3ZWBA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
725
structure length
725
Chain Sequence
b'PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPAVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 264
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwbA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwbA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwbA01
4BNHA 5L53A 2WYWA 4OXYA 2EGGA 2QYSA 5C37A 5JY6A 2B4TO 1QYVA 4L6WA 3GNSA 2PD4A 4FD3A 5G1SA 3E9QA 2ZB4A 3WJAA 3V2GA 4DPKA 5IXYA 1H0KA 5C3MA 5T8KC 4M1QA 4K3WA 3UHAA 3D3WB 4JJTA 4LVCA 4Z9YA 3AK4A 4PZDA 4UUOA 1E7MA 4RJTA 1SOWA 3RD5A 1RJWA 3PQEA 3PP8A 1EDOA 1XEAA 3GVXA 4MVJA 2FP4A 3VAZA 4YT2A 3BXXA 3GGGA 1P31A 3SJ7A 1DC6A 1LBEA 4AJNA 1QYWA 5DCUA 1V6AA 2FRDA 2CVOA 5JC1A 1AUPA 2FSVA 4ELSA 3GAFA 3JQBC 1KVTA 3V5IA 2AQKA 5TNXA 4BO0A 1WZEA 3VH1A 3GHHA 1F0YA 4YACA 4PVCA 3L4BC 2PGDA 4WEOA 1NHWA 3DBHB 3O4RA 2BD0A 2PZMA 3UUWA 1Z75A 4DTIA 5FEUA 1J7XA 1ZK1A 3K8ZA 2HMWA 4LN1A 4Y67A 4EI2A 1PJTA 1B16A 4GBJA 1JQBA 4IJWA 1MP0A 1HTBA 3DBRB 3JYNA 5DP1A 3NV9A 2WYUA 2QIOA 5I8WA 2NTVA 5KDRB 2CDCA 4YPOA 5BNIA 5TT0A 4IQGA 5TS3A 1V9LA 2O7QA 3DAPA 3PJEA 4R9RA 4OM8A 3GLMA 1EK6A 2G0TA 4QO7A 3KEQA 2NSDA 1KVRA 2VX2A 1NQTA 3PHGA 5H83A 3ZWAA 1FDUA 4Q3EA 2Y99A 3RROA 5JW6A 3VVCA 2WDZA 2GZ3A 4L74A 1ADGA 4O5OA 3I9JA 1ZXLA 2IYOA 4XR4A 4BKOA 1MV8A 5C9GA 1D1TA 5BSGA 2E4AA 3Q9UA 2UYYA 4K6FA 2PFGA 3RUEA 2XXJA 3U4IA 3GQVA 1DRUA 1LDEA 1JDJA 4WLNA 1H6AA 3OH8A 4NNJA 4HADA 2YDXA 4G2RA 2F6QA 3F3SA 2I9PA 3VOSA 1R4NB 3HE2A 5E0NX 4FJ1A 3WGYA 4IS3A 2E82A 2X5JO 3NAQA 4NBVA 3TQHA 5IN4A 3F4BA 1SZOA 1PS9A 1CQJA 3LU1A 5F1PA 3WIEA 3PHJA 3ZWWA 2ZL4A 1H6DA 1N8KA 1TEHA 1PS8A 4EMPA 3ZWPA 2A4KA 3O26A 4R68A 4FJ2A 1DFIA 5G0SA 3EZLA 3KSUA 3OEYA 1U7TA 4AJJA 1HLDA 1YGYA 4E5KA 3VIVA 1V0JA 3PHIA 4IDDA 4BQPA 3RBZA 1U28A 2GCGA 4ZGWA 3ZWCA 2X58A 1NVGA 1K89A 3MCVA 2VNAA 3EC7A 3KTDA 5LCXA 4ZRMA 1YDEA 1XNVA 4O6VA 4BNZA 3HADA 1J4AA 2A35A 5A05A 5GZ3A 5L7WA 4MVJD 3VZQA 4YWJA 3S55A 2TMDA 5B4VA 3MEQA 2C82A 4Q3DA 9LDBA 2Y1OA 2GYYA 4GX1A 4NBRA 1MXFA 3BMOB 3UFXA 1KVQA 3Q0EA 3FTPA 3CSDA 4RPJA 2NACA 1O8CA 3GN1A 1FDTA 2WE7A 3UH1A 1VSUA 3WICA 1XELA 3GEGA 3DC2A 1PGNA 2H6EA 4NI5A 4RL6A 2PKQP 1YH3A 4BO7A 4MVJE 1HYGA 2UAGA 3GAZA 4BKQA 1I2CA 1GQ2A 1T26A 1F06A 1I3NA 4NIMA 4BNYA 3QVOA 5DU4A 5KJFA 1ZH8A 2ZTMA 1DCIA 3JQAA 4QSMA 1HE2A 1EFKA 5IZ4A 1DC5A 1DJNA 3DZIA 3LSYA 4RF2A 4WJZA 4OQZA 2VSSA 1AHHA 2DTEA 3F1LA 4KQXA 4JIGA 4NU6A 4ZVVA 1BTOA 4LCJA 1E7RA 3L6EA 1IUKA 4GLLA 5DBGA 2HQ1A 1DFHA 3OETA 3TZCA 3BMCB 2P2SA 4XD2A 2VT2A 5T57A 2GDZA 4I42A 1PZFA 5B4TA 3WGQA 3QKAA 2EKLA 1AE1A 3IUPA 1V3TA 3G17A 3GA0A 2WD7B 4IJKA 1DBVO 1P3DA 4I5FA 4UUPA 4B7CA 4WYOB 2VWPA 4C7KA 3JQGA 4CQMA 3C1AA 3WLFA 3IL2A 4Q0GA 4DC1A 4JN6B 4UREA 4HFMA 3OMLA 1X7DA 2F9IA 3TN7A 4Z3DA 1AXGA 4U1AA 4U6QA 1SOVA 3A9WA 3ZHZA 8LDHA 3DONA 2J3KA 4FOOA 2BH9A 5IKLB 2PLAA 2RCYA 4F3YA 1K2WA 2YZ7A 2EP7A 5DULA 1GR0A 3JCZA 2ZCUA 3GUYA 3WXBA 3ZW9A 2Q45A 5TJ9A 4YR9A 2A7KA 4CM5A 3K2EA 4URFA 3OFSA 4L8KA 4GWKA 1ZZEA 3HQ4O 5F21A 1XO6A 5ILOA 4XQCA 2VREA 3PFFA 4RCNA 4FFOA 4KPKA 1M67A 1Y7OA 1ONNA 5A4DA 3HDYA 3L4SO 4A10A 4WCFB 2PH3A 4PLWA 2FPPA 3U5TA 5JAIA 4WZ8B 1QMGA 1BSVA 3DZBA 1GV1A 4FBGA 4NBTA 1C14A 1XDWA 2DPHA 4XDYA 4D3DA 4AJ4A 1Q7CA 3MJTA 4MKZA 4B3HA 1UIYA 4CR6A 4PLVA 2VSUF 4NK4A 2AG8A 3MJVA 3ZWBA 3DWFA 3WBFA 4D46A 4OSPA 2EJWA 1BG6A 3GVCA 3KTHA 3I1JA 3R6HA 4ZHSA 5KKAA 3RQSA 4CL3A 4Z6KA 1Z7BA 3NT2A 1B8UA 3E5RA 3GGOA 3S2IA 5JCXA 4OH1A 5JDIA 5JDCA 3WWYA 4CR7A 5T64A 3JQ9A 3WB9A 3KXDA 1NPTO 4BS9A 4DXHA 5J23A 4BNNA 2W8ZA 1YL7A 3IJPA 4TRMA 4I4ZA 4YLHA 3JQ6A 1I36A 3K96A 3N7UA 3JV7A 1NQAO 1ZK4A 4EJMA 2H63A 4NR0A 4UVDA 4RGBA 3DJAA 4RV9A 1YJ8A 5G1QA 3IUSA 3SWXA 1GQQA 3K50A 1E3SA 1PGJA 1R0SA 1VM6A 3P5SA 1FCFA 1T2CA 3UCXA 2VWHA 5HM8A 2E6UX 1I01A 1F14A 4L76A 4MKRA 3IB9A 1HETA 2O3JA 1TB4A 5ER6A 1E7WA 5CTBA 3WMXA 3H81A 1C1DA 2YJZA 3LC7O 4HP8A 5HWSA 4FS3A 1VRGA 1YONA 2EW8A 4P22A 1SBYA 1UP7A 2NU9A 4QTZA 3UW3A 5KJPA 4IJUA 4GMFA 3ORFA 3NKLA 4L0QA 1ENYA 1U2GA 4OAQA 4YRBA 4AJEA 1NZYB 1EK5A 3ICPA 4JP3A 1KOLA 4DLBA 1HNOA 4MP3A 3RWBA 1HSOA 4R4JA 1MG0A 5DUCA 1TI7A 3FDUA 4CQMD 2EKQA 4JLWA 1PJQA 3OIFA 5A3VA 4IPTA 3R9SA 3H3JA 2D5CA 4I08A 1I24A 1HDOA 2GZ2A 4YT8A 5MGBA 1IZ0A 1GYRA 2V6MA 4UEKA 1HDZA 2IDZA 1LXCA 3QJ5A 4N5LA 4PLZA 3X2FA 2W3PA 3KLMX 4AJ2A 4XB1A 1HXHA 2NVWA 2JAPA 4BIIA 3STHA 1DSSG 3K5PA 5TX7A 4XCVA 1PIWA 2VUUA 3QMJA 2VYVA 1WMAA 1UZNA 4MO2A 3B1JA 1IL0A 1SAYA 4PLHA 2YHIA 4QFEA 4YYZA 4BO4A 1T4DA 5JDIC 3ICCA 4KWHA 1Q2XA 5JDCC 1DB3A 1GCUA 1VPDA 2FWMX 1D1SA 1NM5A 2Y93A 3JQ9C 3PGJA 4OJNA 2O2YA 3FBTA 5CHEA 3OQBA 4JOTA 2DUWA 5KNLA 1LRLA 2NU7A 3ASVA 4QFDA 4JCTA 5CG1A 1U5AA 5L4SA 2AMFA 1NTOA 3QY9A 3ZNOA 3LAOA 2OO5A 2A92A 4J0EA 2G17A 1EMDA 4ZD6A 4R1NA 2Q2WA 2POQX 4L73A 4CMEA 1DIRA 3RU7A 2HKIA 5IG2A 4CLHA 3H5RA 1SPXA 4M55A 4GKBA 1Z7EA 1DJQA 1GTMA 2BGLA 4MPDA 2P4HX 1FC6A 3RU9A 4TZTA 3U9RB 1KBZA 2FPGA 1Z82A 1ENOA 5DN9A 5DKPA 1JLLA 3TF5A 4HX5A 3WGOA 5JE8A 4PZCA 2P4QA 5I9MA 3I47A 4J3FA 1H2HA 4WLVA 5CDSA 4CUZA 1T2AA 5KCZA 2XOXA 5L7TA 1Z73A 2X6TA 2FOIA 3I3OA 1EVYA 4J9UE 1D8AA 3H2ZA 4XA8A 3SBOA 4XGIA 4FFMA 3TJRA 4UEOA 2ZL0A 1ONOA 1XR3A 4OMRA 5KJ1A 1P1RA 2OORA 4XGKA 1X0VA 4I9HA 5LDHA 2RH4A 2Q4EA 3GLQA 2PG8A 2IRWA 3V5EA 2VN8A 3JQ8A 4ONEA 5A1TA 5IDXA 2C20A 4Y6RA 3ZV5A 3N74A 3SLGA 4YJHB 3PJFA 4K26A 4TMFA 1Q52A 1XHLA 3AUTA 1R4MA 2OL4A 3DAGA 4ZQFA 5F1OA 2V6FA 1XKQA 3DDNA 2CVZA 2CBYA 1LTHR 7MDHA 3UN1A 2Y1EA 4NJOA 1PJ2A 2WD8A 2EW2A 4PCVA 1G0OA 2UUOA 3D3EA 3WDSA 4OKIA 4N5NA 3G3EA 3KM0A 1IZ9A 4W4TA 1XGKA 2P68A 3JYLA 2W2KA 3A4VA 3ZWXA 3IOYA 4NH4A 3DBRA 3F47A 2GPTA 3QVSA 5BT9A 5KDRA 2FZWA 3GMDA 3PWSA 3TZ3A 4J4HA 3HLN1 4G5HA 4GI2A 4FJWD 2V7PA 3R3JA 1Q1NA 2D1YA 3NUGA 1GD1O 2D3TA 4LW8A 4BGIA 3QWFA 3PXXA 4MP6A 4JBGA 1XQ1A 3HN2A 1EBUA 2NWQA 2Q3EA 5EESA 4D7AA 4PLYA 2X24A 1DO8A 4RCVA 4CQMB 2VYVD 5BNTA 4RPLA 2Q4BA 4ELXA 4H7PA 1XNYA 3MYBA 2C2XA 4IINA 2C07A 2F9IB 2YFHA 1H94A 3ONFA 3V5NA 1VL0A 3AJRA 2OHXA 4XQEA 3ZNQA 1YS4A 3ZWVA 2BI8A 2X8LA 1LQUA 1N92A 1W4ZA 1GEGA 1ORRA 4AJLA 3I9OA 3DHNA 3H4VA 4CR8A 1YQGA 4GPD1 1R4NA 1DFGA 1HE3A 1NXQA 4XYEA 2VSUE 4IIUA 3ZNPA 1OAAA 4FFRA 5I7VA 4ESOA 1QORA 1E3IA 3CKYA 3LDHA 5DDIP 1P1KA 2QRLA 1UAYA 2XF8A 4J6FA 3GC6A 1DLJA 5I8ZA 5BNFA 3TL3A 1EF9A 1ONPA 3Q7HA 3JQDA 3KLPX 1K6XA 2OZPA 3CUKA 1CIVA 4FZWA 1Q0QA 5EIOA 2GLXA 3VTFA 4EEZA 4Z0MA 3T8AA 4II3A 2JHFA 4E2ZA 4OO3A 3QLJA 4BO2A 3FTNA 1ULSA 1P9LA 1ON3A 3GDGA 2CMDA 5G4KB 1K0UA 3AUAA 1W73A 1ZMOA 2I3AA 4IM7A 2PKRA 1NQOA 4D41A 1PL6A 4ROSA 4R54A 4PVDA 2YQ4A 1X14A 2C7GA 2CUKA 3TSCA 3MOGA 3AUUA 3DAFA 2UV8A 4BO5A 1XLTA 4E13A 2PR2A 4HY3A 1B2LA 2J5GA 3LZ6A 4LRSB 3OEWA 4I5EA 4XEHA 1JKJA 1NFRA 2UDPA 2IYPA 3CTMA 5INIA 5JO9A 2BLLA 4Z0PA 3CMCO 3EK2A 2WJPA 3BMOA 2G5CA 1T1SA 4LISA 4MOUA 3CEAA 4YJGA 2CFCA 3WSVA 5BQFA 1V3UA 3TNLA 4AVYA 1PEDA 5I9NA 3LT0A 3LC1O 4Q39A 4YBZA 3GMAA 3QXIA 3RRVA 5H82A 4MINA 2FZSA 1A7KA 5CPBA 2QRKA 3QVXA 1FJHA 1M2WA 4LSWA 4R3WA 3QYRA 3H65A 5FFFA 3GVHA 5KJEA 3TL2A 3E82A 1R16A 1UJMA 3AOGA 3WGGA 3IIEA 3ZGYA 4FB5A 2F9YA 1H9AA 1PGPA 1SO8A 4QQRA 4XKJA 5DZKA 1Y8QA 3HNPA 2X7HA 2P9CA 1GDHA 4K9DA 4ZQGA 5F5NA 4P4LA 2HMVA 2NUAA 1RJMA 5KIAA 2DUBA 3WYEA 3BMCA 1HEUA 1GZ6A 1T24A 4ND3A 4M89A 1BXZA 4A73A 1QV7A 2RIRA 2JFFA 2NTJA 3F4LA 1Q51A 5CEEA 2Y1CA 1E92A 3RSHA 5FIFA 1K3TA 2WD7A 1IPFA 3ENKA 5JXWA 2Z5LA 3JQCA 5A9TA 3M6NA 4U0GA 2O3RA 1QSGA 1PWXA 4MVJP 4PG7A 2GNAA 4NHEA 3E18A 1P1FA 3S2FA 5AQ1A 4FZWC 2PY6A 4S1VA 3NTQA 2AQIA 4CLXA 1YBMA 3BF0A 3QQPA 5KVQA 3ZV4A 1HZZA 4Y98A 2PGLA 3QP9A 4CM9A 4JCQA 4XWYA 3L4BA 3ITDA 5EINA 3WMWA 4JBIA 3Q1LA 4A2CA 2NM0A 2ZJ0A 4CMBA 3GVPA 4JJGA 4BVAA 4IMPA 5I9LA 1HE4A 2BHLA 2EERA 5ER9A 1ON9A 4GGPA 1R66A 4BGEA 2Q35A 2I66A 3GG9A 4J2HA 4OSOA 2D59A 1DIBA 3ROPA 4BNUA 2IXAA 1I0ZA 4BNMA 4HNHA 2ET6A 4WCFA 4BO9A 5INGA 3AOEA 1E1NA 3OBBA 4DC0A 3N6RB 2OP0A 4ID9A 2QG4A 2I3GA 1OBFO 4YXFA 8ADHA 1VL8A 2B83A 2GN8A 3O8QB 1XWFA 2JL1A 2JJYA 1PQPA 3H3FA 3NTOA 1B7GO 5THKA 4OG1A 1O95A 4ZU3A 4H15A 1K32A 2HJRA 3I9NA 3I83A 3B70A 4CLEA 2CF5A 1WNTA 4FOSA 1YG8A 4DGSA 4MOWA 4IUYA 2J5GD 3NRCA 4XIJA 4R1SA 3EHEA 1UXHA 4XGNA 4J4TA 1UZLA 3AY3A 3TFQA 1KY5A 1YXMA 4WNCA 1HDCA 4TZKA 3UCFA 4L75A 2WEKA 3L07A 2X86A 3GZNA 4IXWA 3KYCB 4R51A 4CLRB 5A06A 4GX5A 2GERA 3PQFA 4OOFA 3RSTA 4XRRA 3ZU3A 4XB2A 1UDBA 3BTOA 3IJRA 4I1IA 4PRKA 2AEJA 2CF6A 3BHIA 1BXGA 4JNKA 1GPDG 1H9BA 1VKOA 2DVMA 4PRLA 3JQ8B 1NFFA 4MVJI 3IS3A 3A1NA 3EDMA 3Q9NA 3H0SA 1BMDA 1CF2O 4ND5A 2C7VA 1PL7A 4YRDA 4D44A 5JC8A 1R4MB 2ZQRA 1EDZA 2Z1MA 1B8VA 1E7SA 4CQLB 1NQ5A 4MP8A 1TVEA 4IQ0A 3QV1A 1MUUA 4UEJA 5KKCA 4GM2A 4E5NA 3ONDA 1YJQA 1LDNA 2JFHA 2AQ8A 3SC4A 1FC7A 2HLPA 4PLCA 3G49A 4LMPA 4OXNA 5ITWA 4KDFA 1S6YA 1NZYA 4OIMA 5JLAA 3BAZA 3A28A 3BYZA 4XZ3A 3TLFA 3JD4A 4EUHA 2W2KB 2DFDA 2NU6A 2AA3A 3ZV3A 3UAGA 2F6IA 3BMQB 1WDLA 4IMRA 3K73O 3DMTA 4FC6A 2FR1A 4NBWA 4WCFC 3AOEC 1B15A 1X7HA 4MVJM 3VKUA 1XIVA 4WOJA 3DR3A 2C29D 2PK3A 2XAAA 3P7MA 4MI2A 4QIJA 1R37A 2VZ0A 1ISJA 2VHYA 4R3NA 4CM9D 1GYQA 1I5RA 2E48A 3DZHA 3Q6IA 5JY1A 1KEVA 2FR0A 3ADOA 2WWRA 2VZ9A 3B1KA 5HTOA 5B12A 3UGKA 1FXSA 5KJ6A 2V6BA 3ZHBA 2O48X 1UH5A 3AM4A 3JQEA 2PD3A 3TZKA 3ZHYA 1PGOA 5HS4A 4E2WA 4I9UA 3F5SA 1E1LA 1FF9A 1IHXA 4LK5A 3VPGA 5A5FA 4J7CA 4OKNA 4W7IA 2HSDA 1ZBQA 3LK7A 3I9LA 2HK8A 2HMSA 4YAKA 2QW8A 4XYMA 4GHNA 4ZDCA 3DOOA 2J6IA 3PVZA 2CE3A 3WR5A 4UAGA 3LYLA 3DHYA 3ZU5A 1DEHA 2GD1O 1Y5MA 4NK5A 1U8FO 2Y1DA 4E4YA 4B3IA 3ZI0A 4J1QA 1IPEA 2C59A 3Q3CA 4EZBA 1ZEMA 2WMDA 1X13A 3M6IA 3KVOA 1PJLA 4AFNA 2XPCA 1HZJA 4Q9NA 1HLPA 2W90A 1F8FA 4AG3A 3MWDB 4K29A 3QSGA 1EE2A 3GG2A 3OIGA 1T25A 3HSKA 4RPHA 3KUXA 1QV6A 5KWEA 3H5NA 3GMSA 1YBVA 4HWKA 2W98A 3PGXA 2Q2XA 2D2IA 4JGBA 4D42A 3DMTC 1ZNQO 1ULUA 3JQ7A 4YJGB 4GSLA 3T88A 1SC6A 1ID1A 4YJHA 1NWHA 1FC9A 3QVTA 2JCYA 2VQ3A 2EV9A 3E9NA 3M2TA 5FWNA 3PYLA 1MG5A 2BMAA 3RC7A 3GY0A 3HFGA 1U3WA 1GU7A 1TT5B 3ZH2A 4DMMA 4FNBA 1O0SA 4J7UA 4OL9A 5G0VA 3W8FA 3VH4A 1V8BA 2JCVA 4ZA2A 4KNPA 1QKIA 4WK6A 4EDFA 2C0CA 4FB8A 3ZWMA 3NEPX 1Z6ZA 1TXGA 2F9YB 3P19A 3M1AA 4BGUA 5HS6A 4XR9A 4DA9A 1Y8QB 2WE8A 3S2GA 4AJOA 2DBZA 4XYLA 4BB6A 2ZTVA 3E48A 3MJEA 4KTVE 5BSFA 4WGGA 2DPGA 3MJ4A 1HL3A 4RDHA 1NWCA 1F12A 1ZO8A 2PKQO 1DAOA 1JWBB 2QX7A 2JFGA 2FPIA 4TRJA 3QWAA 3JYOA 1M6HA 3PFWO 1G0NA 3TT7A 3JU1A 3IKVA 4I8XA 4R1UA 4NNQA 4CMJA 1MXHA 3AWDA 5DBIA 1DC3A 1I3KA 3I6IA 4GSKA 3LF1A 5BSHA 4R41A 1KY4A 3H9JA 4C4OA 3AUSA 4WOKA 4BNKA 3MJSA 5IF3A 5C7IO 3WQRA 1DIGA 2I67A 1PJSA 1YL5A 1A72A 5JS6A 1ISGA 5JYDA 3R1IA 4Z9XA 4CJXA 3Q1TA 4LRTB 1G6KA 4L4XA 1ISMA 1U7HA 2PV7A 2X0JA 5T6BA 4CV3A 4RVSA 4DPMA 5IXSA 1XX4A 1NHGA 4WECA 1BW9A 4YT5A 2HRBA 3VDRA 5TT1A 4Z3KA 5BSEA 3CPSA 3E5MA 4GKVA 2BELA 4L4SA 2AE1A 3AI2A 1ZUD1 2O4CA 3G79A 1K6IA 2IEBA 3HB4X 3OHSX 1ZSVA 1E1MA 1SG4A 2NLOA 5DZKH 3RSIA 2HK7A 1WPQA 5HBRA 3G1TA 1EVZA 1B14A 2C54A 2BFPA 1DRWA 3WG5A 3CXRA 3F5QA 4XX0A 3OJLA 3EYWA 4BNGA 3SX2A 3QK8A 2YV1A 4DRYA 4K28A 7ADHA 1CETA 5L3ZA 3V1YA 3ANMA 4BGVA 2GF2A 2J5KA 5ES3A 5G4KA 1Q0LA 1T1RA 3HZZA 1FK8A 1A4UA 5IZCA 3NDIA 4EUFA 1BDBA 2H1SA 1C0KA 3RC2A 4DLAA 2J5QA 5JMWA 2TMGA 3ADPA 1YB1A 3K9QO 1Y9EA 5MDHA 5BR7A 4D43A 4QFCA 3BMNB 3FNGA 3W4IA 3VZRA 3I9MA 4EMMA 1VE9A 5ENVA 3G1UA 3L9XA 5U9CA 4RYFH 5TRTA 3NJBA 5AXCA 2QRJA 3HDQA 4CM1A 3GZNB 4Y9DA 4UULA 4YAIA 4ZJUA 2AEMA 5COAA 3WTBA 5L45A 3ZV6A 3H2SA 2PGJA 1YB5A 4U8GA 5F1KA 1JTVA 2I65A 2Y68A 4OHUA 4JBHA 4AICA 1ZCJA 4R5MA 1DC4A 1PGQA 2OUIA 1H6CA 2B0JA 3KO8A 4IGFA 1BXGB 2W2LD 3D5TA 3QVWA 1OOEA 5A02A 3NGLA 4IDEA 3PHLA 5DU6A 1Y7TA 4TSKA 3AFMA 4RVUA 3LT4A 3PYXA 3NJDA 1Y9AA 4CL8A 5DBFA 2DEOA 3KTIA 1RJNA 1PQWA 3A14A 1YQXA 3GN2A 4P38A 4TQGA 1W0CA 1UXKA 2H5LA 1W8DA 2PTGA 4IGEA 3R0IA 4L4RA 5COBA 2DBQA 1QLJA 5E0SA 1BVUA 1GPJA 2VRBA 4JJFA 4RZIA 1TYFA 1QR6A 3H0QA 4HV4A 3X2EA 1DXYA 2ZB7A 1JKFA 1F17A 4E5PA 1EY3A 5G4LA 4CM7A 3WOHA 3H8VA 5L4NA 5CAEA 2ZATA 1B26A 1KERA 1GADO 4FCCA 1HYEA 1O94A 2HW5A 4E6PA 3WQSB 4F45A 2UZFA 4YTEA 1MC5A 2CNBA 2AXQA 5JPIA 4ZQEA 4PIVA 1T2FA 4BV9A 2ZQQA 2R2GA 1PR9A 2VHXA 4ASIA 3GR6A 4MVJH 1YKFA 5IZCC 4U0HA 1MC4A 4K1LA 4KZPA 3VVBA 4NDNE 3Q2KA 2CZCA 2PZJA 3TPCA 1EUCA 3D5QA 1X0UA 2QQ3A 4MIOA 2VSUA 2GUGA 2HCTA 5EN4A 2YW9A 4N18A 2X0IA 5EJ2A 3TZQA 2CDAA 3O38A 2GSDA 2J3IA 3KV3O 3KYDA 1E7QA 1GZ4A 2O23A 3WGTA 3C3XA 4CMIB 2CDBA 3PPIA 4JYLA 2X5OA 1I32A 5A9SA 4BQRA 1J5PA 4JROA 1UYTA 3P2YA 3RC1A 1LLDA 1YOVA 5FI3A 1H5QA 4XJTA 2Q46A 3ZCXA 3U4CA 3O8QA 3IMFA 4XYGA 1MFPA 2GN6A 3KBOA 1RWBA 4O1MA 4W7HA 1RKXA 3U9LA 1V35A 2Y0CA 3LVFO 4A26A 2AG5A 5IDYA 3NT4A 1D7OA 2DTXA 5JMPA 3F9IA 4WNIA 1P1JA 3F1KA 5IAAA 1WWKA 2OOSA 4MDHA 1LLQA 4RLSA 1QP8A 2DAPA 2ILTA 1I3MA 3WX0A 2BRUA 5K9ZA 2HU2A 4PZEA 4E33A 2Q1WA 2WTBA 1JU9A 3ULKA 5G0WA 3H7AA 5L51A 1PZGA 3KYCA 4M87A 2VZ8A 4YAGA 4CLRA 1NAHA 4IZDA 1QRRA 4DQVA 5EPOA 3JD1A 3TZ6A 5CEJA 4JP2A 1YWGO 4RQUA 2OBYA 3VPXA 4EEXA 3GRPA 3WS7A 3ZDFA 2D4AA 5K6AA 3TDCA 1HDGO 4WEQA 3DO5A 2PH5A 3H9GA 4WCZA 1RYEA 3JQ7B 2ZYDA 5A03A 3T89A 1P33A 2JCXA 3DZKA 3E6AA 3IP3A 1NVMB 3V2UA 5KJCA 3OC7A 3LT2A 3UXYA 3HDHA 4F47A 4CQLA 1RPNA 4E5YA 3RJ5A 5A3JA 4O63O 1MLDA 4XDZA 3WYCA 4J49A 2BFMA 2C2YA 4B8WA 2VSUC 1KETA 4TKMA 4XYBA 3GZ4A 2J5SA 2GR9A 5C7LO 1WZIA 3RCBA 1PTJA 2VT3A 4OGWA 4UVEA 1OD4A 4FNDA 4JVTA 4BHTA 2VHVA 4EMLA 1VJTA 3BMQA 3TOZA 1M76A 3AI3A 3GUCA 4RPKA 1NNUA 4DIBA 4KWIA 4B4OA 2ZYAA 1CJCA 2JKVA 4TWRA 5CG2A 4ELWA 5FF9A 4YDRA 2NU8A 3OSUA 4Q1IA 4QT0A 4PLGA 4DLLA 1ZSYA 4ND2A 4A27A 3JYPA 1XYGA 4FJ0A 1I33A 1OC2A 3BHJA 4YEDA 1WDMA 3DBLB 2G1UA 3HB5X 4BB5A 4YAJA 3SLKA 1P74A 1Y5RA 2Q2VA 5EQFA 2BZRA 5DTWA 3FNFA 1NFQA 2V65A 4BNTA 4AJ1A 1EQUA 1XQ6A 3T7EA 2RHCA 4BKPA 1JWAB 4DIOA 4MKXA 3FNEA 3U9TB 4KDEA 2EEZA 1ZFNA 3JD3A 2VHWA 4ITUA 3E9MA 1E0DA 4N7RA 5I7SA 4FSHA 4DYDA 5KVSA 1E5QA 4JCOA 4ALNA 1NR1A 3AFNA 1BW9B 1GL3A 2JAHA 5JO0A 3BTVA 4CLOB 5IDWA 4GX2A 4EJ0A 1WW8A 3B6ZA 4CUJA 5F5LA 4CM8A 2P5UA 3FSRA 3HDJA 4HXYA 2A81A 1R0LA 2FW2A 4I52A 1BHSA 1U3VA 5K6AC 2JD0A 3OM9A 3RI3A 3NDJA 1H6BA 4TRNA 2I99A 3SVTA 4JWVA 1XNWA 3CIFA 2Q1TA 3OF2A 1R6DA 3PHHA 2D8AA 2YFQA 4IIVA 5CP8A 3H0JA 1CRWG 3IAVA 3OJ0A 2ZL3A 4M8SA 3MTGA 4IS2A 5DOVA 1PU2A 2O2SA 5C7OO 3M2PA 3WGHA 3TV5A 3Q0GA 3PLRA 3L9WA 5CPFA 2OP1A 1KYQA 2AE2A 2GN4A 1WLYA 4FFNA 2R00A 2J8ZA 4W99A 2VWQA 4U19A 1YO6A 3RJ9A 4NMHA 2Y0EA 3W1VA 4J90A 4IXTA 3INTA 1GAEO 4W82A 1KC1A 4DIFA 3MTJA 4HFJA 5IDQA 1SZJG 1LJ8A 2I6TA 3GPDG 3GF3A 1E6EA 1X7GA 1UDAA 3IP1A 2GRAA 1LC0A 4RF4A 3WWZA 5A04A 1C1XB 1X1EA 1UYRA 1WDKA 2GO1A 1DAPA 3VDQA 1GY8A 1PJ4A 2NADA 4BL5A 4IZHA 1MX3A 3RUAA 3NT5A 1TT5A 3PYMA 5DUFA 3LLVA 3NJ8A 1VJ0A 5JAZA 5CDGA 2BFAA 4D3FA 1N9GB 1J0XO 4KD6A 1MGOA 1DIAA 1E6UA 1WMBA 3FN4A 4R5HA 1DLIA 4DI1A 5DT9A 1U5CA 3JSAA 1PL8A 3C24A 3I6QA 5JCJD 2ZB8A 3E1KA 4CM3A 1WZ8A 1ZJYA 3KETA 1GQYA 3C85A 1L1FA 5L4LA 4RVGA 5KOIA 4KOAA 3DFZA 4GLOA 3PDJA 1U3UA 2E49A 4Q3BA 4QEDA 1K39A 4BMSA 2QHXA 4HC8A 4E3ZA 5DU8A 5JBXA 1VKNA 2J5IA 4RVHA 3W4JA 3PTZA 3R9TA 1QG6A 3PRJA 4AL4A 5LDGA 1I10A 4EW6A 3FF4A 3V8BA 4P4NA 3ISAA 4O59O 4GX0A 3LF2A 1PX0A 1EVJA 2P5YA 2Z95A 3TZHA 4D79A 2HDHA 4PG4A 1P1IA 3DEYX 2AEFA 4B3JA 4A03A 3OA0A 3FWNA 2DT5A 4BV8A 4WLUA 1YBAA 1Z45A 4TVOA 2P91A 1HYHA 3R0OA 4HUJA 1E3EA 3I52A 3KSZO 1KVUA 1EUDA 4MVJF 4U18A 1QYDA 4GVLA 3RKUA 2O3UA 3RVDA 1GYPA 1GUYA 1HF3A 2R00C 2NVUA 3QHAA 4OOEA 2DQ4A 2QYTA 1KIFA 1Y8RA 1XA0A 3H9QA 5EMHA 2AQHA 4BNWA 3KYDB 3PIIA 3O03A 2Y1GA 4OLQA 2BKAA 3BTUA 5A9SB 1E3WB 1HSZA 1PJCA 2GASA 4J7XA 4UUNA 3QA9A 3HP0A 1DDOA 1YOVB 3PDUA 3ETEA 4LMRA 3GF7A 1N7HA 3NTRA 1E6WA 3D7LA 3GT0A 4QO8A 4YVFA 2Q1SA 2YV3A 4DPLA 1E1KA 1M66A 4YAEA 1MB4A 1AGNA 4CLDA 1Y1PA 3DZFA 2ZTLA 4LK3A 4NBUA 1VJ1A 2PZLA 5DCWA 3WNQA 5C5IA 2VTDA 3U3XA 2PZKA 4DQUA 1Q7GA 1UYSA 4I5DA 4QUKA 3ENNA 2EHDA 4E5MA 3Q11A 1Q7BA 4OYRA 3L0DA 4RZHA 4H16A 3BMNA 4A7PA 5KVVA 4ZICA 1N6DA 2HUNA 4WLFA 3W8EA 3L77A 4PG6A 4O0LA 4BO1A 2FZEA 4E2XA 4NQZA 5CDTA 1OC4A 1CWUA 2NVBA 3HN7A 4RF5A 5KVCA 1HZDA 5CTCA 1E3LA 3BIOA 4R69A 1P0CA 1VRWA 1N6EA 3ZNNA 3JTMA 1LX6A 1HDXA 2LDBA 3R9QA 1IB6A 2OGUA 3PK0A 5ICMA 6ADHA 2PBPA 1PJHA 1OMOA 2X9VA 3WFIA 2A7SA 1KC3A 2DTDA 3PQDA 4J16A 3ZWOA 3RKRA 2NNLD 3FR8A 4P4GA 4GGOA 1ZVMA 2QQ5A 2ZIZA 2IEXA 1O6ZA 3A06A 1GEEA 2Z1NA 5I7FA 4G65A 4Y8VA 4ZQHA 4RQTA 1YG6A 5THQA 3R3SA 4FDAA 4YQZA 1HNUA 3KTKA 3U0BA 4BNIA 3ROKA 2EF1A 4FN4A 4KMSA 3QE3A 1CERA 3EAGA 3RUFA 1U3TA 5H81A 2X23A 1C0PA 3NDRA 2DM6A 4CM4A 1GUZA 5A9RA 4BO6A 2CY0A 1I30A 1LUAA 4BNFA 4ZRNA 1JN0A 2X1HA 3I4CA 3WG9A 3FNHA 3AY7A 3B20A 5AXBA 3CH6A 3BEZA 1P77A 4NEKA 3UCEA 4N54A 3ROQA 2PD6A 2J3JA 2FR8A 5TJHA 1DRVA 1SNYA 3QXZA 4B4UA 4KUEA 1ISHA 3UVEA 1C3VA 3P2OA 3IC5A 1H2BA 3W8DA 3OJOA 4BUCA 1DHRA 1PIXA 2HRZA 4I5GA 1OI7A 1LDGA 2FMUA 2FY8A 3W4KA 1LC3A 2C8TA 1ZK3A 2X0RA 2HK9A 2G82A 4HBGA 1R0KA 4FPXA 4CMIA 1VSVA 4CV2A 1L7DA 3T8BA 1NPYA 1UXJA 4FFLA 2YV2A 1YE3A 3DOJA 4FN7A 5JYEA 2Y66A 1L7EA 2ZJ1A 2X0NA 5U4QA 3WTCA 3JD0A 3K8XA 2UUPA 3GK3A 3RBXA 5DL1A 3EVNA 1A71A 1WP4A 2B5WA 1JVBA 4BMVA 2DKNA 3SEFA 2ZYGA 4PN3A 3K31A 4KP7A 4CM8B 4AJPA 1BVRA 2ZTUA 2ZL2A 3IBBA 1NP3A 3JQFA 1QYXA 2RBEA 2DC1A 2SCUA 4ALIA 2X22A 3K92A 2VSSF 1IULA 4JYJA 1GZ3A 3GRKA 3SC6A 3PEFA 1GV0A 4IJVA 1K6JA 4DL9A 1A5ZA 5G2OA 3GH3A 3KTJA 1KEPA 1IHYA 2YDYA 4KUHA 4TVBA 3QW2A 1EEHA 3VH2A 2IE0A 3UF0A 3ITKA 1DPGA 4JK3A 4TRRA 3U49A 1LDYA 3ANNA 3VZSA 5DF1A 5AVOA 4HNKA 3S8MA 2IZZA 4DBZA 1GFSA 4FC7A 5CEFA 4LGVA 1HDYA 4CMGA 4B4WA 2YYYA 4GMGA 2VCYA 2Y05A 3WGIA 3HINA 2A94A 1YL6A 1ADFA 3OA2A 4CM6A 1HDRA 5IFLA 4NG5A 1Q0HA 4UVIA 2I76A 2YQ5A 3FPLA 3NX4A 3GFBA 1LQTA 3OT6A 3BTSA 4RF3A 1PQUA 5TQVA 1A27A 4EUEA 3G64A 1EQ2A 1ENZA 4QXMA 4ND1A 2NQ8A 5B1YA 4IZBA 2HMUA 5EERA 5GZ6A 1XCBA 3UICA 1IYZA 3KZVA 3TOXA 3OJFA 4F6LA 1A9ZA 3PWZA 1ADCA 3H6KA 3VPSA 4GQAA 2YY7A 4E0BA 2VWGA 3B1FA 2W2LA 3PGQA 1A7AA 2VUSA 3I9KA 3DTYA 4CMKA 1B3RA 4D45A 2HAEA 5JAMA 3VKVA 3INGA 1EUZA 3PI7A 4G2NA 3RIHA 4E2YA 4QECA 4JCSA 2UVDA 4J2OA 4U6SA 3GDOA 4Z0TA 1UP4A 3LQFA 2EJ5A 4JXKA 4RVDA 4C7JA 4UUMA 4WKGA 1LA2A 3EGOA 1BWSA 1DHTA 2B36A 2I5PO 4FR5A 1ZIDA 3KYBA 1IE3A 5L95A 3GEDA 1U4SA 4HFNA 3PZKA 1N1GA 3IDSA 1A4IA 4I9NA 3ZHXA 1YQDA 2J5IB 4E21A 3WJ7A 3GF4A 1E5LA 4ZDEA 4J1NA 2XXBA 3JQFC 3DBLA 4X54A 4D0RA 3MZ0A 1PJBA 1YDWA 3BZUA 5B37A 3L6DA 4YCAA 1XU7A 1ZK0A 2ZB3A 3FHLA 1BXKA 2NTNA 1UAGA 2BF7A 4CMCA 3VPFA 5AOVA 3G0OA 3RUIA 3TRRA 3ZU4A 4CV0A 1I3LA 1ENPA 3DHEA 3GNTA 1LRJA 3C8MA 3DTTA 1VI2A 3ST7A 1UXIA 3ON5A 1SEPA 2FSSA 3WIDA 3BHMA 1ADBA 3WYBA 2Q50A 3DB2A 2Q49A 4G81A 4GL4A 2HMTA 3KQFA 3L3SA 1PZEA 2NVUB 3EMKA 4NJMB 5DZSA 1NX6A 2YUTA 4CLOA 1O8UA 4JFCA 2WSBA 1Y8RB 3TDKA 1MJ3A 2X4GA 3Q0JA 3PZBA 5COQA 1EZ4A 3TVWA 1MA0A 5G0TA 3WFJA 3ZWNA 3T3WA 4FGSA 3S1LA 1UZMA 3DMYA 3PZRA 3EVTA 3QWDA 3K6JA 3FCOA 2B5VA 3H9EO 1ZSNA 4N5MA 1B8PA 3T7CA 4MXIA 3STAA 1NVTA 5IN5A 3SLLA 1G1AA 2BFOA 4RDIA 5KTKA 4U0GH 4BO8A 1LSSA 2QZZA 3L6OO 4A5OA 3OICA 4U7WA 1ZJZA 3NGXA 4Z0HO 5AYVA 1T4BA 3D1LA 3FD8A 1SMKA 4PG8A 1WAMA 4E31A 3I23A 2VOEA 3ANLA 2VHZA 4CMAA 3PJDA 2DU8A 4WLOA 3DFUA 4BMNA 4ZDDA 3HWRA 4BKUA 3C7AA 3KRTA 3VZPA 3BA1A 1LDBA 4PG5A 1J6UA 5AXAA 4J4BA 1C1XA 2X9NA 4MJLA 3GEMA 4J1TA 4JJIA 1HT0A 4YB8A 3VC7A 1J49A 4IY1A 5AXDA 5FUSA 3PEAA 3D4NA 1V3VA 4NFHA 3IKTA 1VL6A 4YA6A 4WLEA 4YRAA 1N6FA 4RPGA 3RBVA 1N9GA 3CMMA 3OQ6A 2GTRA 4E32A 1JA9A 1H93A 1TT7A 3DOCA 3ETDA 1P1HA 4OQYA 4IZIA 1M6WA 3HJAA 1PR3A 4GH5A 1CYDA 3GDFA 5GMOA 2DFVA 1T2EA 3W6ZA 3V2HA 2EG9A 1TA4A 4WPGA 2EP5A 4XJSA 3W6UA 3MOYA 3D0OA 4B8ZA 4R9SA 1EE9A 2VOJA 3DL2A 2IXBA 4IDAA 3N58A 3C7DB 5JAQA 5GZ1A 2B69A 1LDMA 1XU9A 9LDTA 3WQQA 1UXGA 4CM4B 1U1IA 4PLPA 4B7UA 2F1KA 4IDCA 3TT6A 3VHRA 1BGVA 4PLFA 3QWHA 3ZU2A 4CV1A 2VRCA 3JQAD 4YJDA 3GVIA 3H02A 1X0XA 1ISIA 2J5RA 3S2EA 1ML3A 1I8TA 1T2DA 1ISFA 3UOGA 2Q34A 1ZMTA 3M6MA 1UP6A 3COSA 3ZN2A 2DBVO 4NPCA 4DWVA 3CE6A 5F3RA 1OFGA 2CSUA 3DZJA 4DREA 1SEVA 1E7YA 3EZYA 4D3SA 2JD1A 3EUWA 3LT1A 5DNAA 3QWBA 3WLEA 1KS9A 1NYTA 1ZKMA 1HWYA 4PLTA 5CDUA 5JNLA 3EY4A 2GGSA 3CZMA 5CFZA 3GFGA 1LLCA 3LC2O 3WSWA 3C7CB 2C5EA 4FFPA 3QIVA 5DTPA 1D3AA 3K30A 2BGKA 1I2BA 2VSSE 1X15A 1C0IA 2EGHA 5G0UA 2FBMA 1EVIA 4ALJA 5ILGA 1JVSA 1Y6JA 2B35A 2D5AA 3SJUA 3IAHA 1E3WA 4OXKA 5ICSA 3U9SB 4BKRA 2BGMA 3GKBA 2CD9A 3D64A 1N7GA 3ZWYA 1LI4A 3PJGA 3RFVA 4RORA 2VYNA 3NYWA 1U8XX 1Y81A 2NP9A 2QZ9A 3AM5A 3U62A 3HHPA 3ZW8A 1U2DA 1P44A 1UUFA 4L8VA 2ZKLA 4WE3A 4YQYA 3GPIA 1ZEJA 2IZ0A 2EWMA 4J1SA 2R6JA 3IQDB 1FMCA 4YJFA 4EBFA 5EL0A 3F6YA 4CMHA 2H9IA 3DZGA 1CQIA 3MJCA 5INFA 4FQ8A 3QWIA 4ND4A 4INAA 3I4FA 2DUUA 3P85A 1FDVA 3FR7A 1SB9A 1CEQA 1W6UA 5LC1A 4BO3A 4AJKA 3F46A 5TC4A 1LSUA 4UVGA 1GCOA 2X5KO 1QXSA 2EKPA 2HJSA 3D4OA 3PWKA 4L9RA 5HA5A 3ROMA 2Q99A 1HKUA 1S7CA 1YRLA 4WUVA 5EQDA 2GZ1A 4ALLA 3T4EA 3LKEA 4PFJA 1JKIA 3D3WA 3FBGA 1OZAA 3ZZNA 1PJ3A 1RM4A 3FPCA 4BNJA 1DUBA 4QIIA 1A9YA 4MIEA 1B0AA 4DBVO 5DCYA 3JD2A 3V1UA 2J3HA 3E03A 3H0UA 2DLDA 4ZN6A 3LLSA 3DBVO 4U0JA 3KOUA 3MWEB 4B4VA 5JCJA 4DMLA 2VRCD 2VNSA 4LCEA 2OBNA 5JSFA 2RH8A 3C1TA 3HG7A 1BRMA 4H3VA 1AHIA 3T4XA 1PSDA 5L9AA 3D4PA 4ZDFA 1UDCA 1E77A 2IZ1A 2O3TA 1DIHA 3AM3A 1FDSA 1LLUA 2EIHA 4NFSA 2B4RO 3DXFA 4ZQBA 1JXZA 1QYCA 4F6CA 3GNQA 4DUPA 4IDBA 3DBHA 3E8XA 4LVUA 2P9GA 5DP2A 2OMEA 2Q2QA 3ONEA 2A9FA 2JHGA 1GUFA 2F00A 1LNQA 1SB8A 3OECA 3HE3A 4A0SA 3JQAB 1N1EA 1QLHA 5GY7A 2O3QA 4R01A 1KEWA 2Y67A 1EF8A 3TVUA 4Q3CA 2D0IA 4W9NA 2RHRA 3VPHA 1HRDA 4EYEA 2B37A 4Y6SA 1ZW1A 2NV6A 5TF4A 1IOLA 3M1LA 3VH3A 4JQCA 4OMUA 2EXXA 1ZK2A 1LSOA 2X9GA 4Q3AA 3H5AA 4CMEC 1JAYA 4FW8A 2PNFA 4RLHA 3ETGA 1LRKA 2VYND 3KHUA 4ILKA 1EFLA 3JQGB 2C5AA 2IODA 3SXPA 4S3MA 1LU9A 1U4OA 5T5QA 3RUCA 4XQGA 4XRGA 1JAXA 4IBOA 4GWGA 3ASUA 1O9BA 2VTEA 4BOYA 3U09A 4AJIA 4WCDA 4Y6PA 1RM5A 3AW9A 2NQTA 4IDGA 3MT6A 2ZQYA 4NZ9A 4CUKA 4DYVA 1PS0A 2JD2A 3PE8A 3FI9A 4GAEA 4W6ZA 1M75A 4XIYA 4EITA 1UR5A 1X1TA 4JX8A 2W4QA 3ABIA 3Q2IA 1K5HA 3I5MA 2PWZA 5L40A 4ZU2A 1O89A 4J0FA 5FI5A 3RUHA 1BDMA 2V6GA 2ZCVA 1MFZA 4ALMA 4CODB 4NU5A 3WGZA 2Y1FA 3FF6A 3U4HA 2BI7A 4CPDA 1O5IA 4U5QA 2O50A 4II2A 4BNXA 1TLTA 3FWZA 3MFMA 1N2SA 3MOIA 4F46A 4HFRA 1RM3A 5G1RA 4Q3NA 1ARZA 1JW9B 1VC2A 3RC9A 3GHYA 4U0KA 1Z74A 4D0SA 4HNGA 5TIIA 2CVQA 1YB4A 3RFTA 4DVJA 3KTGA 4KWBA 3QRWA 3V1TC 4IDFA 4YT4A 4JCRA 1SCUA 2FN7A 3KB6A 5T67A 3TRIA 4J91A 4K6CA 4BNVA 4IZCA 1OD2A 2AHRA 3U4DA 5A5EA 3KSDO 5ENDA 4KQWA 1N5DA 3ST9A 3H9UA 3INRA 4W9NC 3AI1A 4J43A 2G76A 4R16A 4MIYA 5U1PA 5FYDA 3BPPA 1R12A 3CZRA 6LDHA 3GOHA 1D4FA 2EJVA 1TG6A 1C0LA 4P8RA 3OQ1A 4FIZA 3FRJA 3AU9A 4FGWA 1RM0A 1W2XA 1I2ZA 4K2NA 5IJZA 1XSEA 3WBBA 4QX6A 5ADHA 2DBRA 2P9EA 3OMEA 2ZQZA 2Y0DA 3K2BA 3CINA 1HE5A 1WVGA 3OJEA 5K0ZA 2J5II 1NPDA 3PLNA 5JBIA 1KVSA 2OFPA 4Z9FA 4B7XA 1C1DB 4GVXA 4HKTA 4EJ6A 3P2LA 4WASA 1LEHA 3HFSA 5HRUA 3RUDA 1VLLA 5T8KA 4E12A 4JSBA 2LDXA 3QREA 1AXEA 1P45A 3C1OA 3AU8A 1F8GA 4NFYA 3R6DA 1FDWA 1ZXBA 4RO0A 4NJMA 4PGFA 3UKOA 5JFOA 3DORA 4IQ8A 5TGDA 3TWOA 4ALKA 1CDOA 5JBWA 5TSDA 1PZHA 1EBFA 1NAIA 5B4UA 5CDYA 2O7SA 3RFXA 4M86A 4FN8A 4AJHA 3JYQA 3O9ZA 3JQBA 1B3BA 5DOZA 4RYFA 4DQXA 2Q1UA 1E3JA 3VTZA 3WNVA 4E30A 2HO5A 5E0SH 1U9JA 5L7YA 4B79A 4EGFA 4KTTE 4MVJG 1IY8A 1R15A 2GN9A 4UVHA 3RAJA 1KEUA 3EW7A 2YHIB 4TKLA 2IEDA 2FHSA 4TROA 2ZK7A 2OXIA 1YVEI 2WM3A 1NASA 2RAFA 5C90A 4LSMA 1LSJA 2PPYA 4KUGA 1NR7A 5ITVA 1NBOA 3OP4A 3AY6A 2AW5A 3RASA 1WXDA 4M49A 1AN9A 1DOHA 1XG5A 3GGPA 3NJ4A 3P5MA 3HUDA 4ZDBA 4YJFB 2YHUA 2WYVA 4M54A 2VUTA 3KEOA 3TFOA 2O4UX 4BNLA 1PWZA 2B4QA 4J9VA 4XQ9A 3HRXA 2E37A 3DQPA 1P0FA 3PIDA 1RYDA 2O3SA 4R1TA 3OIDA 5TLSA 4RVFA 2PA3A 1UYVA 5I7EA
chains in the Genus database with same CATH superfamily
4BNHA 2WYWA 1E1RA 1JQDA 3C3DA 3BGIA 1K92A 2JFBA 3D0RA 4GWLA 2YHBA 1D0VA 2QMQA 5C8YF 4KO4S 4EZIA 4L6WA 1N4DA 3E9QA 3OZSA 2K7ZA 1CLEA 3CNHA 3WJAA 4ZZ1A 3DFMA 5T8KC 2ZIGA 2BR5A 2I4OA 4M1QA 4K3WA 3N2NA 1CRPA 1VBMA 2QA5A 5HDBB 1FUIA 1YZNA 1QFYA 3TIIA 1Z16A 3L46A 3O3OB 4HAZA 4AO7A 1V6CA 4RJTA 1WCYA 2V7QD 1GAJA 1VKRA 1XEAA 3GVXA 3PQEA 3BXXA 3S2UA 4R1PA 1DC6A 1LBEA 3PVSA 1IN4A 4AJNA 1QYWA 1OYOA 3H2IA 4PX3A 4BLOA 1AV6A 2LIVA 1D03A 1V6AA 4MS1B 4JEIA 1S4MA 4OMCA 5ANRB 2FSVA 5EIAA 3ND8A 4MEBA 5FO0A 2XHEA 1IBLB 1E61A 3PFKA 4U2CA 3WWPA 3PRHA 1KVTA 2RMKA 2VJDA 2OFOA 4XE5A 1WZEA 3ZIDA 3ER9A 1VHJA 3GUVA 1F0YA 4YACA 3HGTA 3TOVA 3UTCA 4I4TB 1F2UB 1NHWA 1IHPA 4BQNA 2J7PA 2BD0A 4KK3A 4OAPA 1Z75A 2BEJA 1SUBA 5FEUA 5J63A 3K8ZA 1X77A 4YBRA 4AP6A 2IIVA 2N75A 4US2R 2HMWA 3T54A 4Y67A 1QNLA 4QU8A 1B16A 4GVPA 1TEVA 1JDSA 3C14C 3SZRA 1OB5A 1JQBA 4ND7A 2QBYA 4LDRA 1HTBA 4OTZA 3MINA 1ODLA 2X0FA 3WOVA 3NOQA 1LQ2A 4RNCA 3RK1A 5I8WA 2CDCA 4WZBB 1CRQA 2P9HA 4YPOA 5K8LA 3CLRC 1ETUA 2O7QA 2QEQA 2JA1A 3CRVA 4R9RA 1EDEA 2EQAA 2QDXA 2YL2A 2ZAYA 5D3QA 5ES4B 1OXTA 3SFZA 1UJ6A 3RU3A 2AJ8A 2IDKA 1MOSA 2WNIA 3C98A 2NSDA 3EXIB 3E61A 3LX5A 3PFBA 4ZO6A 1RWMA 3PHGA 4V0SA 1U9IC 2JVIA 3ZWAA 1FDUA 1Q7RA 3DZCA 3PF8A 4G0NA 3RYCB 2INGX 3E9YA 1V5WA 1ADGA 2HSEA 4O4HB 4XR4A 1G8GA 3QITA 4H59A 5IK2A 4Y9RA 3U6KA 4B3TB 3TECE 1SBNE 4ZZIA 2PV0A 4Q16A 2I55A 1QIMA 4Q1AA 4TV8B 2UZ3A 3X2SA 2NAFA 4C0QC 4QYTA 5K51A 1QKJA 2UYYA 4CF7A 1U63A 4X24A 1L4EA 3LKBA 2R6R1 5JD6A 4X95A 1DQPA 2F3PA 2W83A 2X4DA 2WZQA 1CJMA 1E5XA 1QTNA 2HPZA 3CX6A 3DOUA 3GQVA 1RJ9B 2EYQA 3U4IA 2ONYA 5DGXA 1KMHB 1WXHA 4U7TB 1OI3A 4G2RA 1R4NB 2ZRPA 5E0NX 1N3YA 2A1TS 4LYYA 1FTYA 1X19A 4BN0A 2X5JO 1B76A 3R0JA 5CW1A 5BXQC 1FRQA 4YCSA 3VO8A 1KFEB 1TAGA 1GTL1 1F9EA 1TU3A 3TIFA 2LKDA 1V5GA 3BH7A 4FJ2A 2PANA 4ZKDA 1DFIA 1HYQA 1BKYA 4ZOEA 3R7BA 3HB0A 4AJJA 1T6XA 1JJ7A 1LKZA 1JSZA 4MWZA 1X70A 4HWRA 3VIVA 3LL4A 3VYVA 1M5RA 4ZGWA 3P2IA 5AJXA 4ZEMA 4HTFB 4IOMA 1EQAA 3LTEA 1K89A 3MCVA 3EC7A 2YOHA 3UM9A 2M32A 3H5TA 3TEJA 2I4TA 1W35A 1J4AA 3VR2D 4DCOA 4EG3A 3ZDCA 3PC6A 5BUCA 2A35A 1MDFA 3RABA 5GZ3A 3F2IA 1WP9A 3VZQA 3S55A 4LZAA 1WSAA 3EWAA 3OLVA 5AVJA 1NQVA 1TQHA 4Q3DA 2FGKA 1NUSA 2OQRA 1C8LA 4C30A 1MXFA 3Q8MA 2R6CA 3BZBA 2FW0A 4K05A 1ECPA 2GJKA 2ORYA 3ZVLA 1KVQA 1FYDA 1VA5A 3GLGE 1C29B 3C3MA 1O8CA 1UQTA 4QEKA 1OI4A 1VSUA 3RYHB 1JXMA 4MEAA 2VQSA 2H6EA 1WB5A 1IBKB 2PKQP 4PZPA 4A8JA 2CNDA 1KDYA 1QQ6A 1BX3A 3NOVA 5TMBA 4J75A 1UKVY 4YP0A 1WQ1R 2BFWA 1RBMA 4BKQA 1I2CA 4NIMA 5TVKA 5DU4A 2LZ0A 5H3CA 2AX3A 4BQEA 1DCIA 1W4BA 1HE2A 1EFKA 3Q0IA 3HM2A 1DC5A 2VSSA 4WJZA 4JI5B 4NU6A 2C5FA 1BTOA 1E7RA 4ZVMA 4QATA 1IUKA 4W5TA 4GLLA 2HQ1A 4AWAA 1NUAA 2Y8EA 3TZCA 3VYSB 2IT1A 4XD2A 5IW8A 4JJZA 1XRLA 5C1OA 1CVRA 2BOVA 4I42A 1OTHA 1OLXB 4PZ0A 2EKLA 1UBEA 5HK8A 1J8MF 1P9RA 1U0JA 1VBFA 1PV2A 3EW9A 4MQBA 3CLSC 3D1VA 4P4UA 1C9JA 4YRLA 1Z5UA 4WTOA 4DR2B 1WABA 1REQB 4XJXA 4WYOB 4UUBA 4IDPA 4O2AB 1G2QA 4ZC8A 5K3FA 2BFDB 2IPNA 3F5DA 3VR3D 4Q0GA 1DDIA 2G7MC 2VPZA 4KEAA 3MT9A 4B6PA 4G8DA 3OMLA 3MCWA 4AMUA 1M8GA 1FNSA 4Z3DA 2EC5A 3A4YA 4UQOA 4U1AA 1SOVA 5JD4A 1T5BA 4ND8B 5JR3A 3F96A 5K3SA 3GJQA 4DAOA 2A81A 3FCCA 5LQNA 1XN4A 4F3YA 1VJRA 3NBYC 1IM2A 1Z29A 4FHCA 1JIXA 5DKFA 3GNLA 4DG5A 4E4RA 3UMMA 2RGNC 2FW1A 2BGGA 2IK8A 4AS3A 4E7OA 3M9WA 3WXBA 2EZ4A 5EYPA 2G9NA 4YR9A 2PWPA 2GCOA 2W6ID 3OEEA 4IRUB 3M6AA 3PNVA 3H9CA 1NV8A 2QSYA 4URFA 3PLAE 1UPTA 2AFHB 1G21B 2EZUA 4P82A 5ELMA 1VJGA 2E5FA 2ZYRA 3M9LA 4V03A 3REOA 5CITA 3PFFA 1LBQA 3ADCA 4F4IA 3WP1B 4DMUB 1E2FA 1C3OA 2AKEA 3NHMA 1Q12A 1P4JA 1VMEA 3D0KA 2IFTA 4O0MA 3UWMA 1O58A 5A4DA 2FSHA 1Q1QA 3KB1A 2PH3A 3UMBA 1QO9A 1LPBB 4P7KA 4PLWA 2V7TA 3QJGA 4YCNA 3UPUA 1QMGA 3VI4B 3M70A 5AKXA 4EB3A 1KEKA 1G9SA 3DZBA 5B3LA 2XOKD 4YS6A 4NBTA 3AZQA 3Q3VA 5FBHA 4MGIR 2VJOA 2XTZA 3MLEA 4OFWA 4ABTA 1O1YA 1Q7CA 3MJTA 4MKZA 1X1DA 4B3HA 3M3DA 3ZHCA 3ETJA 4NK4A 1A3CA 2CZGA 2Q5LA 3C8ZA 5TEVA 3AR5A 3DWFA 3N2ZB 3DVAA 4OSPA 5C8XA 3ESAA 3I1JA 2ZUCA 2I2XB 4ZHSA 4QUJA 5MN4A 4JENA 3HDVA 3NT2A 1WSWA 2CT8A 1PR1A 1B8UA 4KAFA 2WJ4A 4ENTA 3HVUA 2OD2A 1CY2A 3S2IA 5JDIA 4JMPA 4O2LA 1OBHA 4OM7A 2GJSA 3QX7A 2Q21A 4B48A 2YCBA 10MHA 1W19A 1JIVA 3QXSA 4RDXA 2QLBA 2FMIA 4LPKA 1NPTO 4DXHA 5HF5A 1EB9A 4Z8XA 5J23A 2PRZA 3NTVA 5BR4A 4JVOA 1NYLA 1YL7A 3QFRA 1SKBA 3IJPA 1EFRD 2IUYA 4TRMA 4BMDA 3WHPA 4DV0B 4ZTUB 2WJIA 1G2IA 5AI6A 5LOVF 3A0UA 2KJQA 1ZK4A 3SEQA 1J7KA 3QLEA 4RGBA 1AQUA 4JASB 3L8GA 1IZZA 3KOWA 4JLSA 5JTTA 3QOWA 1R6AA 3RUPA 3OE1A 1GNTA 1T2CA 2GK4A 3L1JA 4O4JB 2XKKA 1YS2X 4M9SA 3ZXIA 2DQYA 3OQOA 3OQIA 2O3JA 1TB4A 4JELA 2X9QA 4RACA 4YP9A 3DFFA 1KP3A 3FPAA 1DUVG 1UINA 2P8SA 1V5IA 3F6RA 1Z7GA 1KI7A 5HWSA 1S2NA 2H9YA 3B85A 3LC7O 5CJJA 3T9CA 5I01A 5I3ZA 4P22A 2EW8A 1BJRE 3UW3A 3AFGA 1IAVA 3RSGA 2RGEA 4YRBA 1P2DA 1U2GA 4I4IA 2AEEA 3S5UA 1M2FA 3TBHA 4I8DA 5BVHA 3BFPA 5AIBA 1EK5A 1T9GS 4DLBA 3K70B 1NZYB 1W59A 5H59A 4MR8A 1HSOA 1JTEA 3JZFA 4KE6A 3MINB 2NU6B 1MG0A 1UFVA 2WUEA 3AUFA 3E8SA 4QTTB 4MKGA 2EKQA 3Q3IA 4XW2A 3G8CA 4IWXA 4MW5A 1M72A 5ESDA 3PX3A 4H3SA 2YQZA 4MA0A 1UBJS 4ZAGA 3L7BA 1P5FA 1I24A 3RJZA 1PT8A 1ZL2A 1HDOA 2GZ2A 1QK5A 4G1CA 4NMMA 4PGGA 4UEKA 4EH1A 1HDZA 1P3Y1 3WJ2A 2GPYA 4ZIRA 2JLXA 1XTRA 1O7JA 3SF0A 5D7NA 3K5PA 5TX7A 4FDLA 2VYVA 1JLKA 2BC9A 1D2NA 1XBTA 5EP3A 3EASA 4QTXA 1UZNA 1UK9A 4S2EA 3N3AC 1ACLA 3H99A 1IL0A 1SAYA 3ZHRA 3D6AA 1PCXA 4BBZA 4P5DA 5E7QA 4DJ5X 4UXJA 3VSCA 5LQSA 1C4XA 1T4DA 3NAMA 3AVUA 4HNRA 5KX5F 1R5OA 1DB3A 1VPDA 3HWX1 1AH2A 3T3MB 2FF7A 2PSEA 1NM5A 3UKDA 1XRNA 4O1IA 3FBTA 5B36A 2XT9A 4UNPA 1LTQA 4ICIA 3OPMA 5KNLA 2XWJI 3ASVA 4MGKR 2X3FA 4QFDA 3TG2A 1QHHA 1U5AA 3PF9A 2OCPA 5L4SA 1QF6A 4OH7A 1NTOA 3QY9A 3ZNOA 5KQGA 1ZPDA 2FEKA 2AOUA 3O7WA 1KFJB 3RU7A 1XEFA 2HKIA 5IG2A 1SPXA 1TNDA 3PQ4A 4I19A 4M55A 3NUZA 3JYHA 4MPDA 1GTMA 2ISCA 3QKIA 4TWBA 5I7AA 1FC6A 3UUGA 5CFLA 3RVSA 2FPGA 1Z82A 1DXHA 4OBEA 2ILVA 1QIFA 2WI8A 5EMNA 3VX3A 4IAOA 5DN9A 4DMHA 4QASA 4H31A 5CLGA 4E08A 5LPNA 5AKGA 3WGOA 2GHRA 4PZCA 1GPMA 3P9QA 3SSOA 4RM3A 5SYAA 2HFKA 1N8SA 3FG9A 3HKBA 1SUWA 3FZNA 1T2AA 1U0FA 5DWQA 1XZGA 4CF4A 2UZ0A 1ZHFA 1DG3A 4Z51A 1JT9A 1JQKA 3I3OA 3L5OA 3O84A 1QNFA 3L7MA 1T4MA 1Q7EA 5EC8A 6REQB 3N59A 3VSBA 2GA9A 4KYUA 3MTQA 4C4YA 1XR3A 1ZIXA 1SGWA 1GCIA 1TLLA 1XXLA 2OBBA 2OCXA 2IU3A 1P1RA 2PH7A 4QUEA 4QVIA 1X0VA 4NICA 4ZOLA 3WNCA 3IEMA 1NN5A 3MWFA 4W7SA 1JDZA 3FOAA 3GLQA 5H3LA 1EK1A 3IHWA 3J7TA 3JQ8A 1DT5A 2HHJA 5IDXA 1DJMA 4N0DA 3ZV5A 3KD2A 2G0AA 1GTJ1 3QBVA 4YJHB 2JLQA 1T9KA 3ORSA 1ZNYA 3PXEA 1JB1A 1R4MA 2OL4A 4GG1A 3DAGA 4ZQFA 4FNAA 5GQSA 4HH3C 3HJTA 1S2MA 4MV8A 2IX3A 1LTHR 1PFYA 2VAWA 5CYFA 1HNNA 1K4MA 1Y5IA 2Y1EA 3UN1A 2D00A 1R8XA 3CBQA 5I9IA 3QNMA 4K9LA 2NO7A 4X62B 1G0OA 1L7MA 3G3EA 1IZ9A 1IZ7A 4FHFA 3JYLA 2PMBA 2W2KA 3PUKA 4I1RA 3R6GA 1B42A 3SK0A 3TSAA 2BGTA 1VYUA 3IOYA 4NH4A 4HUQB 4H4CA 3DBRA 2GPTA 3SN6A 3R6TA 8MHTA 5KDRA 4YWHA 1UBOS 1R8JA 1C7IA 1ORDA 2QMZA 3H97A 3LUHA 4IOJA 3FTQA 4GI2A 1T4CA 1OTXA 3NUGA 2D3TA 3OQMA 2OFFA 2ZQ5A 1M2HA 3WHIA 4JYAB 2FPIB 3KWFA 1IUPA 3Q40A 4Y2TA 4N3GA 4LDNA 4Z7QB 4BJHB 5SYMA 3OKAA 1XQ1A 1T5OA 3VNVA 4HDNA 4X94A 4EPVA 5EESA 2Q3EA 2FDCA 2FDXA 4PLYA 2FZKA 5BNTA 1UOQA 1BS2A 1M10A 4Q47A 4RPLA 4ELXA 1EFVB 3QF7A 4H7PA 1XNYA 3MYBA 2Q9AA 3CN9A 2H4FA 2GK7A 3ONFA 3R3WA 3W1EA 2UVPA 4J0HA 3AJRA 4P54A 4AZ0B 3PXGA 2J0QA 1L4MA 3HLYA 3UV6A 4CF6A 5DEIA 5C7YA 2E5WA 2X8LA 2HDOA 1DKOA 1X1QA 3DKIA 3U17A 3SYKA 1ZXXA 4J0GA 1SC1A 4GXRA 4EG7A 1SBZA 2CXNA 2VH1A 3I9OA 4FINA 5IHPA 4KMRA 2VP9A 4ZARA 2QORA 1NXQA 3W5SA 2VSUE 1FBTA 1KAQA 4IIUA 4FFRA 3SD7A 3ZNPA 4DCMA 1ZCAA 1MO2A 3EAFA 3PUHA 5LQAA 1QORA 1E3IA 3CKYA 3OHPA 5DDIP 3JX9A 4J6FA 1UAYA 1JEEA 5BNFA 1DLJA 1E79A 1IEVA 3A2MA 2OHVA 3BQMB 4KDCA 4KZKA 3WJ1A 4JU8A 1G64A 1C4KA 1OPXA 4GRIA 3P2EA 4RSRA 1VE7A 1RPZA 1QRAA 4UHBA 3DDUA 4QJ5A 3WVNA 4Z0MA 4II3A 4NWIA 1Z12A 3RARA 2P2LA 2MYPA 4TTPA 3FTNA 5FL3A 3T7RA 3B38A 3LWBA 3GDGA 1KFKB 4K86A 1W73A 2HEGA 1ZMOA 4RXUA 1NQOA 3B1ZA 3DE5X 3FF1A 3IQZA 4QOEA 3B3GA 2E6KA 2G9ZA 4WH0A 5AKLA 2YQ4A 2HM7A 3JWEA 5GJWC 2FQXA 4MUIA 3MOGA 2YY5A 3AUUA 4KQGA 4MQFA 3CNEA 2XECA 4TLEA 5IVIA 3HCDA 1IJFA 1B8OA 1EH5A 2YH2A 3LZ6A 3U3DA 4AP5A 1E8DA 1WZ2A 3T15A 3B3FA 2ZRHA 4UZSA 1JKJA 3A9CA 4WERA 3RFCA 3NMUF 4ZCSA 2IYPA 1KNXA 3DPIA 2Y2UA 2VBIA 1OKKA 3CMCO 3ONNA 5JSHA 5SZHB 3DMHA 3BMOA 2G5CA 1CDEA 1C1HA 1T1SA 3I32A 1CZUA 1TKAA 3MTAA 3NVDA 2Z8YM 1Z88A 3EWSA 1SXJE 1JVNA 3GJ4A 4YJGA 3PVCA 2H1VA 1NOKA 4AVYA 3ZHQA 2XKJE 3G0DA 3PENA 3KHSA 1JV2B 3BVPA 1EHCA 1T3GA 5ALEA 3PNOA 1PEDA 5KYNA 4GE3A 5HIAA 2H65A 3BXEA 4EATA 2V7QA 4YBZA 4F7DA 2XUIA 1MNAA 1SC4A 4XOUA 1MRZA 2ZVPX 5B2ZA 2X2PA 1FJHA 4LSWA 4OEHA 2ISSD 1B74A 2M6RA 3H65A 5CT4A 2O20A 3NCHA 3QU7A 3TL2A 1JEQA 1XEWY 3GRUA 4HH0A 2OTCA 4KXLA 5CU7A 3AOGA 4Q4DA 1EFAA 3MWJA 1E63A 3OQIB 1Z34A 3OPQA 2PN1A 5BWNA 1Y3IA 1SO8A 4MYRA 5D1HA 4JLNA 2H31A 3QZUA 4HDSB 4HUTA 2PUWA 5BRAA 2X7HA 2QRVA 4K9DA 2Y27A 1AS0A 4X41A 4ZQGA 2HHLA 2HMVA 5CGZA 5AQEA 5F5NA 1DAFA 1XTSA 1W36C 2Y71A 3WYEA 4YDHB 1MOPA 3NATA 1HEUA 1NUHA 1TU4A 3K4HA 3R9KA 4UEQA 1QHNA 1QV7A 2JFFA 2NTJA 3F4LA 5BVHB 3NETA 4DM7A 2CEKA 3IEIA 4B3SB 4XASA 5CTJA 5FIFA 1K3TA 2WD7A 1IPFA 3Q8KA 4KIJA 1CXZA 3BX1A 5I4BA 1RW4A 2ZSBA 3JQCA 1I3CA 2O3RA 3M6NA 1EXVA 1QSGA 4PG7A 2JCGA 4BVHA 1FTWA 3EA5A 4A6PA 1V8DA 3E18A 3S2FA 5AQ1A 4FZWC 4LOHA 1ZI8A 1YBMA 4KGZA 5E1OA 1SHTX 1AMUA 2ZXUA 1LV7A 4OHBA 1RWKA 5KOJB 1HZZA 1T5SA 1WUKS 2A5LA 2GRJA 3IV6A 4CM9A 1WB4A 5IXJA 4PZUA 5JEEA 3HYSA 3WLIA 3EGDB 2CXUA 1TQ8A 2QVZX 1GNLA 3WMWA 4KE9A 1QC5A 3PU6A 3O8RA 4P9NA 4CMBA 1XLTC 2X8JA 2RHTA 5I9LA 2FUEA 3G5AA 3VU0A 1HE4A 2JDIA 1ON9A 2EERA 2YKGA 3ZCVA 3I61A 4KXVA 1NLUA 4LXGA 4CIBA 4CIYA 2AR7A 1PEYA 2JGEA 2I66A 3O93A 3CF4A 3ET5A 3GG9A 3MFYA 3B7PA 1HNZB 1FXUA 2D59A 4RCZA 3I2JA 5KC9A 1YVDA 4BNUA 2IXAA 2O5RA 4H6VA 5ILQA 1QHHB 1KGDA 1ZUIA 2O0LA 3ABRB 3AOEA 3N0TA 2Q3HA 3OBBA 4BO9A 5JSQA 5LWHA 1JXZA 4O02B 3N6RB 4MITA 1PG2A 1KKLA 2QG4A 2I3GA 1P7CA 1ZW6A 2P79A 5CCDA 2B83A 3DA8A 5C4MA 1W581 2OV4A 2ZSJA 4V0OA 3P9KA 3D6HA 3EEFA 4Z2YA 4D4IA 3H3FA 3NTOA 3II6X 3PC4A 3MVEA 1ZGGA 4LCBA 5FTNA 1MMFB 2NO4A 4HN2A 2E18A 2BZ1A 3R7SA 3VR1A 2XADA 2DOKA 1Z2PX 3B70A 1Y8AA 1KFBB 2CF5A 4FOSA 4L8FA 4X84A 4A0FA 2VTBA 3EPLA 3W6NA 4IUYA 1F2TA 4JXJA 1XT6A 3AEUA 4YMGA 4R1SA 4M9UA 1UXHA 3QE4A 2XGMA 1VPEA 3IHLA 1ZU5A 3MJDA 3AY3A 1XZCA 4QOHA 2ZWOA 1YXMA 5BSWA 1FFAA 1HDCA 4LF8B 4BPBA 5H1YA 2WEKA 3V00A 4ARZB 3L07A 2W4IA 2X86A 1SC3A 4UBMA 3Q5DA 4MX8A 3IBSA 3KXIA 3LKDA 2E3JA 5DXAA 4CLRB 1J9ZA 3ZC3A 3TW8B 3S81A 2GERA 3FFXA 1RWQA 1KZGB 2FEOA 2VYQA 5IRCD 1UDBA 2PE5A 1N75A 5FHQA 4D4JA 3HCAA 4ETIA 3A7DA 4INPA 3E4CA 4AUNA 3U37A 1XJ5A 1VKOA 3CV3A 3OWXA 4PRLA 3LZCA 4RL4A 3JQ8B 4WNYA 3VR4H 1CR4A 1KJWA 4UTOA 3F7TA 4M1MA 3H0SA 2PSFA 1NVWQ 2QN3A 1PL7A 1W5AA 4CDGA 2C3UA 3UWOA 1XAIA 1R4MB 1VCMA 1R6BX 3GCXA 4REOA 4BASA 4C03A 4P7JA 3CPHA 3MWGA 3ZLJA 1H23A 3R6LA 5CT5A 1MTZA 4XVRA 1YS6A 2IEAA 2JFHA 1YZYA 3BOSA 3SX0A 5KQSA 3G49A 1AK1A 1Z6GA 4JYCA 4B3CA 2C7PA 4RY2A 2W58A 4OIMA 5D5QA 3CH4B 4XFJA 1XRQA 5DE3A 4CTNA 1DV2A 4PHCA 4HC4A 1JMKC 2W2KB 4EUHA 1AXRA 3IDOA 2C9BA 4QT4A 3DKVA 2AA3A 4GT1A 3ZV3A 2RHLA 4CDRA 3UAGA 1EXDA 3B6IA 3P8ZA 5B30A 3PNQA 4AS1A 1NG1A 3WP0A 2FR1A 3ESXA 3WMEA 4KQ6A 1T4CB 3MMXA 1N6KA 3T1VA 4AT1A 3AVWA 4C0WA 1XWIA 3IUQA 3DR3A 2PK3A 1JG3A 4A16A 1R37A 2QY9A 2Z30A 3OJWA 4R3NA 1L8AA 4L5CA 5DO9A 4Y30A 1I5RA 3KEMA 3DBIA 1IHOA 1E1YA 1GP2A 1WF6A 3SAJA 1THTA 2GZSA 1JB9A 2WWRA 4F93B 3F4KA 3PDHA 4OHYA 1II8B 4LFCB 5I6DA 4I81A 3NHZA 1GSOA 2OZLA 3C3YA 3MAAC 5AI4A 4QL3A 1GG9A 1LPAB 1FXSA 2O2GA 3ZHBA 3AM4A 1UH5A 3PFIA 5LFAA 2PD3A 3NEYA 3WMRA 1PGOA 4NYMQ 4CG3A 2UVPB 4ED9A 4Z1OA 2L19A 1R9MA 3D7SA 1XAHA 1RXYA 3JWHA 2JS7A 3QG5A 1E1LA 2D1TA 5KB3A 1E0JA 5C8YA 3VISA 3VPGA 1C7FA 4OKNA 4RH1A 2YIVX 4QDJA 2HK8A 4IKPA 4PU0A 2JFVA 4W1RA 2QW8A 5A7GA 4XYMA 1JLHA 2HYIC 5EJ6A 3A9RA 2J6IA 1UEJA 1IN1A 2JFXA 2J48A 5AVUA 1EFPB 1I1HA 1E1QD 2AN3A 4N03A 4D9HA 4W5RA 1O95D 2B4YA 3LECA 3LYLA 1YVUA 5ALOA 1FLDA 3I2HA 3L82B 2XW6A 1KSJA 2PMDA 2YY6A 4C4PA 1M2OB 1USWA 4ZVOA 1E3MA 4M6WB 4B2LA 3OESA 2Y1DA 3AB8A 5K45A 1GNPA 1EFCA 4J1QA 3FDXA 4D82A 2O19A 3Q3CA 1ZEMA 3M6IA 4S0ZA 3KVOA 1MORA 4W1SA 3LL7A 4Q9NA 3SHFA 4B6SA 3P2KA 4TLDA 3NOOA 2WAOA 4AG3A 3MD0A 2J09A 4TQ9A 2ZTHA 3BZWA 1JU4A 3VR5A 1NG9A 4UUAA 2HPAA 3AJAA 4GGMX 2JLSA 4MQFB 2FQ1A 3KSBC 1T25A 4M1KA 4OVKA 1GU0A 2PU7A 3HB7A 4ZDJA 3HSKA 1Z2AA 3D7RA 3G5UA 5LUAA 1RFGE 5A5DA 3MUFA 4B6JA 1E58A 4Y2VA 2WTNA 4C0JA 3FFBA 1JKJB 3GMSA 4R7ZA 1QE0A 5IHXA 2AHOA 2FMTA 2Q2XA 3CN7A 4RHFA 5KC8A 3TQTA 1KI8A 3DMTC 1ST2A 5SZKB 3TLMA 5BVGB 1NN0A 5CB4B 3GLIB 2AD1A 2YICA 1N6PA 4QOFA 4YJGB 3T88A 5A4MS 1SC6A 1ID1A 2WHPB 1EFRA 1NWHA 1DKRA 3QVTA 3N39C 4FCWA 4PYLA 4Q9IA 1RI3A 3A9UA 2Q62A 3FSGA 1HMPA 3H5OA 4MZDA 5CFRA 4CEJA 2XE6A 4M1ZA 1CNMA 3H8WA 3KQWA 4DDVA 3KQQA 3LPMA 3VBCA 3W8FA 1OV6A 1V8BA 2JCVA 2ZBRA 2ZSAA 3P0RA 5F3DA 4DUGA 4KNPA 1ZBDA 3WZLA 4BLWA 3E7XA 4P0TA 4EDFA 1SU6A 5CW2A 4B46A 4DRXB 2W6CX 2OCIA 4FLFA 3RVBA 1ZH2A 4HYEA 3ZWMA 4ZYLA 4WKPA 3P19A 2DHEA 3O74A 3ORQA 5JWHA 2ZUUA 4FFDA 5G53C 2C9ZA 2WE8A 3ZIAD 1OUMA 1Z2NX 1EP2B 2GA8A 2F3TA 1CUVA 3E48A 4KTVE 4PC6A 4R8LA 3I8OA 3UUEA 2DPGA 3V7FA 5A5VA 3BL5A 3ILHA 3KR0A 5DBHX 5IBQA 4ATNA 4ER0A 4RDHA 4IKOA 4RPIA 1ZO8A 5F73A 4KI7A 1D2AA 1DAOA 4NOJA 3U19A 1M0EA 3TLGB 8OHMA 4J3JA 4FS8A 4C3VA 1PLLA 2ABWA 3WK9A 4CDNA 2G09A 1I7NA 1NUQA 2IF0A 2KLHA 3GAAA 3G82C 4C2TA 3JYOA 1NMQA 1M6HA 3V4PB 1J97A 1MXHA 1LVHA 4S12A 1QWOA 1UXOA 3I6IA 2V5UA 2ZJZA 3CRMA 4R41A 3AUSA 3IPLA 3HN6A 4G41A 5BNWA 1CSEE 4F92B 1SOAA 3HJRA 1RI1A 3K0FA 2GXSA 2ZIWB 5CNJA 1A72A 4CKCA 4Y6LA 2FUNB 5JYDA 4Z9XA 5HUHA 3OX1A 1IOVA 2BM0A 4GOOD 1P5ZB 1ISMA 1RNLA 1U2RA 5E9JA 3PEWA 1LY1A 2QTRA 4DPMA 2VUIB 3G23A 1RI2A 2A1IA 1G6Q1 1XZBA 3AI7A 3DFKA 2ZSKA 1NHGA 1ULHA 1EUDB 3PB3A 3DVSX 4X7PA 3VDRA 4Z3KA 2VDUE 5BSEA 1XTBA 2X2OA 4U9IS 1L9KA 4GKVA 1N6OA 2BELA 5AKEA 4L4SA 3RU2A 2Q5IA 2O4CA 4EGSA 2WNSA 2JZCA 1K6IA 4W1QA 1ZSVA 5HNKA 1K8YB 1SG4A 3ZWDA 4E51A 1LBTA 2QXYA 4HQFA 1E94E 4LIPD 1SN7A 2D3WA 3H13A 4FQ5A 5IJWA 2I6GA 1R9JA 2CVHA 1DRWA 3PUZA 4MAMA 1DT3A 1XLVA 3D8HA 4QUBA 1IN5A 1PSWA 4XX0A 1VL2A 3CUTA 4Q7KA 3SFVA 3MF4A 2BHRA 2YV1A 4FOTA 1WKCA 7ADHA 5AW9A 4X00A 1ZHHA 1J90A 1V7PC 3JASB 1M1ZA 1G59A 1PZMA 1USGA 1P9NA 1YJXA 3HZZA 3LBYA 1FVOA 4HQNA 5C4GB 2WIJA 4K03A 3K1AA 1QP4A 1H0HA 3CE9A 3NDIA 4LGCA 3NKFA 1WBDA 1R74A 2PH1A 1BDBA 1XPUA 2QE7A 4DLAA 1UBUS 1OILA 1F7UA 3DE1X 3K9QO 4AKTA 1ILEA 2V7WA 4BWGA 1YR7A 2BEKA 2FSUA 2XZOA 4Z3OA 2FFRA 1T9AA 1VG9B 1WXXA 3I9MA 3KAQA 3RVNA 5ENVA 1B6SA 3OURA 4A8HA 2ZIUB 2EX4A 5TRTA 3I5AA 1ZUWA 3IEPA 1CD5A 4CM1A 1HFEL 4Z4GA 5LXTF 3UK0A 1P2SA 1T36A 5B1DA 3W5HA 1C7QA 1CY8A 1VG1A 3UAYA 4A1FA 5FWAA 3H2SA 5F1KA 3BXPA 1JTVA 3QU2A 1D04A 1L4BA 4TWJA 4RIGA 3IVMA 1TMGE 3TZBA 4IGFA 4MUAA 4IW3B 1M33A 3K0CC 1VMKA 1GGMA 1T6BY 5LQCA 1CDZA 3QVWA 3B9BA 3DYBA 3F9RA 3MCAA 4PV7A 3TDMA 4R3UC 3NGLA 3ZJ4A 2SNIE 2GETA 1QBKC 3BBPA 2QJRA 4C6TA 4ENRA 3O9VA 5IMSA 3GEBA 4W5JA 3BUSA 1OZGA 1CUIA 3TQFA 1KH3A 2GM5A 2Z6VA 5LDDC 2NW6A 3HUEA 1GNQA 1C7RA 3A14A 2A0XA 3EBPA 3GN2A 4TQGA 2AC2A 1UFKA 3RRMA 1W0CA 3U80A 4LYEA 1W8DA 3CF6R 3FMFA 1KDPA 4IGEA 3KUUA 2Q28A 4L4RA 3T7JA 1UKBA 1JLSA 2OXEA 4RZIA 3RS0A 1YKSA 1ILWA 1QR6A 2AR0A 2C42A 2PMWB 2Z2IA 4FUTA 4UAVA 4HV4A 4JKOA 3FI0A 1EY3A 5T4HA 3W3AD 2JJMA 5G4LA 3CRNA 4CM7A 4AK9A 3WOHA 5LWQA 3H8VA 4TYNA 3EZGA 1JR6A 1W1UA 2WK1A 2YC2C 2ZATA 4TS3A 4DM4A 1B0PA 1B26A 2FPSA 4L02A 2J0UA 4CTKA 5BOSA 4FCCA 5H4HA 3MWKA 4QDTA 1HYEA 1S2IA 5EIHA 1KTVA 4F45A 1FNMA 4YTEA 5A5GA 3IT2A 1MC5A 2HW5A 5HILA 4LJ4A 5JPIA 2SECE 4JAVC 3ROEA 3ZS9A 2IHKA 1T2FA 1UADA 3AO0B 2ZQQA 2R2GA 2VHXA 2BFBA 2XNKA 3T7KA 4ASIA 4MVJH 1MC4A 3LIPA 4K1LA 3W79A 5IKEA 3OT4A 3Q2KA 5J4HA 2CZCA 4TL7A 3MCUA 4GBMA 4H6WA 2PZJA 4OGFA 1EUCA 2A14A 4MIOA 5FL7D 3TEFA 2C8KA 4KACA 5EN4A 2OZLB 4N18A 3HCRA 4DM3A 5K0GA 2IYWA 3Q10A 3TZQA 1E2EA 5E2IA 1J33A 3A1VA 4JSRA 3O38A 4B0OA 2GSDA 3CGWA 2J3IA 4XWKA 3KYDA 3WGTA 5DN6D 5HQ3A 3B5IA 1G8HA 2H8KA 4HI0E 1UANA 5IEBA 2BGIA 1F3OA 4YHHB 2QN2A 5G02A 1I32A 5A9SA 5C8YB 1U04A 1ONSA 2WU1A 2VSQA 2C2KA 3RC1A 1D8TA 5K2OA 1YOVA 1C4OA 3QEMB 3SSMA 2I1LA 4ZO4A 5FI3A 2ERXA 3SE7A 4XJTA 2WG1A 2OCGA 1KZ7B 3O31A 1UPCA 3GQBB 3VZBA 4UNQA 1YRHA 4IEFB 1D0IA 4XYGA 5LOVA 1E0KA 1MR3F 1TYEB 3OOYA 3KBOA 2H7CA 3S4YA 3IJEB 5IH7A 1GTRA 1J23A 2SCUB 2AZMA 3IP7A 4HYTA 4NHOA 4QGGA 4RLQA 3ZDYB 2I2AA 2QTFA 1D7OA 1VP9A 3DR5A 3NT4A 4RQBA 4EKIA 4WNIA 1XTUA 2C9YA 3RG8A 3F1KA 4MCIA 5HR5A 3B8HA 4HH4A 5IT0A 3D6TB 1IXSB 2JLAA 1CNFA 1SC9A 2BJVA 1ZC3A 1Y5NA 3F6BX 2DAPA 2HF7A 2G08A 2BRUA 2VBCA 4D96A 4Y1FA 4YXWA 3KOZA 2RH5A 3ULKA 3DSRA 5H68A 3H7AA 5L51A 1V6SA 1PZGA 1K7EB 1SCIA 2VZ8A 4M87A 4RS4A 4WOBA 3AJ9A 1TJ3A 1W9MA 4DA7A 5CGQB 1FZTA 3VHXA 1W2XA 3A3YA 4E3WA 5HXAA 4R2IA 2O52A 4MWTA 4AZTA 4KU4A 4DR5B 5EHZA 2GT1A 5DYTA 3O0DA 2CLCX 4B6QA 5AICA 3H9GA 4HVLA 2KBEA 2IV2X 5JXHA 3NALA 4FN5A 3T89A 2JCXA 1DOZA 1M2EA 3KTFA 2XB2A 3IP3A 3CPJB 1QJCA 2W22A 4M0KA 1XAJA 5KJCA 4QU0A 2RCNA 4NONA 5CIYA 4F47A 1HPLA 3K9CA 3HXMA 1W4CA 2WKPA 4LI0A 4OJMX 4ZAZA 4OB6A 5E6RA 3I01M 1C81A 4O63O 1IEWA 1MLDA 4EY5A 1JSXA 2VSUC 3ZBQA 1IIRA 2R4UA 1PNVA 5FUBA 4B80A 3K0AA 5J3JA 3U13A 4OHCA 5I7WA 2GVDC 4RTMA 1FFGA 1I2MA 2JHAA