3ZWIA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound at 1.25 a:unrestraint refinement
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas-Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3zwiA00
1A7VA 3DE9A 1APCA 2XL8A 1LM3B 2YLGA 3QW0A 3M4BA 4IARA 4U9EA 4U9DA 5JT4A 5JVEA 4WGZA 5JS5A 1E83A 2XLOA 1CPQA 3NMJA 2YL3A 3QVYA 4N6HA 3ZTZA 2XLHA 2XL6A 3ZTMA 2XLMA 5JUAA 4ER9A 5AGFA 3C63A 3NMIA 4WGYA 4D4NA 1QQ3A 3HNJA 2XM0A 5JP7A 4L6RA 3L1MA 2YLIA 3QVZA 4CJGA 256BA 2YL1A 5JLIA 3NMKA 4CDYA 1QPUA 1E86A 3M15A 2J8WA 2XLVA 3ZQVA 1E85A 1EKYA 2XLDA 1CPRA 4D4XA 4N4WA 2QLAA 4JKVA 2J9BA 4JEBA 5JRAA 1BBHA 1GQAA 2YLDA 1RCPA 1M6TA 3HNIA 2CCYA 1NBBA 1E84A 3ZQYA 2YKZA 1S05A 1YZAA 3TOLA 3TOMA 1CGOA 4IB4A 5JSLA 1JAFA 3ZWIA 3M4CA 2YL7A 2XLWA 4CDAA 4NC3A 3DE8A 4CJOA 3HNKA 3M79A 1CGNA 3FOOA 3IQ6A 3U8PA 4CIPA 5B3IA 4CDVA 3FOPA 3IQ5A 4ULVA 4CX9A 4IAQA 3QW1A 2XM4A 4EIYA 1YZCA 3VRCA 1YYJA 4JE9A 2BC5A 2XLEA 3HNLA 4JEAA 1MQVA 2YL0A 1YYXA 3C62A
chains in the Genus database with same CATH superfamily
5BQIA 3H2UA 1U89A 1TKNA 2LP4A 3N24A 3T9OA 2R7QA 2FGYA 2GDCA 5GPGB 2R7SA 3GEHA 3ZG1A 3M4BA 1G4US 3AG4C 4CSAC 1TFOB 2P6VA 3VAYA 4AL0A 2EPMX 2R7WA 2HUJA 3L34A 4YT8A 1T9KA 4Z9IA 3V5XA 4AX2A 2KSFA 3S90A 1GM5A 1H9TA 1YAUO 1E83A 4LDQA 3L8JA 5CIVA 5DLJA 1LKXA 2R03A 2YL3A 3QVYA 4MVOA 3H2VA 1G8XA 3ZTMA 5L3QA 2C04A 3C8GD 1D0ZA 1EA8A 4AK9A 1Z63A 3OWTA 1W2WA 2PX3A 1SMYF 2A1DD 3GEIA 3S9OA 1D1BA 5A6JA 5EK0A 2R7VA 1KTMA 4KNVA 4WGYA 5DS5A 4PJLA 2GA0A 2VCBA 2OEXA 4I44A 1NU7D 2W4MA 4I1OB 2HJ3A 3POVA 3ABMC 4LLCA 1J8MF 4PACA 4YT2A 3DJNB 1LE2A 3I5PA 1FAPB 4CBEA 2HMZA 1Q0DA 1HW2A 1RMVA 1VLSA 2NSFA 5KYXA 4AE4B 2VCCA 2H8AA 3ASNC 3U3BA 4PJNA 4YL1A 2ZXOA 1OXKA 2AVKA 5E3AA 1LVKA 2JD3A 3HJCA 3M15A 5K0IA 2H7OA 2R7OA 4MTOA 1I4YA 4YT4A 2XLVA 3DKAA 4C7OB 1Q0KA 1CPRA 4D4XA 4G0HA 4JCHA 2J9BA 2R9RB 2P1AA 4JEBA 4U5FE 3B0VC 3HKKA 1SZIA 1H6GA 1OW6A 4XEFA 4CS9C 1GQAA 4WABA 4MTFA 4Q4ZF 2DYRC 1PD1A 5KYWA 2NUPA 1RCPA 1M6TA 3Q7LA 1NBBA 2A6HF 3NKDA 5KYYA 1FNTc 3GODA 3SEOA 5T1DB 1ZHZA 3TOMA 4BPMA 3IQCA 3SP1A 3GANA 1I4ZA 1QZXA 1IZMA 1JAFA 3EQLF 3H65A 4CS8C 1HW1A 1ZHTA 2VASA 3KYIA 4JURI 1GS9A 1F1MA 2YL7A 4PJJA 1VTMP 4R32A 4DBQA 2EPNA 1FFTC 4DBRA 3KL4A 3CSKA 2OJQA 1YA7O 2WVNA 3A9CA 1V54C 4FX5A 1T6UA 4NC3A 2ZPAA 3GWLA 4XPYA 2X0CA 5T3TA 3O10A 4CJOA 2ZXPA 4HE8D 3OA1A 5F5FA 3MYIA 4NTFA 2D4UA 2QNLA 3IEEA 1OCZC 2ZXRA 3IQ6A 1HY5A 2HZ8A 4QI2A 3C8GA 4N06A 2OQMA 1R5ID 3B0PA 1SR2A 1BDJB 1JRAA 2EIMC 3NYJA 2ETSA 3R2PA 4JVSA 4PK4A 4XEKA 3WHNA 2I15A 4BJ6C 3DAGA 3EG9B 3K6BA 4CDVA 2KGOA 2WZGA 3C18A 2X51A 1OCCC 2BL2A 5L3VA 1YZCA 5FCLA 5B1AC 4JCZA 2GFHA 4U5DE 4M63A 3X1OA 1RJ9B 1OR2A 4BG0A 1BZ4A 2HV7A 2HJMA 3HNLA 3IQTA 4NCQA 4QDLA 3JYYA 3S28A 3AQCA 4G78A 3L8IA 3U5SA 3U9JA 1TFKB 4JEAA 3A11A 2DB4A 1QVXA 4IWBA 3N2ZB 3WODF 1Z5ZA 3L0IA 4Z9HA 1FFHA 1Q0MA 3DWWA 3VM6A 1N1CA 2ICWG 3LAYA 3JRMO 1YYXA 3B71A 1U6HA 1LIHA 2BE5F 2OU6A 2DGJA 3B29A 3DE9A 3Q6MA 4E0HA 4F4BA 4GQHA 3TJ6A 4NTBA 3UMKA 1LM3B 2YLGA 2XXAA 4B6IA 3QW0A 2HS5A 4JTCB 4C7OA 1E2XA 2LIGA 1LPEA 4JZAA 5DVWA 4J7TA 2H7VC 4MW3A 3EGDB 1Z23A 4IARA 5JT4A 1QLEC 5JVEA 3E70C 5KYUA 3S84A 4FAPB 1CPQA 4JTAB 4CS9A 2CNWA 1PCXA 2VC9A 5A6AA 1OW7A 3RQEA 1T6IA 3KH2A 4P9TA 5COFA 3V7OA 4OIQF 1NU9C 1BR2A 1A0BA 1OW8A 1Y4CA 2YWAA 2XRHA 4I3MA 5E33A 1ZU4A 5AGFA 5IY5C 3C63A 4J30B 3EH1A 3NMIA 2IBFA 3ZC4A 4E7SA 2PBEA 2AWCA 1OXBA 3CAXA 1BR4A 3HNJA 3TD7A 3F46A 4E0IA 2W45A 2Y3GA 2YEVA 1YVIA 4DRHB 4YK5A 4E18A 4CJGA 2ZXWC 2KJGA 2YL1A 1M2VA 4LDKA 4UDVA 1JPJA 4NQFA 3AG3C 4PFPA 1E86A 3DJUB 1D1AA 2IXMA 1QKRA 3RH3A 2L9JA 1B68A 4XLPF 5DQZA 3JYHA 2J8WA 5HSWA 2P7VA 3ITFA 1RKCA 3JCUQ 2YQYA 3ZQVA 3UGPA 1JPNA 3RYLA 1HE1A 2QLAA 2LK4A 3VF0A 2LCHA 4O6MA 2DYSC 1TR2A 5JRAA 3FAPB 3RIPA 1BBHA 5D92A 1JR8A 3UMIA 1C03A 1NZEA 2E87A 2L6FA 2HFIA 1YJGA 2NUTA 2Y69C 3OEOA 3AG1C 1ZHXA 2Z15A 4K7BA 3TOLA 2LQGA 2L81A 3EJNA 3KYJA 3US6A 5L0IA 2NG1A 3V5ZA 1O87A 2B0JA 1DOVA 2UUHA 1KNYA 2LFFA 1S7ZA 2AU5A 2YZSA 4P9FA 3NRHA 2FAPB 1C02A 1FMWA 1TWCA 3JZ0A 4YL0A 3PDMP 2J7PA 3K33A 3NYMA 2G62A 3FMSA 2A6EF 3HNKA 3EZIA 3G4ZA 1C17M 1Z3IX 3LEVA 3MLGA 5CI8A 3EGDA 3M79A 2QE9A 3AOUA 3GWNA 1CGNA 5B1BC 4BEMJ 3LEOA 4K0DA 2G3KA 2IYLD 3O39A 4KNWA 5BQGA 2W4BA 1G4WR 2M4EA 1VMAA 2OG2A 2JPUA 4I1MA 2IXOA 1QSPA 3EGXA 3SXKA 4C3DA 3S27A 3RKOF 1HMOA 2CNWD 5KYNA 5COMA 3FOPA 2P0NA 4O6YA 3IQ5A 1UFBA 1V55C 1ORSC 2WB7A 4JJFA 3C8ZA 3QW1A 1T6QA 4IRUA 2XM4A 3RW0A 3SYNA 4EIYA 2OEVA 2Q9CA 4XPWA 2YRFA 3EFOB 3VRCA 4PR9A 2Q4FA 3KMIA 2WVQA 3W2WA 5BQHA 2Q3TA 5DS4A 1K40A 1ORYA 1BR1A 3ATPA 1MQVA 1LI7A 4W8PA 4FESA 1V4AA 4RBNA 5L0JA 1TQGA 3X2QC 5A6BA 3LS0A 3K1IC 3JSEO 2KYHA 4CSAA 1XZPA 3CQZA 1A7VA 4MS2A 1APCA 1ST6A 2P61A 1VLTA 3T6GB 3UMHA 3EPVA 2XL8A 4CIHA 2AP3A 1RKEB 2CDQA 3CEXA 3JT1A 3RQFA 2MYSA 3U3FA 4PJMA 1IW7F 1GGQA 4MQ9F 5HV9A 2IOQA 3S29A 2J0WA 3DMDA 2QY9A 4FWVA 4YL3A 4U9EA 2R7XA 4WGZA 1H9GA 1EQ1A 2XS8A 3TULA 3N0TA 3W8HA 3PHF2 1SYQA 1OQCA 1A41A 3NMJA 2Y3BA 5F5HA 1MNEA 3TQOA 3NKEA 4O79A 3SNHA 4N6HA 4JTDB 4E17A 1ZHYA 1VOMA 2J0XA 2PF4E 4RDAA 3DM9B 4IJJA 4XPXA 5A6KA 2XLMA 3C7JA 4ER9A 4LACB 3AG2C 1YLMA 4OIOF 4GEHA 4YJWA 2LFDA 5F28E 3BEHA 1AEPA 1Y6DA 1K05A 3GEEA 4O7GA 3SXYA 4AE4A 1RXQA 2KW3C 4G7ZF 4MVMA 2ASRA 2CGEA 4DVYP 3J06A 4D4NA 3EH2A 1R4TA 4PFOA 2L6HA 1QQ3A 2A68F 4G7HF 2XM0A 1JOGA 1ZW2A 3L1MA 3LJBA 2NPUA 2WVOA 1A7EA 2A0UA 2CYDA 3Q6NA 4LDRA 4EBJA 1LS1A 3LUTB 4LERA 2L6GA 3SZRA 3GORA 4O6NA 5JLIA 2J45A 2J7PD 3NMKA 3U9MA 4H54A 4J32B 4AL1A 2HMQA 2Y3HA 4DXWA 4G7OF 2J9VA 4WJ0A 1UG7A 2KNHA 1YA9A 1OKKD 1LE4A 2QUPA 3MX3A 1NSGB 1Z6AA 4HEAJ 4W8KA 1E85A 2XLDA 4N4WA 3O55A 5KYXB 1H7IA 2EILC 4JKVA 2L7AA 4IAOA 4BJ1A 2EINC 1OCRC 1M57C 2YLDA 4C3BA 1WWPA 4MVSA 4MW8A 5DQTA 2J9WA 3ABLC 3ASOC 2HV6A 2CCYA 4CS8A 4J7YA 5L0DA 4JRZA 1S05A 1YZAA 1FTSA 3FDQA 1D0XA 1K04A 4MVQA 3AGTA 1OCOC 1L7CA 1CGOA 4ZLCA 4IB4A 5AC4A 1ZZPA 2D5RB 3EHMA 2C03A 3MFNA 3AQBA 1XZQA 4IGGA 3RFYA 3ZWIA 5KYWB 1ZYRF 3M4CA 2NUPB 2R7TA 5A6BD 2LSEA 5KYYB 1MMNA 2F22A 4KC9A 2B0HA 3DD7A 3QZCA 2VH3A 1MMDA 1YDIA 2YHSA 4Q5SF 4JC7A 3ABKC 4LLEA 3W4YA 3UR3C 2UUIA 3DE8A 3UNGC 2PP4A 3S0XA 3EG9A 3Q7GA 1PV3A 1WN0A 3JTLO 2CW0F 3F47A 4BJ6A 3GM2A 2M64A 1NG1A 2PX0A 2KC3A 2EIJC 1NFOA 3FOOA 2HSBA 4MVRA 4CS7A 4YN0B 1RJ9A 2EPLX 1VYKA 3FHDA 1LS4A 3PCVA 3W8IA 4EBBA 3NYLA 2J46A 4EWCA 4CIPA 3RQGA 3UGOA 1WOLA 4ULVA 5A69A 2IXPA 1SF8A 4CX9A 3BRJA 1ZVZA 3DI5A 3RVYA 4ONSA 2AWYA 5B3SC 3T4RA 1ZW3A 2WL8A 1I5NA 4BJ5C 3ZSUA 4OIPF 4ZLDA 1MMAA 1HMDA 3C8GB 2BC5A 2H7BA 2MWQA 5EHHA 1CGME 2Q9AA 1ZU5A 3HTKC 2RSEB 3QMKA 2EPKX 2HKVA 3DZAA 3RF3A 4OINF 4BEJA 2IXNA 2NSGA 5EGYA 4OD4A 3LNMB 1TWAA 4EHPA 2VCAA 4X0RA 2OCCC 3E9VA 2XSEA 4ANJA 3MYFA 1OKKA 1WATA 2HSQA 4DRJB 3QTHA 2OKUA 4MVUA 2R7RA 3I4UA 4MNDA 3TK0A 4Q7CA 3NG1A 3SXZA 5L0GA 2YVKA 4DRIB 4OD5A 4H4KC 3K7DA 2O9XA 4U9DA 4XEVA 3DXJF 2A0BA 3WG7C 2GWWA 1FR0A 5JS5A 2J9UA 3FXHA 4U5GA 2XLOA 2KQ9A 4DVZA 4Z9JA 2XXAB 1U0BB 3LLKA 3ZTZA 4OIRF 3W2VA 2EIKC 2XLHA 2XL6A 5FZTA 1Z7Qc 1OR3A 2V3CC 4NTAA 2RD9A 2PFDA 1T01A 3MBGA 2Y3DA 5JUAA 3B0UX 2PNOA 2Y39A 1D1CA 5L0CA 2I8BA 1V74B 1WTYA 3K66A 3LS1A 5KYUB 4XTKA 5TJ5E 4N6CA 3IPMO 4U5CE 4EKWA 3RVZA 1VK5A 3HLZA 4XWJA 5JP7A 4L6RA 4C3EA 2YLIA 3QVZA 256BA 3T6JA 1M56C 5L0FA 2A69F 1Q0FA 3JSZA 1WGWA 1VB5A 3AJMA 3K1HA 3WAQA 1QPUA 4JW1A 4CDYA 2Q9BA 1AVOB 3U0CA 3IHUA 3ZVRA 3FAJA 4A2NB 3TJ5A 2TMVP 2V26A 1VYIA 1O3UA 4NY3A 3ZDLA 2WZLA 5AC5A 1J8YF 1EKYA 1M2VB 3KPHA 1NFNA 3G50A 1JMWA 4JIOA 2EPOA 3LNRA 3O6XA 4YT5A 1XWJA 1NLXA 5DS6A 2R05A 1FMVA 2GAQA 1MNDA 1TWGA 5D91A 3ZIBA 5BUOA 5CI9A 1A7DA 3VYWA 3HNIA 1E84A 4KI2A 2Q7RA 2R7UA 3ZQYA 4BJ5A 2YKZA 3SXMA 1DOWA 1KU2A 3U2MA 1Q0GA 3GM3A 1T5OA 3GM1A 1G5ZA 2QTVA 2OOCA 5JSLA 1L3PA 2FFHA 5E3CA 2NUTB 3V5YA 4RD9A 4JJGA 4MTGA 4HFFB 2XLWA 1HE9A 1AUEA 4CDAA 4DJ9A 5L0HA 4K1OA 1PD0A 3G4XA 1LI5A 2JX0A 4GYTA 4YWQA 4P6IC 3CZ6A 3EZHA 3M1CB 2LD6A 2MHRA 1M2OA 4EUKB 3NDBB 3JRTA 4U5HA 4DOZA 3EFOA 5T3WA 4ULWA 4XLNF 3ECSA 3U8PA 5COGA 3U8VA 2R02A 4E7ZA 1ZHWA 2KK1A 3DM5A 4XQ1A 3EHNA 2R25A 1ORJA 4A4AA 3LESA 5B3IA 2Q00A 3AGUA 4U5EE 3T6BA 3FVYA 3KKBA 4BJTA 4IAQA 2G3VA 2XL4A 4MVZA 2ZD9A 1TWHA 4KBLA 3I5QA 1D0YA 1MMGA 3U2LA 5E2QA 1YYJA 4JE9A 2WZFA 2OJED 2XLEA 3K1IA 4HFKB 4QI0A 3EGXB 2IM8A 3R7CA 1RKEA 4U5BE 2W9YA 3B9QA 2XS1A 3LLIA 3PMRA 2VB6A 1WASA 1O5HA 4EBKA 2DI3A 2YL0A 3DAFA 1YARO 3C62A 1EI7A
chains in the Genus database with same CATH topology
1A7VA 3DE9A 1APCA 2XL8A 1LM3B 2YLGA 3QW0A 3M4BA 4IARA 4U9EA 4U9DA 5JT4A 5JVEA 4WGZA 5JS5A 1E83A 2XLOA 1CPQA 3NMJA 2YL3A 3QVYA 4N6HA 3ZTZA 2XLHA 2XL6A 3ZTMA 2XLMA 5JUAA 4ER9A 5AGFA 3C63A 3NMIA 4WGYA 4D4NA 1QQ3A 3HNJA 2XM0A 5JP7A 4L6RA 3L1MA 2YLIA 3QVZA 4CJGA 256BA 2YL1A 5JLIA 3NMKA 4CDYA 1QPUA 1E86A 3M15A 2J8WA 2XLVA 3ZQVA 1E85A 1EKYA 2XLDA 1CPRA 4D4XA 4N4WA 2QLAA 4JKVA 2J9BA 4JEBA 5JRAA 1BBHA 1GQAA 2YLDA 1RCPA 1M6TA 3HNIA 2CCYA 1NBBA 1E84A 3ZQYA 2YKZA 1S05A 1YZAA 3TOLA 3TOMA 1CGOA 4IB4A 5JSLA 1JAFA 3ZWIA 3M4CA 2YL7A 2XLWA 4CDAA 4NC3A 3DE8A 4CJOA 3HNKA 3M79A 1CGNA 3FOOA 3IQ6A 3U8PA 4CIPA 5B3IA 4CDVA 3FOPA 3IQ5A 4ULVA 4CX9A 4IAQA 3QW1A 2XM4A 4EIYA 1YZCA 3VRCA 1YYJA 4JE9A 2BC5A 2XLEA 3HNLA 4JEAA 1MQVA 2YL0A 1YYXA 3C62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7V A;  3DE9 A;  1APC A;  2XL8 A;  1LM3 B;  2YLG A;  3QW0 A;  3M4B A;  4IAR A;  4U9E A;  4U9D A;  5JT4 A;  5JVE A;  4WGZ A;  5JS5 A;  1E83 A;  2XLO A;  1CPQ A;  3NMJ A;  2YL3 A;  3QVY A;  4N6H A;  3ZTZ A;  2XLH A;  2XL6 A;  3ZTM A;  2XLM A;  5JUA A;  4ER9 A;  5AGF A;  3C63 A;  3NMI A;  4WGY A;  4D4N A;  1QQ3 A;  3HNJ A;  2XM0 A;  5JP7 A;  4L6R A;  3L1M A;  2YLI A;  3QVZ A;  4CJG A;  256B A;  2YL1 A;  5JLI A;  3NMK A;  4CDY A;  1QPU A;  1E86 A;  3M15 A;  2J8W A;  2XLV A;  3ZQV A;  1E85 A;  1EKY A;  2XLD A;  1CPR A;  4D4X A;  4N4W A;  2QLA A;  4JKV A;  2J9B A;  4JEB A;  5JRA A;  1BBH A;  1GQA A;  2YLD A;  1RCP A;  1M6T A;  3HNI A;  2CCY A;  1NBB A;  1E84 A;  3ZQY A;  2YKZ A;  1S05 A;  1YZA A;  3TOL A;  3TOM A;  1CGO A;  4IB4 A;  5JSL A;  1JAF A;  3ZWI A;  3M4C A;  2YL7 A;  2XLW A;  4CDA A;  4NC3 A;  3DE8 A;  4CJO A;  3HNK A;  3M79 A;  1CGN A;  3FOO A;  3IQ6 A;  3U8P A;  4CIP A;  5B3I A;  4CDV A;  3FOP A;  3IQ5 A;  4ULV A;  4CX9 A;  4IAQ A;  3QW1 A;  2XM4 A;  4EIY A;  1YZC A;  3VRC A;  1YYJ A;  4JE9 A;  2BC5 A;  2XLE A;  3HNL A;  4JEA A;  1MQV A;  2YL0 A;  1YYX A;  3C62 A; 
#chains in the Genus database with same CATH topology
 5BQI A;  3H2U A;  1U89 A;  1TKN A;  2LP4 A;  3N24 A;  3T9O A;  2R7Q A;  2FGY A;  2GDC A;  5GPG B;  2R7S A;  3GEH A;  3ZG1 A;  3M4B A;  1G4U S;  3AG4 C;  4CSA C;  1TFO B;  2P6V A;  3VAY A;  4AL0 A;  2EPM X;  2R7W A;  2HUJ A;  3L34 A;  4YT8 A;  1T9K A;  4Z9I A;  3V5X A;  4AX2 A;  2KSF A;  3S90 A;  1GM5 A;  1H9T A;  1YAU O;  1E83 A;  4LDQ A;  3L8J A;  5CIV A;  5DLJ A;  1LKX A;  2R03 A;  2YL3 A;  3QVY A;  4MVO A;  3H2V A;  1G8X A;  3ZTM A;  5L3Q A;  2C04 A;  3C8G D;  1D0Z A;  1EA8 A;  4AK9 A;  1Z63 A;  3OWT A;  1W2W A;  2PX3 A;  1SMY F;  2A1D D;  3GEI A;  3S9O A;  1D1B A;  5A6J A;  5EK0 A;  2R7V A;  1KTM A;  4KNV A;  4WGY A;  5DS5 A;  4PJL A;  2GA0 A;  2VCB A;  2OEX A;  4I44 A;  1NU7 D;  2W4M A;  4I1O B;  2HJ3 A;  3POV A;  3ABM C;  4LLC A;  1J8M F;  4PAC A;  4YT2 A;  3DJN B;  1LE2 A;  3I5P A;  1FAP B;  4CBE A;  2HMZ A;  1Q0D A;  1HW2 A;  1RMV A;  1VLS A;  2NSF A;  5KYX A;  4AE4 B;  2VCC A;  2H8A A;  3ASN C;  3U3B A;  4PJN A;  4YL1 A;  2ZXO A;  1OXK A;  2AVK A;  5E3A A;  1LVK A;  2JD3 A;  3HJC A;  3M15 A;  5K0I A;  2H7O A;  2R7O A;  4MTO A;  1I4Y A;  4YT4 A;  2XLV A;  3DKA A;  4C7O B;  1Q0K A;  1CPR A;  4D4X A;  4G0H A;  4JCH A;  2J9B A;  2R9R B;  2P1A A;  4JEB A;  4U5F E;  3B0V C;  3HKK A;  1SZI A;  1H6G A;  1OW6 A;  4XEF A;  4CS9 C;  1GQA A;  4WAB A;  4MTF A;  4Q4Z F;  2DYR C;  1PD1 A;  5KYW A;  2NUP A;  1RCP A;  1M6T A;  3Q7L A;  1NBB A;  2A6H F;  3NKD A;  5KYY A;  1FNT c;  3GOD A;  3SEO A;  5T1D B;  1ZHZ A;  3TOM A;  4BPM A;  3IQC A;  3SP1 A;  3GAN A;  1I4Z A;  1QZX A;  1IZM A;  1JAF A;  3EQL F;  3H65 A;  4CS8 C;  1HW1 A;  1ZHT A;  2VAS A;  3KYI A;  4JUR I;  1GS9 A;  1F1M A;  2YL7 A;  4PJJ A;  1VTM P;  4R32 A;  4DBQ A;  2EPN A;  1FFT C;  4DBR A;  3KL4 A;  3CSK A;  2OJQ A;  1YA7 O;  2WVN A;  3A9C A;  1V54 C;  4FX5 A;  1T6U A;  4NC3 A;  2ZPA A;  3GWL A;  4XPY A;  2X0C A;  5T3T A;  3O10 A;  4CJO A;  2ZXP A;  4HE8 D;  3OA1 A;  5F5F A;  3MYI A;  4NTF A;  2D4U A;  2QNL A;  3IEE A;  1OCZ C;  2ZXR A;  3IQ6 A;  1HY5 A;  2HZ8 A;  4QI2 A;  3C8G A;  4N06 A;  2OQM A;  1R5I D;  3B0P A;  1SR2 A;  1BDJ B;  1JRA A;  2EIM C;  3NYJ A;  2ETS A;  3R2P A;  4JVS A;  4PK4 A;  4XEK A;  3WHN A;  2I15 A;  4BJ6 C;  3DAG A;  3EG9 B;  3K6B A;  4CDV A;  2KGO A;  2WZG A;  3C18 A;  2X51 A;  1OCC C;  2BL2 A;  5L3V A;  1YZC A;  5FCL A;  5B1A C;  4JCZ A;  2GFH A;  4U5D E;  4M63 A;  3X1O A;  1RJ9 B;  1OR2 A;  4BG0 A;  1BZ4 A;  2HV7 A;  2HJM A;  3HNL A;  3IQT A;  4NCQ A;  4QDL A;  3JYY A;  3S28 A;  3AQC A;  4G78 A;  3L8I A;  3U5S A;  3U9J A;  1TFK B;  4JEA A;  3A11 A;  2DB4 A;  1QVX A;  4IWB A;  3N2Z B;  3WOD F;  1Z5Z A;  3L0I A;  4Z9H A;  1FFH A;  1Q0M A;  3DWW A;  3VM6 A;  1N1C A;  2ICW G;  3LAY A;  3JRM O;  1YYX A;  3B71 A;  1U6H A;  1LIH A;  2BE5 F;  2OU6 A;  2DGJ A;  3B29 A;  3DE9 A;  3Q6M A;  4E0H A;  4F4B A;  4GQH A;  3TJ6 A;  4NTB A;  3UMK A;  1LM3 B;  2YLG A;  2XXA A;  4B6I A;  3QW0 A;  2HS5 A;  4JTC B;  4C7O A;  1E2X A;  2LIG A;  1LPE A;  4JZA A;  5DVW A;  4J7T A;  2H7V C;  4MW3 A;  3EGD B;  1Z23 A;  4IAR A;  5JT4 A;  1QLE C;  5JVE A;  3E70 C;  5KYU A;  3S84 A;  4FAP B;  1CPQ A;  4JTA B;  4CS9 A;  2CNW A;  1PCX A;  2VC9 A;  5A6A A;  1OW7 A;  3RQE A;  1T6I A;  3KH2 A;  4P9T A;  5COF A;  3V7O A;  4OIQ F;  1NU9 C;  1BR2 A;  1A0B A;  1OW8 A;  1Y4C A;  2YWA A;  2XRH A;  4I3M A;  5E33 A;  1ZU4 A;  5AGF A;  5IY5 C;  3C63 A;  4J30 B;  3EH1 A;  3NMI A;  2IBF A;  3ZC4 A;  4E7S A;  2PBE A;  2AWC A;  1OXB A;  3CAX A;  1BR4 A;  3HNJ A;  3TD7 A;  3F46 A;  4E0I A;  2W45 A;  2Y3G A;  2YEV A;  1YVI A;  4DRH B;  4YK5 A;  4E18 A;  4CJG A;  2ZXW C;  2KJG A;  2YL1 A;  1M2V A;  4LDK A;  4UDV A;  1JPJ A;  4NQF A;  3AG3 C;  4PFP A;  1E86 A;  3DJU B;  1D1A A;  2IXM A;  1QKR A;  3RH3 A;  2L9J A;  1B68 A;  4XLP F;  5DQZ A;  3JYH A;  2J8W A;  5HSW A;  2P7V A;  3ITF A;  1RKC A;  3JCU Q;  2YQY A;  3ZQV A;  3UGP A;  1JPN A;  3RYL A;  1HE1 A;  2QLA A;  2LK4 A;  3VF0 A;  2LCH A;  4O6M A;  2DYS C;  1TR2 A;  5JRA A;  3FAP B;  3RIP A;  1BBH A;  5D92 A;  1JR8 A;  3UMI A;  1C03 A;  1NZE A;  2E87 A;  2L6F A;  2HFI A;  1YJG A;  2NUT A;  2Y69 C;  3OEO A;  3AG1 C;  1ZHX A;  2Z15 A;  4K7B A;  3TOL A;  2LQG A;  2L81 A;  3EJN A;  3KYJ A;  3US6 A;  5L0I A;  2NG1 A;  3V5Z A;  1O87 A;  2B0J A;  1DOV A;  2UUH A;  1KNY A;  2LFF A;  1S7Z A;  2AU5 A;  2YZS A;  4P9F A;  3NRH A;  2FAP B;  1C02 A;  1FMW A;  1TWC A;  3JZ0 A;  4YL0 A;  3PDM P;  2J7P A;  3K33 A;  3NYM A;  2G62 A;  3FMS A;  2A6E F;  3HNK A;  3EZI A;  3G4Z A;  1C17 M;  1Z3I X;  3LEV A;  3MLG A;  5CI8 A;  3EGD A;  3M79 A;  2QE9 A;  3AOU A;  3GWN A;  1CGN A;  5B1B C;  4BEM J;  3LEO A;  4K0D A;  2G3K A;  2IYL D;  3O39 A;  4KNW A;  5BQG A;  2W4B A;  1G4W R;  2M4E A;  1VMA A;  2OG2 A;  2JPU A;  4I1M A;  2IXO A;  1QSP A;  3EGX A;  3SXK A;  4C3D A;  3S27 A;  3RKO F;  1HMO A;  2CNW D;  5KYN A;  5COM A;  3FOP A;  2P0N A;  4O6Y A;  3IQ5 A;  1UFB A;  1V55 C;  1ORS C;  2WB7 A;  4JJF A;  3C8Z A;  3QW1 A;  1T6Q A;  4IRU A;  2XM4 A;  3RW0 A;  3SYN A;  4EIY A;  2OEV A;  2Q9C A;  4XPW A;  2YRF A;  3EFO B;  3VRC A;  4PR9 A;  2Q4F A;  3KMI A;  2WVQ A;  3W2W A;  5BQH A;  2Q3T A;  5DS4 A;  1K40 A;  1ORY A;  1BR1 A;  3ATP A;  1MQV A;  1LI7 A;  4W8P A;  4FES A;  1V4A A;  4RBN A;  5L0J A;  1TQG A;  3X2Q C;  5A6B A;  3LS0 A;  3K1I C;  3JSE O;  2KYH A;  4CSA A;  1XZP A;  3CQZ A;  1A7V A;  4MS2 A;  1APC A;  1ST6 A;  2P61 A;  1VLT A;  3T6G B;  3UMH A;  3EPV A;  2XL8 A;  4CIH A;  2AP3 A;  1RKE B;  2CDQ A;  3CEX A;  3JT1 A;  3RQF A;  2MYS A;  3U3F A;  4PJM A;  1IW7 F;  1GGQ A;  4MQ9 F;  5HV9 A;  2IOQ A;  3S29 A;  2J0W A;  3DMD A;  2QY9 A;  4FWV A;  4YL3 A;  4U9E A;  2R7X A;  4WGZ A;  1H9G A;  1EQ1 A;  2XS8 A;  3TUL A;  3N0T A;  3W8H A;  3PHF 2;  1SYQ A;  1OQC A;  1A41 A;  3NMJ A;  2Y3B A;  5F5H A;  1MNE A;  3TQO A;  3NKE A;  4O79 A;  3SNH A;  4N6H A;  4JTD B;  4E17 A;  1ZHY A;  1VOM A;  2J0X A;  2PF4 E;  4RDA A;  3DM9 B;  4IJJ A;  4XPX A;  5A6K A;  2XLM A;  3C7J A;  4ER9 A;  4LAC B;  3AG2 C;  1YLM A;  4OIO F;  4GEH A;  4YJW A;  2LFD A;  5F28 E;  3BEH A;  1AEP A;  1Y6D A;  1K05 A;  3GEE A;  4O7G A;  3SXY A;  4AE4 A;  1RXQ A;  2KW3 C;  4G7Z F;  4MVM A;  2ASR A;  2CGE A;  4DVY P;  3J06 A;  4D4N A;  3EH2 A;  1R4T A;  4PFO A;  2L6H A;  1QQ3 A;  2A68 F;  4G7H F;  2XM0 A;  1JOG A;  1ZW2 A;  3L1M A;  3LJB A;  2NPU A;  2WVO A;  1A7E A;  2A0U A;  2CYD A;  3Q6N A;  4LDR A;  4EBJ A;  1LS1 A;  3LUT B;  4LER A;  2L6G A;  3SZR A;  3GOR A;  4O6N A;  5JLI A;  2J45 A;  2J7P D;  3NMK A;  3U9M A;  4H54 A;  4J32 B;  4AL1 A;  2HMQ A;  2Y3H A;  4DXW A;  4G7O F;  2J9V A;  4WJ0 A;  1UG7 A;  2KNH A;  1YA9 A;  1OKK D;  1LE4 A;  2QUP A;  3MX3 A;  1NSG B;  1Z6A A;  4HEA J;  4W8K A;  1E85 A;  2XLD A;  4N4W A;  3O55 A;  5KYX B;  1H7I A;  2EIL C;  4JKV A;  2L7A A;  4IAO A;  4BJ1 A;  2EIN C;  1OCR C;  1M57 C;  2YLD A;  4C3B A;  1WWP A;  4MVS A;  4MW8 A;  5DQT A;  2J9W A;  3ABL C;  3ASO C;  2HV6 A;  2CCY A;  4CS8 A;  4J7Y A;  5L0D A;  4JRZ A;  1S05 A;  1YZA A;  1FTS A;  3FDQ A;  1D0X A;  1K04 A;  4MVQ A;  3AGT A;  1OCO C;  1L7C A;  1CGO A;  4ZLC A;  4IB4 A;  5AC4 A;  1ZZP A;  2D5R B;  3EHM A;  2C03 A;  3MFN A;  3AQB A;  1XZQ A;  4IGG A;  3RFY A;  3ZWI A;  5KYW B;  1ZYR F;  3M4C A;  2NUP B;  2R7T A;  5A6B D;  2LSE A;  5KYY B;  1MMN A;  2F22 A;  4KC9 A;  2B0H A;  3DD7 A;  3QZC A;  2VH3 A;  1MMD A;  1YDI A;  2YHS A;  4Q5S F;  4JC7 A;  3ABK C;  4LLE A;  3W4Y A;  3UR3 C;  2UUI A;  3DE8 A;  3UNG C;  2PP4 A;  3S0X A;  3EG9 A;  3Q7G A;  1PV3 A;  1WN0 A;  3JTL O;  2CW0 F;  3F47 A;  4BJ6 A;  3GM2 A;  2M64 A;  1NG1 A;  2PX0 A;  2KC3 A;  2EIJ C;  1NFO A;  3FOO A;  2HSB A;  4MVR A;  4CS7 A;  4YN0 B;  1RJ9 A;  2EPL X;  1VYK A;  3FHD A;  1LS4 A;  3PCV A;  3W8I A;  4EBB A;  3NYL A;  2J46 A;  4EWC A;  4CIP A;  3RQG A;  3UGO A;  1WOL A;  4ULV A;  5A69 A;  2IXP A;  1SF8 A;  4CX9 A;  3BRJ A;  1ZVZ A;  3DI5 A;  3RVY A;  4ONS A;  2AWY A;  5B3S C;  3T4R A;  1ZW3 A;  2WL8 A;  1I5N A;  4BJ5 C;  3ZSU A;  4OIP F;  4ZLD A;  1MMA A;  1HMD A;  3C8G B;  2BC5 A;  2H7B A;  2MWQ A;  5EHH A;  1CGM E;  2Q9A A;  1ZU5 A;  3HTK C;  2RSE B;  3QMK A;  2EPK X;  2HKV A;  3DZA A;  3RF3 A;  4OIN F;  4BEJ A;  2IXN A;  2NSG A;  5EGY A;  4OD4 A;  3LNM B;  1TWA A;  4EHP A;  2VCA A;  4X0R A;  2OCC C;  3E9V A;  2XSE A;  4ANJ A;  3MYF A;  1OKK A;  1WAT A;  2HSQ A;  4DRJ B;  3QTH A;  2OKU A;  4MVU A;  2R7R A;  3I4U A;  4MND A;  3TK0 A;  4Q7C A;  3NG1 A;  3SXZ A;  5L0G A;  2YVK A;  4DRI B;  4OD5 A;  4H4K C;  3K7D A;  2O9X A;  4U9D A;  4XEV A;  3DXJ F;  2A0B A;  3WG7 C;  2GWW A;  1FR0 A;  5JS5 A;  2J9U A;  3FXH A;  4U5G A;  2XLO A;  2KQ9 A;  4DVZ A;  4Z9J A;  2XXA B;  1U0B B;  3LLK A;  3ZTZ A;  4OIR F;  3W2V A;  2EIK C;  2XLH A;  2XL6 A;  5FZT A;  1Z7Q c;  1OR3 A;  2V3C C;  4NTA A;  2RD9 A;  2PFD A;  1T01 A;  3MBG A;  2Y3D A;  5JUA A;  3B0U X;  2PNO A;  2Y39 A;  1D1C A;  5L0C A;  2I8B A;  1V74 B;  1WTY A;  3K66 A;  3LS1 A;  5KYU B;  4XTK A;  5TJ5 E;  4N6C A;  3IPM O;  4U5C E;  4EKW A;  3RVZ A;  1VK5 A;  3HLZ A;  4XWJ A;  5JP7 A;  4L6R A;  4C3E A;  2YLI A;  3QVZ A;  256B A;  3T6J A;  1M56 C;  5L0F A;  2A69 F;  1Q0F A;  3JSZ A;  1WGW A;  1VB5 A;  3AJM A;  3K1H A;  3WAQ A;  1QPU A;  4JW1 A;  4CDY A;  2Q9B A;  1AVO B;  3U0C A;  3IHU A;  3ZVR A;  3FAJ A;  4A2N B;  3TJ5 A;  2TMV P;  2V26 A;  1VYI A;  1O3U A;  4NY3 A;  3ZDL A;  2WZL A;  5AC5 A;  1J8Y F;  1EKY A;  1M2V B;  3KPH A;  1NFN A;  3G50 A;  1JMW A;  4JIO A;  2EPO A;  3LNR A;  3O6X A;  4YT5 A;  1XWJ A;  1NLX A;  5DS6 A;  2R05 A;  1FMV A;  2GAQ A;  1MND A;  1TWG A;  5D91 A;  3ZIB A;  5BUO A;  5CI9 A;  1A7D A;  3VYW A;  3HNI A;  1E84 A;  4KI2 A;  2Q7R A;  2R7U A;  3ZQY A;  4BJ5 A;  2YKZ A;  3SXM A;  1DOW A;  1KU2 A;  3U2M A;  1Q0G A;  3GM3 A;  1T5O A;  3GM1 A;  1G5Z A;  2QTV A;  2OOC A;  5JSL A;  1L3P A;  2FFH A;  5E3C A;  2NUT B;  3V5Y A;  4RD9 A;  4JJG A;  4MTG A;  4HFF B;  2XLW A;  1HE9 A;  1AUE A;  4CDA A;  4DJ9 A;  5L0H A;  4K1O A;  1PD0 A;  3G4X A;  1LI5 A;  2JX0 A;  4GYT A;  4YWQ A;  4P6I C;  3CZ6 A;  3EZH A;  3M1C B;  2LD6 A;  2MHR A;  1M2O A;  4EUK B;  3NDB B;  3JRT A;  4U5H A;  4DOZ A;  3EFO A;  5T3W A;  4ULW A;  4XLN F;  3ECS A;  3U8P A;  5COG A;  3U8V A;  2R02 A;  4E7Z A;  1ZHW A;  2KK1 A;  3DM5 A;  4XQ1 A;  3EHN A;  2R25 A;  1ORJ A;  4A4A A;  3LES A;  5B3I A;  2Q00 A;  3AGU A;  4U5E E;  3T6B A;  3FVY A;  3KKB A;  4BJT A;  4IAQ A;  2G3V A;  2XL4 A;  4MVZ A;  2ZD9 A;  1TWH A;  4KBL A;  3I5Q A;  1D0Y A;  1MMG A;  3U2L A;  5E2Q A;  1YYJ A;  4JE9 A;  2WZF A;  2OJE D;  2XLE A;  3K1I A;  4HFK B;  4QI0 A;  3EGX B;  2IM8 A;  3R7C A;  1RKE A;  4U5B E;  2W9Y A;  3B9Q A;  2XS1 A;  3LLI A;  3PMR A;  2VB6 A;  1WAS A;  1O5H A;  4EBK A;  2DI3 A;  2YL0 A;  3DAF A;  1YAR O;  3C62 A;  1EI7 A; 
#chains in the Genus database with same CATH homology
 1A7V A;  3DE9 A;  1APC A;  2XL8 A;  1LM3 B;  2YLG A;  3QW0 A;  3M4B A;  4IAR A;  4U9E A;  4U9D A;  5JT4 A;  5JVE A;  4WGZ A;  5JS5 A;  1E83 A;  2XLO A;  1CPQ A;  3NMJ A;  2YL3 A;  3QVY A;  4N6H A;  3ZTZ A;  2XLH A;  2XL6 A;  3ZTM A;  2XLM A;  5JUA A;  4ER9 A;  5AGF A;  3C63 A;  3NMI A;  4WGY A;  4D4N A;  1QQ3 A;  3HNJ A;  2XM0 A;  5JP7 A;  4L6R A;  3L1M A;  2YLI A;  3QVZ A;  4CJG A;  256B A;  2YL1 A;  5JLI A;  3NMK A;  4CDY A;  1QPU A;  1E86 A;  3M15 A;  2J8W A;  2XLV A;  3ZQV A;  1E85 A;  1EKY A;  2XLD A;  1CPR A;  4D4X A;  4N4W A;  2QLA A;  4JKV A;  2J9B A;  4JEB A;  5JRA A;  1BBH A;  1GQA A;  2YLD A;  1RCP A;  1M6T A;  3HNI A;  2CCY A;  1NBB A;  1E84 A;  3ZQY A;  2YKZ A;  1S05 A;  1YZA A;  3TOL A;  3TOM A;  1CGO A;  4IB4 A;  5JSL A;  1JAF A;  3ZWI A;  3M4C A;  2YL7 A;  2XLW A;  4CDA A;  4NC3 A;  3DE8 A;  4CJO A;  3HNK A;  3M79 A;  1CGN A;  3FOO A;  3IQ6 A;  3U8P A;  4CIP A;  5B3I A;  4CDV A;  3FOP A;  3IQ5 A;  4ULV A;  4CX9 A;  4IAQ A;  3QW1 A;  2XM4 A;  4EIY A;  1YZC A;  3VRC A;  1YYJ A;  4JE9 A;  2BC5 A;  2XLE A;  3HNL A;  4JEA A;  1MQV A;  2YL0 A;  1YYX A;  3C62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...