3ZWIA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound at 1.25 a:unrestraint refinement
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas-Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3zwiA00
1CPRA 3TOLA 1E83A 4ER9A 4JEBA 4CDAA 3L1MA 4D4NA 1APCA 2J9BA 2XL8A 3C63A 3M79A 1CPQA 3QVZA 3TOMA 3ZQYA 2XLVA 5JS5A 5JVEA 3HNJA 5AGFA 4ULVA 2QLAA 2YL3A 4L6RA 3ZTMA 3NMJA 2XLDA 2XLMA 2XM4A 3DE9A 1JAFA 1E86A 1YZAA 4WGYA 1MQVA 4IARA 2XLHA 3HNKA 4EIYA 2XLEA 2YLIA 2CCYA 3IQ6A 1LM3B 2YL7A 4CJGA 3U8PA 1E85A 2YLGA 5JLIA 5JT4A 4NC3A 3DE8A 5B3IA 1GQAA 4JEAA 3M15A 2J8WA 4CDVA 3HNIA 4CDYA 4IAQA 3IQ5A 5JUAA 4N6HA 256BA 2YL1A 1RCPA 2YL0A 1YYJA 1NBBA 1QPUA 4IB4A 4CX9A 4U9EA 4U9DA 4CIPA 3FOPA 5JP7A 2XM0A 1A7VA 1CGNA 3HNLA 1S05A 1M6TA 2XLWA 4N4WA 3M4CA 2YKZA 3M4BA 3NMKA 1BBHA 1EKYA 3VRCA 4D4XA 1E84A 3QVYA 2BC5A 1YYXA 4JE9A 2YLDA 3QW0A 4CJOA 1YZCA 2XLOA 5JSLA 1QQ3A 3FOOA 2XL6A 3QW1A 4WGZA 3ZTZA 3ZQVA 3NMIA 3ZWIA 1CGOA 4JKVA 5JRAA 3C62A
chains in the Genus database with same CATH superfamily
1OCZC 1CPRA 1V55C 1YA9A 2XS1A 2QE9A 3AGTA 4MVQA 5B3SC 1H9TA 3FHDA 1HE9A 3UMIA 2G62A 1SF8A 4ER9A 1HE1A 3VAYA 4MNDA 3KMIA 2Y69C 4JURI 3TQOA 1MNEA 3DKAA 5GPGB 5B1BC 4CSAC 4N6CA 2OJQA 2J9BA 3SYNA 3C7JA 1JOGA 1H6GA 3SNHA 4G7HF 3EH2A 3QVZA 3SXYA 1I4ZA 3ZDLA 4PFPA 2XLVA 5D92A 4DJ9A 3ZVRA 4A4AA 4G78A 5JS5A 3T9OA 5JVEA 1UFBA 1M57C 3N0TA 4J32B 1T9KA 4QDLA 5COMA 4U5GA 3G4ZA 4ULVA 1O3UA 1LI7A 4G7OF 3ZTMA 5KYNA 1M56C 3NMJA 4MTGA 1TFOB 4CS8C 2XM4A 3I5PA 4DXWA 1OKKA 1PD1A 2QY9A 1YZAA 2VB6A 3DJNB 5E3AA 5AC5A 4BEJA 2IOQA 3LEOA 4NCQA 5KYUA 3GEEA 5KYUB 2CNWA 4UDVA 3LNMB 2P6VA 2R25A 2NSGA 4AE4A 1JR8A 2C04A 1EQ1A 4AE4B 4JJFA 3E9VA 2CCYA 3NKEA 3TJ5A 3AG1C 4NY3A 4CS9C 1RMVA 3ABLC 3L0IA 2LD6A 3EHMA 1J8MF 1E85A 2YQYA 1H9GA 4O6YA 2GFHA 3K1IC 3CSKA 5JT4A 2GAQA 3WHNA 4HEAJ 4OIRF 4XPYA 4HFFB 1TWAA 2V3CC 2OQMA 3RQFA 2BL2A 2B0JA 1YA7O 2EIMC 2EIKC 3S84A 3M15A 2KYHA 3RQGA 1KTMA 4DVZA 2XRHA 3JSEO 2TMVP 3ABKC 2XXAA 2F22A 3DMDA 1I5NA 4PFOA 1A41A 4N6HA 3H2UA 2LFFA 1HMOA 4XEVA 2NUPA 4KNVA 1HY5A 1FFHA 5E2QA 2NUPB 4BJ6C 2EPKX 3U3FA 4OD5A 1OCOC 2V26A 2A6EF 4U9EA 5K0IA 1VYKA 4MVMA 4H54A 3AJMA 1Q0FA 3TD7A 3A9CA 4XPXA 3IQTA 3HTKC 3GM1A 2YHSA 3AQCA 4JC7A 4MTFA 2JD3A 3SXZA 2IM8A 2XM0A 4XQ1A 4B6IA 1VTMP 3ASOC 3B0PA 2L81A 2VCAA 2XLWA 4N06A 3UMHA 2H7OA 5L0CA 1ORSC 1WWPA 2HJMA 4FAPB 2LCHA 4EBBA 4EBJA 3NMKA 2J46A 2MHRA 3NYLA 2KW3C 1HW1A 1EKYA 4P9TA 2HS5A 3VRCA 3EZHA 3NYJA 4D4XA 2R7TA 1GM5A 3QVYA 1YAUO 3GM2A 1NFOA 3VF0A 3IHUA 2Y3GA 5A6BD 3K6BA 3RFYA 1JPJA 3QW0A 2M64A 3W2VA 4K7BA 2PFDA 3PMRA 4YN0B 5JSLA 4MTOA 3FAJA 2R05A 4JTCB 4U5EE 2J9UA 3S90A 2PX0A 1D1BA 3EQLF 4WGZA 2EPOA 2OOCA 2OU6A 3NMIA 4DBQA 1OW7A 3W8HA 3ZC4A 3C62A 3C8GD 3LUTB 2L6HA 4MVSA 3TOLA 4C3BA 1AUEA 4DRIB 2AWCA 2J9VA 4DRHB 3DD7A 4E7SA 4CDAA 1WATA 2CDQA 4IGGA 2AWYA 1LS1A 3KPHA 1APCA 1VYIA 4CBEA 1Z23A 2EPNA 2AVKA 3JYYA 1TWCA 2LP4A 5AC4A 1Q0KA 3C63A 3K33A 4NTAA 1CPQA 4XEFA 5F5FA 3EH1A 3PHF2 3H2VA 5L0DA 4PJLA 4G7ZF 4Q5SF 2A0UA 3FAPB 3KYJA 4I3MA 1BR4A 5B1AC 3LLIA 2WVNA 3T6JA 3UR3C 4WJ0A 2QLAA 1HMDA 2WVOA 2YL3A 3HLZA 3AQBA 1V4AA 4J7TA 4BJTA 2R7XA 2XLMA 4J30B 1Y6DA 1ORYA 2XL4A 1JAFA 3DE9A 3DZAA 5COFA 4LLCA 1Z7Qc 3T6GB 4WGYA 3AG4C 1VB5A 3GORA 3TJ6A 5L0FA 2B0HA 4I1OB 2JPUA 2ZPAA 4IRUA 1OXKA 2IXMA 4EIYA 1Y4CA 2DYRC 1LS4A 4C3DA 5DS4A 1EA8A 1FNTc 1L3PA 2Q9AA 2HUJA 3IQ6A 2YL7A 4J7YA 4F4BA 2P1AA 1NZEA 1R4TA 4C3EA 1OCCC 1ZU5A 2NSFA 2W45A 5DVWA 2PNOA 4MVRA 2JX0A 1OQCA 5A69A 3LJBA 4M63A 4NC3A 4BG0A 1ZVZA 1ST6A 3NDBB 3EZIA 1OKKD 3LNRA 1NFNA 2WZGA 3IEEA 2W9YA 2D4UA 2O9XA 4XLPF 1VMAA 2WZLA 4RBNA 3US6A 4C7OA 3G4XA 4C7OB 2J0WA 3HNIA 1MMAA 3CZ6A 4CDYA 3ZIBA 2CNWD 3IQ5A 1MMGA 3SZRA 1T5OA 1ZHZA 2QTVA 2GA0A 3EHNA 3QZCA 2G3KA 3MFNA 1NU9C 2YL1A 3V5XA 2KC3A 3RVZA 1RKCA 1PV3A 1Q0DA 2Y3BA 4H4KC 3B71A 3W2WA 5A6JA 1NBBA 4GQHA 4Q4ZF 4IB4A 4W8KA 3V5ZA 4JTAB 3DM9B 2HKVA 1OXBA 1N1CA 3CEXA 3B0VC 2PX3A 3I4UA 3MYFA 2R7QA 2VC9A 4NTBA 1FMWA 2VH3A 2X0CA 1ZHTA 4A2NB 3JRMO 4EHPA 2GDCA 4EUKB 1D1AA 2Y39A 2OEVA 3DAGA 4OIQF 2A0BA 2OG2A 1D0YA 1A7VA 3NKDA 1T6UA 1YJGA 2ZXOA 2L7AA 4YL0A 1T6QA 3VM6A 3WAQA 4E17A 4QI2A 3QTHA 1NG1A 3W4YA 5CI9A 3S29A 1ORJA 3HKKA 3NG1A 5DLJA 3R7CA 3ECSA 4O6NA 2IXNA 4E0IA 2R7WA 1K04A 4PK4A 3TK0A 4BJ5C 1WTYA 2VASA 1TWHA 4I44A 3O6XA 3V5YA 1BBHA 1V54C 3ABMC 4JW1A 4BJ5A 1HW2A 4PJNA 3L8JA 4CS7A 5L0HA 4U5DE 1TQGA 1E84A 2XSEA 5KYYA 2ZXRA 4OD4A 1KU2A 2NUTA 5KYYB 2Y3HA 1OW6A 1XZPA 2NUTB 4LERA 4EBKA 1BDJB 2R7OA 4YL1A 4JCHA 4KNWA 2YRFA 2NPUA 1F1MA 1M2OA 1NLXA 2CGEA 1YZCA 3GODA 3QMKA 3RQEA 4CSAA 4KI2A 5L3VA 1QQ3A 4RDAA 5BUOA 2LQGA 3RF3A 2R7RA 1PCXA 3VYWA 3ZWIA 1KNYA 1MMNA 1SMYF 3S0XA 4DVYP 1WOLA 2ZXPA 2HV6A 1A7DA 1OR2A 1MNDA 2ASRA 1E83A 3SXKA 2G3VA 4O7GA 4OIPF 5JRAA 4JEBA 2LFDA 4IJJA 4U5CE 5DS5A 2YWAA 4WABA 2L6GA 2PBEA 3O55A 3TOMA 4YT5A 3L8IA 1BR1A 2EINC 2WVQA 4AL1A 1VOMA 4U5FE 1G8XA 3N2ZB 2OKUA 4CS9A 3U9MA 4NQFA 2IYLD 2EPMX 1YDIA 1YVIA 2P7VA 4MQ9F 2L6FA 4OIOF 2RSEB 4JZAA 1OW8A 1E86A 2DB4A 1CGME 4ULWA 4JVSA 1MQVA 2IBFA 1D1CA 3S27A 4KBLA 3M1CB 1ZW3A 3O39A 3AG2C 2XLHA 2Q7RA 2OJED 2XLEA 3AGUA 2YVKA 2D5RB 1JMWA 1Z5ZA 3DXJF 1E2XA 4LLEA 3ATPA 5COGA 5F5HA 1QKRA 2DI3A 4K1OA 3X2QC 2YLGA 4XEKA 3ZSUA 5A6BA 1S7ZA 5JLIA 1EI7A 3EGDA 3WG7C 2P0NA 1RKEA 2Q4FA 3EGDB 3WODF 4BJ6A 1RKEB 5A6KA 3H65A 4PACA 1H7IA 1K05A 2HV7A 5B3IA 4XWJA 4MVZA 4JEAA 3RW0A 1C02A 2Y3DA 2YZSA 3CQZA 3MBGA 2LK4A 4YL3A 2VCBA 3R2PA 4IAQA 2AU5A 4KC9A 3UNGC 1JPNA 4GYTA 3LAYA 4IAOA 256BA 1JRAA 1FR0A 2ETSA 4LDRA 5IY5C 2KNHA 2LIGA 1QPUA 3DI5A 3AG3C 1L7CA 1AVOB 4CX9A 1TFKB 1O87A 1TKNA 1XZQA 3GEIA 4XTKA 1QSPA 4O79A 3B9QA 4R32A 3U8VA 2AP3A 4Q7CA 4DOZA 2XS8A 3I5QA 2HMZA 1U89A 2R9RB 3JT1A 1K40A 3ASNC 2J7PD 4XPWA 1WASA 3EGXA 1AEPA 1LKXA 3EGXB 3FXHA 2J7PA 1XWJA 4MW8A 3U9JA 4AK9A 2J9WA 2UUIA 3HNLA 3KYIA 4MVUA 4LACB 2J0XA 2UUHA 3G50A 4YT2A 1Q0GA 4N4WA 5CIVA 5HV9A 1W2WA 2IXPA 5DS6A 1T01A 2CYDA 4G0HA 4MS2A 1U0BB 3LESA 1V74B 1TR2A 3GANA 1FMVA 2Q9BA 4Z9JA 3IPMO 4XLNF 5DQTA 5DQZA 4E0HA 1WGWA 1YARO 3NYMA 5A6AA 1YYXA 2Z15A 4JE9A 5L0GA 1LIHA 3PDMP 2WZFA 4YT8A 4ZLCA 2YLDA 2KK1A 2RD9A 2HMQA 1GS9A 3MLGA 3U3BA 1VK5A 2KSFA 2XL6A 3QW1A 5CI8A 2R7UA 3S9OA 1NSGB 1QZXA 3ZTZA 5FCLA 5L0JA 1CGOA 2ZD9A 3BRJA 3JCUQ 4JIOA 5EK0A 2H7BA 4YK5A 3Q6MA 1ZZPA 4JKVA 1I4YA 5FZTA 3RH3A 5HSWA 5D91A 3KH2A 3RYLA 1R5ID 4ZLDA 3K1HA 1MMDA 2R03A 3Q6NA 1M2VA 2HSBA 4JRZA 2FGYA 1M2VB 1G4WR 3V7OA 4ANJA 3PCVA 3L1MA 4D4NA 3B0UX 3JZ0A 3S28A 1Q0MA 3SEOA 2X51A 1SYQA 1TWGA 3U2LA 2XL8A 4MVOA 3X1OA 1RJ9A 3M79A 3T6BA 3U0CA 1Z3IX 1RJ9B 3GWLA 5T1DB 5EHHA 3ZQYA 3ZG1A 4JCZA 3HJCA 2A68F 4NTFA 2KQ9A 2WB7A 2Q00A 1LVKA 3HNJA 3LS1A 5AGFA 5L0IA 2IXOA 4YJWA 4DRJB 3E70C 3UGPA 4E18A 4L6RA 2XLDA 2HFIA 1BZ4A 2A6HF 3K7DA 3DM5A 3JYHA 1FAPB 2ZXWC 2XXAB 1DOVA 3LS0A 4IARA 4JTDB 4BJ1A 4I1MA 1G5ZA 5E33A 1A0BA 1QVXA 1D0ZA 3O10A 5TJ5E 3FDQA 3POVA 1U6HA 3DAFA 3HNKA 4IWBA 3NRHA 2YLIA 4CS8A 3JTLO 2CW0F 1G4US 1LM3B 4BEMJ 1NU7D 3GWNA 3IQCA 3N24A 4CJGA 5L3QA 2H8AA 1LPEA 3U8PA 3UMKA 4FX5A 4EWCA 1FFTC 3RVYA 3DJUB 2QNLA 2P61A 1IW7F 2PP4A 2VCCA 4W8PA 2Q9CA 1SZIA 3Q7LA 3FVYA 1QLEC 3DE8A 3L34A 4PR9A 2R02A 2HZ8A 4Z9HA 3EFOA 1DOWA 1GQAA 3EG9A 3EFOB 3T4RA 3EG9B 2HSQA 4AX2A 3F47A 3JRTA 1ZHXA 2DGJA 2E87A 3RKOF 2R7VA 1GGQA 2BE5F 2A69F 2J8WA 3K1IA 3LLKA 4K0DA 4CDVA 1T6IA 2ICWG 4AL0A 2EIJC 3CAXA 4JJGA 1WN0A 5JUAA 4FESA 4YWQA 5F28E 5BQIA 5BQHA 3U2MA 3OA1A 1OR3A 2I15A 4FWVA 1RCPA 4P6IC 2LSEA 4ONSA 2J45A 5KYXA 2YL0A 1ZW2A 4GEHA 1D0XA 1PD0A 1C03A 1YYJA 1ZHYA 2I8BA 4P9FA 4U5HA 5KYXB 3TULA 3LEVA 4LDQA 1VLSA 3EJNA 4U5BE 3SXMA 3KL4A 2MWQA 2KJGA 3J06A 4HFKB 2KGOA 4PJJA 5E3CA 3EPVA 2HJ3A 2WL8A 1UG7A 4Z9IA 2FFHA 4U9DA 1BR2A 5BQGA 2W4MA 5T3WA 1A7EA 4CIPA 3FOPA 5JP7A 3BEHA 4X0RA 3C18A 4O6MA 1YLMA 3RIPA 1LI5A 1C17M 1CGNA 2PF4E 2MYSA 3GEHA 5T3TA 4PJMA 4EKWA 1S05A 1M6TA 2M4EA 3B29A 3Q7GA 4LDKA 1B68A 1LE2A 3U5SA 4OINF 2GWWA 2QUPA 3M4CA 1J8YF 1ZYRF 3C8GA 3C8ZA 1FTSA 3C8GB 2R7SA 2YKZA 4DBRA 3K66A 4CIHA 3M4BA 3UGOA 3A11A 3OEOA 1ZU4A 2W4BA 3W8IA 4E7ZA 4YT4A 1SR2A 5KYWA 5KYWB 1O5HA 4HE8D 2L9JA 2Q3TA 3MX3A 3OWTA 1RXQA 3FMSA 2BC5A 3GM3A 3JSZA 3SP1A 2EILC 3F46A 3ITFA 4QI0A 1Z6AA 3MYIA 2H7VC 4CJOA 2YEVA 1VLTA 3KKBA 2XLOA 1Z63A 2NG1A 3FOOA 2FAPB 2OEXA 5EGYA 3AOUA 1LE4A 3DWWA 4RD9A 3ZQVA 1ZHWA 2C03A 2EPLX 2DYSC 2A1DD 4BPMA 4MW3A 1IZMA 2OCCC 1OCRC
chains in the Genus database with same CATH topology
1CPRA 3TOLA 1E83A 4ER9A 4JEBA 4CDAA 3L1MA 4D4NA 1APCA 2J9BA 2XL8A 3C63A 3M79A 1CPQA 3QVZA 3TOMA 3ZQYA 2XLVA 5JS5A 5JVEA 3HNJA 5AGFA 4ULVA 2QLAA 2YL3A 4L6RA 3ZTMA 3NMJA 2XLDA 2XLMA 2XM4A 3DE9A 1JAFA 1E86A 1YZAA 4WGYA 1MQVA 4IARA 2XLHA 3HNKA 4EIYA 2XLEA 2YLIA 2CCYA 3IQ6A 1LM3B 2YL7A 4CJGA 3U8PA 1E85A 2YLGA 5JLIA 5JT4A 4NC3A 3DE8A 5B3IA 1GQAA 4JEAA 3M15A 2J8WA 4CDVA 3HNIA 4CDYA 4IAQA 3IQ5A 5JUAA 4N6HA 256BA 2YL1A 1RCPA 2YL0A 1YYJA 1NBBA 1QPUA 4IB4A 4CX9A 4U9EA 4U9DA 4CIPA 3FOPA 5JP7A 2XM0A 1A7VA 1CGNA 3HNLA 1S05A 1M6TA 2XLWA 4N4WA 3M4CA 2YKZA 3M4BA 3NMKA 1BBHA 1EKYA 3VRCA 4D4XA 1E84A 3QVYA 2BC5A 1YYXA 4JE9A 2YLDA 3QW0A 4CJOA 1YZCA 2XLOA 5JSLA 1QQ3A 3FOOA 2XL6A 3QW1A 4WGZA 3ZTZA 3ZQVA 3NMIA 3ZWIA 1CGOA 4JKVA 5JRAA 3C62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPR A;  3TOL A;  1E83 A;  4ER9 A;  4JEB A;  4CDA A;  3L1M A;  4D4N A;  1APC A;  2J9B A;  2XL8 A;  3C63 A;  3M79 A;  1CPQ A;  3QVZ A;  3TOM A;  3ZQY A;  2XLV A;  5JS5 A;  5JVE A;  3HNJ A;  5AGF A;  4ULV A;  2QLA A;  2YL3 A;  4L6R A;  3ZTM A;  3NMJ A;  2XLD A;  2XLM A;  2XM4 A;  3DE9 A;  1JAF A;  1E86 A;  1YZA A;  4WGY A;  1MQV A;  4IAR A;  2XLH A;  3HNK A;  4EIY A;  2XLE A;  2YLI A;  2CCY A;  3IQ6 A;  1LM3 B;  2YL7 A;  4CJG A;  3U8P A;  1E85 A;  2YLG A;  5JLI A;  5JT4 A;  4NC3 A;  3DE8 A;  5B3I A;  1GQA A;  4JEA A;  3M15 A;  2J8W A;  4CDV A;  3HNI A;  4CDY A;  4IAQ A;  3IQ5 A;  5JUA A;  4N6H A;  256B A;  2YL1 A;  1RCP A;  2YL0 A;  1YYJ A;  1NBB A;  1QPU A;  4IB4 A;  4CX9 A;  4U9E A;  4U9D A;  4CIP A;  3FOP A;  5JP7 A;  2XM0 A;  1A7V A;  1CGN A;  3HNL A;  1S05 A;  1M6T A;  2XLW A;  4N4W A;  3M4C A;  2YKZ A;  3M4B A;  3NMK A;  1BBH A;  1EKY A;  3VRC A;  4D4X A;  1E84 A;  3QVY A;  2BC5 A;  1YYX A;  4JE9 A;  2YLD A;  3QW0 A;  4CJO A;  1YZC A;  2XLO A;  5JSL A;  1QQ3 A;  3FOO A;  2XL6 A;  3QW1 A;  4WGZ A;  3ZTZ A;  3ZQV A;  3NMI A;  3ZWI A;  1CGO A;  4JKV A;  5JRA A;  3C62 A; 
#chains in the Genus database with same CATH topology
 1OCZ C;  1CPR A;  1V55 C;  1YA9 A;  2XS1 A;  2QE9 A;  3AGT A;  4MVQ A;  5B3S C;  1H9T A;  3FHD A;  1HE9 A;  3UMI A;  2G62 A;  1SF8 A;  4ER9 A;  1HE1 A;  3VAY A;  4MND A;  3KMI A;  2Y69 C;  4JUR I;  3TQO A;  1MNE A;  3DKA A;  5GPG B;  5B1B C;  4CSA C;  4N6C A;  2OJQ A;  2J9B A;  3SYN A;  3C7J A;  1JOG A;  1H6G A;  3SNH A;  4G7H F;  3EH2 A;  3QVZ A;  3SXY A;  1I4Z A;  3ZDL A;  4PFP A;  2XLV A;  5D92 A;  4DJ9 A;  3ZVR A;  4A4A A;  4G78 A;  5JS5 A;  3T9O A;  5JVE A;  1UFB A;  1M57 C;  3N0T A;  4J32 B;  1T9K A;  4QDL A;  5COM A;  4U5G A;  3G4Z A;  4ULV A;  1O3U A;  1LI7 A;  4G7O F;  3ZTM A;  5KYN A;  1M56 C;  3NMJ A;  4MTG A;  1TFO B;  4CS8 C;  2XM4 A;  3I5P A;  4DXW A;  1OKK A;  1PD1 A;  2QY9 A;  1YZA A;  2VB6 A;  3DJN B;  5E3A A;  5AC5 A;  4BEJ A;  2IOQ A;  3LEO A;  4NCQ A;  5KYU A;  3GEE A;  5KYU B;  2CNW A;  4UDV A;  3LNM B;  2P6V A;  2R25 A;  2NSG A;  4AE4 A;  1JR8 A;  2C04 A;  1EQ1 A;  4AE4 B;  4JJF A;  3E9V A;  2CCY A;  3NKE A;  3TJ5 A;  3AG1 C;  4NY3 A;  4CS9 C;  1RMV A;  3ABL C;  3L0I A;  2LD6 A;  3EHM A;  1J8M F;  1E85 A;  2YQY A;  1H9G A;  4O6Y A;  2GFH A;  3K1I C;  3CSK A;  5JT4 A;  2GAQ A;  3WHN A;  4HEA J;  4OIR F;  4XPY A;  4HFF B;  1TWA A;  2V3C C;  2OQM A;  3RQF A;  2BL2 A;  2B0J A;  1YA7 O;  2EIM C;  2EIK C;  3S84 A;  3M15 A;  2KYH A;  3RQG A;  1KTM A;  4DVZ A;  2XRH A;  3JSE O;  2TMV P;  3ABK C;  2XXA A;  2F22 A;  3DMD A;  1I5N A;  4PFO A;  1A41 A;  4N6H A;  3H2U A;  2LFF A;  1HMO A;  4XEV A;  2NUP A;  4KNV A;  1HY5 A;  1FFH A;  5E2Q A;  2NUP B;  4BJ6 C;  2EPK X;  3U3F A;  4OD5 A;  1OCO C;  2V26 A;  2A6E F;  4U9E A;  5K0I A;  1VYK A;  4MVM A;  4H54 A;  3AJM A;  1Q0F A;  3TD7 A;  3A9C A;  4XPX A;  3IQT A;  3HTK C;  3GM1 A;  2YHS A;  3AQC A;  4JC7 A;  4MTF A;  2JD3 A;  3SXZ A;  2IM8 A;  2XM0 A;  4XQ1 A;  4B6I A;  1VTM P;  3ASO C;  3B0P A;  2L81 A;  2VCA A;  2XLW A;  4N06 A;  3UMH A;  2H7O A;  5L0C A;  1ORS C;  1WWP A;  2HJM A;  4FAP B;  2LCH A;  4EBB A;  4EBJ A;  3NMK A;  2J46 A;  2MHR A;  3NYL A;  2KW3 C;  1HW1 A;  1EKY A;  4P9T A;  2HS5 A;  3VRC A;  3EZH A;  3NYJ A;  4D4X A;  2R7T A;  1GM5 A;  3QVY A;  1YAU O;  3GM2 A;  1NFO A;  3VF0 A;  3IHU A;  2Y3G A;  5A6B D;  3K6B A;  3RFY A;  1JPJ A;  3QW0 A;  2M64 A;  3W2V A;  4K7B A;  2PFD A;  3PMR A;  4YN0 B;  5JSL A;  4MTO A;  3FAJ A;  2R05 A;  4JTC B;  4U5E E;  2J9U A;  3S90 A;  2PX0 A;  1D1B A;  3EQL F;  4WGZ A;  2EPO A;  2OOC A;  2OU6 A;  3NMI A;  4DBQ A;  1OW7 A;  3W8H A;  3ZC4 A;  3C62 A;  3C8G D;  3LUT B;  2L6H A;  4MVS A;  3TOL A;  4C3B A;  1AUE A;  4DRI B;  2AWC A;  2J9V A;  4DRH B;  3DD7 A;  4E7S A;  4CDA A;  1WAT A;  2CDQ A;  4IGG A;  2AWY A;  1LS1 A;  3KPH A;  1APC A;  1VYI A;  4CBE A;  1Z23 A;  2EPN A;  2AVK A;  3JYY A;  1TWC A;  2LP4 A;  5AC4 A;  1Q0K A;  3C63 A;  3K33 A;  4NTA A;  1CPQ A;  4XEF A;  5F5F A;  3EH1 A;  3PHF 2;  3H2V A;  5L0D A;  4PJL A;  4G7Z F;  4Q5S F;  2A0U A;  3FAP B;  3KYJ A;  4I3M A;  1BR4 A;  5B1A C;  3LLI A;  2WVN A;  3T6J A;  3UR3 C;  4WJ0 A;  2QLA A;  1HMD A;  2WVO A;  2YL3 A;  3HLZ A;  3AQB A;  1V4A A;  4J7T A;  4BJT A;  2R7X A;  2XLM A;  4J30 B;  1Y6D A;  1ORY A;  2XL4 A;  1JAF A;  3DE9 A;  3DZA A;  5COF A;  4LLC A;  1Z7Q c;  3T6G B;  4WGY A;  3AG4 C;  1VB5 A;  3GOR A;  3TJ6 A;  5L0F A;  2B0H A;  4I1O B;  2JPU A;  2ZPA A;  4IRU A;  1OXK A;  2IXM A;  4EIY A;  1Y4C A;  2DYR C;  1LS4 A;  4C3D A;  5DS4 A;  1EA8 A;  1FNT c;  1L3P A;  2Q9A A;  2HUJ A;  3IQ6 A;  2YL7 A;  4J7Y A;  4F4B A;  2P1A A;  1NZE A;  1R4T A;  4C3E A;  1OCC C;  1ZU5 A;  2NSF A;  2W45 A;  5DVW A;  2PNO A;  4MVR A;  2JX0 A;  1OQC A;  5A69 A;  3LJB A;  4M63 A;  4NC3 A;  4BG0 A;  1ZVZ A;  1ST6 A;  3NDB B;  3EZI A;  1OKK D;  3LNR A;  1NFN A;  2WZG A;  3IEE A;  2W9Y A;  2D4U A;  2O9X A;  4XLP F;  1VMA A;  2WZL A;  4RBN A;  3US6 A;  4C7O A;  3G4X A;  4C7O B;  2J0W A;  3HNI A;  1MMA A;  3CZ6 A;  4CDY A;  3ZIB A;  2CNW D;  3IQ5 A;  1MMG A;  3SZR A;  1T5O A;  1ZHZ A;  2QTV A;  2GA0 A;  3EHN A;  3QZC A;  2G3K A;  3MFN A;  1NU9 C;  2YL1 A;  3V5X A;  2KC3 A;  3RVZ A;  1RKC A;  1PV3 A;  1Q0D A;  2Y3B A;  4H4K C;  3B71 A;  3W2W A;  5A6J A;  1NBB A;  4GQH A;  4Q4Z F;  4IB4 A;  4W8K A;  3V5Z A;  4JTA B;  3DM9 B;  2HKV A;  1OXB A;  1N1C A;  3CEX A;  3B0V C;  2PX3 A;  3I4U A;  3MYF A;  2R7Q A;  2VC9 A;  4NTB A;  1FMW A;  2VH3 A;  2X0C A;  1ZHT A;  4A2N B;  3JRM O;  4EHP A;  2GDC A;  4EUK B;  1D1A A;  2Y39 A;  2OEV A;  3DAG A;  4OIQ F;  2A0B A;  2OG2 A;  1D0Y A;  1A7V A;  3NKD A;  1T6U A;  1YJG A;  2ZXO A;  2L7A A;  4YL0 A;  1T6Q A;  3VM6 A;  3WAQ A;  4E17 A;  4QI2 A;  3QTH A;  1NG1 A;  3W4Y A;  5CI9 A;  3S29 A;  1ORJ A;  3HKK A;  3NG1 A;  5DLJ A;  3R7C A;  3ECS A;  4O6N A;  2IXN A;  4E0I A;  2R7W A;  1K04 A;  4PK4 A;  3TK0 A;  4BJ5 C;  1WTY A;  2VAS A;  1TWH A;  4I44 A;  3O6X A;  3V5Y A;  1BBH A;  1V54 C;  3ABM C;  4JW1 A;  4BJ5 A;  1HW2 A;  4PJN A;  3L8J A;  4CS7 A;  5L0H A;  4U5D E;  1TQG A;  1E84 A;  2XSE A;  5KYY A;  2ZXR A;  4OD4 A;  1KU2 A;  2NUT A;  5KYY B;  2Y3H A;  1OW6 A;  1XZP A;  2NUT B;  4LER A;  4EBK A;  1BDJ B;  2R7O A;  4YL1 A;  4JCH A;  4KNW A;  2YRF A;  2NPU A;  1F1M A;  1M2O A;  1NLX A;  2CGE A;  1YZC A;  3GOD A;  3QMK A;  3RQE A;  4CSA A;  4KI2 A;  5L3V A;  1QQ3 A;  4RDA A;  5BUO A;  2LQG A;  3RF3 A;  2R7R A;  1PCX A;  3VYW A;  3ZWI A;  1KNY A;  1MMN A;  1SMY F;  3S0X A;  4DVY P;  1WOL A;  2ZXP A;  2HV6 A;  1A7D A;  1OR2 A;  1MND A;  2ASR A;  1E83 A;  3SXK A;  2G3V A;  4O7G A;  4OIP F;  5JRA A;  4JEB A;  2LFD A;  4IJJ A;  4U5C E;  5DS5 A;  2YWA A;  4WAB A;  2L6G A;  2PBE A;  3O55 A;  3TOM A;  4YT5 A;  3L8I A;  1BR1 A;  2EIN C;  2WVQ A;  4AL1 A;  1VOM A;  4U5F E;  1G8X A;  3N2Z B;  2OKU A;  4CS9 A;  3U9M A;  4NQF A;  2IYL D;  2EPM X;  1YDI A;  1YVI A;  2P7V A;  4MQ9 F;  2L6F A;  4OIO F;  2RSE B;  4JZA A;  1OW8 A;  1E86 A;  2DB4 A;  1CGM E;  4ULW A;  4JVS A;  1MQV A;  2IBF A;  1D1C A;  3S27 A;  4KBL A;  3M1C B;  1ZW3 A;  3O39 A;  3AG2 C;  2XLH A;  2Q7R A;  2OJE D;  2XLE A;  3AGU A;  2YVK A;  2D5R B;  1JMW A;  1Z5Z A;  3DXJ F;  1E2X A;  4LLE A;  3ATP A;  5COG A;  5F5H A;  1QKR A;  2DI3 A;  4K1O A;  3X2Q C;  2YLG A;  4XEK A;  3ZSU A;  5A6B A;  1S7Z A;  5JLI A;  1EI7 A;  3EGD A;  3WG7 C;  2P0N A;  1RKE A;  2Q4F A;  3EGD B;  3WOD F;  4BJ6 A;  1RKE B;  5A6K A;  3H65 A;  4PAC A;  1H7I A;  1K05 A;  2HV7 A;  5B3I A;  4XWJ A;  4MVZ A;  4JEA A;  3RW0 A;  1C02 A;  2Y3D A;  2YZS A;  3CQZ A;  3MBG A;  2LK4 A;  4YL3 A;  2VCB A;  3R2P A;  4IAQ A;  2AU5 A;  4KC9 A;  3UNG C;  1JPN A;  4GYT A;  3LAY A;  4IAO A;  256B A;  1JRA A;  1FR0 A;  2ETS A;  4LDR A;  5IY5 C;  2KNH A;  2LIG A;  1QPU A;  3DI5 A;  3AG3 C;  1L7C A;  1AVO B;  4CX9 A;  1TFK B;  1O87 A;  1TKN A;  1XZQ A;  3GEI A;  4XTK A;  1QSP A;  4O79 A;  3B9Q A;  4R32 A;  3U8V A;  2AP3 A;  4Q7C A;  4DOZ A;  2XS8 A;  3I5Q A;  2HMZ A;  1U89 A;  2R9R B;  3JT1 A;  1K40 A;  3ASN C;  2J7P D;  4XPW A;  1WAS A;  3EGX A;  1AEP A;  1LKX A;  3EGX B;  3FXH A;  2J7P A;  1XWJ A;  4MW8 A;  3U9J A;  4AK9 A;  2J9W A;  2UUI A;  3HNL A;  3KYI A;  4MVU A;  4LAC B;  2J0X A;  2UUH A;  3G50 A;  4YT2 A;  1Q0G A;  4N4W A;  5CIV A;  5HV9 A;  1W2W A;  2IXP A;  5DS6 A;  1T01 A;  2CYD A;  4G0H A;  4MS2 A;  1U0B B;  3LES A;  1V74 B;  1TR2 A;  3GAN A;  1FMV A;  2Q9B A;  4Z9J A;  3IPM O;  4XLN F;  5DQT A;  5DQZ A;  4E0H A;  1WGW A;  1YAR O;  3NYM A;  5A6A A;  1YYX A;  2Z15 A;  4JE9 A;  5L0G A;  1LIH A;  3PDM P;  2WZF A;  4YT8 A;  4ZLC A;  2YLD A;  2KK1 A;  2RD9 A;  2HMQ A;  1GS9 A;  3MLG A;  3U3B A;  1VK5 A;  2KSF A;  2XL6 A;  3QW1 A;  5CI8 A;  2R7U A;  3S9O A;  1NSG B;  1QZX A;  3ZTZ A;  5FCL A;  5L0J A;  1CGO A;  2ZD9 A;  3BRJ A;  3JCU Q;  4JIO A;  5EK0 A;  2H7B A;  4YK5 A;  3Q6M A;  1ZZP A;  4JKV A;  1I4Y A;  5FZT A;  3RH3 A;  5HSW A;  5D91 A;  3KH2 A;  3RYL A;  1R5I D;  4ZLD A;  3K1H A;  1MMD A;  2R03 A;  3Q6N A;  1M2V A;  2HSB A;  4JRZ A;  2FGY A;  1M2V B;  1G4W R;  3V7O A;  4ANJ A;  3PCV A;  3L1M A;  4D4N A;  3B0U X;  3JZ0 A;  3S28 A;  1Q0M A;  3SEO A;  2X51 A;  1SYQ A;  1TWG A;  3U2L A;  2XL8 A;  4MVO A;  3X1O A;  1RJ9 A;  3M79 A;  3T6B A;  3U0C A;  1Z3I X;  1RJ9 B;  3GWL A;  5T1D B;  5EHH A;  3ZQY A;  3ZG1 A;  4JCZ A;  3HJC A;  2A68 F;  4NTF A;  2KQ9 A;  2WB7 A;  2Q00 A;  1LVK A;  3HNJ A;  3LS1 A;  5AGF A;  5L0I A;  2IXO A;  4YJW A;  4DRJ B;  3E70 C;  3UGP A;  4E18 A;  4L6R A;  2XLD A;  2HFI A;  1BZ4 A;  2A6H F;  3K7D A;  3DM5 A;  3JYH A;  1FAP B;  2ZXW C;  2XXA B;  1DOV A;  3LS0 A;  4IAR A;  4JTD B;  4BJ1 A;  4I1M A;  1G5Z A;  5E33 A;  1A0B A;  1QVX A;  1D0Z A;  3O10 A;  5TJ5 E;  3FDQ A;  3POV A;  1U6H A;  3DAF A;  3HNK A;  4IWB A;  3NRH A;  2YLI A;  4CS8 A;  3JTL O;  2CW0 F;  1G4U S;  1LM3 B;  4BEM J;  1NU7 D;  3GWN A;  3IQC A;  3N24 A;  4CJG A;  5L3Q A;  2H8A A;  1LPE A;  3U8P A;  3UMK A;  4FX5 A;  4EWC A;  1FFT C;  3RVY A;  3DJU B;  2QNL A;  2P61 A;  1IW7 F;  2PP4 A;  2VCC A;  4W8P A;  2Q9C A;  1SZI A;  3Q7L A;  3FVY A;  1QLE C;  3DE8 A;  3L34 A;  4PR9 A;  2R02 A;  2HZ8 A;  4Z9H A;  3EFO A;  1DOW A;  1GQA A;  3EG9 A;  3EFO B;  3T4R A;  3EG9 B;  2HSQ A;  4AX2 A;  3F47 A;  3JRT A;  1ZHX A;  2DGJ A;  2E87 A;  3RKO F;  2R7V A;  1GGQ A;  2BE5 F;  2A69 F;  2J8W A;  3K1I A;  3LLK A;  4K0D A;  4CDV A;  1T6I A;  2ICW G;  4AL0 A;  2EIJ C;  3CAX A;  4JJG A;  1WN0 A;  5JUA A;  4FES A;  4YWQ A;  5F28 E;  5BQI A;  5BQH A;  3U2M A;  3OA1 A;  1OR3 A;  2I15 A;  4FWV A;  1RCP A;  4P6I C;  2LSE A;  4ONS A;  2J45 A;  5KYX A;  2YL0 A;  1ZW2 A;  4GEH A;  1D0X A;  1PD0 A;  1C03 A;  1YYJ A;  1ZHY A;  2I8B A;  4P9F A;  4U5H A;  5KYX B;  3TUL A;  3LEV A;  4LDQ A;  1VLS A;  3EJN A;  4U5B E;  3SXM A;  3KL4 A;  2MWQ A;  2KJG A;  3J06 A;  4HFK B;  2KGO A;  4PJJ A;  5E3C A;  3EPV A;  2HJ3 A;  2WL8 A;  1UG7 A;  4Z9I A;  2FFH A;  4U9D A;  1BR2 A;  5BQG A;  2W4M A;  5T3W A;  1A7E A;  4CIP A;  3FOP A;  5JP7 A;  3BEH A;  4X0R A;  3C18 A;  4O6M A;  1YLM A;  3RIP A;  1LI5 A;  1C17 M;  1CGN A;  2PF4 E;  2MYS A;  3GEH A;  5T3T A;  4PJM A;  4EKW A;  1S05 A;  1M6T A;  2M4E A;  3B29 A;  3Q7G A;  4LDK A;  1B68 A;  1LE2 A;  3U5S A;  4OIN F;  2GWW A;  2QUP A;  3M4C A;  1J8Y F;  1ZYR F;  3C8G A;  3C8Z A;  1FTS A;  3C8G B;  2R7S A;  2YKZ A;  4DBR A;  3K66 A;  4CIH A;  3M4B A;  3UGO A;  3A11 A;  3OEO A;  1ZU4 A;  2W4B A;  3W8I A;  4E7Z A;  4YT4 A;  1SR2 A;  5KYW A;  5KYW B;  1O5H A;  4HE8 D;  2L9J A;  2Q3T A;  3MX3 A;  3OWT A;  1RXQ A;  3FMS A;  2BC5 A;  3GM3 A;  3JSZ A;  3SP1 A;  2EIL C;  3F46 A;  3ITF A;  4QI0 A;  1Z6A A;  3MYI A;  2H7V C;  4CJO A;  2YEV A;  1VLT A;  3KKB A;  2XLO A;  1Z63 A;  2NG1 A;  3FOO A;  2FAP B;  2OEX A;  5EGY A;  3AOU A;  1LE4 A;  3DWW A;  4RD9 A;  3ZQV A;  1ZHW A;  2C03 A;  2EPL X;  2DYS C;  2A1D D;  4BPM A;  4MW3 A;  1IZM A;  2OCC C;  1OCR C; 
#chains in the Genus database with same CATH homology
 1CPR A;  3TOL A;  1E83 A;  4ER9 A;  4JEB A;  4CDA A;  3L1M A;  4D4N A;  1APC A;  2J9B A;  2XL8 A;  3C63 A;  3M79 A;  1CPQ A;  3QVZ A;  3TOM A;  3ZQY A;  2XLV A;  5JS5 A;  5JVE A;  3HNJ A;  5AGF A;  4ULV A;  2QLA A;  2YL3 A;  4L6R A;  3ZTM A;  3NMJ A;  2XLD A;  2XLM A;  2XM4 A;  3DE9 A;  1JAF A;  1E86 A;  1YZA A;  4WGY A;  1MQV A;  4IAR A;  2XLH A;  3HNK A;  4EIY A;  2XLE A;  2YLI A;  2CCY A;  3IQ6 A;  1LM3 B;  2YL7 A;  4CJG A;  3U8P A;  1E85 A;  2YLG A;  5JLI A;  5JT4 A;  4NC3 A;  3DE8 A;  5B3I A;  1GQA A;  4JEA A;  3M15 A;  2J8W A;  4CDV A;  3HNI A;  4CDY A;  4IAQ A;  3IQ5 A;  5JUA A;  4N6H A;  256B A;  2YL1 A;  1RCP A;  2YL0 A;  1YYJ A;  1NBB A;  1QPU A;  4IB4 A;  4CX9 A;  4U9E A;  4U9D A;  4CIP A;  3FOP A;  5JP7 A;  2XM0 A;  1A7V A;  1CGN A;  3HNL A;  1S05 A;  1M6T A;  2XLW A;  4N4W A;  3M4C A;  2YKZ A;  3M4B A;  3NMK A;  1BBH A;  1EKY A;  3VRC A;  4D4X A;  1E84 A;  3QVY A;  2BC5 A;  1YYX A;  4JE9 A;  2YLD A;  3QW0 A;  4CJO A;  1YZC A;  2XLO A;  5JSL A;  1QQ3 A;  3FOO A;  2XL6 A;  3QW1 A;  4WGZ A;  3ZTZ A;  3ZQV A;  3NMI A;  3ZWI A;  1CGO A;  4JKV A;  5JRA A;  3C62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...