3ZWIA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound at 1.25 a:unrestraint refinement
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas-Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3zwiA00
2YL7A 2XLVA 1QPUA 4CJOA 3DE8A 4N4WA 3QVYA 5JLIA 4NC3A 3U8PA 5JUAA 4IB4A 4IAQA 1QQ3A 3HNJA 1YZAA 2YKZA 2XM4A 4JEBA 4CX9A 4U9EA 2XM0A 3DE9A 3ZQYA 1EKYA 5JT4A 3ZWIA 3IQ5A 3VRCA 1YYJA 3M15A 5B3IA 3M4CA 2XLDA 2XLHA 3FOOA 3ZTZA 3C62A 1S05A 256BA 2YLGA 3TOLA 4WGZA 2YL3A 3TOMA 4CJGA 4EIYA 1RCPA 1YYXA 2XLMA 1NBBA 3NMIA 3HNIA 1CGNA 1JAFA 4JKVA 3M4BA 5AGFA 4JEAA 3M79A 3QW0A 5JVEA 3NMJA 3HNLA 2CCYA 4WGYA 2XLOA 2YL1A 1M6TA 4U9DA 3QVZA 1APCA 5JS5A 1YZCA 4CDYA 5JSLA 3IQ6A 1E83A 1A7VA 4IARA 3L1MA 1E84A 1BBHA 3HNKA 2YL0A 2BC5A 2QLAA 1E86A 4D4NA 4CDVA 3QW1A 3ZQVA 4L6RA 5JP7A 2YLIA 1CPQA 3NMKA 1CGOA 2XL6A 4JE9A 2XL8A 4ER9A 1LM3B 4CDAA 2J8WA 4ULVA 2XLWA 4CIPA 1MQVA 5JRAA 3FOPA 2YLDA 2J9BA 4N6HA 3ZTMA 3C63A 1E85A 4D4XA 1GQAA 1CPRA 2XLEA
chains in the Genus database with same CATH superfamily
4BEJA 4AX2A 4PR9A 2TMVP 4J30B 5KYUA 1BR2A 4XLPF 3IHUA 3U8PA 2J9UA 3EJNA 3K7DA 3KH2A 2R7XA 2G3VA 4JCHA 4K0DA 2A1DD 1OCCC 3I4UA 1Q0GA 2Y69C 2XM0A 3DE9A 3RKOF 2LP4A 3UMKA 3AQCA 2W45A 1ZHYA 3FMSA 2EINC 3LLKA 3TULA 4J32B 2HFIA 1L7CA 2ASRA 4U5GA 3ZSUA 1OKKD 1GM5A 1HW1A 5D92A 2EIMC 2EPNA 1C03A 5AC4A 3RVYA 5DQZA 2EILC 4O6MA 3RF3A 5T3TA 2G62A 1PV3A 4G7HF 4JVSA 1NFOA 5KYNA 4MVZA 3MFNA 3FXHA 4A4AA 3EFOB 3ABKC 4JRZA 4U5DE 3W4YA 5L3QA 2WZGA 2D4UA 3K1HA 3ZTZA 1D1CA 3C62A 3Q7GA 2A0UA 3L34A 3LEVA 4IWBA 5EHHA 3UGOA 1MMDA 1JRAA 2Q3TA 1T6UA 3DM9B 2VC9A 2R03A 2R02A 3ZG1A 2YL3A 1ZZPA 2XSEA 1Z3IX 4OD5A 5KYWB 5COMA 4CS9C 3V5XA 3V5ZA 4O7GA 3SYNA 5BQHA 3TK0A 3QMKA 1NG1A 5DVWA 2BL2A 2H7VC 4KI2A 3JRMO 1CGNA 4LDKA 1TFKB 5L0GA 2IOQA 2Y3HA 1LS4A 2NSFA 2WZFA 5L0HA 1HY5A 3JZ0A 4BJ5A 5K0IA 1W2WA 3GEEA 4PFPA 5A6JA 2R7VA 3LNMB 4YK5A 3K66A 3Q6MA 1VMAA 3BEHA 2IBFA 2HZ8A 4KNWA 3R7CA 1T6QA 4OIRF 3DWWA 4U9DA 4YL1A 2E87A 3MYFA 2MHRA 2YEVA 1H9TA 1NZEA 1PD0A 1RKEB 4JJGA 1KU2A 5DS6A 3H65A 1H9GA 4ANJA 5F28E 5JS5A 3DKAA 2IM8A 1J8MF 1OXBA 2PF4E 5L3VA 3U8VA 2IYLD 4F4BA 2Y39A 3HKKA 3AJMA 3EH2A 3IQ6A 3JRTA 4X0RA 1S7ZA 1LKXA 2KJGA 3QTHA 4IARA 3RYLA 1Q0FA 4CBEA 2L9JA 4E7SA 1AUEA 2KNHA 4H4KC 4DOZA 2RSEB 1XWJA 3LS1A 1D0XA 2HUJA 1AEPA 3HNKA 3S9OA 3S90A 2P1AA 1OXKA 4D4NA 1UFBA 3X2QC 5L0CA 4ONSA 4BJ1A 2HV6A 1ZVZA 1WOLA 2I8BA 5JP7A 5HV9A 2J7PA 4Q4ZF 1PD1A 3DJNB 2R7OA 4BEMJ 4ULWA 1CPQA 1JPNA 2VB6A 2WVQA 4IGGA 3B29A 4MVOA 2JX0A 3PHF2 5DS5A 4FWVA 2WB7A 3SXZA 1OW7A 3T6GB 3V7OA 4CDAA 3K1IA 1RJ9B 2EPOA 4OD4A 2J46A 2PNOA 4ULVA 4W8KA 4XWJA 4EBJA 2XLWA 2XXAB 2J45A 1M2VB 2OCCC 1RMVA 3FOPA 2MWQA 1M57C 2H7BA 2YLDA 3MYIA 3EFOA 1EI7A 4EUKB 3C63A 1E85A 3DXJF 1QVXA 2HSBA 1PCXA 3KYJA 3ASOC 2YVKA 4XPYA 4XQ1A 4XPWA 3WODF 3J06A 1O3UA 1QPUA 1LS1A 2Q9AA 3QVYA 2HJ3A 1ZHWA 3ABMC 1NSGB 4HE8D 5JUAA 4I3MA 2P0NA 2KQ9A 3OEOA 4DRJB 4FAPB 5KYWA 4G7OF 1YZAA 1Y4CA 2XM4A 4JEBA 4U9EA 3UNGC 1ZW3A 3DM5A 5F5FA 4OINF 2OJQA 3DJUB 4XLNF 1K05A 3AG4C 2IXNA 3GM3A 1EKYA 4KBLA 4I44A 2NPUA 1ORYA 2UUIA 3VRCA 3LEOA 3NG1A 5DLJA 3IQCA 2CYDA 3EG9A 3M15A 1BZ4A 4U5FE 4BJ5C 4P9FA 3N2ZB 1VB5A 2G3KA 3M4CA 2AU5A 5E3AA 4DXWA 2A0BA 2C03A 2VCCA 4FX5A 3JYHA 4MVMA 4PJJA 4JURI 3WG7C 2HS5A 3A11A 1RKCA 3L0IA 1TR2A 1RKEA 4MS2A 2IXPA 3ECSA 3EH1A 1MMNA 4QDLA 5DQTA 3SEOA 1Q0MA 4XTKA 3RVZA 1ST6A 4G7ZF 1WGWA 3GEIA 1G4WR 2PFDA 4CJGA 3IPMO 2XRHA 4EIYA 1WATA 4MTOA 1HE1A 1RCPA 4IJJA 3T4RA 4NY3A 4GQHA 2L81A 1YAUO 5KYXB 3RIPA 3FVYA 2A69F 2ETSA 3KYIA 2EPMX 2PP4A 5F5HA 4C3EA 3CZ6A 3U5SA 4E7ZA 3HNIA 1R5ID 4PJLA 2J9WA 4NTFA 3G50A 4YN0B 3RH3A 3S29A 2D5RB 4NTBA 3Q6NA 3C7JA 2P61A 3HNLA 2CCYA 4WGYA 2Q4FA 3LUTB 2I15A 2J0XA 3C8GB 3ZIBA 4Q5SF 1VLSA 4PK4A 2Y3BA 1WTYA 3QVZA 1RJ9A 4EKWA 1SMYF 2L6FA 2XXAA 3DZAA 1M2VA 2X51A 3K1IC 2PBEA 1APCA 1Z23A 3NKDA 2AP3A 3JSZA 1IZMA 3N0TA 4C7OB 2KW3C 1YZCA 3G4XA 5JSLA 1C02A 1LE4A 1D1AA 2DYRC 3DAFA 4U5BE 2R7QA 3EGDB 3F46A 3VAYA 1E84A 5T3WA 3ATPA 3JCUQ 1MMAA 1U89A 2YL0A 5KYYB 1MMGA 1FMVA 3AGTA 4LACB 3NKEA 2QLAA 2VH3A 1Z5ZA 1G8XA 3NRHA 3RW0A 2WVNA 1FAPB 3EG9B 4EHPA 4OIPF 2R9RB 2OG2A 3EZIA 3AG1C 3B71A 3QZCA 4JTAB 3RQGA 3SXYA 4L6RA 5CI8A 1Y6DA 3GORA 2DB4A 1D1BA 4CS7A 4CS8A 4JW1A 2FFHA 1AVOB 1VK5A 1GGQA 1J8YF 3NMKA 4J7YA 5TJ5E 1L3PA 2QNLA 3LAYA 4N6CA 5T1DB 2EPKX 2XL8A 2A6HF 3CEXA 3KKBA 4JE9A 2NG1A 1LM3B 3EHMA 3T6BA 5A6BA 2GFHA 2OU6A 1OW6A 2J8WA 1NLXA 1TKNA 3C8ZA 3GANA 3NYLA 3NYMA 2IXOA 4G0HA 4O6NA 1YJGA 3KMIA 3Q7LA 2OEXA 4WABA 3GEHA 2IXMA 2J7PD 3ZC4A 2QUPA 5E3CA 3H2UA 3ZDLA 3GM1A 1GQAA 4DBRA 1T6IA 3NYJA 2YL7A 3AG2C 4E0HA 2DGJA 3AQBA 2KSFA 4LERA 4N4WA 5L0IA 2FAPB 5JLIA 4NC3A 4AE4A 2QTVA 1ZU4A 2YHSA 4Q7CA 5E33A 4JJFA 1SYQA 4IB4A 2JD3A 2Q7RA 4IAQA 3T6JA 2AWCA 2KGOA 3HNJA 2R7WA 2CW0F 1BR1A 2B0JA 2CDQA 2YKZA 2NUTB 4J7TA 4JZAA 1M2OA 4Z9HA 3AG3C 4Z9IA 1HMDA 3H2VA 3UR3C 5KYXA 3C8GD 2M4EA 3JTLO 2J0WA 2A68F 4RBNA 2NSGA 1D0ZA 1I5NA 1XZPA 1HE9A 2UUHA 3ZWIA 3IQ5A 2ZPAA 1MNEA 1YYJA 3M1CB 1K40A 1NFNA 1SF8A 1A7DA 1LPEA 3MBGA 3GODA 3BRJA 1LVKA 4JIOA 3MX3A 4DJ9A 5B3SC 4E18A 2BE5F 4CSAA 1DOVA 5A6AA 4XEVA 2XLDA 3CAXA 4M63A 4PJNA 3C8GA 4YJWA 2XS8A 3CQZA 2YWAA 3TQOA 4LDQA 2ZXRA 3IQTA 3RQFA 1ZHXA 3G4ZA 1A41A 1EA8A 3FOOA 4UDVA 1S05A 1MNDA 1Q0KA 3PCVA 3C18A 4N06A 1XZQA 2GA0A 5L0FA 4C7OA 5EK0A 1VOMA 3TOLA 4WGZA 1B68A 1LI7A 2A6EF 3B0PA 3TOMA 1TWAA 1T9KA 1G5ZA 1I4ZA 1YDIA 2LFDA 2R7SA 1YYXA 3EGDA 4CS9A 3AGUA 4JC7A 4Z9JA 4YT4A 2R7RA 3PMRA 1NBBA 3LS0A 3NMIA 4GYTA 4K1OA 4NQFA 5DS4A 5KYYA 2WZLA 2DYSC 2OEVA 4AL1A 3UGPA 1OR2A 4MW3A 3U3BA 3W2WA 4EBBA 4PACA 2JPUA 1JAFA 4NTAA 2J9VA 3M4BA 3FAPB 2HMZA 4IRUA 5AGFA 1OCZC 3M79A 4GEHA 3QW0A 3O55A 1FFHA 2EIKC 5COFA 3S84A 2R7UA 3NMJA 3EPVA 4YT5A 3AOUA 4MQ9F 2YQYA 3TJ6A 1R4TA 4CS8C 3GWNA 2XL4A 2DI3A 1IW7F 4OIQF 1V54C 4RDAA 3TJ5A 1WASA 5A6KA 4AE4B 1A7EA 5BUOA 3X1OA 3U0CA 2L7AA 4DVZA 3L8JA 3I5PA 2VASA 1A0BA 1T01A 4CDYA 5BQIA 2Z15A 1WN0A 1Q0DA 2LD6A 1QLEC 1T5OA 1RXQA 2V26A 1OQCA 4HFFB 2W4MA 1HW2A 3SNHA 3US6A 1A7VA 3L1MA 3K6BA 3S28A 2P7VA 3W2VA 2R7TA 1Z6AA 3O10A 2M64A 4EWCA 1N1CA 4BPMA 4OIOF 4XEKA 2NUPA 4YL3A 4LLEA 2NUTA 2LFFA 2Y3GA 3ZVRA 1NU7D 2ZXPA 1Z63A 4HFKB 1V74B 3VYWA 4C3DA 4P6IC 2ICWG 3IEEA 3E70C 4U5EE 3UMIA 4MW8A 1SZIA 5IY5C 1VTMP 4LLCA 3SXKA 5E2QA 5L0JA 4YT2A 1YA9A 1UG7A 4I1OB 2CNWD 3I5QA 2WL8A 1CGOA 2GAQA 4JTDB 1JOGA 1DOWA 2XL6A 3DAGA 1HMOA 1VLTA 3ITFA 4ER9A 3KL4A 2R05A 5EGYA 4MNDA 2YRFA 4CIPA 2FGYA 5FCLA 1ZHZA 4CSAC 3HLZA 1OCOC 2XS1A 3ZTMA 1O87A 2KK1A 4MTFA 2PX3A 2CNWA 1ZYRF 4P9TA 1KTMA 2Y3DA 4HEAJ 4MTGA 2OQMA 2XLVA 3B9QA 4CJOA 1OKKA 3DE8A 5A6BD 1I4YA 2HV7A 2Q9BA 2W9YA 2H8AA 4DRHB 1QQ3A 2OJED 2OOCA 2RD9A 3DI5A 1FTSA 4H54A 4LDRA 4CX9A 4U5CE 3DMDA 3JSEO 5GPGB 4BG0A 1V55C 3EGXA 3OWTA 3E9VA 2X0CA 3ZQYA 3T9OA 3TD7A 3EZHA 1V4AA 4E0IA 4BJ6A 1O5HA 3FHDA 2W4BA 3GWLA 4NCQA 2VCAA 5JT4A 5FZTA 3A9CA 3VM6A 1BDJB 3U3FA 4JTCB 1BR4A 1JPJA 2ZD9A 1JR8A 4A2NB 1H6GA 3RFYA 1ZHTA 1TQGA 5B3IA 1LIHA 1TWHA 3ABLC 4R32A 4QI2A 2XLHA 4JCZA 4AL0A 4YL0A 1QKRA 3POVA 3JT1A 3S0XA 2LK4A 1ORJA 1ZU5A 1FMWA 4ZLCA 2V3CC 1GS9A 1ZW2A 3B0UX 1ORSC 1JMWA 1U6HA 1VYKA 4KNVA 256BA 2GWWA 2NUPB 2YLGA 4O6YA 1Z7Qc 5KYUB 5HSWA 1OCRC 4CIHA 2AWYA 1QZXA 2ZXOA 2KYHA 1YA7O 2L6HA 3L8IA 4C3BA 2XLMA 4RD9A 2LCHA 3MLGA 5COGA 2P6VA 5L0DA 1OR3A 2LIGA 3SP1A 2CGEA 2L6GA 3SXMA 5CI9A 3EHNA 4E17A 2LQGA 1TFOB 3N24A 1CGME 3EQLF 1FNTc 4JKVA 1SR2A 3O6XA 2Q9CA 2VCBA 2YZSA 2HKVA 4JEAA 1NU9C 5JVEA 4G78A 3V5YA 3S27A 1K04A 3VF0A 4DBQA 3DD7A 2XLOA 3LJBA 4QI0A 2Q00A 3WHNA 5D91A 1M56C 1H7IA 2YL1A 4AK9A 5BQGA 1OW8A 2HMQA 3K33A 2WVOA 3KPHA 5CIVA 1M6TA 1C17M 1YLMA 4KC9A 1LE2A 4MVRA 3HTKC 4XEFA 3GM2A 4DRIB 4PJMA 4XPXA 1QSPA 3O39A 4B6IA 2LSEA 5B1BC 2H7OA 2R25A 3FAJA 4I1MA 4MVUA 3JYYA 3WAQA 1VYIA 1YVIA 2O9XA 1E83A 3EGXB 3HJCA 1F1MA 4PFOA 3LESA 2AVKA 5B1AC 2EPLX 2B0HA 1KNYA 1BBHA 4MVQA 1WWPA 2PX0A 4EBKA 2BC5A 3ASNC 1E86A 3OA1A 3B0VC 2OKUA 4CDVA 1U0BB 4YT8A 4U5HA 3QW1A 3ZQVA 4O79A 3UMHA 1D0YA 4YWQA 4BJTA 3FDQA 4FESA 4IAOA 1TWGA 2KC3A 3SZRA 2EIJC 2MYSA 2YLIA 3U9MA 2ZXWC 3PDMP 1FR0A 3W8HA 2HSQA 4BJ6C 3LLIA 1TWCA 4K7BA 3CSKA 3F47A 3R2PA 4MVSA 5AC5A 1YARO 4DVYP 1FFTC 2GDCA 2F22A 3U2MA 1LI5A 3U9JA 4WJ0A 1MQVA 2QY9A 3W8IA 5JRAA 4ZLDA 3LNRA 2HJMA 3RQEA 2C04A 2J9BA 5A69A 4N6HA 4W8PA 4D4XA 3NDBB 2QE9A 1CPRA 1E2XA 3U2LA 2XLEA 1EQ1A 1G4US
chains in the Genus database with same CATH topology
2YL7A 2XLVA 1QPUA 4CJOA 3DE8A 4N4WA 3QVYA 5JLIA 4NC3A 3U8PA 5JUAA 4IB4A 4IAQA 1QQ3A 3HNJA 1YZAA 2YKZA 2XM4A 4JEBA 4CX9A 4U9EA 2XM0A 3DE9A 3ZQYA 1EKYA 5JT4A 3ZWIA 3IQ5A 3VRCA 1YYJA 3M15A 5B3IA 3M4CA 2XLDA 2XLHA 3FOOA 3ZTZA 3C62A 1S05A 256BA 2YLGA 3TOLA 4WGZA 2YL3A 3TOMA 4CJGA 4EIYA 1RCPA 1YYXA 2XLMA 1NBBA 3NMIA 3HNIA 1CGNA 1JAFA 4JKVA 3M4BA 5AGFA 4JEAA 3M79A 3QW0A 5JVEA 3NMJA 3HNLA 2CCYA 4WGYA 2XLOA 2YL1A 1M6TA 4U9DA 3QVZA 1APCA 5JS5A 1YZCA 4CDYA 5JSLA 3IQ6A 1E83A 1A7VA 4IARA 3L1MA 1E84A 1BBHA 3HNKA 2YL0A 2BC5A 2QLAA 1E86A 4D4NA 4CDVA 3QW1A 3ZQVA 4L6RA 5JP7A 2YLIA 1CPQA 3NMKA 1CGOA 2XL6A 4JE9A 2XL8A 4ER9A 1LM3B 4CDAA 2J8WA 4ULVA 2XLWA 4CIPA 1MQVA 5JRAA 3FOPA 2YLDA 2J9BA 4N6HA 3ZTMA 3C63A 1E85A 4D4XA 1GQAA 1CPRA 2XLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL7 A;  2XLV A;  1QPU A;  4CJO A;  3DE8 A;  4N4W A;  3QVY A;  5JLI A;  4NC3 A;  3U8P A;  5JUA A;  4IB4 A;  4IAQ A;  1QQ3 A;  3HNJ A;  1YZA A;  2YKZ A;  2XM4 A;  4JEB A;  4CX9 A;  4U9E A;  2XM0 A;  3DE9 A;  3ZQY A;  1EKY A;  5JT4 A;  3ZWI A;  3IQ5 A;  3VRC A;  1YYJ A;  3M15 A;  5B3I A;  3M4C A;  2XLD A;  2XLH A;  3FOO A;  3ZTZ A;  3C62 A;  1S05 A;  256B A;  2YLG A;  3TOL A;  4WGZ A;  2YL3 A;  3TOM A;  4CJG A;  4EIY A;  1RCP A;  1YYX A;  2XLM A;  1NBB A;  3NMI A;  3HNI A;  1CGN A;  1JAF A;  4JKV A;  3M4B A;  5AGF A;  4JEA A;  3M79 A;  3QW0 A;  5JVE A;  3NMJ A;  3HNL A;  2CCY A;  4WGY A;  2XLO A;  2YL1 A;  1M6T A;  4U9D A;  3QVZ A;  1APC A;  5JS5 A;  1YZC A;  4CDY A;  5JSL A;  3IQ6 A;  1E83 A;  1A7V A;  4IAR A;  3L1M A;  1E84 A;  1BBH A;  3HNK A;  2YL0 A;  2BC5 A;  2QLA A;  1E86 A;  4D4N A;  4CDV A;  3QW1 A;  3ZQV A;  4L6R A;  5JP7 A;  2YLI A;  1CPQ A;  3NMK A;  1CGO A;  2XL6 A;  4JE9 A;  2XL8 A;  4ER9 A;  1LM3 B;  4CDA A;  2J8W A;  4ULV A;  2XLW A;  4CIP A;  1MQV A;  5JRA A;  3FOP A;  2YLD A;  2J9B A;  4N6H A;  3ZTM A;  3C63 A;  1E85 A;  4D4X A;  1GQA A;  1CPR A;  2XLE A; 
#chains in the Genus database with same CATH topology
 4BEJ A;  4AX2 A;  4PR9 A;  2TMV P;  4J30 B;  5KYU A;  1BR2 A;  4XLP F;  3IHU A;  3U8P A;  2J9U A;  3EJN A;  3K7D A;  3KH2 A;  2R7X A;  2G3V A;  4JCH A;  4K0D A;  2A1D D;  1OCC C;  3I4U A;  1Q0G A;  2Y69 C;  2XM0 A;  3DE9 A;  3RKO F;  2LP4 A;  3UMK A;  3AQC A;  2W45 A;  1ZHY A;  3FMS A;  2EIN C;  3LLK A;  3TUL A;  4J32 B;  2HFI A;  1L7C A;  2ASR A;  4U5G A;  3ZSU A;  1OKK D;  1GM5 A;  1HW1 A;  5D92 A;  2EIM C;  2EPN A;  1C03 A;  5AC4 A;  3RVY A;  5DQZ A;  2EIL C;  4O6M A;  3RF3 A;  5T3T A;  2G62 A;  1PV3 A;  4G7H F;  4JVS A;  1NFO A;  5KYN A;  4MVZ A;  3MFN A;  3FXH A;  4A4A A;  3EFO B;  3ABK C;  4JRZ A;  4U5D E;  3W4Y A;  5L3Q A;  2WZG A;  2D4U A;  3K1H A;  3ZTZ A;  1D1C A;  3C62 A;  3Q7G A;  2A0U A;  3L34 A;  3LEV A;  4IWB A;  5EHH A;  3UGO A;  1MMD A;  1JRA A;  2Q3T A;  1T6U A;  3DM9 B;  2VC9 A;  2R03 A;  2R02 A;  3ZG1 A;  2YL3 A;  1ZZP A;  2XSE A;  1Z3I X;  4OD5 A;  5KYW B;  5COM A;  4CS9 C;  3V5X A;  3V5Z A;  4O7G A;  3SYN A;  5BQH A;  3TK0 A;  3QMK A;  1NG1 A;  5DVW A;  2BL2 A;  2H7V C;  4KI2 A;  3JRM O;  1CGN A;  4LDK A;  1TFK B;  5L0G A;  2IOQ A;  2Y3H A;  1LS4 A;  2NSF A;  2WZF A;  5L0H A;  1HY5 A;  3JZ0 A;  4BJ5 A;  5K0I A;  1W2W A;  3GEE A;  4PFP A;  5A6J A;  2R7V A;  3LNM B;  4YK5 A;  3K66 A;  3Q6M A;  1VMA A;  3BEH A;  2IBF A;  2HZ8 A;  4KNW A;  3R7C A;  1T6Q A;  4OIR F;  3DWW A;  4U9D A;  4YL1 A;  2E87 A;  3MYF A;  2MHR A;  2YEV A;  1H9T A;  1NZE A;  1PD0 A;  1RKE B;  4JJG A;  1KU2 A;  5DS6 A;  3H65 A;  1H9G A;  4ANJ A;  5F28 E;  5JS5 A;  3DKA A;  2IM8 A;  1J8M F;  1OXB A;  2PF4 E;  5L3V A;  3U8V A;  2IYL D;  4F4B A;  2Y39 A;  3HKK A;  3AJM A;  3EH2 A;  3IQ6 A;  3JRT A;  4X0R A;  1S7Z A;  1LKX A;  2KJG A;  3QTH A;  4IAR A;  3RYL A;  1Q0F A;  4CBE A;  2L9J A;  4E7S A;  1AUE A;  2KNH A;  4H4K C;  4DOZ A;  2RSE B;  1XWJ A;  3LS1 A;  1D0X A;  2HUJ A;  1AEP A;  3HNK A;  3S9O A;  3S90 A;  2P1A A;  1OXK A;  4D4N A;  1UFB A;  3X2Q C;  5L0C A;  4ONS A;  4BJ1 A;  2HV6 A;  1ZVZ A;  1WOL A;  2I8B A;  5JP7 A;  5HV9 A;  2J7P A;  4Q4Z F;  1PD1 A;  3DJN B;  2R7O A;  4BEM J;  4ULW A;  1CPQ A;  1JPN A;  2VB6 A;  2WVQ A;  4IGG A;  3B29 A;  4MVO A;  2JX0 A;  3PHF 2;  5DS5 A;  4FWV A;  2WB7 A;  3SXZ A;  1OW7 A;  3T6G B;  3V7O A;  4CDA A;  3K1I A;  1RJ9 B;  2EPO A;  4OD4 A;  2J46 A;  2PNO A;  4ULV A;  4W8K A;  4XWJ A;  4EBJ A;  2XLW A;  2XXA B;  2J45 A;  1M2V B;  2OCC C;  1RMV A;  3FOP A;  2MWQ A;  1M57 C;  2H7B A;  2YLD A;  3MYI A;  3EFO A;  1EI7 A;  4EUK B;  3C63 A;  1E85 A;  3DXJ F;  1QVX A;  2HSB A;  1PCX A;  3KYJ A;  3ASO C;  2YVK A;  4XPY A;  4XQ1 A;  4XPW A;  3WOD F;  3J06 A;  1O3U A;  1QPU A;  1LS1 A;  2Q9A A;  3QVY A;  2HJ3 A;  1ZHW A;  3ABM C;  1NSG B;  4HE8 D;  5JUA A;  4I3M A;  2P0N A;  2KQ9 A;  3OEO A;  4DRJ B;  4FAP B;  5KYW A;  4G7O F;  1YZA A;  1Y4C A;  2XM4 A;  4JEB A;  4U9E A;  3UNG C;  1ZW3 A;  3DM5 A;  5F5F A;  4OIN F;  2OJQ A;  3DJU B;  4XLN F;  1K05 A;  3AG4 C;  2IXN A;  3GM3 A;  1EKY A;  4KBL A;  4I44 A;  2NPU A;  1ORY A;  2UUI A;  3VRC A;  3LEO A;  3NG1 A;  5DLJ A;  3IQC A;  2CYD A;  3EG9 A;  3M15 A;  1BZ4 A;  4U5F E;  4BJ5 C;  4P9F A;  3N2Z B;  1VB5 A;  2G3K A;  3M4C A;  2AU5 A;  5E3A A;  4DXW A;  2A0B A;  2C03 A;  2VCC A;  4FX5 A;  3JYH A;  4MVM A;  4PJJ A;  4JUR I;  3WG7 C;  2HS5 A;  3A11 A;  1RKC A;  3L0I A;  1TR2 A;  1RKE A;  4MS2 A;  2IXP A;  3ECS A;  3EH1 A;  1MMN A;  4QDL A;  5DQT A;  3SEO A;  1Q0M A;  4XTK A;  3RVZ A;  1ST6 A;  4G7Z F;  1WGW A;  3GEI A;  1G4W R;  2PFD A;  4CJG A;  3IPM O;  2XRH A;  4EIY A;  1WAT A;  4MTO A;  1HE1 A;  1RCP A;  4IJJ A;  3T4R A;  4NY3 A;  4GQH A;  2L81 A;  1YAU O;  5KYX B;  3RIP A;  3FVY A;  2A69 F;  2ETS A;  3KYI A;  2EPM X;  2PP4 A;  5F5H A;  4C3E A;  3CZ6 A;  3U5S A;  4E7Z A;  3HNI A;  1R5I D;  4PJL A;  2J9W A;  4NTF A;  3G50 A;  4YN0 B;  3RH3 A;  3S29 A;  2D5R B;  4NTB A;  3Q6N A;  3C7J A;  2P61 A;  3HNL A;  2CCY A;  4WGY A;  2Q4F A;  3LUT B;  2I15 A;  2J0X A;  3C8G B;  3ZIB A;  4Q5S F;  1VLS A;  4PK4 A;  2Y3B A;  1WTY A;  3QVZ A;  1RJ9 A;  4EKW A;  1SMY F;  2L6F A;  2XXA A;  3DZA A;  1M2V A;  2X51 A;  3K1I C;  2PBE A;  1APC A;  1Z23 A;  3NKD A;  2AP3 A;  3JSZ A;  1IZM A;  3N0T A;  4C7O B;  2KW3 C;  1YZC A;  3G4X A;  5JSL A;  1C02 A;  1LE4 A;  1D1A A;  2DYR C;  3DAF A;  4U5B E;  2R7Q A;  3EGD B;  3F46 A;  3VAY A;  1E84 A;  5T3W A;  3ATP A;  3JCU Q;  1MMA A;  1U89 A;  2YL0 A;  5KYY B;  1MMG A;  1FMV A;  3AGT A;  4LAC B;  3NKE A;  2QLA A;  2VH3 A;  1Z5Z A;  1G8X A;  3NRH A;  3RW0 A;  2WVN A;  1FAP B;  3EG9 B;  4EHP A;  4OIP F;  2R9R B;  2OG2 A;  3EZI A;  3AG1 C;  3B71 A;  3QZC A;  4JTA B;  3RQG A;  3SXY A;  4L6R A;  5CI8 A;  1Y6D A;  3GOR A;  2DB4 A;  1D1B A;  4CS7 A;  4CS8 A;  4JW1 A;  2FFH A;  1AVO B;  1VK5 A;  1GGQ A;  1J8Y F;  3NMK A;  4J7Y A;  5TJ5 E;  1L3P A;  2QNL A;  3LAY A;  4N6C A;  5T1D B;  2EPK X;  2XL8 A;  2A6H F;  3CEX A;  3KKB A;  4JE9 A;  2NG1 A;  1LM3 B;  3EHM A;  3T6B A;  5A6B A;  2GFH A;  2OU6 A;  1OW6 A;  2J8W A;  1NLX A;  1TKN A;  3C8Z A;  3GAN A;  3NYL A;  3NYM A;  2IXO A;  4G0H A;  4O6N A;  1YJG A;  3KMI A;  3Q7L A;  2OEX A;  4WAB A;  3GEH A;  2IXM A;  2J7P D;  3ZC4 A;  2QUP A;  5E3C A;  3H2U A;  3ZDL A;  3GM1 A;  1GQA A;  4DBR A;  1T6I A;  3NYJ A;  2YL7 A;  3AG2 C;  4E0H A;  2DGJ A;  3AQB A;  2KSF A;  4LER A;  4N4W A;  5L0I A;  2FAP B;  5JLI A;  4NC3 A;  4AE4 A;  2QTV A;  1ZU4 A;  2YHS A;  4Q7C A;  5E33 A;  4JJF A;  1SYQ A;  4IB4 A;  2JD3 A;  2Q7R A;  4IAQ A;  3T6J A;  2AWC A;  2KGO A;  3HNJ A;  2R7W A;  2CW0 F;  1BR1 A;  2B0J A;  2CDQ A;  2YKZ A;  2NUT B;  4J7T A;  4JZA A;  1M2O A;  4Z9H A;  3AG3 C;  4Z9I A;  1HMD A;  3H2V A;  3UR3 C;  5KYX A;  3C8G D;  2M4E A;  3JTL O;  2J0W A;  2A68 F;  4RBN A;  2NSG A;  1D0Z A;  1I5N A;  1XZP A;  1HE9 A;  2UUH A;  3ZWI A;  3IQ5 A;  2ZPA A;  1MNE A;  1YYJ A;  3M1C B;  1K40 A;  1NFN A;  1SF8 A;  1A7D A;  1LPE A;  3MBG A;  3GOD A;  3BRJ A;  1LVK A;  4JIO A;  3MX3 A;  4DJ9 A;  5B3S C;  4E18 A;  2BE5 F;  4CSA A;  1DOV A;  5A6A A;  4XEV A;  2XLD A;  3CAX A;  4M63 A;  4PJN A;  3C8G A;  4YJW A;  2XS8 A;  3CQZ A;  2YWA A;  3TQO A;  4LDQ A;  2ZXR A;  3IQT A;  3RQF A;  1ZHX A;  3G4Z A;  1A41 A;  1EA8 A;  3FOO A;  4UDV A;  1S05 A;  1MND A;  1Q0K A;  3PCV A;  3C18 A;  4N06 A;  1XZQ A;  2GA0 A;  5L0F A;  4C7O A;  5EK0 A;  1VOM A;  3TOL A;  4WGZ A;  1B68 A;  1LI7 A;  2A6E F;  3B0P A;  3TOM A;  1TWA A;  1T9K A;  1G5Z A;  1I4Z A;  1YDI A;  2LFD A;  2R7S A;  1YYX A;  3EGD A;  4CS9 A;  3AGU A;  4JC7 A;  4Z9J A;  4YT4 A;  2R7R A;  3PMR A;  1NBB A;  3LS0 A;  3NMI A;  4GYT A;  4K1O A;  4NQF A;  5DS4 A;  5KYY A;  2WZL A;  2DYS C;  2OEV A;  4AL1 A;  3UGP A;  1OR2 A;  4MW3 A;  3U3B A;  3W2W A;  4EBB A;  4PAC A;  2JPU A;  1JAF A;  4NTA A;  2J9V A;  3M4B A;  3FAP B;  2HMZ A;  4IRU A;  5AGF A;  1OCZ C;  3M79 A;  4GEH A;  3QW0 A;  3O55 A;  1FFH A;  2EIK C;  5COF A;  3S84 A;  2R7U A;  3NMJ A;  3EPV A;  4YT5 A;  3AOU A;  4MQ9 F;  2YQY A;  3TJ6 A;  1R4T A;  4CS8 C;  3GWN A;  2XL4 A;  2DI3 A;  1IW7 F;  4OIQ F;  1V54 C;  4RDA A;  3TJ5 A;  1WAS A;  5A6K A;  4AE4 B;  1A7E A;  5BUO A;  3X1O A;  3U0C A;  2L7A A;  4DVZ A;  3L8J A;  3I5P A;  2VAS A;  1A0B A;  1T01 A;  4CDY A;  5BQI A;  2Z15 A;  1WN0 A;  1Q0D A;  2LD6 A;  1QLE C;  1T5O A;  1RXQ A;  2V26 A;  1OQC A;  4HFF B;  2W4M A;  1HW2 A;  3SNH A;  3US6 A;  1A7V A;  3L1M A;  3K6B A;  3S28 A;  2P7V A;  3W2V A;  2R7T A;  1Z6A A;  3O10 A;  2M64 A;  4EWC A;  1N1C A;  4BPM A;  4OIO F;  4XEK A;  2NUP A;  4YL3 A;  4LLE A;  2NUT A;  2LFF A;  2Y3G A;  3ZVR A;  1NU7 D;  2ZXP A;  1Z63 A;  4HFK B;  1V74 B;  3VYW A;  4C3D A;  4P6I C;  2ICW G;  3IEE A;  3E70 C;  4U5E E;  3UMI A;  4MW8 A;  1SZI A;  5IY5 C;  1VTM P;  4LLC A;  3SXK A;  5E2Q A;  5L0J A;  4YT2 A;  1YA9 A;  1UG7 A;  4I1O B;  2CNW D;  3I5Q A;  2WL8 A;  1CGO A;  2GAQ A;  4JTD B;  1JOG A;  1DOW A;  2XL6 A;  3DAG A;  1HMO A;  1VLT A;  3ITF A;  4ER9 A;  3KL4 A;  2R05 A;  5EGY A;  4MND A;  2YRF A;  4CIP A;  2FGY A;  5FCL A;  1ZHZ A;  4CSA C;  3HLZ A;  1OCO C;  2XS1 A;  3ZTM A;  1O87 A;  2KK1 A;  4MTF A;  2PX3 A;  2CNW A;  1ZYR F;  4P9T A;  1KTM A;  2Y3D A;  4HEA J;  4MTG A;  2OQM A;  2XLV A;  3B9Q A;  4CJO A;  1OKK A;  3DE8 A;  5A6B D;  1I4Y A;  2HV7 A;  2Q9B A;  2W9Y A;  2H8A A;  4DRH B;  1QQ3 A;  2OJE D;  2OOC A;  2RD9 A;  3DI5 A;  1FTS A;  4H54 A;  4LDR A;  4CX9 A;  4U5C E;  3DMD A;  3JSE O;  5GPG B;  4BG0 A;  1V55 C;  3EGX A;  3OWT A;  3E9V A;  2X0C A;  3ZQY A;  3T9O A;  3TD7 A;  3EZH A;  1V4A A;  4E0I A;  4BJ6 A;  1O5H A;  3FHD A;  2W4B A;  3GWL A;  4NCQ A;  2VCA A;  5JT4 A;  5FZT A;  3A9C A;  3VM6 A;  1BDJ B;  3U3F A;  4JTC B;  1BR4 A;  1JPJ A;  2ZD9 A;  1JR8 A;  4A2N B;  1H6G A;  3RFY A;  1ZHT A;  1TQG A;  5B3I A;  1LIH A;  1TWH A;  3ABL C;  4R32 A;  4QI2 A;  2XLH A;  4JCZ A;  4AL0 A;  4YL0 A;  1QKR A;  3POV A;  3JT1 A;  3S0X A;  2LK4 A;  1ORJ A;  1ZU5 A;  1FMW A;  4ZLC A;  2V3C C;  1GS9 A;  1ZW2 A;  3B0U X;  1ORS C;  1JMW A;  1U6H A;  1VYK A;  4KNV A;  256B A;  2GWW A;  2NUP B;  2YLG A;  4O6Y A;  1Z7Q c;  5KYU B;  5HSW A;  1OCR C;  4CIH A;  2AWY A;  1QZX A;  2ZXO A;  2KYH A;  1YA7 O;  2L6H A;  3L8I A;  4C3B A;  2XLM A;  4RD9 A;  2LCH A;  3MLG A;  5COG A;  2P6V A;  5L0D A;  1OR3 A;  2LIG A;  3SP1 A;  2CGE A;  2L6G A;  3SXM A;  5CI9 A;  3EHN A;  4E17 A;  2LQG A;  1TFO B;  3N24 A;  1CGM E;  3EQL F;  1FNT c;  4JKV A;  1SR2 A;  3O6X A;  2Q9C A;  2VCB A;  2YZS A;  2HKV A;  4JEA A;  1NU9 C;  5JVE A;  4G78 A;  3V5Y A;  3S27 A;  1K04 A;  3VF0 A;  4DBQ A;  3DD7 A;  2XLO A;  3LJB A;  4QI0 A;  2Q00 A;  3WHN A;  5D91 A;  1M56 C;  1H7I A;  2YL1 A;  4AK9 A;  5BQG A;  1OW8 A;  2HMQ A;  3K33 A;  2WVO A;  3KPH A;  5CIV A;  1M6T A;  1C17 M;  1YLM A;  4KC9 A;  1LE2 A;  4MVR A;  3HTK C;  4XEF A;  3GM2 A;  4DRI B;  4PJM A;  4XPX A;  1QSP A;  3O39 A;  4B6I A;  2LSE A;  5B1B C;  2H7O A;  2R25 A;  3FAJ A;  4I1M A;  4MVU A;  3JYY A;  3WAQ A;  1VYI A;  1YVI A;  2O9X A;  1E83 A;  3EGX B;  3HJC A;  1F1M A;  4PFO A;  3LES A;  2AVK A;  5B1A C;  2EPL X;  2B0H A;  1KNY A;  1BBH A;  4MVQ A;  1WWP A;  2PX0 A;  4EBK A;  2BC5 A;  3ASN C;  1E86 A;  3OA1 A;  3B0V C;  2OKU A;  4CDV A;  1U0B B;  4YT8 A;  4U5H A;  3QW1 A;  3ZQV A;  4O79 A;  3UMH A;  1D0Y A;  4YWQ A;  4BJT A;  3FDQ A;  4FES A;  4IAO A;  1TWG A;  2KC3 A;  3SZR A;  2EIJ C;  2MYS A;  2YLI A;  3U9M A;  2ZXW C;  3PDM P;  1FR0 A;  3W8H A;  2HSQ A;  4BJ6 C;  3LLI A;  1TWC A;  4K7B A;  3CSK A;  3F47 A;  3R2P A;  4MVS A;  5AC5 A;  1YAR O;  4DVY P;  1FFT C;  2GDC A;  2F22 A;  3U2M A;  1LI5 A;  3U9J A;  4WJ0 A;  1MQV A;  2QY9 A;  3W8I A;  5JRA A;  4ZLD A;  3LNR A;  2HJM A;  3RQE A;  2C04 A;  2J9B A;  5A69 A;  4N6H A;  4W8P A;  4D4X A;  3NDB B;  2QE9 A;  1CPR A;  1E2X A;  3U2L A;  2XLE A;  1EQ1 A;  1G4U S; 
#chains in the Genus database with same CATH homology
 2YL7 A;  2XLV A;  1QPU A;  4CJO A;  3DE8 A;  4N4W A;  3QVY A;  5JLI A;  4NC3 A;  3U8P A;  5JUA A;  4IB4 A;  4IAQ A;  1QQ3 A;  3HNJ A;  1YZA A;  2YKZ A;  2XM4 A;  4JEB A;  4CX9 A;  4U9E A;  2XM0 A;  3DE9 A;  3ZQY A;  1EKY A;  5JT4 A;  3ZWI A;  3IQ5 A;  3VRC A;  1YYJ A;  3M15 A;  5B3I A;  3M4C A;  2XLD A;  2XLH A;  3FOO A;  3ZTZ A;  3C62 A;  1S05 A;  256B A;  2YLG A;  3TOL A;  4WGZ A;  2YL3 A;  3TOM A;  4CJG A;  4EIY A;  1RCP A;  1YYX A;  2XLM A;  1NBB A;  3NMI A;  3HNI A;  1CGN A;  1JAF A;  4JKV A;  3M4B A;  5AGF A;  4JEA A;  3M79 A;  3QW0 A;  5JVE A;  3NMJ A;  3HNL A;  2CCY A;  4WGY A;  2XLO A;  2YL1 A;  1M6T A;  4U9D A;  3QVZ A;  1APC A;  5JS5 A;  1YZC A;  4CDY A;  5JSL A;  3IQ6 A;  1E83 A;  1A7V A;  4IAR A;  3L1M A;  1E84 A;  1BBH A;  3HNK A;  2YL0 A;  2BC5 A;  2QLA A;  1E86 A;  4D4N A;  4CDV A;  3QW1 A;  3ZQV A;  4L6R A;  5JP7 A;  2YLI A;  1CPQ A;  3NMK A;  1CGO A;  2XL6 A;  4JE9 A;  2XL8 A;  4ER9 A;  1LM3 B;  4CDA A;  2J8W A;  4ULV A;  2XLW A;  4CIP A;  1MQV A;  5JRA A;  3FOP A;  2YLD A;  2J9B A;  4N6H A;  3ZTM A;  3C63 A;  1E85 A;  4D4X A;  1GQA A;  1CPR A;  2XLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...