3ZWBA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPAVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
total genus 264
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwbA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwbA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwbA01
1WW8A 4MVJM 4E12A 2OHXA 4XA8A 1T2DA 4OIMA 4FOSA 2Q99A 1XLTA 3H65A 5JBXA 4TKMA 2BI7A 3AY6A 4W9NC 2Y05A 3FD8A 5IG2A 1ADFA 2A4KA 4KDFA 5JO9A 3HDYA 1UXHA 3UAGA 3AI2A 2J3JA 5CAEA 2I76A 1FJHA 1C1XA 4M54A 3ZNPA 3U9LA 4UEOA 1VSUA 1H6DA 2JCXA 3ZH2A 3EHEA 4U0GA 3GLMA 1U3TA 2CE3A 2Q2XA 4CV0A 1XIVA 1ML3A 4I9HA 4GX0A 3T8AA 2JL1A 3VTFA 4WCDA 2EKQA 1SEVA 5TT0A 2ZB8A 3ZWPA 1I5RA 4OMRA 2I9PA 4GVXA 4GWKA 5AXDA 5DKPA 2J5IA 3FPLA 1ON9A 2JCYA 2J8ZA 3GPDG 2YHUA 3NDJA 3JQAB 2X86A 5JCXA 5INGA 3RROA 1GV1A 1KVQA 1B8PA 3C7DB 4IXTA 3DOOA 2DM6A 3ZWOA 5ADHA 4GH5A 3RUFA 5EMHA 1PS0A 2JFHA 3GDOA 1XNYA 3KV3O 4XYEA 1GL3A 1IUKA 3TZCA 2FW2A 1B26A 3PWZA 5G4KA 1AE1A 3ETDA 2Q45A 1GUFA 4WYOB 3GVIA 4Q9NA 1JU9A 3GGPA 2O23A 4HNGA 3AK4A 4IJVA 1N92A 4HV4A 1LXCA 4R1TA 5I9MA 3H0SA 1X0VA 1E1KA 4QO8A 3C1AA 5A02A 1VJ1A 2WYUA 2Q4BA 2Y93A 1DO8A 1XSEA 1YKFA 3L07A 1VKOA 1GYRA 3DOCA 5JBIA 3JQBA 2DC1A 3PLRA 1M6WA 2ILTA 3DBHB 3H9JA 3DJAA 2AQHA 1PJHA 3NT5A 2WDZA 2W3PA 5U9CA 1WNTA 1J5PA 4GX1A 1T26A 4MVJH 1YL6A 4YEDA 3WIEA 4JJGA 4OSPA 4P4GA 1MG5A 3VHRA 3R9QA 3DAFA 5DCWA 3I9OA 2DU8A 3B1JA 2Y67A 1U2GA 2Y66A 1EEHA 3E18A 4YCAA 3PJFA 1M66A 1UYVA 4ZGWA 2O3JA 1E5QA 3MOIA 1PZHA 2NVBA 2XAAA 4MVJD 3ZZNA 1EDOA 3FF4A 2WEKA 4PLTA 4EW6A 3M2PA 4CMHA 4H3VA 4IZDA 1QLHA 2GGSA 4IQGA 4RVFA 4YJFB 3UCFA 1CQIA 3ZHYA 1CERA 4XYLA 2VSUC 2O7SA 4DLLA 3H2ZA 1MG0A 1C0LA 1QMGA 2YFQA 1ZCJA 3I4FA 1HE2A 4R51A 1CETA 1GUYA 1I3KA 4B7CA 5KJCA 1GZ3A 4PLFA 3MWDB 1HE5A 4BNYA 3JQ8A 2PKQO 2RH8A 3DL2A 3ZV4A 3R1IA 3VC7A 4OO3A 3ZU5A 2RCYA 4IZBA 5L51A 1EFKA 3ZNQA 4BO5A 1PS9A 4WZ8B 5JAMA 4IXWA 4CM1A 1TI7A 2TMDA 4TRRA 1MJ3A 1H9BA 1V0JA 1U3WA 1QYXA 3PZBA 2FPIA 1F12A 1KETA 2FR1A 2Q34A 5A5FA 3LAOA 3FNFA 1ENPA 3ONFA 1IY8A 1DRVA 2OO5A 2Q2QA 1HLPA 3IQDB 2WE7A 1RJWA 3OJOA 1X7HA 4U6QA 3WYCA 4DQXA 3N74A 1XQ1A 2P2SA 4ALJA 1HDRA 5IKLB 4I08A 4CM3A 5DZKH 1T4BA 1GD1O 1Z74A 3F46A 3RJ5A 1NVTA 5B1YA 4KPKA 2D4AA 1DHRA 1U1IA 3PPIA 3QK8A 4FN7A 1LDEA 3P2OA 4OXKA 2WD8A 5COBA 1KBZA 3W8DA 5C7OO 2ZL2A 4JOTA 3I6IA 1ONOA 3CZMA 1QP8A 3D4OA 3JQFC 3JV7A 3HZZA 2UYYA 6ADHA 1E1NA 1HSZA 4MVJG 1I10A 1JAYA 4KUEA 3BHIA 5JCJD 5JXWA 3GMAA 3QWHA 1PJ4A 1G1AA 3EGOA 3BMOA 3HP0A 2E4AA 4HC8A 3KBOA 2CVOA 1P0CA 3ORFA 4DPLA 4M8SA 2ZTVA 4G2RA 4B7UA 4FJWD 1ADCA 3Q9UA 1BRMA 5DCYA 3EW7A 3PJEA 1C14A 4FJ2A 3RUHA 3Q6IA 3JQAA 4PZCA 3D5TA 4CM9A 3F9IA 1XG5A 4RL6A 4FIZA 3UVEA 2Z1MA 5JY6A 1IB6A 4JBHA 5T6BA 3BMCA 2W8ZA 3DMTC 1E3SA 3RKRA 4ASIA 4IZIA 3GFBA 4L4RA 4R01A 1EBUA 4MOWA 1KOLA 1HWYA 5KVCA 2G82A 3V1UA 1A7AA 1M76A 4OKNA 4Z3KA 3WSVA 1ZK0A 1PJLA 3Q1LA 3ULKA 1VLLA 4F47A 2XXJA 4A0SA 2Y1CA 1UDBA 5KNLA 3PJDA 3IMFA 1QV6A 3GR6A 4TVOA 3GEMA 4JYLA 2Q50A 4JJIA 1S6YA 3VIVA 3E03A 2Q4EA 3H0UA 1UR5A 4MPDA 1SEPA 3CE6A 3PHLA 4IIUA 2YQ5A 1ZMOA 3GNSA 3HDJA 4ND3A 5B4VA 3KHUA 1Y8QB 1AN9A 2H5LA 1ZXBA 2VHVA 4R68A 5ICSA 4TZKA 1JN0A 5JBWA 4ALMA 2ZL4A 3NAQA 2XXBA 1WWKA 4OKIA 4XB1A 1NZYB 1DFGA 3UGKA 2FPGA 1R6DA 3T4EA 3QY9A 1Z75A 4QT0A 4AL4A 3H7AA 2I3GA 1I2ZA 4PRKA 3TNLA 4J0FA 1Q52A 2IE0A 4RPLA 2X0RA 3JD2A 1YJQA 1TYFA 4UAGA 2BZRA 4NK5A 1A7KA 3F4BA 3EY4A 3GFGA 2EWMA 4GLLA 3BXXA 4KP7A 4HFNA 3IOYA 1EUZA 3TN7A 3KB6A 2NQ8A 3Q9NA 3WNQA 2G76A 2WWRA 1XNWA 3JQ8B 4B4VA 1WAMA 2P68A 1KVRA 2VWHA 3PGXA 5FEUA 5I7VA 5GMOA 4D41A 2R00A 1VL6A 5CDGA 4J7CA 1OOEA 4WPGA 4WCFA 5U4QA 4YJGA 4ND5A 1F8FA 4K6CA 4LCEA 3QVTA 3W8FA 2FWMX 3I52A 5EJ2A 2CF5A 4J1SA 3GG9A 3DMYA 3JU1A 4B3HA 2HAEA 1NVMB 4BO9A 3U9SB 1IOLA 4UUMA 5TT1A 4TQGA 2JJYA 1KERA 2X7HA 3QP9A 1KC1A 3UCXA 1P1FA 4PLGA 3ROKA 5CHEA 3Q2KA 1H9AA 4XGIA 4HY3A 2GN6A 1VL8A 3A06A 1YVEI 3GQVA 4YT8A 1DIRA 1PX0A 4JROA 5CEEA 4FBGA 4ALLA 4BO8A 5L4NA 4RDHA 4FR5A 3SX2A 3QWFA 3OC7A 1X0XA 3ZCXA 4AJHA 3OM9A 5CDYA 4FD3A 4WLFA 3Q0GA 3OP4A 3E9NA 5G0VA 5G1SA 1E7SA 1GR0A 4L73A 4UVGA 3E9QA 1I24A 3TF5A 4RF3A 1HYEA 2HJRA 3A14A 1KC3A 3JYQA 4MP6A 5IN4A 3WG9A 2H9IA 3C85A 4LRSB 3IP3A 2H1SA 3DEYX 1I32A 5DBGA 4KUGA 1NBOA 1R4NA 4YTEA 4DMMA 2AEFA 3K9QO 1EFLA 3DBVO 2WM3A 3GK3A 3PFFA 3R0IA 4NI5A 4ZDBA 2X5KO 2OZPA 4IJUA 1ZKMA 1GAEO 1GYPA 4LISA 4G81A 1FC6A 2GZ2A 1DPGA 4KNPA 2ZQZA 2VTDA 4DC1A 1GQYA 4J43A 3DHEA 5JLAA 1F06A 1LSSA 2CVQA 4IDCA 2CDBA 2GDZA 4QEDA 2DPHA 1K32A 1B3RA 1NYTA 3GMSA 1PSDA 3HHPA 1B16A 1N6EA 2FPPA 4W7IA 3E5MA 4F6LA 1NQ5A 3ITKA 3UF0A 1J7XA 3K92A 4MINA 4Y8VA 1RM4A 2J5SA 4CR8A 1LSJA 4K9DA 3TZKA 1K39A 3NYWA 2X24A 3KTHA 4ZA2A 1SPXA 3CINA 4BO6A 1PL8A 3I83A 5COAA 1F14A 2NVUB 1YE3A 4R54A 4E5KA 2YV3A 3JQDA 4CM5A 3AFMA 5CTCA 3DXFA 4L9RA 4YRAA 1B0AA 3ST9A 2V65A 3ITDA 4LMPA 3U5TA 5IZ4A 4PLYA 2O50A 3W4KA 4H16A 4A10A 4OMUA 3OICA 2IEBA 1HDYA 1UP6A 2YYYA 3LKEA 2QW8A 3L9WA 2JD2A 3ON5A 4QSMA 4JSBA 1XDWA 3TOZA 3GEDA 3PTZA 4FCCA 2BKAA 4RJTA 5CEFA 1PL7A 5FYDA 4B79A 4M1QA 4R4JA 4D44A 2NTJA 2PBPA 4ZDDA 1BW9A 3ROPA 1YQDA 5TQVA 4CODB 2IDZA 3MEQA 4PLVA 3DZKA 4WNCA 4CM4B 3UUWA 4RVGA 1YQXA 4FFNA 5DU6A 3T89A 4QTZA 2ZJ1A 5IAAA 3BTSA 1KY5A 3GH3A 3D7LA 4WCFB 1K89A 1R4MA 3BTVA 4JBGA 3D3EA 2ZQRA 1BXZA 2BI8A 3WGIA 2RH4A 3KSZO 3JYLA 3EVTA 3KYDA 3N6RB 3CEAA 4LMRA 4ELWA 3FTPA 4QFDA 2BFMA 2GN9A 2J5QA 2Z5LA 5ER9A 3RC1A 3S1LA 2HSDA 4FZWC 3WXBA 3S55A 1CQJA 4BQRA 3EVNA 4AJNA 2Y0DA 1GDHA 5L7WA 1B14A 3CXRA 5JC8A 1A5ZA 1JWAB 3TZ3A 1SZJG 1T4DA 1U5AA 4J2HA 3RUIA 3VDRA 4CLHA 3RFXA 2PLAA 2Q1UA 4NFYA 1YL7A 4FS3A 4ZN6A 3NJ8A 3UOGA 3GY0A 3KTKA 4ZICA 4RVHA 7ADHA 1NQAO 2A9FA 3GNQA 1Z6ZA 1PGJA 4QQRA 3N7UA 3S8MA 4XRGA 5CP8A 4BNTA 4CMKA 3LVFO 3KEQA 1EVIA 5EQFA 2VHZA 5TRTA 2QYSA 4XIJA 4ESOA 3WNVA 2W4QA 3G64A 4WOJA 4WUVA 1R37A 3CSDA 2X4GA 2B37A 1SOWA 2DTXA 4CL3A 4CQMB 5TGDA 2AEMA 3ANNA 3Q7HA 3K2EA 2ZL3A 1BMDA 3I47A 3KRTA 3W4IA 4WE3A 3IUSA 4E2XA 1XU9A 3TZQA 2DPGA 2GF2A 3VPHA 5DOZA 1NM5A 4GMGA 4I52A 5FIFA 1ZSVA 1SOVA 1KVSA 1N9GB 2IEDA 1WVGA 4NQZA 3D5QA 3L4BC 4R9SA 3PDJA 3Q11A 3WJAA 3TDKA 5JCJA 4N5NA 1QYCA 3UFXA 1WZIA 4BKRA 2C54A 2F00A 2VT2A 3KZVA 3BHMA 1YB4A 3UXYA 3OF2A 2D1YA 1LX6A 2O3QA 3PGQA 1F0YA 3DQPA 4B3JA 3L9XA 4IJWA 1P9LA 4BL5A 3BEZA 5GZ3A 3KETA 5ENDA 4D42A 4YA6A 2DTEA 3S2EA 4YAGA 3I4CA 1DOHA 5AXBA 3RC9A 4CMIB 3WMWA 1J4AA 3AOEC 3R6HA 3N58A 2HDHA 3VOSA 4LSMA 2ZATA 5MGBA 1ENOA 5TJ9A 1LRJA 2PH3A 4DBVO 4EZBA 2FZWA 2J5IB 3OECA 3EDMA 3PZKA 4NEKA 1BVRA 2PK3A 4HFRA 1O94A 4TVBA 3DB2A 1OC2A 3L3SA 1A9YA 5IDYA 3TFQA 1EBFA 1R4MB 1LQUA 1S7CA 3SLGA 1DRWA 4EMMA 4JFCA 3INTA 5KJPA 5IXYA 5FF9A 2OGUA 2GN4A 4BO1A 4HXYA 4RDIA 2HO5A 4KWIA 1RWBA 1W0CA 1H5QA 1PZGA 1K6IA 1TEHA 3CIFA 4LGVA 4K3WA 4RPJA 3WGQA 1HRDA 1D8AA 2J3KA 5BNIA 2GYYA 3RCBA 1NNUA 3ADPA 5J23A 3ZI0A 2DAPA 4ZDCA 3BZUA 4PG5A 2IYOA 5BNTA 1Y7OA 4NR0A 4EYEA 3RSHA 3NJBA 4PLPA 3QWAA 2WTBA 1EVJA 5C5IA 1D3AA 2FBMA 3OJEA 1HYGA 3DFZA 1ZW1A 1LRLA 1GCOA 5TC4A 3VZSA 4N5LA 3ZNOA 1H6CA 3NT4A 3W6ZA 3MT6A 2C7VA 2WYWA 1HDZA 1ADGA 2E48A 3RUCA 3V1YA 4I5FA 2HMWA 4E6PA 5F1OA 1JKIA 1PWXA 3LC2O 4XJSA 1X1EA 1XHLA 9LDBA 1YBMA 4R9RA 5JYEA 5I9LA 5IDQA 3W6UA 3RU9A 1XX4A 2DVMA 4AG3A 1OD4A 2ZKLA 3DAGA 2PZKA 4YJDA 3H81A 1Y6JA 3U0BA 4BNXA 4DBZA 1IYZA 4BO2A 1QRRA 1EVZA 1U7HA 4CLOA 3VKVA 4BGVA 1TT5A 3OQBA 4UEKA 1EE2A 4DLAA 2O48X 4DYDA 2GPTA 4NFSA 4NK4A 3ZDFA 4E31A 3SBOA 1QKIA 1VJTA 3VPFA 2UUPA 2CMDA 3F4LA 4NJOA 2BELA 2JFFA 5JDCC 5HA5A 5FUSA 2YY7A 2NU9A 4ILKA 3HUDA 1PGOA 2DBZA 2WE8A 1O89A 3U49A 4J1NA 1SB8A 3IAVA 4B4OA 4CLRB 1IZ9A 2NV6A 2HMUA 2OMEA 2Q1SA 3E9MA 1G0OA 1U7TA 1C1DA 2EXXA 1SZOA 4IJKA 4IQ0A 1SAYA 3EUWA 4EUEA 3PQFA 4P8RA 5KVSA 1UUFA 3WB9A 5A3VA 4HNKA 3F3SA 1VE9A 3PYLA 1ZIDA 4R16A 1E3WA 3FNEA 4QO7A 5DU4A 5L95A 3ANLA 5LDGA 2X0IA 3LT1A 1MX3A 4BOYA 2VZ8A 2HQ1A 3KVOA 3LC7O 4QFCA 2JAHA 5EIOA 1O5IA 1U4SA 4Q3AA 1VM6A 1NFFA 3C3XA 3H5NA 3H5AA 2VOJA 3DONA 3PLNA 3WLEA 3TDCA 2PH5A 4WCFC 5JFOA 4FSHA 4JXKA 4RF2A 4BQPA 4JX8A 1R4NB 3GF4A 4G5HA 4CMIA 2PWZA 5KJFA 3GDGA 1LJ8A 2JD1A 3AU9A 1JVBA 2D5CA 4WLVA 4AJIA 2PKQP 1HDGO 3TZHA 5F5LA 3L6EA 1XEAA 3CPSA 3U4HA 1AHIA 1RYDA 4R1UA 4BS9A 4ELSA 3DR3A 1WMBA 4K1LA 4LVCA 2BFAA 1O95A 2RHRA 5EL0A 4Q3EA 3E1KA 4FFMA 3ISAA 5KTKA 1Y81A 3KTDA 3SJ7A 1K6XA 3TFOA 2PFGA 3FWZA 3OH8A 4IUYA 5T57A 3H3FA 4K26A 3BMCB 5K6AC 1D4FA 4O6VA 3HB5X 1KEUA 3VPGA 4MVJE 4B3IA 5JDCA 3QVXA 4L8KA 4ROSA 4NNQA 3JD4A 3MJSA 3GKBA 3VVCA 1N1GA 3ICPA 4IGFA 3ZU2A 3NTQA 4IS2A 4EUHA 2FR0A 4KTTE 4Z3DA 3V1TC 2IYPA 1N6FA 3ZU4A 3SC4A 1BW9B 2VRCA 1UJMA 4PN3A 2Q35A 4UUNA 2VYND 3JD1A 1JQBA 3GGOA 1EF9A 3PGJA 3WQQA 1U8FO 4XCVA 3PIIA 3BF0A 1PJCA 1LBEA 5E0SA 4BGIA 1WDKA 5THKA 1ZO8A 2EJWA 3JQ7A 1L1FA 4FFLA 1NZYA 2ZYGA 5FI5A 1JVSA 1Y9EA 2A35A 1N1EA 3G0OA 3RFVA 1WP4A 1A9ZA 1Y8QA 2GZ3A 4BNZA 3P85A 3BTOA 5COQA 2VSSE 2GD1O 3Q2IA 1JLLA 3PEAA 4XR4A 3HB4X 4XQEA 3RBVA 4UVIA 1OMOA 2FMUA 4L75A 3HQ4O 2Q49A 4IZHA 1P1IA 4YPOA 1OAAA 2H63A 2V6FA 1ENZA 4II3A 4AJ1A 3DOJA 3DMTA 4TMFA 2NADA 4GPD1 4OAQA 1NWCA 4LK3A 1LLDA 3VZRA 3W4JA 4D3FA 1JW9B 5C9GA 3M6IA 3G79A 3U3XA 3STAA 4CLOB 4YT2A 4B8WA 2AXQA 1D1TA 5DOVA 2NTVA 4Y6SA 1T1SA 5T8KA 3PWKA 4BNVA 1I33A 4CV3A 2C8TA 4Z0HO 4ZJUA 2QG4A 2Y1EA 2J3HA 6LDHA 1Q2XA 3D3WA 2CSUA 2IXAA 3WQSB 1NPDA 5KDRB 2F9IB 1BDBA 5JS6A 4OXYA 1DHTA 1CRWG 2F6QA 2ZB4A 4GX2A 2QZ9A 4KQWA 4L4SA 2QHXA 1FDVA 4BNJA 3F5SA 5KDRA 1BHSA 4D0RA 3EK2A 1YGYA 2I5PO 4U0JA 3TZ6A 4YVFA 4Q1IA 1CIVA 1K2WA 2E6UX 4JJTA 3OBBA 2A81A 4INAA 1ZUD1 2B5WA 1PJSA 3FBGA 1ENYA 1E3WB 1ZVMA 4BHTA 3RUEA 4F45A 1ADBA 1N5DA 4CUKA 2QYTA 2BLLA 1FCFA 2YV1A 3DDNA 2PZLA 3H02A 4TROA 2UUOA 2A92A 5JC1A 5L7YA 1CJCA 3GAFA 3GVCA 5JAZA 4AICA 1X13A 3QWIA 5ILGA 4GSKA 5G0TA 1J49A 1BXGA 2ZJ0A 1HNOA 2BGKA 3CMCO 5DF1A 4PIVA 4FFRA 1LC3A 3ONEA 5EESA 2ZTUA 5TF4A 3X2FA 3PXXA 1UXGA 3LQFA 4I5EA 5JYDA 1X1TA 5JMPA 4LK5A 2DLDA 2UV8A 3C24A 5GZ6A 3IUPA 4M49A 3WSWA 1BXKA 4E5YA 2HK9A 3OIFA 9LDTA 4TKLA 3LT2A 1Q7BA 2JFGA 4XDZA 2XF8A 3O4RA 3RASA 4QIIA 4RPKA 4J3FA 2YFHA 3GNTA 2VHXA 4BNMA 2X0JA 2NUAA 3EYWA 1ORRA 4FPXA 1GTMA 1X14A 1RPNA 3HJAA 5CDTA 4F6CA 5DL1A 2OBNA 2AE1A 1MLDA 4KDEA 3STHA 1R0SA 3H9GA 4B4UA 3ZWBA 1TLTA 4B7XA 1PJBA 2Q2WA 1Z45A 4MKZA 1LC0A 1NXQA 3TSCA 4U18A 3F47A 3VH2A 1E77A 2B83A 3K73O 2BGLA 2HMTA 2DBQA 1T24A 5A9SA 4J9UE 3DBHA 3IDSA 2I99A 1GCUA 1NAHA 2DBVO 1Z73A 1VRGA 1IZ0A 1GEGA 2Y1DA 3FPCA 1Q1NA 1TT7A 1Z7EA 1RJMA 1IPEA 3JQ7B 1VRWA 3FCOA 2EP5A 4M87A 3WGTA 5IXSA 2FR8A 1MXFA 3BIOA 2GN8A 3DZGA 5KKAA 3ZV3A 2DUUA 4HFJA 1M6HA 1B15A 1E3IA 3GZNA 3PHGA 4RO0A 2HU2A 2P4QA 2E37A 4J4HA 3PZRA 4NNJA 1K5HA 2D0IA 1NAIA 4FZWA 5T64A 2QZZA 4YXFA 4NDNE 4CJXA 3H0JA 3ZNNA 4U0HA 4J90A 1Q51A 1MC4A 2JD0A 2PGDA 1NFQA 4JGBA 1YS4A 4RZHA 1HKUA 2Q2VA 4FNBA 1HEUA 1H6BA 1G6KA 4BNKA 4H15A 1DIAA 3ZHBA 1YDEA 1DJNA 3R9SA 2IZZA 1TT5B 5KOIA 1XKQA 3MFMA 1WLYA 3WGGA 4YT4A 5B4TA 3VZQA 5BT9A 3G1TA 3KEOA 3NUGA 2I3AA 4E30A 1JDJA 4BNLA 2AHRA 3GVHA 1E7QA 4M86A 2PD4A 4A27A 4WGGA 5HWSA 2A7KA 2X9GA 1E3JA 3QXIA 4K29A 1JAXA 2BRUA 1E6UA 3WYBA 4YT5A 4CMCA 2W2LA 1E1LA 3FTNA 4URFA 2VSUF 2UAGA 4GWGA 2J5II 1F8GA 4XGNA 2AEJA 2PZJA 4BKQA 3LC1O 3BYZA 3JQGB 1R0LA 4QECA 4ZQHA 2J5GA 2GRAA 3QVOA 4HADA 1DXYA 4I9UA 4NZ9A 5FI3A 3SLKA 4OM8A 2GUGA 1Q0LA 2AQIA 3GVXA 4OXNA 1SC6A 2VUSA 3QVWA 3E6AA 4CLDA 5DNAA 4OG1A 2DFVA 3MZ0A 4RQTA 1KS9A 4RVDA 5A5EA 4XX0A 4WLEA 3HINA 1D1SA 3NDIA 3U4DA 2Q46A 5I7SA 4Q0GA 3WMXA 5B12A 1PIWA 1CDOA 3GPIA 1JKFA 4Q3BA 4J4BA 2PR2A 4TSKA 2AQ8A 3IAHA 2NU6A 5H81A 2V6GA 4CLRA 4IDEA 4UVDA 1JKJA 1R0KA 4PZEA 4Z0MA 4W99A 1KVUA 2D5AA 2NSDA 3BMNB 8ADHA 3E48A 3C7CB 2FSVA 2EIHA 1V9LA 2Q1WA 3QJ5A 3RD5A 7MDHA 4NBUA 4BO3A 4YAJA 3LT4A 4N7RA 5A3JA 1UAGA 5GZ1A 1KEPA 4PCVA 3PE8A 2UZFA 1PZFA 4CMEA 4BGEA 5CG2A 3ETEA 1P1RA 2EHDA 1PJTA 3GN1A 1DAPA 1VPDA 2Q3EA 4NU5A 1UXJA 3RQSA 3FWNA 5U1PA 5IN5A 1PEDA 5BQFA 4H7PA 1BGVA 3T4XA 2I66A 2OORA 1UDCA 1ZJZA 3TLFA 4II2A 5FWNA 4FGSA 3ST7A 4MJLA 1IHYA 4NBTA 4R1SA 4YRDA 1YDWA 4QXMA 4Z9YA 3I9KA 2X8LA 1P1JA 1MC5A 2OL4A 4RYFA 3G49A 4U0KA 3BMOB 2YZ7A 3PDUA 3V5IA 5GY7A 5DTWA 2VSUA 3RRVA 4JCOA 4IQ8A 5BNFA 3S2FA 4ALNA 1A72A 3KM0A 4ZHSA 4PZDA 1LA2A 4OLQA 1EE9A 1I3MA 1I8TA 3PHJA 4CV1A 4BNFA 2IODA 4JQCA 1C0IA 3K30A 1ZZEA 5F21A 4TRJA 5CPFA 1DIGA 3RBZA 3H2SA 4M55A 3ZU3A 4J1TA 4GX5A 4ND2A 4L6WA 2ZYAA 4MVJP 5JE8A 2BH9A 1IE3A 3DBRA 3R3JA 3ZV5A 2BFPA 3FF6A 3UHAA 1DIHA 1N2SA 5A9RA 1PZEA 5ICMA 3Q3CA 2GSDA 3OIGA 4IDBA 4YWJA 1V8BA 4FJ0A 2FY8A 1GQQA 3B1FA 4L0QA 3JQBC 2DEOA 1XQ6A 4ZRMA 4YAKA 3QWBA 4I4ZA 4ND4A 2VQ3A 2QRJA 3DZFA 4NJMA 5IDXA 1HXHA 4FOOA 1FK8A 3IKVA 3TT6A 3T3WA 1SCUA 1Y9AA 2AG8A 3QV1A 3MOYA 3RSTA 1B3BA 4CPDA 5BSEA 1I3LA 5C7LO 1YG8A 2YHIB 1PS8A 3IJPA 1LUAA 1CWUA 3WYEA 3H6KA 1PIXA 4WLUA 1L7EA 5TNXA 2VTEA 4HKTA 3UW3A 3BPPA 2VYVD 4D43A 3G3EA 5G4LA 4XQ9A 4Q3DA 4GI2A 3NX4A 3VTZA 1O8CA 4J16A 2E49A 1SO8A 2HLPA 4ALIA 2OFPA 4YJFA 5A1TA 4CMAA 4E2ZA 3LU1A 2PNFA 4D3SA 5DULA 5JW6A 2VRCD 5TLSA 2YUTA 2WMDA 3PFWO 4MIOA 1OBFO 1XR3A 3V5EA 2B5VA 3WX0A 3NJ4A 1RYEA 4BO7A 2Y99A 1IULA 3E82A 4MIYA 1E6WA 2EJVA 3S2GA 4AJOA 4UREA 1C0KA 3H5RA 1UZLA 1AXEA 4YRBA 4JP2A 3A9WA 1YBAA 4N5MA 1C1XB 2V6MA 5T8KC 2GERA 5CPBA 1PL6A 4IZCA 1DDOA 4CQMA 3X2EA 4W9NA 1E7RA 5KWEA 1GQ2A 3HDQA 3A28A 1RM0A 2ZTLA 2W2KB 3PJGA 1FDTA 4EJ0A 1KYQA 1XYGA 2P5YA 4AJJA 1ZH8A 4XWYA 1WZ8A 2I67A 1H0KA 2O4UX 2ZQQA 4CM8A 3KOUA 3JTMA 1NP3A 3DZIA 3VH1A 3HLN1 1OD2A 2HUNA 2RAFA 4DQVA 5IZCA 3DTYA 2W98A 2EKLA 3GOHA 2DUBA 1T2EA 3TRIA 1V3TA 3BAZA 1NR7A 2C07A 1FDWA 5KKCA 1LTHR 4XKJA 4Y67A 3R9TA 3HE3A 1QYDA 2C5AA 2FOIA 2RBEA 3P2YA 3P7MA 1I2CA 2Y68A 4E32A 5DU8A 1RKXA 4GLOA 4RVUA 1U9JA 4YQYA 3VDQA 4BV8A 3DHNA 3NEPX 1T25A 4F3YA 2F9YA 1P44A 4FDAA 4CM9D 2JHGA 3PIDA 3QXZA 2NVUA 5DP2A 3KLMX 4FW8A 2OP0A 1LDMA 5EQDA 3C8MA 3A1NA 4IINA 3O38A 2I6TA 3F6YA 1X7DA 3M6MA 4RCNA 2GZ1A 2NNLD 3EC7A 5EERA 2EJ5A 1IPFA 3VVBA 1O8UA 4MVJA 1DC3A 1UAYA 5G1RA 3UCEA 2YHIA 2AA3A 3B70A 1HT0A 2OUIA 3ENNA 5A9TA 1YB1A 2FRDA 2UVDA 3PWSA 3LF1A 4BB5A 1JA9A 3HN2A 1ISJA 4LRTB 2VSSA 3ZWAA 1LLCA 2OP1A 1ISHA 2HCTA 2GTRA 4XJTA 3QA9A 4ELXA 3OMLA 2R6JA 1O9BA 1K3TA 4O0LA 2PGJA 2POQX 3U9TB 1N7GA 4UUPA 1DFHA 3GLQA 3FN4A 4E4YA 5IJZA 3MJVA 4JBIA 3DAPA 4I1IA 2IEXA 1HZZA 3GRKA 5DDIP 1HTBA 5KJ6A 3TL2A 5A9SB 2ZB3A 4MO2A 1ZK2A 4WNIA 2EP7A 1Q7CA 3FSRA 1W2XA 1U3VA 5TIIA 5I8WA 2VSUE 3K5PA 1ZK1A 3M2TA 4RQUA 2VREA 4XQCA 3MYBA 3K8ZA 2BF7A 3AOGA 2G17A 1LDGA 2VOEA 4PLZA 2X58A 1SMKA 5I7EA 2JHFA 1ZEMA 5F3RA 3PQEA 2VNSA 2P91A 3I9NA 2ZCUA 2ZL0A 1K0UA 5ENVA 1GUZA 1FC7A 4OOFA 4Q3NA 3WQRA 4C4OA 4DPMA 1T1RA 1C3VA 4CMGA 3PEFA 4AJPA 2O2SA 4OQZA 4IGEA 5DBFA 3B1KA 3H9EO 1EMDA 3TJRA 4JCRA 1R66A 1A4IA 3JCZA 2FP4A 2DKNA 5JAIA 1QYVA 2W90A 3OQ1A 4IDGA 4NJMB 4WEOA 3K50A 2VWQA 1NQOA 3SEFA 4XYBA 3AM3A 1ZEJA 5EPOA 3NTOA 4PG6A 4MP8A 2WSBA 3AY3A 3QQPA 3I5MA 1JXZA 3GAZA 2NTNA 4EEZA 3LSYA 4E2WA 3INRA 3MTGA 4BIIA 1A27A 1N6DA 1DAOA 4BNGA 3TL3A 4FC7A 2VUTA 4E5PA 1VJ0A 1MXHA 3JQGA 1ONPA 4NPCA 3AU8A 3I9MA 3JQCA 5G0UA 5HS6A 1GYQA 2EERA 5DP1A 3O9ZA 5ITVA 3L6DA 4IMRA 4DXHA 3T88A 3DWFA 3PYMA 3PK0A 4QX6A 1ZK3A 1DCIA 1MGOA 5DBIA 1PTJA 4YR9A 4NU6A 4XR9A 1HDXA 1W73A 2FZEA 3KSUA 1ISGA 5G1QA 3I23A 4XRRA 2PD3A 4FN4A 4LVUA 3D0OA 4XQGA 5DT9A 1SNYA 2VSSF 3QE3A 5ES3A 3AWDA 3WBFA 3M1AA 4DMLA 4UVHA 3VH3A 3AY7A 2X5OA 4CLXA 4PGFA 3FNGA 4RCVA 2Y1OA 3QSGA 3WFJA 4Z0PA 3T8BA 3L0DA 1P3DA 5FFFA 3PVZA 4G2NA 1K6JA 1YQGA 2CBYA 1EVYA 4N18A 2HKIA 4KWHA 1HETA 3HG7A 2D3TA 1M2WA 1DRUA 3QKAA 4JYJA 4GGOA 4RLHA 2E82A 2P9CA 5THQA 1X7GA 2G0TA 1E7MA 5KJ1A 1HF3A 4IPTA 3WOHA 4F46A 3P5MA 1YOVB 2YQ4A 4DYVA 1I2BA 4RVSA 2J3IA 5CFZA 3GHHA 3KYBA 2F1KA 1DSSG 5A03A 4NFHA 5KCZA 3R0OA 4YACA 5G2OA 1N7HA 5BSGA 2EGGA 2B0JA 4NBRA 1AUPA 5JPIA 4PG4A 3MJ4A 3TQHA 1LLUA 1DUBA 3V5NA 4G65A 1ULSA 4R41A 2YDYA 3AOEA 5TX7A 3JQ9A 1WPQA 2VCYA 4JIGA 4GM2A 3EZYA 3LDHA 1E5LA 4J0EA 2O7QA 4FB5A 1RM5A 2BHLA 4FGWA 3NTRA 1Y7TA 2QIOA 5IF3A 4EMLA 5A04A 1V3UA 4R1NA 1HL3A 1V35A 3WR5A 3OEWA 5L40A 3HRXA 5L3ZA 2EV9A 4HBGA 4PVCA 3V8BA 1UP4A 3DHYA 4PLWA 4QFEA 4XYMA 1NTOA 3I1JA 4Z9FA 1I30A 3D4NA 3L4BA 3OETA 4UVEA 3GF7A 2NACA 4BNHA 2H6EA 1QYWA 3P19A 4I9NA 1CEQA 4R3WA 3ROQA 4M89A 2HMVA 2RHCA 3IC5A 3OIDA 1LDBA 4JCQA 3HADA 1SB9A 3OJFA 1DC4A 3AUUA 3KUXA 1DIBA 4AFNA 1GPJA 2Q1TA 2QX7A 3KO8A 4D79A 3TVWA 5EINA 4LW8A 4E0BA 1LDYA 3NDRA 3QYRA 1KVTA 1P33A 5AXAA 4U5QA 5CG1A 1XA0A 3L4SO 1EY3A 1PJQA 4IY1A 2SCUA 3IS3A 1P45A 4P38A 2PA3A 1ISMA 1HYHA 3B6ZA 3FHLA 4L76A 5IDWA 1LLQA 4YB8A 3H4VA 4BNNA 3GDFA 3IB9A 3T7EA 1DC5A 3ZHZA 4JJFA 4EJMA 2V6BA 2CFCA 2R00C 1LEHA 4GGPA 5B37A 2GASA 1ON3A 2F6IA 1CYDA 3JD0A 4WLOA 5DZSA 4B4WA 4GBJA 3D3WB 2YDXA 2ZIZA 4B8ZA 1VL0A 2HJSA 3BMNA 1QORA 3H9UA 5ITWA 1YH3A 1EK6A 3U4IA 2DTDA 3EMKA 1SBYA 2IXBA 4XEHA 3GMDA 4ZU3A 5KVQA 4CM8B 1UP7A 4A73A 1N9GA 2EEZA 1PJ3A 4UULA 3QREA 3OA2A 2EW8A 4KZPA 5INIA 4TZTA 3RI3A 3OJ0A 1YOVA 2EKPA 4Q39A 4S3MA 4FJ1A 2BFOA 4ZD6A 4ZQGA 5KVVA 3Q0JA 1MV8A 4J1QA 3M6NA 3INGA 4KWBA 3JSAA 5INFA 1NHWA 3PQDA 3C7AA 3RC2A 4WK6A 3L77A 4PVDA 2PD6A 5I7FA 2A94A 2UDPA 3K96A 4ZRNA 5TJHA 3C1OA 4A2CA 4DLBA 3PHIA 4OL9A 1PGPA 3SWXA 1ARZA 1MP0A 4NMHA 2VWGA 1E6EA 2Y0EA 1BXGB 1CF2O 4PG7A 1EUCA 1YONA 3UH1A 5ER6A 4A5OA 4QIJA 5K0ZA 3D64A 1W8DA 3AUTA 3H9QA 4GKVA 4YLHA 2VHWA 1HDCA 4E2YA 4RLSA 1YO6A 4JWVA 4L74A 1P74A 3FI9A 4NHEA 3SLLA 4DL9A 1Y5MA 5A05A 1PJ2A 3GHYA 1ZJYA 2FN7A 4O63O 3HE2A 2B36A 1ZK4A 4DIOA 2PY6A 4PFJA 3ASUA 3WWZA 3O26A 4P4LA 4YYZA 5L53A 3TPCA 1LU9A 3ZN2A 1P31A 3ZWNA 3RUDA 4OOEA 1H2HA 2QQ3A 3QLJA 5KJEA 1OZAA 4DA9A 1Q7GA 4I5GA 1ULUA 4YAIA 3ADOA 2G1UA 3NV9A 4EEXA 3GC6A 4RF5A 3H8VA 3DZBA 2P4HX 3GG2A 4D46A 4E5MA 1FXSA 4U1AA 4ZQFA 4U19A 1FDSA 1HE3A 1U2DA 1MUUA 4PG8A 1NHGA 3QIVA 2WD7B 1U8XX 3IJRA 2C2YA 2R2GA 3GVPA 4ITUA 4X54A 5HS4A 2CDCA 4CMBA 4MP3A 1EQ2A 4JK3A 1LNQA 4HUJA 4OQYA 3VKUA 4DREA 3PRJA 4A7PA 4Y6RA 4Z6KA 3VPSA 4K28A 2LDXA 1U5CA 5DUFA 3RBXA 4RF4A 2VZ0A 1Z82A 2A7SA 4EITA 1Y8RB 4FB8A 1ONNA 4ALKA 1EUDA 1JWBB 4XGKA 5CDUA 4WOKA 5JDIC 4CQMD 3CH6A 4CM7A 3B20A 3DZJA 1SG4A 2BD0A 3ZW9A 4JNKA 5DUCA 4ZVVA 2HRBA 1AGNA 4XZ3A 1FF9A 1FMCA 2LDBA 5BR7A 1WDLA 1DLIA 1HE4A 1RJNA 1AHHA 3BA1A 3COSA 4D7AA 4MI2A 4BUCA 1LSUA 3VPXA 4L4XA 1Q0QA 3H3JA 4LN1A 3WGHA 2PG8A 1M75A 3GT0A 5L45A 2GNAA 3K2BA 1OFGA 3QRWA 4XB2A 1RM3A 3JQEA 3WICA 5K6AA 1PQUA 2CDAA 4J9VA 4CM4A 2ZB7A 1VKNA 4NBWA 1WZEA 1YB5A 2O3TA 5AXCA 3RC7A 3VAZA 5IFLA 2HW5A 1HLDA 3NKLA 4JLWA 4NG5A 4MKRA 3JD3A 4CMEC 1GU7A 5LCXA 3TV5A 3RFTA 1ZNQO 4GL4A 3IKTA 1X0UA 3ZHXA 1R15A 5HM8A 4J91A 4PLCA 5G0WA 3BMQA 1KIFA 2VYVA 2EW2A 1UDAA 3EZLA 5L7TA 2CNBA 1MFZA 2YJZA 1UYSA 5G0SA 5F1KA 3IL2A 2JAPA 3ROMA 3NJDA 2WJPA 2YV2A 3CKYA 3JQ9C 2Z1NA 4IBOA 1Y5RA 3KQFA 4JVTA 4EI2A 4IDAA 3ABIA 8LDHA 1DJQA 1YWGO 2GCGA 2QQ5A 3DTTA 1MFPA 4Y9DA 3DBLA 3K8XA 4WCZA 4ND1A 2JKVA 1OC4A 1B8UA 5DTPA 3GUYA 2B35A 3ZWMA 5IZCC 1XU7A 2VZ9A 4CR6A 3JYOA 1H6AA 1IL0A 3WFIA 3CUKA 3RIHA 5JY1A 5LC1A 4DTIA 2CF6A 4YJHB 4YBZA 2DFDA 1O6ZA 4E33A 2HRZA 2P5UA 3A4VA 4WECA 2NP9A 1LI4A 1I0ZA 1D7OA 4YJGB 1GZ6A 4MDHA 4UUOA 4P4NA 1R12A 3PHHA 3Q1TA 3FNHA 3F1LA 3RWBA 4DIFA 4Y98A 3TOXA 2IZ1A 3WWYA 1NPTO 3U62A 4DUPA 4U7WA 4A03A 3OMEA 4AJ4A 3V2UA 4WKGA 1J0XO 3DFUA 2B4QA 5HTOA 3KYDB 4XIYA 1WDMA 3WTCA 2P9GA 1EK5A 4YAEA 2PKRA 1J6UA 5A4DA 4DI1A 3ZW8A 4CL8A 3KXDA 4OH1A 1TVEA 4MXIA 4FNDA 1E1MA 4I8XA 3WTBA 4C7JA 2O3RA 3GEGA 2C7GA 5I8ZA 1L7DA 1R16A 4TRNA 4K2NA 1UZNA 3HNPA 1E3LA 4EUFA 2DUWA 2FZSA 5E0SH 2BGMA 4DIBA 1OI7A 3R6DA 5EN4A 2X9NA 3WBBA 3ZWWA 3L6OO 5AVOA 4BKOA 1H93A 2AE2A 2ET6A 2YW9A 4N54A 4ZDFA 1ZSNA 2I65A 4L8VA 2CUKA 2ZTMA 5TSDA 4RPHA 4GSLA 4PRLA 2X5JO 3LLSA 4KUHA 4Z9XA 1P77A 3KYCA 1XNVA 5AOVA 4BMSA 4FN8A 3GGGA 4CMJA 4O1MA 2EGHA 3M1LA 3MWEB 4QUKA 4IIVA 3RVDA 4EDFA 2X1HA 4TRMA 3RSIA 4IM7A 5JO0A 4YDRA 3D4PA 1ZXLA 4E3ZA 2O3SA 5JSFA 4HX5A 1GPDG 4CR7A 1LQTA 3PI7A 3CTMA 4KOAA 5CEJA 4IDFA 2NWQA 5C7IO 4KMSA 3H0QA 2DT5A 3K31A 4W82A 4BVAA 1LDNA 4CM6A 1KEVA 4BNUA 3AJRA 3RUAA 2B69A 4ZQEA 1T2CA 5G4KB 2ZYDA 3RJ9A 3RAJA 4XD2A 4EJ6A 1GEEA 1YJ8A 2Z95A 3C1TA 4CUJA 1FC9A 3DBRB 3JQ6A 2QRKA 4GMFA 3HSKA 4Y6PA 1PWZA 2IRWA 4KD6A 3S2IA 3P5SA 3QHAA 1QG6A 1VSVA 2AMFA 1TA4A 2P9EA 1PR3A 3F5QA 3FR7A 3OQ6A 3LK7A 4RV9A 4U8GA 5C90A 1PGNA 2C0CA 2PV7A 3SXPA 4DQUA 1HZDA 5JAQA 2NM0A 5JMWA 2EF1A 1TB4A 3PYXA 5BSHA 1UXKA 2C59A 1I3NA 2TMGA 2OBYA 5ILOA 2B4TO 3BTUA 4C7KA 3PP8A 2Y0CA 4DC0A 4WJZA 4EBFA 3DORA 1GY8A 2CZCA 3OFSA 3I3OA 4FFOA 1MA0A 2EG9A 3GZNB 2W2LD 2C82A 4NBVA 1WMAA 3GA0A 1PQWA 3U4CA 1A4UA 1JTVA 1B2LA 1LRKA 1UH5A 3MCVA 1XO6A 3RKUA 2C20A 1UZMA 4HWKA 4UEJA 4E13A 2GO1A 4DRYA 1HSOA 4OYRA 4BKPA 1QV7A 3KTJA 4XDYA 2VT3A 1E7YA 4LCJA 3MTJA 1DEHA 4D3DA 3O03A 4WLNA 2X0NA 4R5MA 3ETGA 4MVJF 3KTIA 3OEYA 4JCSA 4AJLA 2FSSA 4AJKA 5DCUA 1AXGA 2VRBA 1I36A 3IP1A 2D2IA 2VHYA 5L4SA 3AUSA 3SVTA 4FC6A 1PGQA 1BSVA 1YRLA 2GLXA 3I6QA 4BMVA 3ASVA 3MOGA 2G5CA 4ID9A 5E0NX 4XYGA 1T2AA 3GZ4A 2ZQYA 4J7XA 5KIAA 3AM5A 2F9IA 5HBRA 1GADO 5JDIA 4FFPA 2FHSA 3ZV6A 4BO0A 4WASA 2HMSA 2XOXA 1VC2A 4I5DA 1G0NA 4W4TA 1BG6A 5B4UA 5DN9A 1DB3A 2GR9A 3W1VA 3KSDO 1C1DB 1E0DA 2NLOA 1M67A 1HDOA 1I01A 1HZJA 3I9JA 3JQAD 3MJCA 4ONEA 4RZIA 3ENKA 3MJTA 4HFMA 4P22A 4WEQA 5A06A 3LF2A 3I9LA 5L9AA 4ZU2A 3OHSX 3ANMA 4E21A 2IZ0A 4U6SA 3QMJA 1KEWA 2ZCVA 1DLJA 2CVZA 4JCTA 5CDSA 4NIMA 1P1KA 4I42A 3HFSA 4JP3A 4YJHA 4OSOA 1ZFNA 1W6UA 4BB6A 1MB4A 3ZWYA 3LT0A 1V3VA 3TRRA 4GVLA 1ISIA 2X22A 1F17A 4J2OA 3R3SA 4EMPA 1GFSA 1U3UA 4O5OA 3WGZA 3JYNA 2C29D 2WD7A 3CZRA 1ID1A 2ZK7A 3MJEA 2F9YB 1Q0HA 3OSUA 3DC2A 3TWOA 3FDUA 5CTBA 4U0GH 4J4TA 3ZWVA 4HNHA 2DBRA 1GZ4A 2PTGA 4KTVE 4MVJI 1ZSYA 1A71A 3FBTA 4MOUA 1EDZA 1BTOA 1NPYA 2DQ4A 3W8EA 3U09A 1QLJA 2CY0A 4DGSA 3O8QA 4CQLA 3DZHA 3FRJA 3UKOA 1Y8RA 2OOSA 2W2KA 3T7CA 2O3UA 4DPKA 4BMNA 1PU2A 3ZWCA 3AI3A 4A26A 3WG5A 3JYPA 1WXDA 3GRPA 4W7HA 3V2GA 1BVUA 1H2BA 3LZ6A 4ZQBA 4DVJA 1B8VA 2QRLA 3DO5A 4J7UA 2B4RO 1E7WA 1YG6A 2VWPA 4AJ2A 1E92A 3WGYA 3GN2A 3AI1A 1NFRA 4BKUA 3VZPA 3TVUA 4HP8A 4IS3A 1XWFA 3D1LA 1DBVO 1XELA 4BNWA 2Y1GA 4PLHA 3KLPX 1FDUA 1PQPA 3HFGA 2NU8A 1BWSA 5AQ1A 4K6FA 2C2XA 3WIDA 5JNLA 5K9ZA 2AQKA 4CLEA 2X23A 3WJ7A 2AG5A 4R69A 3IIEA 1T2FA 3KYCB 3HN7A 3O8QB 4CQLB 4KQXA 3HWRA 1O0SA 1P0FA 3RU7A 1LSOA 1ZMTA 3EAGA 4JN6B 1V6AA 4R3NA 1Z7BA 2J5RA 4D45A 3BHJA 4OGWA 2WYVA 4RPGA 5T67A 2J5GD 2VX2A 5DZKA 2PZMA 4R5HA 4BGUA 3KTGA 1NQTA 3GUCA 4OJNA 4FQ8A 2J6IA 2Y1FA 3OA0A 3SJUA 3QWDA 3UICA 3ZWXA 2VN8A 4BV9A 2X6TA 2X9VA 1PR9A 3ONDA 3VH4A 1E3EA 2PGLA 4YQZA 1TXGA 3ICCA 2OXIA 3FR8A 3UN1A 5L4LA 2NU7A 1UYRA 4MIEA 1TG6A 3WGOA 3SC6A 2HK8A 1YL5A 4RYFH 1UXIA 1B7GO 5T5QA 5AYVA 1BDMA 3OJLA 1NX6A 1DFIA 1YXMA 3P2LA 1N8KA 4W6ZA 3JQFA 2PPYA 3AUAA 3HDHA 1C0PA 1W4ZA 4TWRA 1ISFA 1UYTA 3QW2A 1H94A 2V7PA 2RIRA 3NRCA 1P1HA 5F5NA 2J5KA 3NT2A 1QXSA 4ZDEA 3WLFA 2NQTA 2C5EA 1XGKA 2D59A 4NH4A 1YBVA 4AVYA 4GAEA 4CUZA 1EF8A 1NR1A 4S1VA 3TT7A 3G1UA 1EZ4A 3WDSA 1XCBA 1NWHA 1IHXA 4OHUA 2VYNA 2XPCA 4E5NA 4GHNA 2CD9A 3DBLB 4MKXA 1NASA 1QR6A 1NVGA 1QSGA 1U28A 2AW5A 4O59O 5H83A 4AJEA 4DWVA 4J49A 4Z0TA 5H82A 2O4CA 3E5RA 2NVWA 3U9RB 3CMMA 3LYLA 5I9NA 1VI2A 4CV2A 4BO4A 2HK7A 2O2YA 4LSWA 3OT6A 3V2HA 4EGFA 3AW9A 3WS7A 1ZBQA 4IDDA 3BMQB 4RGBA 4GQAA 4IMPA 1U4OA 4D0SA 1HNUA 4RORA 5BSFA 1EQUA 5F1PA 4J6FA 3AM4A 2BMAA 1GV0A 3E8XA 2VNAA 5C37A 4BNIA 1X15A 2JCVA 2D8AA 3K6JA 1Y1PA 4GKBA 3ZGYA 1KY4A 3NGXA 5C3MA 3NGLA 4Q3CA 3LLVA 3QVSA 5TS3A 5MDHA 3Q0EA 3F1KA 5HRUA 1DC6A 5LDHA 3G17A 3IBBA 1UIYA 3AFNA 3GF3A 2VUUA
chains in the Genus database with same CATH superfamily
1M5RA 4M1YA 3IEVA 1T2DA 1D6JA 3OM0A 4FOSA 4KX3A 4JOCA 1XLTA 4MUKA 4OIMA 3TYXA 2BE7A 1QGDA 3ZVRA 1ABBA 4CEIB 4M7WA 3NFYA 2BBWA 4W9NC 2PAAA 3R5JA 3BB4A 5IG2A 1WTCA 2A4KA 5H9WA 1JEDA 4MPRA 1SURA 1HV8A 4PONA 2ONYA 3MTDA 1J8YF 5BOVA 4X90A 1C1XA 1S89A 1MVOA 3HEAA 5IAGA 4QG7A 1RXSA 3DLPX 1N5IA 3GLIB 2CE3A 1RAFA 2WQ6A 2Q2XA 1LI5A 1XIVA 4KXWA 2PUGA 4IDNA 2VAMA 3SQWA 3T8AA 1N6EA 4IVNA 5CVEA 3VTFA 3CRQA 4WCDA 1XVVA 1OYOA 3ZQ6A 3V4OA 1XEWX 1VDMA 2QVXX 1I5RA 4AYWA 3IRVA 1PV2A 3OZEA 3FPLA 4A16A 1ON9A 4TSRA 1UM8A 2YHUA 5JCXA 1KYTA 3RROA 1N32B 1CUGA 2YX1A 3V1KA 1NW8A 4G01B 2E7ZA 4KRXA 4M1KA 3PRYA 4WACA 2DR0A 3FM9A 2PX5A 1GTL1 4PGGA 1MENA 5ADHA 3OHPA 2F67A 3QYPA 3V8MA 4UOQA 3VZDA 2GN2A 3MRTA 4RY0A 3HEMA 1XNYA 5JAUA 1RI4A 1GL3A 1IUKA 2WIDA 3DMPA 1CP2A 4PHTA 1XRRA 3ETDA 5HRAA 1TNDA 2GK3A 4R0VA 2E6KA 4CDGA 2Q45A 1C9MA 1CK4A 1AUQA 3ZGVA 3AESB 4FSDA 2O23A 3LPMA 4B75A 3E22B 3IILA 1J2EA 2JFVA 4HNGA 4IJVA 1HX7A 1ST3A 4ZYZA 1N92A 4HV4A 2C61A 4FBLA 1IOVA 1LXCA 4R1TA 4ZOCA 1E1KA 1LX7A 1Q15A 1TJYA 2WYUA 2Y93A 4LKOA 3C4JA 2I03A 3QEBZ 3I2FA 3A4IA 4LNUA 1GYRA 1T6XA 4G4SO 2VTKA 8ATCA 1M6WA 3DJAA 1M0EA 3JY6A 4RMHA 3IO5A 4XDGA 2HU8A 3EBLA 3DQQA 2HMAA 2ZIEA 3QOXA 4YWHA 1PJHA 2A1IA 1GQOA 4DW8A 2I54A 4AO8A 1TE2A 5A4AA 2DOKA 1DAEA 1QK3A 1T26A 4MVJH 1YL6A 2J5XA 4LYJA 4OSPA 4P4GA 3UAXA 3D8HA 2AUNA 1TUBA 2QW0X 3AJEA 3I64A 3I9OA 4V0RA 3QLVC 4DDMA 3WHKA 5D3MB 3E18A 4YCAA 5HVNA 2J45A 1R8QA 3AR9A 3RS4A 3RSZA 1MN6A 2O3JA 3LOQA 4GXRA 2IH4A 5DASA 4DWJA 2NVBA 1ID8A 1FFSA 3TW0A 3AETB 3N53A 1SIOA 3VR4D 1UDWA 1RKQA 1RHQA 5E4TA 2EU8A 1AKEA 2PJZA 4EW6A 4H3VA 3PU6A 3AL0C 2QKYA 4RVCA 3UCFA 7REQB 3PKZA 1CQIA 1RKBA 4PZAA 1CERA 4BNDA 3G7UA 2NPOA 3WL3A 5GIOE 2R62A 1YF3A 2D00A 4DLLA 4NE9A 5FPTA 4YV7A 1MG0A 1C0LA 2X2FA 2FZLA 2G07A 3HGMA 2B8NA 1ULZA 4ZEXA 5M3BA 3W5DA 4C0SA 4CKZA 4CCAA 2O1SA 3NBZC 1UBGA 1CETA 2APJA 4I6EA 4QGHA 5KJCA 3DA8A 5AOBA 1RNLA 4GP9A 2JJ2A 1FOEB 1HE5A 3AXTA 3JQ8A 4KQ9A 4KPFC 4WADA 3T9EA 4D4IA 4OXRA 2P8SA 1Z6YA 1NJSA 2PMBA 4DJDC 1VE6A 2RCYA 2ZR9A 1EFKA 1TTPB 3LECA 4BO5A 1XPOA 1PS9A 3VVMA 4WZ8B 4UZSA 4CM1A 1EJ6A 1TI7A 1PNTA 2GBLA 2TMDA 1MJ3A 4WUTA 1QYXA 4LJYA 4F5EA 1F12A 2Q34A 2W8BA 3LAOA 2WFLA 1QR2A 5G41A 4IHJA 1WBBA 1YC2A 3ISVA 3IQDB 2C4HA 4M2LA 2XW6A 3I5XA 4AS1A 4U6QA 1L5WA 4DQXA 4MPJA 7MHTA 2M32A 1HDEA 2OZLA 1GITA 2FQWA 2P2SA 1KK1A 3I6MA 1EQAA 3M5PA 1HDRA 1SCKA 1U2RA 5KYYB 4UXIA 3HJGA 1YRAA 1XRQA 1Z74A 1SBNE 2WM2A 1V96A 3PDIA 5ED4A 3N0RA 5LQCA 3DOHA 5DTQA 4D57A 4FN7A 3ZDRA 1LDEA 2XYGA 3V00A 4V0OA 3WHIA 4YONB 1KBZA 2O7VA 3W8DA 3G8YA 4JOTA 3IV6A 2ID7A 5B6JA 4M88A 4ZARA 1ONOA 2Y27A 3HO1A 1Z08A 4L3OA 2J4FA 4GE0A 5ALXA 1XAHA 6ADHA 1MEOA 2P3QA 3STWA 4OQLA 1UMDB 1SCAA 3GJTA 1HSZA 4XD7D 4KUEA 5JCJD 3T7KA 1QPZA 3QWHA 3BB3A 3R3YA 2DR2A 4KO1S 1QJCA 2GBFA 5AM4A 1M5UA 4YV0A 2WICA 5AW3A 1KKUA 4URHA 5LJLA 1RKUA 3FETA 4WXPA 2ZI9A 3LXRA 1IM8A 3ORFA 2O0MA 1JVNA 2IHTA 4M8SA 7REQA 1P9WA 2VQDA 2H54A 4WBNF 4FJWD 2ZU0C 1SVNA 1VBKA 2RGXA 3HYNA 5DCYA 3U5TA 3EW7A 3PJEA 4FJ2A 2BEUA 3EVFA 3LUHA 3TJMA 5F23A 5C81A 5DK4A 5ICEA 3R6GA 5IT9A 4DA6A 1UEXC 1EFTA 1R8SA 2RGNC 4FIZA 3UVEA 1KOFA 3E7FA 1TZJA 3BD6A 2W8ZA 4IRUB 4U2CA 3MCUA 4K9PA 4R1PA 4LYYA 1YR9A 1T4MA 2XT6A 1IY2A 3KU1A 4RLQA 4U3JA 4R01A 5CA1A 4JLOA 4MOWA 1VIMA 1V48A 5CH5A 3KXLA 2CDRA 3REOA 1M76A 2JB9A 4D9FA 3LS2A 4Z3KA 1W46A 1QHYA 3OO0A 3C5WP 3ULKA 3F2IA 3Q1LA 1VLLA 2YHBA 2XXJA 3VKWA 4A0SA 2Y1CA 3N2GA 4BLUA 2OZEA 3IXMA 2Q5EA 2QXUA 5KNLA 1WZ2A 5JZSA 1QGAA 4TVOA 3X1ZA 2Q50A 1GNPA 1S6YA 4ZO7A 3E03A 1C3OB 1T1IA 2WJ3A 1SEPA 4KB5A 5EXPA 2YINC 2O5RA 4C4AA 1JR3E 1QIMA 3OFNA 5FPSA 1HG1A 3QX9A 4AMYA 5IAOA 2VHVA 4R68A 3FVVA 4ZYUA 3UQZA 1X94A 1KGDA 2AZDA 1WWKA 1V1MA 4L8WB 5D3MA 3WAJA 1NZYB 3MAGA 2UUBB 3G2HA 3KPYA 1KY3A 4AL4A 1Y6GA 1YQWA 1TM3E 3TSAA 2AWNA 4WWHA 3H86A 2R96A 4RPLA 3STTA 1TYFA 4X7PA 4EHAA 1CQIB 5KI6A 1YIOA 2EFCB 2AV6A 3EY4A 4GLLA 1OA1A 2OOKA 2XVYA 3KB6A 2FP4B 3GQBB 4IQ4A 3WNQA 3AIMA 4KCGA 4FB4A 1NM5C 1QO9A 1XNWA 4ZVPA 4BY9E 5FEUA 3CSUA 1K88A 3KNZA 5BYBA 2LWIA 1Q92A 1SWWA 1PV1A 3I04A 4GOXA 4J7CA 4MCJA 3WAKA 3IBTA 5U4QA 4EB6B 3O4JA 4FOPA 2RGUA 1F8FA 4K6CA 1JUDA 1EWQA 1G4UR 4BFZA 3I52A 4HPXB 2CF5A 4J1SA 4BEJA 3HP1A 4PR3A 5KYWA 1WBDA 3HDGA 4TTVA 1LWOA 2YV5A 1N4AA 4AYXA 1D09A 4KDCA 4LVOA 5EKDA 3QP9A 3UCXA 4PLGA 3ROKA 4AKHA 4F97A 1KAHA 3HR7A 2GQ0A 5DMXA 4FBGA 4LYFA 4BO8A 4F2DA 2B1QA 1OIVA 4DF3A 3SX2A 2HSJA 2YWEA 3T4UA 1KKMA 1TQ2A 2WIAA 4FD3A 4WLFA 1XUOA 3Q0GA 2ZSBA 1QKKA 3OP4A 3E9NA 4PIMA 4EG8A 1PEAA 2CUNA 4YJ2A 3DVLA 4FOTA 1ESEA 4EO4A 1E7SA 3NVAA 1I5OA 4L73A 2VAXA 5A4JA 1DEKA 3VMMA 1L5MA 1A9RA 3IAUA 1KC3A 1IY1A 2P41A 3AKEA 2EBWA 2H9IA 4AF6A 1PDWA 3LIIA 3HJFA 4ZAFA 3ANTA 1I32A 3KZOA 5DBGA 4W5OA 3IE0A 4R84A 3ZVNA 1NBOA 3T7SA 2ORIA 3H1GA 3K9QO 4G0VA 4OP2A 3LKZA 4B35A 3DBVO 1TQ8A 3N8IA 1JU3A 1WUKS 2IE8A 4JI8B 2AI2A 1FNMA 2V7VA 2X5KO 3BJEA 5HCNA 4EQZA 2OZPA 5HZHA 1USVA 4JDPA 1Q84A 1GYPA 2XCUA 4LISA 4R8VA 1AGRA 3H11B 5K8TA 4KNPA 1CY2A 4C20A 4CMIA 3ZLTA 5E3HA 5CDFA 3DHEA 4MIKA 3ESCA 3MPUA 2XDYA 3HKBA 4ZAVA 1LSSA 2DPHA 1K32A 3GOQA 2HY7A 5FTMA 1L6IA 1NYTA 1NUHA 2OCPA 3GMSA 4XH9B 2JJ1D 5H70A 4MUAA 1E99A 2FPPA 1RBZA 3ZCTA 5HE9A 4PSKA 3VUEA 3SF0A 4YUYA 9ABPA 2WQ7A 1PE0A 4F6LA 1E9EA 4U3JB 1G64A 3C3KA 1K7SN 4P4SA 5A4FS 3IMEA 1XRJA 3K92A 4IAOA 1RM4A 4MINA 4CR8A 2YWJA 3QX7A 4X00A 1XQ9A 4D6PA 2X24A 4ZOEA 1EK0A 4FNMA 5JALA 2LD4A 1OCEA 3F49S 5J4LA 3CINA 2KJQA 3I83A 3B36A 4D4JA 2PJUA 1N2BA 2WYOA 1GFZA 4MXDA 1TK2A 3AVYA 2P2CA 1AO3A 4E5KA 3U44A 1JJVA 4KH1A 3JQDA 2Z2IA 2A9RA 1H23A 4YNBA 1ODFA 5AHRA 3WYNA 2NO9A 3C6MA 3EZXA 3THWA 3DXFA 4L9RA 1CUBA 1B0AA 2QMQA 3FKSA 1RI3A 1TDJA 2V65A 1C0EA 3FAZA 2VLBA 1G3IA 1LGYA 2BV3A 2G06A 2GHRA 2GX6A 2ZT6A 3PQ3A 4L15A 1QH8A 2IXDA 5LYJA 5NULA 4LJ8A 4BBZA 4BQIA 2PZBA 2VAVA 3AUYA 2A78A 4KR9A 1MTZA 1LZKA 3A6JA 3FOWA 3U3JA 3N8KA 4OKSA 4W6QA 2Q6OA 3FPGA 2X2EA 1SUPA 4L95C 3KQQA 4GOLD 3Q2OA 1QG2A 4ZVRA 2NSHA 1JECA 2JD2A 4Q1DA 3OCWA 4GXTA 2C31A 1A8IA 2DHQA 1QF7A 4PQRA 3TOZA 4FCCA 5AKYA 2BKAA 2GXQA 3C3JA 1KI8A 4J6EA 5LWHA 1J8MF 1V5FA 2AGVA 2VEDA 3RK0A 1ISSA 5CEFA 4O2AA 2LE0A 4S1TA 1KMHB 3EXFB 4F6RB 5IBPA 4IWYA 1G17A 4C4TA 1ISPA 1Q0ZA 4FR0A 2YN4A 4QPDA 3D6TB 3WKCA 5WRFA 2OQVA 4RH0A 4OLFA 4A0RA 1YQXA 2Y0PA 4U63A 1EFVB 3Q3IA 4C2UA 4LCBA 2P7HA 4QTZA 3O73A 3ZU6A 5IAAA 4K87A 5C52B 1KY5A 1DOZA 3D7LA 2G36A 1QGZA 2JLYA 1YZLA 2WT8A 4WFKA 4AP5A 3BTVA 3DKRA 1N6IA 5ALTA 4C0XA 1XZPA 1FUEA 1LNSA 1ZN2A 2BI8A 4L5CA 2WWYA 3JYLA 3CN7A 1MT0A 4H08A 3CEAA 2BFMA 4WJKB 5AK0A 4LE0A 3HUTA 2AOTB 4Q1AA 3U48A 3VMFA 3RC1A 5AVJA 4MVYA 1T4GA 1NP7A 5IBQA 3WXBA 3HFRA 3QMVA 3EVNA 1MOPA 2Y0DA 3PX7A 4LF5B 5JC8A 3UHOA 5KNBH 3TZ3A 1SKQA 1SZJG 1U5AA 3DEFA 3RUIA 3I5AA 2PLAA 5FRDA 4N0QA 5LA6F 4FS3A 1IFXA 4YIHA 2XZLA 1FU4A 1J5XA 3NJ8A 3WIBA 3KL2A 3PUJA 3TLKA 4F7DA 2D0PB 3UOGA 3PUWA 2ZYUX 1ILEA 2JLSA 5AKHA 1E1RD 1EFPB 3R8CA 1F2TA 4X71A 1WL8A 3GNQA 2XUZA 1V7ZA 1XTVA 1BO6A 4HWSA 1A2BA 1ESDA 5C5EA 2FEKA 1EX9A 3HACA 1R5OA 2QLNA 1OX4A 4DRXA 3L84A 2FP3A 2II6A 3WLHA 5KYXB 2IYLD 3QK7A 5TRTA 2GM4A 4XIJA 2IBMA 4DYHA 5FJJA 1OWMA 5EIFA 1DQYA 1KQPA 2P2LA 1U7DA 1JJFA 3NG1A 1UWLA 1HUQA 1F60A 1R37A 1UMDA 1Z88A 2GYUA 2DPYA 2XUFA 3OJWA 3PGLA 4WUVA 3F7TA 1M7BA 4WHMA 2Z4SA 3YASA 2DTXA 4EW3A 5E9JA 5C2JB 4JUFA 3MGBA 3ANNA 5TGDA 4LJRA 1U8EA 2BVNA 1POWA 2W83A 4G5YA 2QXYA 5EZQA 3PFCA 3KRTA 2HFJA 1OXUA 4PM4A 3W4IA 4EVSA 1OZFA 2YV4A 3FGOA 3QV2A 4YMLA 4Z4GA 2QRUA 2I4IA 2PT5A 4C78A 4QUDA 5CX1B 4P2BA 2Y1LA 3TH5A 2JBAB 1KVSA 4C0HA 1N9GB 3TI9A 3RYCB 1N34B 1ZH2A 4GECA 2N1MA 5DLEA 4LV5B 4R9SA 4Z7QB 3TDKA 3CCCA 2VJKA 4N5NA 4Q4CA 1OB2A 3R24A 4IGIA 5CA0A 2ECQA 4FI3F 4OHRA 4DMFA 1QC5A 2VTVA 3OT1B 5JCPA 2VT2A 1GHTA 2B99A 3KZVA 3WK9A 4D9CA 1YB4A 3LJKA 4KFRA 5KU7A 1JB1A 2GRJA 3PGQA 4RSRA 3JVEA 1T9HA 1G8GA 1NVKA 3ELDA 1VMIA 5JWHA 2O1EA 2ZT7A 1ZLXA 2MYUA 4IJWA 3VX3A 4BL5A 3BEZA 5K20A 2DWCA 4G1MB 2WNIA 4HS9A 2AZXA 3JZMA 3ER9A 1ZUWA 1PSZA 4D1YA 1H85A 2Z4RA 3WL8A 4W5QA 5C80A 4L4UA 4GOKA 4LGMA 4RGQA 1VYTA 3C3DA 1F7UA 4UBKA 3HM2A 5AXBA 2BTQA 3NRBA 2H9YA 3E0XA 2BSQA 3WMWA 1GGEA 1J4AA 2FU5C 1AF7A 1G7CA 2GZMA 2SKCA 3AOEC 3ECSA 3LUJA 2C94A 2BFFB 3N58A 2FPKA 4MRAA 4E88A 5JAHA 5MGBA 3PZKA 4EZBA 3MCZA 4EF4A 4NEKA 4LSGA 5H16A 3WKDA 2QPTA 2PK3A 4HFRA 1O94A 3IP7A 4GI5A 3K6SA 1QIFA 2XWQA 1JAHA 1OC2A 5IDYA 3ADBA 2XWBF 3LHIA 4L5IA 4MEAA 1NN5A 3B3JA 3SLGA 3ZYZA 3NS7A 1MZPA 4EMMA 3MSXA 2FWPA 5IFKA 3E9YA 3DCYA 2Z2ZA 4C3OB 5SYNA 4JFCA 3HB0A 3FCCA 3INTA 5KJPA 1ECGA 1LFDB 3GIDA 3E2IA 5EG5A 1KQNA 1EGHA 2PVPA 3E5NA 1I6LA 5DBOA 1PWHA 3RFFA 2OB1A 3WK8A 4BO1A 1XDBA 2VJPA 1SJ9A 2QK4A 1H5QA 3AHCA 3NHPA 4X92A 2NU7B 3CIFA 4I1OA 4LGVA 3U7QB 2CLDX 3ZDAA 2OHOA 4AQ7A 3TRJA 1ZLYA 4O2AB 3RCBA 4A5SA 2HRCA 1NNUA 1X19A 5J23A 2E1RA 4HUQA 4NZNA 1Y7OA 1UKVY 3AF3A 3OE7D 4NR0A 1Q16A 2VAWA 3TRDA 5IAEA 1OFUX 5IK2D 3EEOA 5C5IA 5SZKB 4ZI3A 1NG1A 3DFZA 3T6KA 4A36A 1X42A 1H6CA 3W6ZA 4YP5A 5JS1A 4KQMA 2C7VA 1U0LA 5KYUB 1Y1LA 4QAJA 3ML1A 1IWOA 4UAUA 1ICEA 4MAAA 2OPHA 4GLFA 1DBPA 3UZUA 1PWXA 5HUJA 1DCFA 1X1EA 3LP8A 4QYIA 2D1TA 3VR6D 1SCIA 1UBLS 2OC9A 3QW4B 3AVUA 3KKOA 3W6UA 2ZE5A 4ZCLA 3ZE2B 3FOAA 3AM1A 1T36A 3DAGA 1RYBA 2FRVA 2VUHB 1OFVA 1UFOA 2G67A 2YVUA 3P9XA 3QFRA 2A0UA 1Z8FA 2OHFA 5AMXA 1RI1A 4NYJQ 2HA2A 3HMKA 1U99A 3SZ3A 4JNCA 4ARBA 1NVVR 1KIAA 1VJ5A 4BVKA 2QN6A 2XDAA 1FJ2A 1XEFA 3KVYA 3UV3A 3AP3A 1T13A 3VKVA 1DV2A 3ZYCA 3B8EA 1TT5A 4BGVA 4KRFA 4C87A 1YSCA 3CISA 1UXOA 5F51A 3TLYA 3N05A 1G21E 3AZPA 1B6SA 4TKUB 1K75A 5CBPA 5F52A 2O48X 3TS1A 4OK3A 1A9XA 3BX1A 4AROA 1P1BA 5BV1A 2PUFA 2XJ4A 1F9AA 3NVDA 1QQTA 5HZMA 3EXG1 1IXRC 2NU9A 5EFOA 5HKLA 2Y1KA 3HUDA 3MCWA 2WG1A 4ZANA 1Z3CA 2XRYA 4CW7A 3QKWA 1NBAA 1KDYA 3U49A 1CUFA 3A1FA 4GXQA 3IAVA 1CE8B 1XN4A 3H1BA 1IZ9A 5CNKA 2HMUA 1R0BA 1V7QA 3IDZA 1HMYA 4BE4A 5JCOC 5JVDF 1OI4A 3A70A 4AY3A 1C1DA 1DBIA 4IJKA 1SAYA 4RKEA 4X41A 5FO1A 5JTUA 2YVKA 2PZFA 3EUWA 4M9SA 5C34B 5KVSA 1XYYA 1H2RS 3PUZA 2XGJA 3PF8A 4I81A 2EKDA 4IWNA 2FGJA 5ICGA 5DM2A 3DUFA 3Q10A 3F3SA 2XNDA 4ON9A 4HNKA 1ZIDA 4UUQA 3UO8B 3SJAA 3FNEA 1XX6A 2C1ZA 4QO7A 1R9GA 1AOXA 3HUFA 4OAPA 3I58A 2JLQA 3LT1A 1NOKA 5AJUA 5LDGA 3W78A 1HTTA 3AL2A 3LC7O 4CTJA 3A4MA 1VHDA 4Q3AA 4HOYA 2Y2VA 3MVEA 5JROA 3FDIA 5DN6A 3H5NA 4FYXA 4IDHA 1HC7A 1YS1X 2UZIR 2VOJA 2PH5A 5FYQA 1PUXA 1WD7A 3QX8A 1UDXA 4FSHA 4BQPA 5JFOA 2GK6A 1IN1A 1MRSA 2A9KA 3KJGA 1R4NB 4G5HA 4MUBA 1TO1E 3D59A 3KUDA 2JD1A 1EX7A 3T7JA 4KXFB 4HB0A 2IHJA 1F2UB 4AJIA 2PKQP 1T6BY 1HDGO 1PZXA 2MSWA 3X0DA 3L0IB 1XEAA 5IC5A 2J3QA 3CPSA 3V6LA 1RYDA 4BS9A 4R1UA 4DNPA 1O8BA 2WJ6A 1Z8DA 2VJMB 2C2KA 2A1TS 1J21A 3L82B 1WMBA 4Q4AA 4TWIA 4NX2A 1EWKA 3OEEA 4V38A 4O4JF 3LA6A 4OV6B 4B3XA 4B4KA 2BFAA 3RC3A 1EEXB 1O95A 3FOEC 4O2RA 4BMCA 1UOEA 3ISAA 1JZQA 3AR5A 2AG0A 3LQ4A 1S2OA 4QDXA 4FFVA 3WKBA 2PFGA 5F7XA 3DE0X 1SWVA 1E4EB 1V8OA 4LHSA 2Z9CA 3QKRB 3FWZA 4G0QA 5D85A 5LB4A 2PKWA 1AX9A 3EEBA 4IUYA 3UM9A 3RRXA 2ZUSA 3I0ZA 2EFGA 1KEUA 3VPGA 5JDCA 2WUWE 3G8BA 4L8KA 1T3GA 4TWZA 4A8JB 3GFSA 4FGUA 4DG9A 3VVCA 3LFUA 4IGFA 4KRYA 5DYNA 3ZU2A 1KBOA 1C7ZA 1N9ZA 1YE5A 4KTTE 4Z3DA 3ZU4A 1U0BB 3L5OA 2VP2A 3TEMA 1PO7A 4KPEC 1DQSA 3WLOA 4UUNA 4AP6A 4PN3A 2Z6AA 3HI6A 1U8FO 5C53B 1PR1A 1PJCA 1I7QB 4BGIA 2HT1A 1ZO8A 4L22A 3NCHA 3EWAA 2ESRA 1M2KA 1Y9EA 2A35A 4UPVA 3G0OA 1NMXA 2QTHA 5FTWA 4GZMA 2VDJA 2GZ3A 2YIJA 2P11A 4PTYA 5I4KA 2ZVPX 1DUIA 1F4VA 3Q2IA 1EVQA 4NYIQ 1FZTA 3SQNA 3IULA 4HAOA 3GJ3A 3SF8A 1SQ0A 2BWJA 1J56A 2CHUA 4FZVA 1V43A 2CLMB 3PKJA 3F7OA 2Q21A 2GK4A 2XGSA 2XA9A 3A4YA 3OEHA 3QXGA 4DSUA 2BFCA 2F9FA 2A9JA 4MH0R 5JHGB 2JA2A 4AJ1A 1ENZA 2AN5A 3EXHC 4GGMX 2V9CA 1ULAA 3DMTA 3FDZA 4QBTA 3N2GB 3ZE1B 5KHOC 1AH2A 1NWCA 4P93A 2ZULA 4EHBA 4C4PA 3ZIDA 2VI5A 5ALMA 3G79A 3DL0A 1KZ6A 3MQ4A 3ZX5A 4Z3OA 4P1ZA 3IEUA 3VNSA 4B8WA 2CSXA 4AWBA 4AMZA 3OZWA 2P3SA 4AUNA 1C8VB 1FFEA 1ZP6A 2C8TA 2NUBA 2O57A 2QG4A 2RHGB 3O0DA 3ODPA 4B2LA 3QENA 4BFYA 3HFJA 1ZOLA 2R1ZA 2VF7A 4F56A 2MSDB 4JEHA 3OZTA 4UKDA 4AY4A 4NCIA 5J47A 4F5YA 2V3WA 3PC4A 5ECYA 4B45A 4DA8A 1FDVA 3F5SA 1ZA2A 3ZDZB 4LJKA 3FGZA 3EK2A 1YGYA 4Q1IA 2Q6KA 4MUJA 1AQJA 3OBBA 2ICAA 3FPAA 3LXMA 4INAA 4TPKA 1N2OA 5EXSA 2GXAA 1E3WB 2YJTD 5THXA 2QN3A 3MAJA 4F4DA 2QYTA 2PMKA 3H02A 2PZLA 2UUOA 2VA8A 2BKVA 5H4HA 3PVSA 1U0EA 2F3PA 1F0PA 1N6HA 3GVCA 3N28A 5ALEA 3KIPA 5JAZA 3GBSA 5K7SA 5KYNA 3JVUA 2P9TA 3INYA 1CY7A 4W5WA 1P5RA 2EF0A 5CDGA 4BCBA 4MUHA 2CXXA 4ZMBA 1GTRA 1TPZA 2H52A 3CMCO 4PIVA 4S1OA 1H4VB 1KARA 4Q4HA 1RFLA 3ONEA 4Q9IA 5DF1A 5TF4A 1T0HB 5LP6B 1UXGA 1L4LA 1X1TA 4DCOA 5IKEA 4DGQA 1YB6A 1OAOA 2RAVA 4Y2UA 1CEXA 1TK9A 2HQSA 2R65A 3H0KA 3BBPA 1YAJA 3ND8A 2HK9A 4M49A 2ATXA 4TKLA 3LT2A 1CR4A 3KB1A 3WRXA 1NF2A 4HUTA 4RPKA 1QAMA 1T9CA 3GNTA 2A86A 1K68A 3I76A 3H2YA 4J3FA 4AF8A 1P2VA 1DTEA 2BC9A 1ORRA 3ONNA 2DCUA 4FMCB 4MYCA 5JCZA 3RVPA 4MKIA 1KRXA 2KQUA 3FYUA 5LOVF 1RPNA 1U0JA 3SAJA 4CDNA 2CHEA 3HJAA 5A62A 2C5BA 5DL1A 5E6RB 1RFGE 1ZD8A 4LWQA 3EH1A 5IYZF 3AWIA 5TQJA 3UOWA 3AONB 3DUWA 4DLWA 3ZX4A 1PJBA 3EFBA 3SS8A 4DV3B 2ZDHA 4G5FA 4WBNA 2BGRA 3O8NA 2QTLA 3N0WA 3R9KA 2G40A 4FHEA 1K66A 4R3UC 4TTIA 4Y2JA 3RYHB 3CO0S 4YUVA 4CEHB 1NXQA 2J0SA 2FCRA 3JVIA 4U18A 4OMDA 5KYGA 3LA8A 3K73O 2HMTA 2R6FA 1U8UA 1R5NA 2G1AA 2VDNB 3IR6A 3NDPA 2DBQA 3R9IA 3U17A 3EVBA 3TW6A 3IIKA 5K8CA 4BPBA 2XB2A 3DBHA 2IBTA 1UMBA 2OT3B 3EN0A 1Y4ZA 1Z73A 1VRGA 3DW1X 1FRVA 2VT6A 3QNMA 4RE5A 3JQ7B 1VRWA 1Z5GA 3FCOA 4GU5A 2QTGA 3SDSA 5D00A 2FR8A 1MXFA 3K9CA 5KKAA 2WKPA 3A6EA 4MRMB 2DUUA 2QM8A 3BWEA 2YZGA 4N01A 4UEWA 5JNTA 2HU2A 2P4QA 1Z4LA 5DTRA 4YYEA 4V0LA 4Q66C 1AUOA 2WHRA 3PZRA 2FW1A 3R74A 1HQDA 2XMQA 4DDWA 3M49A 2D0IA 2P65A 1QFMA 3JASA 3BXOA 4GEKA 4IGAA 3TSWA 4MV7A 4KLAA 3H0EA 4PINA 4CTOA 1Q51A 1MA3A 2AC7A 2JD0A 1WHTB 4RZHA 2BUBA 5AK6A 1HEUA 4BNKA 2QQGA 1M3SA 3AGPA 1JHDA 1R4ZA 1OB5A 2IZZA 4OYYA 1XKQA 1G7TA 3ZJYA 5CYGA 1JAZA 3ZCSA 3UB3A 3Q7IA 3B3FA 2R1TB 2BCJQ 3WLAA 5B4TA 4NG4A 1R9JA 1HT1E 3IT0A 3KS9A 3LKVA 1D9XA 4LGYA 4DR6B 2XWPA 2IHZA 5LBTA 3TLCA 4F9EA 3JWIA 4M3NA 1YU6A 3PD1A 5C35A 4A27A 1UT8A 2A7KA 1G1MA 2WMNB 3F71A 2I3ZA 2ZRHA 4KEAA 4DCMA 4IIJF 4EYGA 4JDUA 1E6UA 4B2IA 1KYWA 3FUXA 4AZVA 3VJLA 1P0IA 2BJHA 2W2LA 4JX9A 1T6YA 2VSUF 2F8LA 4RTNA 2WUFA 1RAAA 1FX0A 1RABA 4ZC1A 2PZJA 2Y92A 4BKQA 3AERB 5K3FB 4ZV4A 2O2ZA 3JQGB 1R0LA 1A8PA 2GRAA 4RX1A 2NIPA 4HADA 4YH1A 3W2FA 1PEYA 4NZ9A 3ZDQA 4TZ6A 3O3NB 3UT0A 1VCHA 4OM8A 1GWNA 2V54A 2DFTA 4BP9A 4DILA 3N2IA 3ZZUA 5F9FA 3UWOA 2VSNA 1Q0LA 1P7ZA 2R7AA 1F2VA 1TM7E 3N2KA 1Y3HA 3E7XA 3OT5A 3OTOB 2VUSA 1MEEA 3D2LA 1ZBDA 2YYZA 5I4IA 4RC9A 3L8GA 2VSSF 1H1LB 2OWDA 1KS9A 3VGPA 1B43A 2YASA 1F3LA 4Y1RB 5INTA 5JEDA 4D4MA 3FNIA 2CMKA 2W48A 3LHKA 4HS4A 3RARA 4Q0GA 2GBGA 3L04A 2ZYVX 2H1VA 4Q0MA 2ATIA 5DNVA 4DV1B 1DWUA 4L9WA 1GTVA 1QO0D 1CVLA 1OLXB 1T8UA 2PR2A 2ZAOA 4DKXA 2NQ2C 3TIXB 3UMBA 1E2JA 4IDEA 4PBTA 1R0KA 3E2MA 1W0KD 3A9VA 4JV5B 5D51S 4Z0MA 2C3MA 3HWSA 1N2HA 4F1JA 1TAHA 1ZOOA 1WUHS 2BZSA 2QTVA 3ZE6A 4DAOA 8ADHA 3IOBA 5B2EA 2W6PA 1RJDA 2FSVA 2EIHA 3TMYA 4BO3A 4YAJA 1NOIA 3H4TA 4L0CA 1BA2A 2XTZA 5EZYF 4Z0NA 4ZV9A 5AW9A 1ESCA 1P1RA 3TOCA 4OK6A 5CG2A 3GD7A 5EKXA 5JIBA 1DAPA 4AN1A 1P9OA 2XE8A 4JI4B 3KSAC 3WKAA 3FHTA 2VAPA 1PLJA 3ES9A 3QMMA 1PEDA 1OFTA 3N07A 4II7A 4Y0VA 3SHQA 2P7IA 2ZBGA 5BQFA 2OO5C 5E3JA 3T4XA 1QOZA 2FZKA 1BS2A 4QL3A 4YGYA 1A95A 2IU3A 2C8KA 2YVQA 4II2A 5FWNA 4FGSA 3FTDA 4DJ5X 4MJLA 3P9ZA 4XUEA 3S0JA 2V7QA 4Z9YA 4YIKA 3I9KA 1N5LA 2I7XA 1MC5A 5D1HA 4A8TA 2OL4A 1LLFA 3ROGA 3MWEA 3BMOB 3E9ZA 3V5IA 5GY7A 5DTWA 4O4HA 4G5QA 2VSUA 1PN3A 2PUVA 3HJCA 4LXYA 4ZODA 2VJMA 4G5OA 4ALNA 4ZHSA 3NONA 4PZDA 1UFKA 1IBRA 4OLQA 3JWGA 1I8TA 3PHJA 4CV1A 1T6ZA 2O19A 2IUFA 2FX5A 4JQCA 5AW4A 2AN9A 1FYDA 5C8DA 2J9RA 3K30A 2GXUA 5JY1A 1V5WA 5DNUA 5CPFA 1MQ9A 3H2SA 3NATA 4UBJA 1C7EA 4B0PA 3W5HA 1B1AA 3ABRB 1RXWA 4XSHA 1JJBA 2G08A 3I2KA 2HPVA 5DE3A 2EBHX 5JE8A 4GUAA 4PYNA 4UNQA 1L4YA 1IE3A 1SIWA 1Z2CA 2RARA 4FGZA 1JSXA 4HWRA 1KKLA 2BFPA 1CR6A 1SZDA 2E1PA 3K1AA 3QLUC 4X45A 5H68A 4ASUA 1DIHA 1VSBA 1X38A 1AIPA 2G0NA 4P7FA 4YJKA 3ZIAA 2IOHA 4YWJA 4KN5A 3SKVA 3X1DA 3TQOA 4D9NA 4K9OA 3IKLA 4NOKA 3KKLA 3V80A 3ZLVA 2FQ1A 3QWBA 2WYHA 2EFHB 3EXFA 2GA9A 3KSRA 4OQPA 2X4DA 2VQ3A 4F6RA 1VJCA 3TOVA 2WWWA 2VDKB 3NXKA 4FOOA 1XMOB 1SUAA 3UT5B 5FO0A 2AG8A 4KR6A 3KD2A 3M6FA 3MOYA 3RSTA 4CPDA 4EATA 2WDPA 1OJ7A 2W58A 2IYSA 3DWIA 4MZXA 4Q3OA 3FZQA 1YG8A 1OIWA 3IB3A 1FRFS 2WVHA 1WA5A 4W9RA 3WYEA 3N5KA 1PIXA 1AA9A 2GVDC 4KQGA 3FLAA 1YR3A 1IZ7A 4A8JC 1PT8A 4F84A 5HKBA 2ZJ3A 2AH5A 3MJHA 2AMYA 2X0KA 2QRVB 3SG0A 4LHXA 5LNK1 4YCJA 1WEHA 1F1BA 1SHUX 1Z56C 2F3UA 3R3HA 4J16A 4PZ0A 2HUPA 3RB8A 3M81A 4DIMA 4F71A 2OFPA 1Q57A 2HA4A 2HF8A 2QIPA 3FDZB 2J0VA 2VCEA 3LU1A 3SQDA 4DBLE 5CBKA 1N57A 3D4IA 3GLHE 2IYYA 4MUGA 1N7JA 1MW8X 3OLXA 2WMDA 3HCBA 4EQ6A 4MIOA 4GNRA 2LV8A 5ALIA 3WX0A 2KB0A 3S2UA 3PR1A 3ZEIA 3SCZA 2WAXA 2R8OA 4PS0A 1RC0A 4UU0A 4MIYA 1WTAA 1DAGA 3VJRA 5DGIA 2MHCA 4HB3A 4BAGA 5BVHA 3Q7EA 3KB8A 4H1UA 3H42B 1N6LA 4YRTA 1JHYA 1I6KA 4JP2A 3DDZX 4N5MA 4YMIA 1TD1A 2ZPAA 4XPIA 3HR4A 1PR0A 3MBIA 4GYYA 4MGIR 2RFLA 3X2EA 4RJKA 3E1SA 2PSFA 3DGFC 1O1YA 2O2CA 2QSZA 7AT1A 2BN4A 4JCRA 4MKGA 2GAOA 1RHUA 2PS0A 2GEBA 3VM6A 2W4MA 1RM0A 2Q8NA 3CZ9A 1J0EA 1XNHA 4DVGA 4QHSA 1FDTA 2WKRA 4RH1A 2ZJZA 2P5YA 2XVXA 3DXXA 1N6OA 4UCWA 4HAWA