 4F46A 3GVPA 4EBFA 1PQWA 1LQTA 1L1FA 4JX8A 1PJTA 4MVJH 1DB3A 5CDTA 4G5HA 2PH5A 4Y8VA 3HFGA 1NHWA 5G1SA 1HETA 1NZYB 2J5II 4OQZA 2ZQRA 3EVNA 1A7KA 4H7PA 4FR5A 4PGFA 3JQ7B 1SOVA 3HN2A 3V2HA 3RUEA 3AY3A 3D3WA 4MVJF 4CQMD 3WNQA 4FFMA 5F1PA 5JDCA 4L75A 2O3TA 3RUFA 2IEDA 3JYQA 5G0UA 4XA8A 5JAIA 2PD6A 3IJRA 1LEHA 2IDZA 5DL1A 3LC2O 4JWVA 4I5FA 4JYJA 1X7HA 1UAGA 3GVHA 1J49A 1GZ3A 2IXBA 1LLQA 4DIFA 1JLLA 3RC9A 3JQBA 4JOTA 1YQGA 1XU9A 1EUDA 1YBAA 1UDBA 2Q99A 4ZQBA 2QHXA 4Q1IA 4MOWA 1JVSA 1W8DA 1VL0A 1WNTA 4TRRA 3SJUA 1ZO8A 3QVSA 1PZEA 5FI3A 5BNFA 4EEXA 3F47A 2A9FA 2BF7A 2HK7A 1PWZA 2EW8A 3VH4A 4B4VA 3RVDA 1SEPA 2A81A 3OA2A 1P74A 2GF2A 2YUTA 1O0SA 6ADHA 4N7RA 2GDZA 4JK3A 3AUTA 4FCCA 4IQ0A 2OFPA 3G49A 2HJSA 1R0LA 5IDYA 4KZPA 3LT1A 1FK8A 3AFNA 2Y0EA 5DCYA 5JDIA 4D79A 4CQLB 4HNGA 2C7VA 3QSGA 2JCXA 4TKMA 4DPKA 4WZ8B 5BSFA 1P1RA 1ISFA 3QK8A 4WNCA 1Y8RA 3OETA 2BRUA 3KXDA 3RFVA 3KYDA 3GUYA 5B1YA 1RWBA 3G0OA 4BGIA 2POQX 5DZSA 5HA5A 5EMHA 5EJ2A 5HRUA 1N7GA 1C14A 4I5EA 4FJWD 4FN4A 3AY7A 3PWSA 4U6QA 1YKFA 1KVUA 1BXZA 3QVWA 2HDHA 1PU2A 4IGFA 5TIIA 2WMDA 2X7HA 1IUKA 2ZYGA 2VTEA 5I8WA 2C2YA 1N5DA 2FZSA 3NJDA 4YT2A 1JKJA 2C5AA 4FFRA 1NQ5A 3K6JA 1TT5B 3KSUA 4WK6A 4OKIA 1YOVA 3OIFA 1P1IA 2EHDA 3AU8A 3JQDA 4BNFA 2R00C 5DUFA 3DZBA 4CPDA 1ZJZA 4OAQA 2HSDA 3KHUA 1GPJA 4K2NA 2D2IA 4C7KA 5JS6A 1MLDA 1O9BA 1SCUA 2EJWA 3D3WB 1E3LA 4IIUA 4PLVA 5GZ1A 1GPDG 5F5LA 1GYPA 5ITVA 3WYCA 4GM2A 3VC7A 4IJWA 2NTVA 2UDPA 2RCYA 3E5MA 2QIOA 5JAMA 2JD2A 4I1IA 1ZH8A 1GUFA 1LRJA 1TA4A 3O8QB 2I76A 4YJGA 2X5KO 2OBYA 2DBRA 4BV8A 4RPLA 5KJPA 1T2AA 2EJVA 4AJHA 2Q1WA 4YQYA 3BTOA 5TQVA 3WR5A 4QX6A 3C3XA 1Z82A 3LYLA 4W6ZA 3BHJA 3LZ6A 3BEZA 3CXRA 2O3RA 3ZWOA 4CV1A 5MGBA 4NI5A 2CE3A 3O38A 4HFNA 4W99A 2UZFA 3HRXA 4FSHA 1QV6A 5I9LA 5U1PA 3JQ8A 4L8VA 2C5EA 2D0IA 3TNLA 2QG4A 2PKRA 4IQGA 4CQMB 3OJOA 4LVUA 2FZWA 1XSEA 4XWYA 1E5LA 4DVJA 2OHXA 2OO5A 1P77A 3H02A 4LRSB 1QORA 1PZFA 2Q2XA 1N9GA 4DREA 3IL2A 2IYPA 4UEOA 4K1LA 4W7HA 4QIJA 2EKLA 1VJ0A 2HO5A 2F1KA 3ANNA 4G81A 1HDXA 1DDOA 2CY0A 4DYVA 3DFUA 1NX6A 3FSRA 3WBBA 1HEUA 1ISMA 2Y1EA 4E5YA 2Q3EA 1U2DA 1UP4A 2BH9A 1AE1A 4DIOA 4DQUA 1NQTA 4WLNA 1SC6A 4YAEA 3MOGA 2WD8A 4QO7A 1XR3A 4GBJA 2PD3A 3VDRA 4A5OA 3HP0A 1HZJA 3OC7A 3K31A 1EF9A 4ELWA 4Q39A 5ILOA 2FHSA 3K5PA 2F6IA 3I1JA 1Z6ZA 4GGOA 4MVJE 3U3XA 5A9SB 4R4JA 1RM3A 5FFFA 5B4VA 2NVWA 2F9IA 3T4XA 2B0JA 3M2TA 5CDGA 4GMFA 1U2GA 3SLGA 2VOJA 3W8FA 4KUEA 2X9NA 1TT7A 4HBGA 4QFDA 3HFSA 1ZW1A 1ZSYA 2JD0A 2XOXA 1KS9A 4AJLA 2QQ5A 4ZICA 3UN1A 2V65A 1XNVA 1WP4A 3OICA 4W82A 4YDRA 1T26A 3DXFA 5DTWA 4UVGA 4XYMA 4FJ2A 3E82A 3TZHA 3L6EA 4L4XA 4MXIA 4CLXA 4HP8A 4JLWA 4NNJA 2P9GA 5LCXA 3MCVA 2DUUA 2YHIA 2WYUA 5AYVA 3V8BA 1B3BA 2PH3A 3WLFA 3RSHA 5ICSA 2E49A 1W0CA 2RH8A 3CTMA 2CUKA 4PLFA 3ZV3A 1ENOA 1ISHA 1R0KA 3KYBA 4MP3A 1DRVA 4ZDBA 1GTMA 2LDBA 2R00A 5A9SA 1Y8QB 4ITUA 2Q34A 4KQWA 5F3RA 5L40A 4ALLA 4GSLA 3GZ4A 4Q3BA 4XDYA 5DF1A 1WLYA 4J1TA 4FOSA 1PX0A 4BNWA 2D4AA 4J43A 2J5RA 2I3AA 1IOLA 4EEZA 1D8AA 1DIAA 3JYPA 3SLLA 3WXBA 1ZXBA 1KETA 1O94A 1R37A 4P22A 1H93A 2O3JA 1HZZA 2YV2A 4Q9NA 1YO6A 4ZU2A 2J5QA 3K50A 1ZNQO 4O1MA 2GN6A 1UXKA 1ZIDA 5ADHA 3OMEA 2V7PA 4GHNA 2ZQYA 4BO0A 3L3SA 3PFFA 3FRJA 1LJ8A 4DBVO 1X14A 2EJ5A 1AGNA 1DHRA 4GLLA 3CZRA 1ENPA 3IDSA 4RORA 3ASUA 5A3VA 2Y66A 4ID9A 4MJLA 3W4JA 4Z9XA 3WGQA 5BNTA 2D3TA 2BKAA 3JSAA 1SO8A 3AI2A 4B7XA 4YXFA 4CMGA 2O23A 2XXJA 3ZWBA 4BQRA 2DPHA 5A5EA 3FNHA 1MJ3A 1DFIA 3MWEB 4HFRA 4M49A 2JJYA 1UXGA 4EMLA 1CETA 4IDFA 4PG7A 5IXSA 3V2UA 4IDEA 3AFMA 3W8DA 1YB1A 4JCTA 1ADCA 3TZQA 2X6TA 3UFXA 1F8FA 2ET6A 2Z95A 3H3JA 4IZIA 2HK8A 3DWFA 3PZRA 4CM8B 5JO9A 2J5IA 4C7JA 2BELA 1VKNA 2PTGA 4ALMA 3LT0A 4ND1A 3INTA 4XRGA 1I0ZA 1LDEA 1P9LA 4W4TA 1JWBB 1G0NA 1NAHA 1HYGA 2JCVA 2EGHA 4OQYA 1V0JA 2FZEA 2VUSA 5JCJA 1NAIA 2V6MA 1ZXLA 2VZ9A 3WGOA 4KUGA 2PV7A 3PHHA 2NVUB 1BSVA 1RM4A 3VVBA 4BNJA 5INGA 3WGIA 3LU1A 1A4IA 1N7HA 1E1NA 4Z0HO 2QX7A 2JAHA 1PJSA 1K6JA 2UUPA 3Q11A 4XJSA 5KJ1A 1C0LA 1LC3A 5BSEA 4OOFA 4N5LA 2J8ZA 1HE4A 3PHJA 4MVJM 5IJZA 4E21A 1E6EA 4W9NC 4GSKA 4XRRA 1C0PA 3JQ7A 4PVDA 4CUKA 3LLVA 1QR6A 3EZLA 2GNAA 1EFKA 3QWAA 1X1TA 1C0KA 1EDOA 3GG2A 5KJ6A 3OT6A 1R4MB 3AJRA 1IHYA 3PZBA 4JCOA 4LMPA 3I47A 3KTIA 4DQVA 3AW9A 2BGMA 3A4VA 4IUYA 2WTBA 1YBVA 3ROMA 3UCEA 3U9LA 2Q35A 5C7IO 4WYOB 2O7QA 4Q3CA 5E0SA 3GVXA 4B7UA 1GEGA 4IY1A 5DOVA 4HC8A 3CKYA 4Y6SA 3SC6A 4GKBA 1Q51A 2NU6A 3MEQA 4DPMA 1IPFA 5T64A 3QXIA 2EERA 4KWHA 4XYBA 2RIRA 5H83A 4U1AA 1P45A 1M76A 1EZ4A 2FPGA 5F5NA 4CMEA 5L7WA 3Q9NA 1DC3A 5T8KC 3GLMA 1E3WA 2DKNA 1JU9A 5G4KA 5IZCC 5B37A 1E3JA 1PGOA 2HMWA 2AE2A 3OIDA 4DMLA 1ORRA 3BAZA 1UZLA 2NQTA 1LQUA 1J5PA 2QZZA 3GC6A 1PJQA 1PL6A 2CFCA 1HXHA 4F6LA 3NX4A 4D7AA 4NG5A 2FWMX 1YQDA 3DONA 3NTRA 5EESA 3ZN2A 4XD2A 1Q1NA 4IMPA 4HX5A 4IZDA 3I6IA 1U9JA 2VHYA 1RYEA 5JBWA 1Y7OA 3DR3A 3DTTA 3GF3A 3M6IA 2FR0A 1H6BA 4K6FA 1HT0A 4WGGA 3WLEA 3TFOA 1FCFA 4Q3DA 1UJMA 4WLEA 2DBQA 4RQTA 4BMNA 1J6UA 3KQFA 1BMDA 3KVOA 1ADGA 1KVTA 5JDCC 3SVTA 3BPPA 4R69A 4ELSA 4XB2A 1EUCA 3KUXA 1L7DA 3WFIA 1ENYA 4IDGA 4PLWA 1QYDA 4AL4A 4J2HA 3ISAA 3VKUA 3FTNA 4CM3A 4NR0A 4IINA 3I9JA 2FPPA 2I67A 5IKLB 3BTSA 4RF5A 2QQ3A 1LSSA 1MB4A 1QYXA 2WM3A 4DC0A 3AY6A 3SJ7A 4E4YA 1YB5A 3JU1A 2VX2A 3N58A 1PGPA 4LCJA 5EQDA 3TZ3A 1WDMA 1YH3A 2VRCA 3UCFA 5CDYA 2HAEA 1E3EA 4W7IA 3PQFA 2RH4A 1I24A 1UUFA 1SZJG 4BKQA 4YPOA 2BGKA 3QWIA 3JD3A 1ON3A 1HDCA 2ZTMA 1A5ZA 4ND4A 4TSKA 2PLAA 2NWQA 4ZQEA 5IZCA 5A9TA 3BYZA 4GGPA 2O48X 4XQCA 3INGA 2O2YA 3KOUA 3U0BA 3IP3A 3UKOA 4CM5A 3FBTA 4J9VA 4DWVA 4WPGA 3KO8A 5HM8A 1N6EA 1XIVA 3JQAB 3KRTA 2Y1CA 1TT5A 1YE3A 4RVGA 4CM4A 4E5NA 4WOJA 3STHA 4OHUA 2YDYA 1SEVA 3LDHA 3OJEA 1U3WA 1P1FA 3TZKA 2F9IB 4Z0MA 4Y6PA 2EV9A 2VUUA 2B4TO 2ZL3A 2DQ4A 2B5WA 4CJXA 4WCFC 2QRJA 1Z7BA 2GZ2A 1I5RA 1BXGA 3TL2A 4YRAA 1J7XA 4G2NA 1JTVA 5HWSA 4RF3A 5L3ZA 2X22A 2J3JA 3MJCA 5BNIA 4BNUA 5JMWA 3DAPA 3Q6IA 1Y8QA 3OJLA 4URFA 1YL7A 4JCRA 3P2YA 4U0GH 1MX3A 3BMCB 2P9EA 3RASA 2EKPA 1V3TA 3NDIA 5FWNA 4Q0GA 1FDSA 4DLAA 4XYEA 4JBGA 5CHEA 2C20A 2VYNA 3F46A 4GX1A 3WJ7A 2VNAA 1LC0A 2ZATA 4OH1A 5GZ3A 3CZMA 3OJFA 2E82A 4PZCA 3COSA 4UVDA 3L9WA 4M8SA 5ILGA 3VZQA 4YJFB 5A06A 2VWGA 4L8KA 4ZVVA 3C7AA
chains in the Genus database with same CATH superfamily
4MTLA 1EVLA 5LC1A 5BOSB 4LHXA 1VBNA 5E6SB 2IEGA 2W83A 5H81A 5DTQA 2Q4EA 3ZE1B 4BLVA 4D2IA 1MXFA 2HDOA 3WVNA 2OSBA 721PA 1IULA 4TS3A 2EQAA 1FP4B 1C41A 1P9OA 3VC3A 3WGVA 1TF7A 1SB8A 1U9IC 4JB0A 3LIPA 3O4VA 3FKSD 1RHQA 2W2MA 1IBLB 4M1TA 1PR3A 3I5YA 6CHYA 2DG2A 1ZWLA 2IBSA 2V7TA 3F3SA 1CY8A 3I8OA 3N0VA 4FCTA 3W6OA 3ZHYA 2RSLA 2IW3A 1RVV1 4OJKA 5THQA 5K0JA 2H31A 1TIBA 2WUVA 3KJGA 3VTFA 4DR5B 5BV1A 1H5UA 3ICQB 1KGSA 2V9CA 5LXTF 1O95C 3P20A 2AEJA 4IH9A 4X6UA 2XDQB 4MR8A 3ZQ4A 1QTRA 4IMJB 3OIWA 1NFQA 3X3HA 4QT0A 4AYTA 4AXXA 4MPRA 1G8SA 2UUOA 1AKEA 1EM6A 5KCMA 3STYA 4D3YA 2HMTA 3TSWA 4PPFA 4K87A 2QI9C 1LVUA 2V4UA 3D1VA 3DZCA 2J0UB 2ZBQA 5JFGA 3O4RA 3IAM1 3GLIE 3RNLA 1NVKA 4ALKA 2ANBA 5HDQA 3WL6A 1QO0A 4MVWA 1ISIA 3ZX4A 5DU8A 1YBHA 2ZK7A 3R7DA 1DVRA 2QN7A 3NGMA 1U7TA 3L4BA 4YUAA 3PJRA 3QVTA 5LBIA 3OQIB 5M5BA 3BCSA 1ESCA 3EC1A 5JLJA 2MCFA 4HDMB 1A9TA 2ZANA 3H5VA 2XMZA 2BEWB 1GGJA 2RK6A 7AT1A 1LPMA 2J45A 1KI6B 2IYNA 2JHPA 5CB4B 1Y0BA 4DEXA 1LRKA 2PUGA 5B2EA 1JFRA 1IDN1 2Q4BA 4UTXA 5IJ0B 1W93A 1A97A 1LPPA 1QFXA 1BE8A 2DM6A 4F72A 5EJ4A 1S3GA 1RBQA 4M2LA 2WG0A 4R9UC 4MI2A 2C8VA 2CJPA 3F7TA 3FGZA 3HJUA 1FVXA 1KAMA 2PX5A 5CHYA 3CEJA 1L4UA 2GN8A 4HT3B 3I09A 1C1HA 1CWUA 3AEYA 4HB3A 2MSDB 3UB3A 4HVCA 4WA8A 3VO8A 4J91A 1TG6A 3IUEA 4GL2A 4FFPA 1AZTA 2W4MA 1AQIA 5AVZA 1NP6A 1XA3A 4RKFA 4OLBA 1FXUA 1QHFA 2YUIA 1ZK2A 1THZA 4RK0A 4ZRNA 5FWYB 4IYJA 4JXXA 3GY0A 4OHCA 1AF7A 5GOZA 4BFWA 4HGPA 3D2BA 5JZ9A 1TGYA 4NYMQ 1Z15A 1XZHA 2BW0A 4XFKA 2B8JA 1M34A 3ZVMA 1G5HA 3MJTA 3OU2A 4OFWA 1BGXT 3ON5A 4KIGA 1U9CA 2XZTA 3F5QA 1YOVB 4LXIA 1DAOA 2IHZA 1LPOA 1T0HB 3E3LA 1P2DA 4KIUA 4IICA 4BRZA 2FR8A 4X1KA 2IYOA 2H2HA 1CIJA 4JOQA 4WJKB 4PCLA 1Z7EA 1H6DA 5FNVF 3DCIA 5T6MA 2CWDA 4F38A 1L7AA 4BMVA 4IH4A 1FYDA 4RABA 5GY7A 4RK4A 2WVHA 1X1SA 4P0TA 4E5DA 4EQ6B 4ZREA 1R74A 1LF0A 3ZHBA 2Y4OA 4DRXB 2I6TA 2PKYX 4HWKA 4FD2A 1ST3A 3CRRA 3DL2A 3EBOA 4OY3A 3U13A 2O14A 4OHPA 1R8SA 5T8KA 2GCOA 2R1TA 4G0PA 1LBEA 5LOVF 1W4CA 4NZ9A 2NAFA 2C0CA 2JJ2A 2OGSA 5LYYA 3ZDBA 3IVRA 3MWKA 1CEQA 3FHTA 1D8TA 1EGVB 2H6EA 3ACDA 1NI4A 4BTLA 4YRKA 1N6NA 3CUTA 2Z1NA 1N6DA 3MTQA 4D3FA 3B9BA 1LS1A 1PG2A 4HH1A 5EI5A 3CO0S 5DN6A 1KP3A 1VSQA 3TTTA 3WBJA 1NHGA 2ZRMA 1ZM4A 3MN1A 5EKSA 5EZQA 2Q62A 4D26A 3WSWA 2XNKA 4J0JA 4LVCA 1M75A 2ADMA 4PIPA 3DUFB 5JCPA 4WKBA 2M6LA 5C34B 1DAPA 1EX7A 1FA9A 4NICA 1HOTA 4BQSA 2P30A 4NYMR 3S2GA 4QPZA 3P85A 3KEQA 1D1SA 3E3OA 2KLHA 2O2EA 3OQ1A 5IKMA 5EVJA 3K8ZA 4WZBB 4XIIA 3MT6A 4D0SA 2P2NA 4DS3A 1DXHA 4FHCA 3L04A 5GJWC 4LE0A 4ROTA 5BN5B 1RJGA 2QU7A 5DZKA 3AJEA 4V1CB 4C2AA 4TKVB 1CRLA 1WXHA 2O0HA 1QYWA 2BFOA 1GILA 1BOOA 1JIKA 1SUIA 2OXFA 2PK3A 4L85A 4U63A 1KO1A 2HLNA 3FIJA 1F6DA 1VYHA 1P2UA 1ZS9A 1KE1A 1NLFA 4B3CA 1LD3A 1I8TA 2XTZA 5CW1A 1OIWA 5E1DA 1ZMXA 3T3WA 1ZMOA 3ZWNA 2BHSA 4UVHA 5JMOA 4RVHA 3KTAB 3AVPA 3ANMA 1QVZA 3BT7A 4HJRA 3WYEA 1T5SA 4MUIA 2BFEA 4GXRA 4QNNA 2R79A 1GG9A 2AMFA 3A0UA 1A04A 4S12A 4IDQA 1XAGA 3D4OA 3GNQA 5B6IA 3GDOA 4OP2A 3DQQA 2Z98A 1YASA 5AM2A 1RRGA 3WMGA 5AP9A 2FDXA 1TZMA 3AM4A 3WV5A 2R0QC 4EUNA 2FP4A 2OD2A 4BJ3A 3OURA 1E1RA 1EHIA 5JXIA 3QX8A 1EXDA 2DERA 3HB5X 3NMUF 1OFHA 4OKSA 2GJKA 4CIBA 2JI6A 3GL9A 3WQSB 4RTMA 2PBPA 1D9XA 1FP2A 2XVXA 3H99A 3I4CA 2NYAA 4R8KA 3B2NA 3G5MA 1C30A 2ONCA 4LDZA 3RIHA 4C14A 4PVCA 4PLGA 2P90A 3IB3A 3X1KA 4FDUA 4AK9A 4EAQA 1TEXA 5FWXB 2CV2A 3OWXA 3EMBA 4FBLA 2XRYA 3MYYA 4HO1X 4RCYA 4C4AA 3A6PC 4BMSA 2X2FA 3PGVA 4EJSC 4YCAA 3HDYA 1LPAB 3PE4A 2Y9ZA 5CTCA 3ST9A 2G76A 1A8QA 4DMHA 4X1YA 3FTFA 1RRVA 1YL6A 4GPD1 5J23A 1CS0A 2BFCB 2QUIA 3M1IA 3M5WA 4TTAA 2GFIA 3GA0A 2E9SA 2KPOA 4N39A 1A98A 3RTEA 1ETUA 2CXNA 2CCKA 1D5CA 1LCIA 1UM9A 4Q03A 5J4YA 3D3NA 1TZJA 4XIYA 5IARA 5K8LA 2W6PA 1IY8A 4J0IA 2WTAA 4B31A 5FFNA 1VTKA 2NO7A 3UGKA 4E31A 4FNOA 4ONEA 4DZZA 1XZCA 5K3EA 3Q3IA 1S2MA 1RACA 4CKEB 4CMEC 4JI8B 2XDAA 3C15C 3BORA 2PT5A 3JXEA 1WPRA 3PCXA 1DL5A 2PNFA 2V6IA 3ECSA 4HKTA 2FA9A 1LF5A 1QG2A 1QF6A 4XARA 1SVOA 1XMIA 2P9TA 3QVJA 2NG1A 2Y1DA 3LK7A 2HHAA 3OTQA 1JBQA 4J1NA 2G5CA 4UTRA 1R0YA 1W4LA 1UFKA 5F33A 3LVQE 2DC1A 3RRYA 1RJEA 3PNQA 1T1IA 1WPXA 2WYOA 1N2SA 3QXGA 1GCGA 1HG0A 2W90A 4NCAA 3E9MA 2OQ2A 4EG0A 2OECA 5DLPA 2CXTA 2FPOA 2DPMA 4YI3A 5FPPA 1JQBA 3C5CA 2HDNB 3ABZA 5B1IA 3TI7A 3HFJA 2DKFA 4CT0A 2WM2A 2J09A 2WT9A 2O2HA 1R6XA 4L2IA 3NRBA 2WK1A 3W8EA 7REQA 1RE0A 4CMKA 2HSGA 4RMNA 5A4IS 4HWTA 4QLAA 4ESHA 2PZKA 3RC7A 2HEIA 2Q07A 2QDKA 4LDPA 4U7TB 2Q9CA 4FUTA 5IULC 3WQRA 4U0GA 3NBYC 4PTZA 5FV4A 5LDDC 1J7JA 2PUHA 1UXJA 3N59A 4AN1A 4DR4B 5TPZD 5ERGB 2Y76A 2VYVD 2OPHA 4BO6A 3L41A 3TS1A 3NOOA 2EIHA 3EZ9A 1RZRD 2DHRA 2WFLA 1SOUA 1RAFA 2OOSA 1D4OA 2FAXA 2Z0MA 3L3BA 3SFZA 4GHWA 4F92B 3F2IA 1FDOA 1WU7A 2AWOA 4AAYA 3N8GA 3ZWVA 1U5CA 4G1CA 3X0DA 1P9WA 5IJ9A 4NAUA 1QKKA 1THTA 2HU2A 4RVFA 3T9DA 5JR3A 5DHTA 3B12A 5JYEA 1E2LA 3QQPA 5BSMA 4GBED 1SHLA 4F84A 2A88A 3WIDA 3LDAA 4JY7A 3UBMA 2AOWA 4BVKA 4CI9A 2VJMB 2BEKA 2GVNA 2PWPA 3LBFA 4Y98A 5C5IA 1HDEA 2ZR9A 2CJYA 4WY2A 5JEDA 4FWIB 1C2TA 3C6YA 4BFXA 1Y7LA 3PWKA 1B43A 1U7XA 4ENRA 1WBBA 3Q1LA 3QITA 3A25A 1WB5A 1OYOA 3U7GA 3UCXA 2YRXA 2OCXA 5A4AA 1PVVA 3RIXA 3TV5A 1M6WA 5TXGA 2P2YA 3MELA 4X1KB 4D4LA 2WABA 4JP1A 3AB7A 1CE8B 1UOPA 2P2GA 1N6FA 1KAQA 2YCBA 4XX1A 3ND9A 5DGTA 1AS2A 1PGQA 3ZNNA 3ZUGA 1XCJA 3T8YA 4Z0NA 4FB4A 3IR7A 4B80A 3IPRA 3PICA 3DT6A 3JS5A 5HEKA 4B6RA 2HT1A 1ODCA 2FEKA 3NPMA 2R8PA 1F1JA 2NW6A 1GADO 3BIXA 3PXBA 4QUHA 5C5EA 4CV2A 2UZAA 3SBXA 4CE6A 5AW8A 2OO7A 1D4FA 4HYTA 2TMGA 4PYKA 5E9AA 3PHCA 4DM4A 2J5IB 1DAFA 2COEA 5KYYB 2Z4RA 1KL7A 2RHMA 1IJEA 4S35A 3DEJA 3M2PA 3MWFA 3WGLA 2ADOA 1W0JD 3LO5A 3NXSA 1XV5A 3CU5A 1U8YA 3CGGA 3O7WA 4MEBA 3KAJA 4MZDA 4PYQA 5FUBA 4KDFA 4LECA 1FZQA 1W5AA 1Z6PA 3A1DA 2R25B 5FA6A 3VMFA 1QRAA 4G0XA 3U19A 3KKNA 2D74A 3PI6A 4DQDA 5CAEA 6LDHA 3DKKA 4GR5A 3MWEA 1Z88A 2A9JA 3U0VA 2X0RA 2IXDA 3SEAA 2FFJA 4ZHSA 1JDTA 1EEHA 1MGPA 1F17A 2COUA 1R8JA 1E1QD 3B53X 3NHSA 1ADBA 1PJBA 1U2SA 1Y7HA 3LW7A 4L3VA 1YONA 4NARA 4ND3A 4MGZR 4Y9DA 4NYIR 3S99A 1GUBA 3LK6A 5TF4A 4Z1MD 1X1RA 1Q0LA 5CG2A 4NFSA 4DM7A 2WYIA 3QPWA 1YBFA 4NBUA 1H2FA 1EIWA 1TM7E 2G28A 1ODLA 2GTHA 2JD1A 2V8OA 3IE2A 4N40A 1XE3A 5ED0A 3RHZA 3LLSA 1LQ2A 2HA0A 5LP1A 3FMGA 1EVZA 3AR9A 3DFKA 3M6LA 5EZYB 3U2QA 2V7QA 1WCWA 3DDWA 1GQOA 3IS3A 3MIIA 3OE7D 1WNFA 1U4OA 4AZ3B 3AF6A 4FWTA 1KDOA 1RD4A 2C9DA 1AHIA 1I4LD 3BWYA 4KQMA 3PFHA 4MB0A 1EU1A 3JPWA 5FPTA 3UENA 4ARUA 2JVIA 5CD1A 4RFSB 4UPVA 4RHEA 3ZBPA 4LQDA 3T3MB 3FR8A 5J2TA 4IXNA 3GEIA 2WNHA 3WRVA 1D6JA 2PPLA 1UC9A 1EBFA 4YV7A 2QNBA 4U3JB 2GA9A 4PX9A 4F1WA 1OAOA 3TDCA 1Y48E 3U9TB 5HTOA 1YQQA 2G04A 1F2UA 3M6AA 1GPNA 2EBUA 2A58A 2O3SA 3SM9A 1PGNA 1AN9A 2YS6A 5A2GA 5HQ3B 1Y6FA 4OSOA 3VPAA 1MO5A 4P8RA 4UOQA 5DBGA 5KDLA 1QRTA 3GLHB 1QCCA 3BCHA 4ZU6X 3IA2A 1NRXA 4QM7A 3KWFA 2PFKA 4JJFA 4BU1A 3U4MA 1FMTA 4ARBA 2ROQA 3E58A 1IPHA 4RTNA 1YZFA 4MI6A 4CMIB 3UXHA 3AU9A 3THXB 2XSZA 4MKXA 1K5HA 2F9YA 3ADOA 3NB0A 5AESA 3P5SA 4X84A 5E6SA 4IIBA 3ZK9A 3KYDB 3QOYA 2NP7A 1R2QA 2ZUCA 1JAYA 1P7CA 1WTAA 3UJ3X 1L5FA 5B7QA 4WMLA 1YZNA 2GPWA 3ZK7A 1JHQA 1I2MA 4B6QA 4EB8A 1YU6A 1LSJA 4ENPA 3T15A 1T2DA 2Q4OA 4FTWA 3DBRA 4K9QA 5B57C 1ODSA 4HZIA 1D4ZA 2VP3A 3GARA 2VBFA 2ZSDA 2C0QA 1OAOC 2DH5A 3QRWA 4LRTB 1FFWA 3PA8A 1PAUA 3QE9Y 4F96A 5CT9A 4K6CA 2PS1A 1JU3A 1CULC 3RS5A 2C3UA 4KEAA 4UHCA 4UJ5A 4UUMA 3V7NA 3W5BA 1PE0A 3FZEA 4Z7OB 1ZM9A 2V55B 5D2CA 4K8RB 1X0VA 4B0OA 4LHWA 2EP7A 4OP3A 4R8VA 1ZZEA 4QPCA 2EFCB 1T10A 2RHRA 2WWRA 3UT5A 5KYNA 5FOUA 3FDUA 3P7MA 3LQ4A 2CF6A 3EXHB 3OQJA 3IUQA 5C90A 1MRZA 2VO1A 2IX9A 4QUDA 4GOLD 1GLGA 3IELA 5C80A 3ED1A 1JN0A 3PT5A 1IBRA 4WV3A 3AL0C 1JFVA 4GX5A 2J0UA 2IYEA 1SAYA 3X44A 1O9HA 1JYSA 3KSAC 3OZIA 3FETA 2JFUA 2ZUSA 4JC8A 3KTAA 5DWQA 5AW1A 1VB5A 1G20A 2VCYA 2ZT6A 2PGNA 3ZE7A 5BMVB 4JFCA 4KGDA 1P73A 1HDOA 2QTBA 3JQAA 4OU4A 4AU1A 1EK0A 2EYQA 4WJLA 4S1OA 4M76B 5I5GA 4F3CA 1OBHA 5ED4A 2C7QA 1L7MA 1JPVA 2GERA 2XB4A 4I50A 4O63O 4DWJA 1KQGA 2E6KA 1GA4A 1YQXA 1Y3DE 3VBEA 1LX7A 4E2ZA 2FZ4A 1V6AA 2VZEA 3MT8A 4L4SA 1X8KA 1YB6A 1GTSA 2H1WA 3JAWB 1DQPA 1EDDA 5DXJA 4GM2A 4AY3A 2WKQA 3QYRA 1GNTA 1S8FA 3SICE 5LSAA 4M0CA 2NZVG 1P1KA 3JQ8B 2EQBA 1OFUX 3BFPA 5GJCA 2ATVA 1QH9A 2RHCA 2MDTA 4K9OA 3QJGA 2ZYDA 3C3BA 2GZMA 3GUCA 4UUBA 1RQNA 1CW2B 1RJ9B 1TEHA 4Y1FA 4WW0A 4JSBA 5LIPA 1Q7EA 5JPDA 1HYBA 1ZUNA 2CE2X 5IU6A 2ZRBA 3VGJA 2SICE 3TRIA 3ZWWA 3VGPA 3WZMA 1UBKS 4ZFNA 2LCIA 2ZIGA 2FWBA 1TZBA 1HF3A 2GR9A 2ANCA 1YVEI 2R1ZA 4M1EA 4UNPA 5TS2A 4AO6A 5AHXA 2H9YA 1CP2A 2NPOA 3Q87B 2VF2A 1GQ2A 1K86A 2Y0BA 2GD1O 1M8PA 1LA2A 4QIHA 4ZV4A 1DIGA 2QLTA 1DKPA 2VA8A 5I4BA 4U7DA 4UEWA 2YY7A 4CBVA 4LDQA 1MABB 3QUQA 4KAXA 1V5WA 4PU0A 3ZZMA 1VQ1A 1QG6A 1TU4A 3HXTA 3KNZA 3ZDQA 4EPTA 5ALWA 2AL7A 5CB8A 1AKNA 1TM4E 3SD7A 2GM3A 3RV3A 4AF7A 1E92A 3CS3A 3CVUA 1MFPA 3QENA 4FYPA 3LPCA 4KR6A 3LPAA 5MF6A 3NAMA 4GWGA 4BRSA 3RSTA 4RWEA 3NKLA 4UBLA 5IXJA 4I50F 2BSXA 3I4LA 4DMUB 4U00A 3LQKA 1NP3A 1EGQA 2ZJ2A 4X8OA 4EM6A 4ZK2A 1R0WA 1RYHA 3A6DA 4F4FA 2C59A 2RKWA 2E4XA 2RHBA 2WF9A 4C4RA 2YX1A 4KIFA 1T2UA 4KV7A 1UXOA 3ZIAA 2FCRA 2A7SA 1PBNA 3NWJA 1CUIA 3I2JA 1A1SA 4OUKX 1EGAA 2CDNA 4ZAZA 4ZVQA 3RAGA 2QZSA 3P8ZA 3FCUB 5LM3A 4EARA 2E5LB 2QW0X 3QLVC 3TIFA 2EJTA 2ZKLA 5JS2A 3JCZA 2CB0A 1ACJA 1NVGA 1ZLYA 4QOSA 1H4VB 1MIOB 1TF5A 4N6OA 2IPLA 4M7PA 4P4TA 4J16C 4F6CA 4PAOA 3MMZA 1NXVA 2WLTA 4MR7A 4FOTA 2B20A 9LDBA 3TOXA 1LU9A 2JFZA 1VG9B 1TUBB 4KR3A 2YV5A 4NE9A 3PPWA 3WWEA 4DA6A 4NP6A 1TPYA 4XSHA 2PKXA 3CRZA 3LKZA 4MLCA 3RRXA 1F6WA 3NHJA 1WXWA 4B0PA 3U80A 1IRIA 4TLMB 2DECA 2WQ7A 2J0SA 3LKVA 4QPNA 3VV3A 2F90A 3ODGA 4O25A 4S1NA 5TS3A 3GBVA 4UE6A 3F9RA 4LI0A 5BWBA 4INOA 1DIOB 1OCEA 1VHJA 1W6UA 1OFTA 1AKRA 1VJ1A 2OV4A 3IJPA 3IP5A 3LCCA 5EKXA 5KYWA 2IKQA 2D8MA 1WZ8A 4IVPA 3H6KA 2FN7A 4LXHA 3AGQA 1ZUD1 1GTG1 1HUQA 4UE2A 5AJYA 2NLOA 3S1AA 5KQPA 1WOYA 1CU1A 4DLVA 1SVKA 1V4VA 4H6PA 4XZ3A 3SYRA 2E4YA 3E9EA 1E3MA 2QGFA 2L69A 1T6ZA 1MNAA 2FQWA 3FW1A 2OKCA 4P1ZA 1I2ZA 1D04A 1W96A 5CA1B 1Q1AA 2GO7A 2ZOSA 2ORVA 2Y05A 1ZNZA 1IIBA 5GVSA 1JU4A 3D3KA 1Y6QA 3I52A 5TSDA 4PZPA 1R4ZA 1PG0A 2C8KA 1Z3CA 3JASB 5D3QA 1R8XA 5CYGA 4HDCA 2ODNA 2R44A 2CFTA 2I33A 4UD6A 5ALPA 5KVVA 4TWJA 4IFTA 2Q5JA 2ZJ0A 3MCWA 4WN3A 4X3CA 4MYTA 3WWYA 1NSTA 4ETWA 2MOKA 1NDQA 1NUUA 3BUSA 4CHGA 2QRLA 4NBWA 4CCWA 4JJIA 2DMRA 3RBXA 3L0OA 4QREA 2XDWA 2CNLA 2H4YA 3E70C 4YT5A 3ZIAD 4NMXB 4NG4A 3TIXB 1TO2E 4BE7B 2ZRCA 3SQLA 1WSAA 1U65A 1TIKA 2YMMA 3DZJA 5DWVA 3IPXA 5C8YB 4V1CI 1RQ7A 4LRQA 3DOEA 1ZCZA 1UKYA 3RDPA 3H05A 1U02A 4LOHA 4R41A 1KQFA 4LE2A 3W3AH 3L1VA 3V5IA 4QUIA 4P80A 2YZ2A 4DQXA 4KDRA 4HNUA 3WK5A 3GPDG 1U0OC 1N5LA 3MGCA 3KP1A 3NP7A 5DEIA 2HUNA 4XVQA 4AZ0A 4B7ZA 5HW0A 1R66A 5JAOA 1BH6A 3WLKX 3EPJA 2CFSA 2MINA 5IDQA 5CPFA 3B3JA 4R5MA 5TMEA 3K20A 1J2UA 4P3XA 2H8KA 5DXFA 2EEZA 4EGCB 1OFIA 1ZKDA 2ISCA 2NACA 2XWPA 3E15A 3Q40A 4YBRA 2X0EA 1Z26A 2O57A 5D84A 2I2CA 3E9QA 2HQ1A 4E13A 5JCZA 3VTAA 4GP9A 5CUQA 3U7EB 1DPFA 4RIGA 1MQ8B 4M4SA 4Y2TA 3B38A 2BGIA 1T0PA 2GN4A 2MHCA 4LWPA 2XKBA 4JSRA 3ROPA 4C3VA 5CEEA 5E0OA 2YWGA 5EAIA 2G4VA 4QOGA 1COWD 2F1RA 3R75A 2OYCA 4G01B 1UKEA 2GK7A 4HDQB 4URZR 1IUOA 3P9NA 5FPYA 4D5GA 3G0IA 1TYFA 2OBXA 4DCJA 2BFBA 4WUVA 1IHOA 4NOJA 5KDOA 2FG6C 1FFHA 5TC4A 5JCJD 3BXGA 4NXNB 1IJKA 2FH5B 2IEZA 5EIBC 5KTOA 3KJHA 1TKAA 3ZTWA 3KBBA 1XK6A 1OW3B 4QEDA 3V32A 2CW5A 2OL4A 1XQYA 2BD0A 3Q4GA 2GBCA 1QZ3A 2H63A 5DT9A 4KACA 4N76A 4N1AA 4AP6A 3G0CA 1WR8A 3H17A 3Q3CA 1GNVA 1VHWA 3SR4A 3PXCX 2RG7A 4KMRA 2Q4RA 3EYWA 5J59A 3MQ4A 2WINI 4LDJA 2AC7A 1JIIA 5FUQA 1FDUA 4WIAA 3GDHA 1T6BY 4HXEB 5FQOA 3B60A 2JEOA 2OO5C 3TI9A 3EXEA 2BTEA 4QJIA 1UAAA 5CDYA 1WBDA 1F0NA 3FWNA 3CZ5A 2ODWA 2NADA 5EEHA 3R3ZA 5F78A 3DMDA 5H16A 1F2DA 1P3JA 1UBNA 3C8MA 3D64A 3QLTA 3WNDA 2H11A 5IABA 3L7YA 1SXJD 3ZJUA 2JGLA 3B70A 1OH6A 5K0EA 1XCPA 4ZCRA 3OFJA 4B83A 2O59A 1BHQ1 1C8LA 1H2HA 1KMHA 2O2SA 3LRTA 4HB0A 4UTVA 3DV0B 2JKZA 2FR8C 2QTRA 5FQNA 3N76A 1K7CA 2LP4Y 4LMRA 5KB3A 1B0AA 1R9GA 2C7BA 3LGAA 1C1XB 1M2GA 4DLWA 2UVDA 1Y4AE 1Z08A 3E4CA 1C0IA 1RMTA 1PW7A 1ZVJA 2O1EA 1KK0A 3GLSA 4XLZA 4Q02A 1ABEA 1VHTA 2XSZD 1G38A 1PEKE 1KI1A 5ETJA 4ZHQA 1FDIA 1L5ZA 4OF4A 521PA 3TNYA 4CKYA 1OLXA 4W8GA 1QOQB 4DG9A 4LTDA 3NV9A 1YB4A 1N2XA 3FCAA 5KQSA 4CYMA 3IIJA 3A3YA 4IJKA 4CL8A 1JHZA 2F3RA 1VE6A 4WN9B 3MGGA 3QA3E 4YRBA 4C2TA 3MJ4A 1QO7A 4M1QA 5K0ZA 4MWSA 3MGKA 5A2QA 5H5JA 2YDXA 1W581 3FFXA 4JUAA 4UAGA 3I61A 5HDBB 2AC4A 4I1YA 4E7OA 3ABOB 2P91A 3ABIA 4RSHA 1LVHA 3R3VA 4TKLA 3DR5A 4RLSA 5HK9A 3TYXA 1JVNA 2BFBB 4WINA 4U0HA 3ZW8A 2RDMA 3BVPA 4UUAA 5ECGC 3FYUA 5HBRA 3UYKA 4MJ7A 5KDRA 4LSMA 3IIKA 2KS6A 4DDUA 3EPRA 5J4LA 5LN1A 5T6BA 1AHNA 5KHLB 1ZEJA 4RYFH 1RJDA 3NHYA 5D7BA 3CZ4A 1OLXB 1O96B 5I4KA 1IB6A 2WHQA 4UVEA 5DTPA 1I2BA 1U3GA 3Q9SA 4IXDA 2ATIA 4BXOA 1CP3A 2KYRA 2JFHA 3P4UA 1GPWB 3EZ7A 3P0HA 4LEIA 3IUSA 3VPFA 3WIEA 4GOND 2A30A 4LXTA 3HRKA 1ML4A 1CUHA 2QJWA 3L06A 4HAYA 4RXTA 5C2JB 1KMHB 4LF6B 1SR8A 1L5NA 2LBPA 4RYDA 2XGGA 2ZROA 4JJ8A 4MYDA 4GI5A 4P86A 5FI0B 4ESOA 1NW3A 2CLLB 4J90A 3WGKA 1TCUA 5FOTA 2LW7A 3OTHA 4ENQA 1CF4A 4V3CA 3GRKA 1PTJC 1KQ3A 1U2PA 3E9YA 4FR2A 4E09A 4IX9A 4LDRA 3UTDA 2C3YA 2AQKA 4IDPA 4QPDA 3S8EA 3NEAA 2O5EA 2H16A 1Z0JA 4TLAA 4TV9F 2XUHA 4WNYA 2ZREA 3TL6A 1Y1QA 4NZOA 3VZPA 5K6TA 2HY7A 3HQ4O 4GM1A 4RA6A 2VPZA 3IOMA 4DUGD 1ZUWA 1FU4A 1H4QA 3P5MA 5IG2A 1R0XA 3D3EA 4ERNA 5L6LB 1MZPA 3WYFA 1PR5A 2BMDA 1KY5A 1YVDA 2HU5A 1N5OX 4FBMA 2PR2A 1BA2A 1H8HD 2PVPA 1UKCA 1LFAA 3HUUA 3UICA 2NP9A 3RFFA 1PS8A 3H9JA 5FPQA 4XCVA 3ZEIA 2DTDA 1ZRNA 1G21E 3NAQA 4KR2A 2R6DA 2I4OA 2AZTA 1YR8A 3EQ9A 4OGLA 3VSCA 2IYFA 3FYUB 5HS4A 3CCCA 3PRHA 1R10A 1WMAA 3CJRA 3M6WA 1NVFA 4MQLA 4X63A 1NVDA 3L0ZA 1T29A 1GUYA 1TAHA 3H5LA 4K28A 3KAQA 2RJ3A 2WJAA 5EFOA 2GHQA 3U17A 5JRDS 3ROQA 4XQ0A 1IXSB 2FBMA 3DJYA 5C1OA 1E4VA 1KFEB 1XN4A 5KPDA 5LU9A 5FAKA 3OZUA 1OFUA 3HJFA 4EEKA 1X9HA 6Q21A 2ZAOA 1KARA 1MV8A 4Q4JA 4RDCA 3I5XA 3W6UA 4ZKEA 4A6EA 1MX1A 2O2CA 2WV7A 3PFGA 3V4OA 3CMCO 3PHBE 1ICIA 3PGKA 3LQ1A 4G8BA 5IVPA 5JO0A 5JXWA 221PA 1JSCA 4X3OA 1C3OB 4E14A 1B14A 4WH0A 3T38A 1UYVA 3LHFA 1W30A 5CVDA 3RFXA 1BS9A 3UEOA 5TNXA 4FDMA 2PUVA 4R3WA 2FMIA 3DLPX 1P5ZB 4M8LA 2V7VA 4I55F 5DMXA 1XTBA 4BO3A 1Z29A 1KRXA 4Q47A 4TOIA 3QPCA 5ES3A 2L19A 3DCJA 1Y4ZA 2ZTUA 3ECAA 1LI7A 3Q3HA 4LK3A 3VH3A 2PLWA 2YXDA 1X7WA 3HYLA 4NEHB 1ORDA 4R05A 3DBRB 2PUEA 1WB4A 4I4IA 3ABRB 4NONA 2ZJ1A 3OZGA 4DJEC 2A9RA 1BDMA 2VXOA 3FHCB 4O5OA 3RFCA 3ZZUA 3PUXA 3OQ6A 5AK6A 3WGZA 2P3LA 3WDSA 1S7CA 4LFAB 3SKYA 2BAGA 2Z5LA 4FW8A 3BHMA 5BSTA 4HV4A 2J4DA 2E6UX 3O26A 2GZAA 1NLMA 3V7FA 1QQTA 2A0FA 2G77B 3A2NA 5TJ9A 1K32A 1QZZA 1KZ7B 3IT2A 3N0WA 3J7AC 3GD5A 5KAPA 2IS6A 3CRNA 2PGAA 3HYNA 3L01A 1HFKA 4WSOA 5JSHA 3M3PA 3D54D 2V58A 2VYFA 1S8NA 4C0LA 1O5IA 2H06A 1SIBE 5JYCA 1QQBA 1WAMA 5LQMA 5AKXA 2RHJA 5AI0A 4Z4IA 1YZUA 1L9XA 1TLTA 1XD2B 1HZZC 2XVZA 4UHEA 2IX3A 3IA7A 5I9IA 3PJEA 5AW9A 2JIBA 3IOBA 1F3LA 4ZZ2A 3D8BA 4J2UA 4Q1FA 1TL7C 4MJXA 4KWTA 5EXPA 4YLHA 4L4RA 3E2PA 2HTFA 1N3BA 2DY1A 1UMDB 1PJHA 3WK7A 1FMCA 3SWXA 2HWUA 2P67A 2ZBPA 3L8EA 3FFWA 5JCXA 3ET5A 4WK2B 5ARCA 1FTSA 4G8JA 1RJMA 5DGCA 2PLFA 3DNMA 3NBFA 2JC3A 2PIDA 3VM6A 1PQYA 4LCEA 3R9TA 1GQYA 2GLUA 3T7AA 5DNCA 1I7SB 1SKYB 2L0XA 3Q10A 4NULA 3NEJA 4W6QA 2Z5VA 3PPXA 3WGHA 4A26A 4F56A 1KJYA 3B3AA 3WAKA 5LNK6 1GA6A 4WJZA 3BK7A 1Q17A 1XCGB 1L5RA 2FUCA 4P5PA 3KKMA 2Q8QA 5GPBA 3TTXA 1UT6A 4LNUB 3THYA 2DP4E 3H1TA 5GONB 2QRPA 2WNIA 1VE1A 5G0VA 4MRAA 1DBVO 4I4ZA 2QX6A 4GI7A 1I0LA 4FJ1A 2UZ1B 4EI8A 3PEWA 4KQGA 1FNMA 5AM4A 1R9MA 5B2FA 4QUAA 3WKBA 4FC7A 1M66A 4H77A 5AR1A 3BTUA 1LLDA 3O5AA 4MNTA 3HVHA 2GD6A 3G0GA 3MUOA 1N4AA 3HL0A 4YRTA 1RHRA 4BNXA 1ZSVA 1P0CA 4W63A 3MINB 4IS3A 1CVLA 1XEXA 3KHSA 4U6SA 4ARIA 3RF6A 1TQ4A 2OKGA 2ZUTA 5HUJA 3UIEA 1WQ1R 1T8RA 2FB9A 4UTPA 3BCRA 2B1GA 4CMAA 1PDVA 4TT8A 1QKJA 2JEZA 4HNTA 1IBKB 5JJKA 3AF5A 4YLYA 1NNSA 4NH4A 1AV7A 1CK4A 3B2EA 1OHHA 4YI5A 4C05A 1CDEA 2HF9A 5CCXA 1HMYA 3JY6A 5KDRB 3STAA 4OIFA 5EPEA 2Q3BA 2E48A 4FS8A 3ETNA 1M7GA 2R5NA 4YS6A 3GELA 5J1TB 2VP0A 3KVNA 1NNLA 3PT9A 5ILQA 3DMTC 2QE6A 2LZ0A 2X86A 3GFRA 3KFLA 3LPDA 4LNHA 4MH0R 4URHA 1O95D 1QYIA 4S1TA 4AJ4A 1N32B 2A1UB 2PV0A 1J90A 4PYIA 4U6NA 4AY6A 2PGDA 1UH5A 1YA8A 3RIGA 5GGYA 3WG9A 4Z7JA 3K9WA 5FOXA 3IAS1 1L5OA 3LLUA 1ULAA 4YREA 4GS5A 4A2WA 3EQ8A 5EL0A 1E4OA 2QIPA 5CB0A 3HM9A 1LV7A 3WQBA 2JCBA 4YDSA 3ZV4A 5CTBA 1ZITA 1MABA 4UUNA 4MCIA 4PPNA 2EW2A 1EX6A 2H7YA 3C3KA 1B8NA 3I72A 6YASA 5IT4A 2YYZA 4GIBA 4W1QA 2B6HA 3L9XA 3WHLA 4H1TA 2CJFA 1B2RA 2C7RA 3MWLA 3ND5A 2X0JA 2ZWPA 3JQAD 4KR0A 3VV2A 1NVXQ 1WSBA 1P1CA 3PP8A 5BSVA 3IAVA 3G8AA 2VWQA 1DS6A 1POXA 2GZRA 2JAQA 3GCDA 3KEFA 4LXXA 5FOWA 3R9IA 1QGYA 3NDPA 4BLUA 4O4LB 4C3ZA 3UJ9A 2OBBA 4HQRA 1NUAA 2OO3A 2R11A 2C88A 1V47A 4GPTA 4J0KA 4XEHA 5T5QA 2I7DA 1BVRA 3KTOA 3REGA 5K6AA 2EW1A 2FN3A 3DMRA 1UDAA 2YWRA 3ETCA 3GGOA 2ATXA 5F9HA 1Z8FA 1Z8NA 1STOA 2I2WA 3H2KA 3AQIA 3WMEA 2HK6A 1Q0SA 2CDAA 4GLOA 4ZQFA 1G6OA 5LLDA 1LK5A 5JS1A 5KTKA 1NVBA 2GVZC 5BW6B 1RQXA 4C89A 1RNLA 3CLSC 3KD2A 3U09A 5F98A 1E2BA 1J2RA 1XLTA 2B83A 4B73A 1KYXA 4WL0A 1ORWA 4YR9A 2O0MA 3ET4A 2AMLA 4J0FA 3CVJA 3QK7A 4Z2AA 1QB8A 1N2ZA 1CV2A 2VK4A 1GCOA 3K1TA 3L7IA 3M7IA 3R5XA 4O2AA 3KQHA 4LF4B 5AI4A 4U9HS 4YAUA 1K3FA