3ZWTA

Structure of human dihydroorotate dehydrogenase with a bound inhibitor
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
356
structure length
353
Chain Sequence
b'HLMPTLQGLLDPESAHRLAVRFTSLGLLRFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE (QUINONE), MITOCHONDRIAL
publication title Factors Influencing the Specificity of Inhibitor Binding to the Human and Malaria Parasite Dihydroorotate Dehydrogenases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 134
structure length 353
sequence length 356
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2011-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3zwtA00
2DZPA 4FB7A 3A5FA 1F6PA 1O95A 3MI6A 3UPWA 2WO5A 5AYZA 4M6VA 3MHGA 5AC6A 3U2OA 3UWQA 5F4WA 2YDAA 1T96A 1KTBA 4EVZA 1XC4A 3GKFA 5KMYA 5ABTA 1VCFA 2WPBA 1X7FA 1C9DA 3DAQA 3W71A 1OK6A 1EIXA 3P5ZA 1Z44A 3NQ6A 1O60A 3IIVA 3EXTA 4FNTA 2EF9A 3P7YA 3QW3A 2DORA 4O1DA 2WSYA 1B3OA 1KFEA 1WOBA 3BK0A 2A6LA 2EKCA 2J6XA 3KHJA 4JD4A 3A23A 3DHDA 5I3IA 1QCWA 5D32A 3GKAA 5HUPA 1YYAA 3MW7A 3TXZA 4X3ZA 1IXNA 3W7CA 3P81A 1P0NA 2VEIA 3FS2A 2ATSA 3CHVA 3CQ0A 1JRBA 3TC6A 5EY5A 3LHUA 1NAL1 4UMBA 3LCLA 5KZEA 3DH7A 3IIPA 1U5JA 1WBHA 3CEUA 2H8ZA 3GZ3A 2Q3OA 2V5LA 1W54A 1EP3A 3H53A 2NWSA 3L5MA 4L4MA 1OFPA 3G1AA 2PC4A 4GNJA 1VRDA 3BGJA 5AYYA 2ZRVA 4X9SA 2YW4A 1TTIA 4U28A 4UFMA 3G0XA 2A85A 4A2RA 3YPIA 4DO6A 5E93A 3G3DA 4MY8A 4A21A 4LVBA 5LNUA 1SW3A 3CWOX 1EUAA 5DY3A 1TJRA 3G1SA 4YL2A 2V2DA 3W07A 3R8RA 3TQ0A 4YWIA 2G5WA 3TCEA 4L4LA 4JY9A 3NPVA 3FJ6A 3LRKA 2VEPA 2OZ0A 4O12A 4QM1A 1DOSA 2ZZ7A 4TX9A 4IXHA 3SI9A 2IQTA 1G4PA 3NPUA 1LBFA 1BWKA 4U4MA 3W1AA 4IGHA 1FWNA 4ZQCA 1YTEA 3W87A 3SW6A 3O6YX 3W2NA 2E68A 4FNSA 4A3UA 4FX7A 2VFGA 3BO9A 1CW2A 3HMJG 1SO4A 1ICSA 1OFBA 5G2HA 4JICA 3UD6A 5L9FA 4FXRA 1VCVA 3N73A 3BW4A 4N02A 1VJIA 4DXVA 4IMEA 4AMAA 4FHAA 1KM1A 3LCHA 3VCRA 3W72A 3QPZA 3O07A 1X8FA 2NX1A 2PRMA 3C3NA 4GFSA 3M5ZA 3S42A 1H7PA 1FX6A 4QAIA 4HSNA 2Y7FA 3FOKA 4WOQA 5F2LA 3OHIA 2X2GA 4QISA 3LHYA 3R5EA 1TB3A 2FJKA 5HR6A 4AH7A 4O0ZA 4ALDA 5HWJA 1TQJA 3UY7A 5FEWA 1SPQA 4WOZA 2FB2A 1NFBA 4KWVA 2ZRWA 5K9DA 1ZAJA 3CWNA 5IBXA 3SGZA 4LS0A 4HNNA 4JNMA 4LVGA 1PE1A 1H7WA 2VEKA 5EMUA 1TRDA 1IF2A 2B0MA 4AB4A 2NUXA 3SZ8A 3MP4A 2ZA2A 4ADSA 4NNBA 4ONVA 4UTIA 5HMSA 3GAYA 4JDYA 1Q6RA 3MI2A 4NUWA 2YSWA 4RR4A 5D2WA 3LCWA 1XBZA 3ATZA 4GUIA 4P61A 2YW3A 4AWTA 1K7FA 1RR2A 5KSWA 1KLZA 1VC4A 5DCDA 3CM4A 3A22A 4XKYA 4DF0A 2J24A 4AHQA 1U83A 3T55A 1EWEA 1SSGA 1OFQA 4LS1A 1LTDA 2GPTA 3NQ7A 1P0KA 3C2FA 3CIWA 4O52A 1R46A 3KX6A 3TNOA 4N9CA 1H60A 1C8VA 5BOOA 4C1KA 2E09A 4LVFA 1FQ0A 4FXSA 5LNVA 3IVSA 3TXVA 1JCYA 3FFSA 1I2PA 1W8SA 3BG5A 1NEYA 4UTKA 4PA8A 3IGXA 2NUYA 2RDWA 1TPB1 4MVAA 3W7NA 2A5HA 3LXCA 2CZEA 2VFIA 1YTDA 3NO5A 1LBMA 3W7RA 4QNEA 2BX7A 4ICNA 4FNRA 3LRLA 4JDBA 1TIMA 1TPC1 3QSTA 1KTCA 3DGRA 1W31A 2CZFA 3BG3A 3IIZA 4ML9A 1PHWA 3KVKA 2OMAA 3NQGA 4DF2A 2V9DA 4AWUA 2DJXA 1G6CA 5CZSA 4E2BA 1RD5A 1FWTA 4N4PA 1W1ZA 3S1UA 1KM2A 2BSLA 1WBJA 2C14A 2PRHA 4DO4A 4PEKA 2C13A 3VNDA 1FWSA 1JJKA 1VS1A 2JBMA 2G96A 4NXKA 4NJHA 4Q32A 4RK8A 2QCDA 4W9TA 3TU9A 1IIHA 3NA8A 3OVQA 2C6QA 3EKZA 1ML1A 4I7VA 1TCDA 4UNLA 5CGQA 2QJHA 4C1LA 1H61A 2ZA1A 3HG5A 4O14A 3P61A 5D2XA 4RZ6A 1YADA 3R12A 4MLJA 1LZOA 4NX0A 2DZVA 1N55A 3E12A 4S1FA 1CX9A 3PB0A 4JTGA 1XM3A 4J9JA 4MY1A 1EP1A 5E0KA 1P5BA 2QCCA 3N9SA 5MHBA 1OFDA 3BARA 5G1YA 1SW7A 1DKWA 1ZFJA 1KM6A 1A5SA 1IXOA 1S3HA 3VE9A 2Y61A 4DO5A 3OA3A 2HS6A 3DKJA 4CLMA 4XBSA 1JUKA 3PULA 5FEPA 1MZHA 4Z08A 5LSMA 5BMWA 4JTHA 2C15A 4AHOA 1W5PA 2OJPA 2C0AA 1I2RA 1X1OA 4ADUA 3T78A 4XUGA 3W7QA 3I6RA 3I7QA 3HJZA 4JXCA 1ZAIA 1KW1A 4E2DA 4UTLA 1L6WA 2GQ9A 1OYCA 4TMBA 4DPQA 1HTIA 1H62A 3LHTA 4HNTA 1GEQA 4O17A 2HS8A 2QDGA 2J9ZA 2V82A 5C5YA 1SUXA 3CEPA 3ZS4A 3P74A 4CQAA 3WK1A 4FF7A 2XN1A 1WV2A 1BKSA 3NQCA 3O6CA 4UUIA 3UWVA 3W2UA 3EWZA 3L9CA 5FF0A 2CLLA 3HBLA 1AW2A 3GR8A 4HNVA 3STFA 1QPQA 4JYDA 3GXTA 1O4UA 4IWWA 2ISVA 1G67A 2ZCGA 1KM3A 2JKEA 3UWUA 4O16A 1VCGA 1XL9A 1TJPA 3N2MA 2AAMA 1LRQA 2RDTA 2ISWA 3NXFA 3TQKA 2Y7GA 1RZMA 1AW1A 2VELA 1XI3A 2ZQ0A 3OEXA 1KM5A 8TIMA 1GOXA 3W7DA 4YCPA 4MIMA 3C6CA 4DQWA 1H7NA 4PH6A 3LB0A 4OGZA 3DFQA 2NX3A 1V7YA 3C8FA 4Y6GA 1TPVA 3LCFA 2O7SA 4UCGA 2H3DA 5DXXA 4Z1DA 1VLWA 2FPTA 3TFCA 3HGOA 2DZUA 2V8ZA 2FDSA 3G18A 1VR6A 4N9DA 5H2ZA 4ZMGA 4UTJA 1J4EA 2WQPA 1LOQA 1ZJIA 2HMCA 3ANYA 1FBAA 4NNCA 2I9EA 3G1YA 3R89A 3G1VA 4H4IA 3DI1A 1QR7A 2JKAA 3LGEA 3CTLA 5FEZA 2ZTJA 1OFRA 4HPXA 2E5DA 3QQ1A 2GJNA 3DFPA 4KWWA 2ZZ4A 3L2IA 1LCOA 4K6AA 3LV5A 4O11A 3RLUA 1ZY9A 3S5YA 3W2LA 4R33A 4O1CA 5EL1A 5C55A 1HUVA 4RXFA 1LOSA 1SFLA 4Z1CA 1G7VA 1Q6OA 1FY6A 4JEQA 5F4SA 1L9WA 4WY0B 1FXQA 3LX9A 2RKXA 3M7WA 1KM4A 2ABBA 4Y8FA 3MWAA 5HQEA 4YXGA 1SU5A 2QEZA 2XN0A 4UR7A 1DBTA 3TAOA 3S0CA 3W70A 1MXSA 3M47A 4FIQA 1OG0A 3DFSA 2CLFA 3W1LA 4IOTA 5KTLA 3W7MA 1O5KA 3O16A 3SY5A 5K2ZA 3G8EA 2E1DA 2XFWA 3JR2A 3G0UA 3W85A 1R30A 1TRIA 2GUUA 4N6FA 4YCOA 3MHUA 4Y96A 3BPWA 1LLWA 2BXVA 3CLMA 1W3TA 3EEGA 1RV8A 1VQTA 3LBCA 1IXQA 5TIMA 3UPBA 1S5VA 2CLHA 4PTNA 1NVMA 5F4XA 3FEMA 1LP6A 2J9YA 3LTSA 4MZ8A 1SW0A 1JQXA 2YFOA 1GG0A 4B5NA 1DQWA 4POCA 3Q58A 3LCXA 3EXSA 3U6WA 3QMRA 4NT0A 5DCEA 1ME8A 2WOQA 3B04A 4O0KA 4GBUA 1OX6A 4DELA 4R7JA 1T99A 1K7EA 2QCHA 4JTEA 2Q8ZA 1ZCOA 1H1ZA 2WKJA 4K7VA 2NX9A 4CNPA 2CLIA 3SIZA 4EF9A 2QKFA 1XDMA 4KKXA 2QJIA 4UTTC 3W3OA 1GPWA 3PC0A 3JS3A 3EWWA 3LLDA 1G4TA 1JQVA 1VHCA 1O5XA 1DJQA 3PSVA 4XQ6A 3H54A 5I3JA 1L6SA 5D33A 1EWDA 3S5ZA 5CKSA 2YCEA 1WYIA 1QPOA 3GX9A 3P60A 5HJLA 1O94A 3GNDA 3LCIA 6ALDA 3GXPA 3TW6A 3FIGA 1PCKA 1MSSA 3MYPA 1TTJA 2RDUA 3BW3A 4M7TA 4OWGA 4M6QA 2QCEA 4JTKA 3N2XA 5EA9A 1X1ZA 3W2JA 4UFLA 2Y7EA 4O53A 3TC7A 2TRSA 4UFJA 3PY2A 1ADOA 5LHEA 1KFJA 1LORA 2A7PA 5G1TA 5DCBA 3F4NA 4ZVJA 3NM1A 5G4WA 3TH6A 2YYUA 3QFEA 3W7EA 3MBFA 1M7OA 3FYOA 4QSHA 1JCMP 5I3FA 1VPXA 3C56A 4FX6M 1D3HA 1NSJA 3LBMA 3P5YA 3LXAA 4AVFA 3GDRA 2I14A 4TO8A 1H50A 1LRNA 3W9ZA 5CPNA 4OHQA 3LTYA 3BGGA 3ABRA 5BRBA 1G4EA 1ZENA 3NZRA 2CW6A 1R2SA 4JS3A 2ZZ1A 3W1TA 3LV6A 1Z42A 3W23A 1YXDA 3NL5A 1ME7A 3M9YA 5LZLA 2VFFA 5TBOA 3CIXA 1TPEA 4Z1AA 1P1XA 2C3ZA 3LTPA 2QCFA 4IQLA 2LLEA 4MFEA 2JGQA 2DZSA 2ZZ2A 4JTUA 1Q45A 3O06A 3G1DA 2A2IA 4HN4A 5LHFA 2Y62A 2W6RA 3RLVA 1RQEA 3CPRA 4S2CA 5D2VA 1IIGA 4LUIA 1F05A 3W83A 1KM0A 3PUOA 1JCJA 4AEOA 1B4EA 1TMHA 3NAVA 4RZ4A 1F7BA 4HPJA 1N8FA 3G0SA 3EWYA 5FF3A 3T44A 4BWLC 1UUMA 4AF0B 1F6KA 3C4UA 1LOLA 3UQNA 1Z41A 3O05A 4A2SA 4EWND 3PBUA 1RVGA 5C54A 3IIXA 4JX6A 5HULA 2B7NA 4I7UA 4FNPA 2TSYA 1H63A 5EKYA 1YDOA 2QR6A 3NPXA 5K3VA 3F4WA 1I8JA 5K9XA 4XZ9A 1TPWA 4WY0F 3BLFA 5E1QA 2V0TA 4IPJA 3ABQA 1PVNA 4O1BA 1FWRA 2V81A 4UTHA 3TX9A 3T40A 2ATMA 3E49A 3UWYA 2QCMA 3C2EA 5AOUA 5BW6A 4JTIA 2FLIA 3DZ1A 3W1QA 3HO8A 3CU2A 2B7PA 3NOEA 3THAA 2E6DA 2V2CA 5FEXA 2QJGA 1VHNA 3LERA 1B4KA 4Q33A 4NJJA 4O1AA 5G2WA 3VKJA 2GQ8A 2Z6JA 4BR1A 4OU1A 2E6YA 3WJYA 3L5LA 4JTJA 2F7FA 2A21A 4IUOA 5IM51 4HIBA 3W76A 5AYXA 4MUZA 4CCDA 1A5BA 3QJAA 3L5AA 1DL3A 3EWXA 3O15A 1XUUA 1JR1A 3QQ0A 4XTDA 5CPMA 1QO2A 3N3MA 3STEA 1H5YA 4IJBA 1ZHAA 4IMDA 4BF9A 3O6DA 5A5WA 2OCZA 1A50A 4ZQRA 3MP5A 4CCCA 4LVDA 2QUTA 3KRSA 1QAPA 1YLVA 4UFIA 3GYEA 3GDTA 2JK2A 2E5BA 2V5BA 1W37A 3BLIA 3NR0A 1K03A 2ZZ5A 4DPPA 3STCA 4FO4A 2FPVA 3M44A 4RZ5A 1GVRA 4AHPA 5TQLA 4ZQOA 2RHGA 2BZNA 2GQAA 3TV8A 2ISSA 3W84A 3DHFA 3L0GA 4CCEA 1WX0A 4H6KA 1OVDA 2OT0A 3INPA 4FNUA 3W1UA 2YZRA 3UYCA 4TU1A 5CZTA 3CT7A 3PBYA 5F2GA 4JYEA 5KZDA 1UUOA 1TV8A 3R2GA 2CLOA 5KITA 4UTMA 1SR9A 1ICPA 4WY0A 1F73A 1UBSA 4Z0JA 3FJLA 3MI3A 1THFD 1Y0EA 5C2XA 4GWEA 1W56A 3NM3A 1W5QA 2Y85A 3NYZA 3LI0A 3NL3A 4LRSA 4MFDA 1UCWA 5AHIA 1EX5A 3A9IA 1GTHA 4GE8A 1I4NA 4I7WA 3B05A 2VFHA 3G24A 1OJXA 3ELFA 4KFOA 1UASA 3PB2A 4M19A 2NWRA 3UNDA 4DBDA 3QH2A 3THQA 3W2KA 1NF0A 2CZ5A 3NL2A 2TMDA 3CC1A 4DF1A 5F2IA 3L68A 2H8XA 1I2QA 1XDLA 2J9XA 5I3KA 3LI1A 5LNRA 5T26A 1KLYA 1GVQA 1R2TA 3DFTA 4FEZA 3PSWA 2PRLA 1OFAA 2YYTA 1WOAA 2ZTKA 3B4UA 1PL9A 1W5NA 3FLUA 3M43A 4UTWC 3U8GA 3LOTA 4RXGA 2FQIA 1IXPA 1EA0A 1PCWA 2ZYFA 1SZEA 3UY8A 4IMCA 1QWGA 2EPHA 3GDKA 3O63A 2P10A 2UV8G 3SGUA 3ZR4A 5HWNA 4RX0A 5DXYA 2DU2A 2H90A 3D0CA 1WAUA 3KRZA 3RF9A 3G22A 3W7JA 4RKAA 4AWSA 2A0NA 3TE9A 4MLRA 4K39A 1QDSA 2YPIA 3NL6A 4S2BA 1K7XA 1TPFA 5D30A 1FUYA 1KFBA 5HR7A 1BWLA 3NVTA 1PS9A 2ZDRA 4ADTA 3IVTA 5AN7A 1KA9F 5LGXA 3KFTA 3QSRA 1CI1A 1QNVA 3ZWSA 3USBA 2EHHA 5FF2A 3CB8A 3QEZA 4KFNA 2QUUA 1W3NA 4IXXA 3UXDA 3QC3A 1TO3A 4Q4KA 3W2MA 2R14A 2Z0IA 1K8XA 3W86A 4Z0SA 4UC5A 2WJZA 3GLCA 1SO5A 1F76A 4JX5A 4WX2A 3F1QA 3HG2A 3S6DA 3DXIA 3B0PA 3PUDA 3W1XA 1FCVA 3B0VC 1MEWA 4N9BA 3RFAA 2NXHA 4NZFA 3K30A 3S5OA 1DQXA 1UJPA 2Y70A 1MEHA 3QZEA 2J88A 3EX6A 4BI6A 3DKLA 4NX5A 3N34A 3NQFA 1TTQA 1TTPA 1XUZA 2E6AA 3DFOA 1BEUA 1YPIA 2R8WA 3E96A 3L0NA 4WXZA 4LW7A 1M7PA 1OX4B 4TIMA 3M6YA 1AW5A 1OYAA 2VENA 4JIQA 4OQVA 4NJIA 3PM6A 4O57A 1F74A 4QITA 4BK9A 3PBVA 2CLKA 1WXJA 3P84A 1YXCA 5F1VA 3WK3A 2VC6A 4G1KA 2B7QA 2E5CA 3LDVA 3VI2A 4PL1A 2VOMA 3W75A 1XBXA 5EYWA 3MBDA 3EWBX 3MP3A 2Z1BA 1R2RA 5CSSA 3TMQA 1A5CA 3P80A 4HT3A 5DBTA 3MHFA 2ZRUA 3AJXA 3OVPA 4X22A 1FDZA 3HF3A 3IGUA 4MZ1A 3GNNA 3JRKA 1VLIA 3PUEA 4Y9AA 1OYBA 1YDNA 2ZA3A 3B06A 4MYAA 1NF7A 4PC8A 4JTLA 2QCDB 3ZWTA 1OFOA 3PF3A 4CNOA 3TK7A 1M5WA 2X1RA 1DV7A 4MKNA 4IX0A 2G95A 3I68A 2WNQA 3KVLA 4AF0A 1KTNA 2V30A 1JUBA 4OV4A 2QAPA 2AGKA 3DU0A 1X6UA 4MY9A 3SSJA 4A22A 1A5AA 5FF4A 3W6YA 1L6YA 3EX3A 1PV8A 3TDFA 1DVJA 4UTWA 1F2JA 3BVJA 3STGA 1B9BA 1HO4A 1KV5A 1GYNA 3PS7A 1LBLA 2Y7DA 2X30A 2A7RA 2Z6IA 3ZFHA 5G2IA 2X1SA 2A4AA 1SO6A 3W7OA 4NJKA 1QO5A 3M0ZA 4GUJA 5AHFA 1JCXA 4PODA 1SZGA 4UFHA 2GOUA 4D2JA 3BW2A 5SWUA 3PG9A 1YPFA 4ZL1A 4CQ9A 1TREA 5HNRA 3H55A 3HIJA 7TIMA 3RMJA 1JCLA 1YTKA 3EX2A 4GRSA 1L2UA 3TSMA 1GYLA 2NLIA 2Q8LA 3LHWA 1ZAHA 4ZQNA 5A8GA 2X1TA 4CNNA 1H7XA 5LKYA 5D05A 2CLEA 2P0OA 5AHLA 2VKZG 4ZQPA 4IPIA 4WUIA 4LUJA 3WJZA 3LCGA 4RCXA 3FA5A 1H1YA 3VE7A 3IVUA 1VYPX 2NXGA 1TV7A 4YMZA 2QDHA 3M5YA 5CPOA 4A29A 2NUWA 2PCQA 4MYXA 3L21A 4O54A 1D9EA 2VFDA 1TPH1 4JTSA 4WQ6A 1EPXA 2YXGA 1FDYA 2QAFA 3EB2A 1AK5A 1GQNA 4N6EA 2OX1A 2OT1A 4WZHA 5IBXC 2ALDA 2ZZ3A 5D03A 1TYGA 3MO7A 4P2VA 1LM1A 4QQ3A 2Y6ZA 3QM3A 3G3MA 1HFBA 3HPSA 4JX4A 3E02A 3DFNA 1K8YA 2ZZ6A 1Q3NA 4LC8A 4GUFA 3NQAA 3BLEA 4GJ1A 4O4VA 4O10A 1OFEA 3G8RA 3HPXA 5D02A 2JKPA 4IX2A 1QFEA 2VEMA 1JULA 5LNWA 4LNYA 1W3IA 3I7SA 3S1XA 3E0IA 4JN6A 3TSBA 5AB3A 4OT7A 2WNNA 4PFMA 3V1PA 5F2MA 4NVTA 1OX5A 2FTPA 1TPDA 3SJ3A 3TIMA 1ZALA 3HGRA 3EWUA 3P82A 4NJGA 4NQ1A 3P62A 3GIYA 2QUVA 1SZFA 2WNZA 3QMSA 3FYPA 4N9EA 3W88A 3C2RA 2X1UA 2CU0A 3C52A 3C0JA 3QPYA 4K8HA 3ABOA 1C29A 1S5WA 3GK0A 4XTIA 2ZBTA 4N4QA 1RQBA 1J5TA 4WXYA 4I9AA 3W1MA 4EF8A 4MOZA 1K8ZA 4LT9A 3S9YA 4ORIA 5HWMA 2WSRA 2Y88A 1QPRA 1FWWA 4IMFA 5D2TA 3KRUA 1KBJA 1XBVA 3W7PA 3S1VA 4JTTA 4NNAA 2QCNA 3Q37A 3LHZA 3UZ5A 1JUEA 5D2YA 2HSAA 2CZDA 2A6NA 4UMAA 2R94A 1W5MA 3RK8A 1OK4A 4EIVA 1KFCA 3W7IA 1P4CA 2BTMA 1EUNA 2TPSA 1EB3A 4MZYA 5DY2A 3QMTA 4JY8A 3KAOA 3W73A 3KXQA 4WJEA 4HKPA 4UTTA 3Q2DA 4QNWA 4UR8A 5BNKA 1HG3A 4MJZA 1WA3A 3HG3A 2DZXA 2BLEA 2DJLA 3DBPA 1EEPA 1F5ZA 4PL2A 1QPNA 3NPWA 5FF7A 2TYSA 1FCBA 5DELA 5FESA 2B4GA 5G4EA 5BMXA 5CSRA 2ZRYA 3GAKA 4LY8A 5K4XA 3UWZA 3TR2A 1AMKA 1GVOA 2QCLA 1SO3A 1ZNNA 3TUUA 3NGJA 2YX0A 5CG7A 3TROA 4ZQMA 3IGSA 4X2RA 2V2HA 5K9CA 3G1XA 5K7JA 3VFLA 2ZRXA 4AAJA 5DLCA 4UTUA 3LXBA 3ATYA 3OVRA 5AHMA 3WFAA 2I1OA 1GG1A 3LLFA 4R53A 1GJPA 1XBYA 5I3HA 3T7VA 4R34A 3W7HA 1TSIA 5LGZA 5D37A 5D38A 3BG9A 3W74A 1BTMA 3NQVA 4DBEA 3NNTA 1VZWA 1MEIA 1QOQA 1ICQA 1TQXA 4TR9A 2ZRZA 3IRDA 4LV9A 3WJXA 1TV5A 1J2WA 1GVFA 2VFEA 2VXNA 3MMTA 4QIUA 5C6MA 1XXXA 2JGYA 5KINA 1K02A 5KZMA 1MO0A 4LU0A 3IIOA 4M7SA 1XCFA 3M41A 3PWAA 2A1YA 4Y90A 1Q6QA 4FX8A 1N7KA 3NG3A 4JYFA 3NQMA 3QF0A 4MPQA 5AHEA 1FDJA 3W1NA 3G1FA 1OX4A 3EX1A 3L65A 3SR7A 2EGZA 2ABAA 1GTEA 2WSQA 3BV4A 1T8XA 4PCFA 1G69A 1W5OA 1XKYA 2DZTA 2O7QA 1JCNA 4Z1BA 2RH9A 3LRMA 1G7UA 1JVNA 3IV3A 1AG1O 3AO0A 2E6FA 3Q94A 2XN2A 4BWLA 2WV8A 4WD0A 1IGSA 4K38A 1DHPA 3TFXA 3RNDA 3SECA 5CPLA 3A21A 1TPUA 1QMLA 3R13A 1SZNA 3HB9A 5U4NA 3GXNA 3N19B 4LS2A 4M5PA 1HL2A 3GR7A 4JR5A 1H51A 3O8AA 1I2OA 2D73A 3GDLA 4HHPA 2BWGA 1KFKA 3S8HA 1S5TA 2DZWA 1R47A 5G5IA 1H7RA 2CFFA 4UFKA 3WJSA 4NXSA 1ME9A 2ZFAA 3WJWA 5I3GA 1GWJA 2NV1A 4N2YA 3P8JA 3P8IA 4QJ1A 1K3UA 3QRHA 5AC7A 3B8DA 4O4WA 3PBWA 3OIXA 4OV9A 3TQVA 2CWNA 1M6JA 4O15A 2C18A 1Q6LA 4K37A 1WQ5A 4UMCA 1YDVA 1PIIA 5H91A 1W0MA 2Q3RA 1DORA 4BI7A 2H3BA 3PG8A 4GXMA 3HG4A 5LNSA 5AHNA 1VGAA 2C19A 5AFDA 1LLZA 1VYSX 2PURA 3HQ1A 5EPDA 4BFAA 2YFNA 4LVAA 3C61A 4ORMA 4OBTA 3UWWA 3N9RA 4DEFA 1YXYA 3GVGA 4FIRA 1HO1A 2C1HA 2EAWA 3NDOA 3P67A 1KV8A 4TMCA 1LYXA 3HOJA 3B03A 4CQ8A 2GVGA 3NZ1A 4K8EA 1AL8A 1UB3A 4K36A 3KVJA 1D3GA 3PVFA 1KBIA 3MYOA 3V75A 4NZJA 3F03K 3SFKA 5AC8A 3S5NA 3B0UX 2NZLA 2GJLA 5U7SA 4RV8A 3UXAA 4MJMA 3TMLA 3NQ2A 3WK0A 4XBKA 5J5RA 3FKRA 3M5VA 3EKLA 5F1UA 3L67A 5HINA 1B57A 2GVJA 4LWWA 4XKYB 2C16A 3I65A 3W7LA 3RU6A 3A5VA 4HNUA 3LM7A 3EX4A 4NU7A 2P1FA 1I45A 4RJEA 4HSOA 3WK2A 2PE4A 1LDCA 2Z2UA 4GUGA 4JTFA 3W7GA 3PAJA 1OF8A 1DJNA 4UIOA 3UZJA 3DI0A 1G4SA 1GVSA 4GUHA 3W22A 4EOUA 1SFJA 3TA6A 5CZJA 2FIQA 3QW4B 2CLMA 2AQWA 4JGDA 5GVJA 3TJLA 1LRTA 1FCQA 3HGJA 2Y89A 3EXRA 1GZGA 4LTSA 3HGSA 5DN1A 3I7RA 5D04C 5J5DA 3MJYA 4RLIA 3NQDA 2G97A 3DENA 4YLWA 1VH7A 3N14A 1OABA 4LRTA 3L66A 2RFGA 1RPXA 3TAKA 1E51A 1PHQA 1Z48A 4LV4A 1JRCA 3W7KA 2W79A 4O28A 3C2OA 4K7YA 1H7OA 3L0KA 4ZZ9A 3NQ8A 1OHLA 3M1ZA 5D09A 3FKKA 3W1RA 2FFCA 2B7OA 1I2NA 2F84A 3KVMA 6TIMA 1OF6A 1T0OA 3KOFA 4FNQA 2QF7A 2J27A 4O18A 4GC4A 3TSDA 3NEVA 3OG3A 2FPYA 4IMGA 5CZ0A 5FI8A 4JIPA 2DP3A 5K4ZA 2E77A 1FXPA 4O13A 2NXIA 3G1HA 3ABSA 5L6UA 1VYRA 2GVLA 3GDMA 2QCGA 2W0UA 1ONRA 3TKFA 3GB6A 3IEBA 4LC6A 1V5XA 4H3DA 4O8RA 4BI5A 1EP2A 3T4CA 1LROA 1XFBA 1SSDA 4LOCA 4XWUA 3S1WA 5DBUA 4KFPA 3TJXA 3M16A 2Y63A 4AXKA 1ALDA 4UXDA 3W1PA 4O50A 3M5XA 1WDWA 2H6RA 2X16A 3NQEA 2NV2A 1AL7A 4M6PA 3O1NA 1A53A 3C2VA 3E9AA 3PR2A 3HPZA 2A7NA 2YGYA 4OE7A 2HTMA 3LHVA 3QYQA 4E0CA 4O19A 1RQHA 3MUXA 4UNKA 1QOPA 1SQ7A 5EBUA 2R91A 2YR1A 2KZHA 1FCUA 4E38A 5HUOA 3TW7A 1GT8A 1KFLA 2FB3A 3A24A 3OBKA
chains in the Genus database with same CATH superfamily
4FB7A 2GZXA 3MKVA 1C9WA 4JZ5A 5AYZA 2JF7A 1S2WA 3U2OA 1T96A 5KMYA 1UD2A 3W71A 3T6CA 1EIXA 3P5ZA 2HVNA 4KT2A 1S2TA 4E3VA 4CN6A 3QLLA 3IIVA 3HFTA 3EXTA 2PP0A 4HHHA 2WSYA 3UG3A 3QTGA 2O0TA 4CKQA 1TA3B 2WMIB 4JD4A 5I3IA 1ZGDA 3DG3A 4MKSA 3GKAA 5HUPA 1YYAA 1Z3NA 3LMYA 1AD1A 1ADSA 5FAGA 2XIJA 4Q7BA 5T9CE 4DLFA 5ABFA 1B3XA 3WUEA 3L12A 5EY5A 4ATWA 4AZCA 3EDDA 4YYFA 3GZ3A 3L4YA 2V5LA 1UIPA 1EP3A 3PUGA 4ZODA 3ICJA 3W00A 3L5MA 4EWJA 2PC4A 1P0EA 4JIHA 3BGJA 3PP7A 2YCJA 5AYYA 2YW4A 2YA0A 3WLLA 3AZRA 2A85A 9XIAA 3G3DA 4MY8A 2XFFA 3LM3A 1B9ZA 4H8UA 1ZZMA 2VEGA 1XV8A 1V0MA 3UPMA 1BYBA 4FLRA 1E0TA 2V2DA 3WH8A 2R24A 3TQ0A 1QOXA 5CSUA 3BWWA 4L6HA 2VEPA 3LGDA 1VKFA 4O12A 2VX4A 3N25A 4I5UA 3T81A 4IXHA 1W1TA 4DJEC 1G4PA 3NPUA 3BLKA 2OEMA 2VX6A 3W1AA 1UW9A 4ZQCA 3SW6A 3RX4A 3W2NA 1UQZA 4FNSA 4A3UA 2VFGA 4DAFA 3HMJG 1X39A 2YL9A 4C1NA 2W4XA 2ZXAA 1DTUA 3WL1A 3KHDA 4GY1A 1H09A 4S23A 4WJXA 4H8VA 3SAZA 3M0YA 1XHGA 3O07A 4HJFA 4GQQA 1KQYA 1RA5A 1OT1A 4QAIA 4HSNA 3REQB 1WZMA 1UP0A 1CB2A 2V67A 3UESA 1KBBA 3SIMA 2GDVA 3LHYA 1S2UA 5LXXA 2QV5A 3FGCB 4O0ZA 4AH7A 4ALDA 4WOZA 1NFBA 1GOQA 2OGYA 3SCRA 2Z1VA 3CWNA 1KRMA 1ZBWA 1TV4A 4YVXA 3OIHA 5FAJA 1H7WA 1RLCL 1VFTA 5EMUA 2QJMA 1G1YA 5EMKA 3MP4A 1UMLA 4PBEA 4ADSA 4NNBA 4UOZA 1PYFA 1J2BA 5HMSA 4KIRA 1Q6RA 4RR4A 4WK9A 5I23A 3ATZA 1AQHA 4GUIA 4S3KA 1HVQA 1DTNA 4AWTA 1K7FA 3QZ6A 2NVAA 3CM4A 4DF0A 2J24A 4AHQA 3TTOA 4W4QA 3WQPA 4GI9A 1LTDA 2GPTA 4WCJA 4C91A 2G3IA 2EPLX 3URQA 3VNLA 3PZOA 4C1KA 5BOOA 3NSXA 1E4LA 3ARVA 3IVSA 1JCYA 1W8SA 1DWGM 1NEYA 3A3WA 4PA8A 3IGXA 3KBJA 3W7NA 2BHUA 1YTDA 1XRTA 4AIOA 3AMCA 3QSTA 1RCOB 1TIMA 3AZTA 1H0IA 3DGRA 3AS3A 4QJ3B 3BURA 2GJRA 4P8WA 1NDWA 3IIZA 2ZIDA 1PHWA 1EJUC 2VGIA 2V9DA 2PODA 4GJJA 4IGSA 5HQLA 1WKYA 1POKA 1G6CA 4UBPC 4N4PA 4LB3A 1JYXA 4AD0A 2BSLA 4UQBA 4WDXA 2WCGA 4JEJA 4DO4A 3P14A 4AC7C 4G56A 3TYAA 4CD5A 1YW1A 5J8LA 5JXQA 2XIQA 1QASA 4NXKA 4Q32A 4I3GA 4F4RA 3WMSA 1XRSA 4H41A 3TU9A 3OVQA 1XIMA 3SN1A 4RW3A 2C6QA 4W7WA 3W4RA 3BMVA 1TCDA 4J5NA 3ES7A 2E9MA 2W67A 3RLHA 1F3WA 3M0MA 2DUXA 1H61A 3HG5A 3WEZA 4G8TA 1FP9A 4ACYA 1UD5A 4PFHA 2R1LA 3H4GA 1RVKA 5I78A 3AS1A 4L6OA 3GC4A 1JZ6A 2XGIA 3BANA 4GIYA 3R58A 4C6FA 1KM6A 2D2GA 1XLMA 1CGTA 2EXOA 1IXOA 3L2MA 3VILA 4GXWA 1VJSA 3CPUA 5I03A 1JUKA 1IT8A 4S3EA 4W93A 2V5JA 3N4FA 5BMWA 3SRDA 1POJA 4AHOA 4F0HA 2CKRA 3LY0A 3T78A 3KE0A 3CH0A 4XUGA 3W7QA 1W1B1 1VFUA 3HJZA 1KW1A 4E2DA 2VUYA 1SFTA 4UTLA 1FWGC 1J6OA 2XFRA 4LUYA 4C6DA 4DPQA 3ZZ1A 1H62A 3MC5A 4O17A 2VQUA 2J9ZA 5DRCA 3FJNA 5C5YA 1KBLA 4AW7A 1WKDA 2A3AA 1G01A 4GO8A 1E5NA 4OIFA 1WV2A 2AGTA 3A4XA 4GLEA 3NQCA 4HMNA 3O6CA 1VFFA 4UUIA 1BXBA 2EBNA 3TN5A 3A4JA 2CLLA 1FH8A 1QPQA 4JYDA 2DEPA 3APTA 3VDAA 2ZCGA 3UWUA 3T9PA 1NOWA 1US3A 3T09A 2AAMA 4IUGA 2RDTA 2ISWA 1V79A 1ISZA 3NXFA 4LAZA 4AU0A 3ZVHB 3KOYA 1RZMA 3O0FA 4BF5A 2ZQ0A 3W7DA 2G3JA 3C6CA 3CQHA 3L4ZA 3LB0A 1ENUA 1V7YA 4Y6GA 1TPVA 4HCHA 1O68A 1DIEA 2X41A 2W5FA 3HGOA 4F40A 4GQ0A 3NIYA 3WDPP 3ZQ9A 4N9DA 4XSLA 5H2ZA 1IEQA 1ZJIA 3BXWA 4NNCA 1DXFA 3G1YA 4PCTA 3R89A 1GVEA 1E4MM 4H4IA 3DI1A 2JKAA 5FEZA 2ZTJA 1OFRA 4HPXA 2E5DA 2GJNA 1EJ7L 3MUAA 1HF6A 1PTDA 5C55A 5I77A 1HUVA 2D69A 1SFLA 2V5KA 5HMDA 1G7VA 2VT0A 1EA9C 3I4KA 1R3VA 1T5AA 4WY0B 4Y9OA 3M7WA 1XINA 1KM4A 2ABBA 4Y8FA 4AYGA 1X6NA 3AMKA 5HQEA 1UR8A 3TQPA 2WW5A 3A64A 1A5UA 4JQ3A 4ZSUA 2BY2A 3N3TA 4UR7A 1DBTA 4N42A 4FIQA 3WNNA 2CLFA 3D46A 5KTLA 1O5KA 3O16A 2DIJA 5DO8A 1XLEA 1JGIA 2E1DA 2AKMA 1IT0A 3G0UA 3WQOA 1ZU8A 4DY1A 2VRJA 2NQ9A 2PEVA 3UCQA 3MHUA 4YWSA 1RV8A 1VQTA 5A69A 5IFPA 2FMOA 4GCXA 4GGBA 2CLHA 2JQXA 4PTNA 2C1GA 1NVMA 1T8QA 5F4XA 1LP6A 3IUDA 2IPWA 4PUUA 2DSUA 4C7GA 3Q58A 4I9MA 2HE8A 2WOQA 4GBUA 1ODUA 1RAKA 1PZ1A 2AL2A 2H9AA 4K1WA 1K7EA 1Q5MA 2ODOA 3FDKA 1H1ZA 2Z28A 4I5XA 4UOJA 3MCMA 3GFYA 3KZSA 2QKFA 4A3RA 5M03A 3W3OA 3PC0A 3NSMA 3JS3A 3EWWA 1K8CA 1G4TA 3H7VA 1E1FA 1O5XA 4GA8A 1UH2A 3U4AA 4Q6JA 1L6SA 1CPUA 4Z2JA 4B3ZA 1QPOA 1WDSA 3PWGA 1J8VA 1IZKA 3CO4A 5D8ZA 1O94A 3WDRA 3FIGA 1MDRA 3WDIA 1MSSA 2UZ9A 1J0HA 5D4YA 2RDUA 4D6GA 3M0VA 2Q01A 2YXOA 2GJXB 5EA9A 2GUBA 2PWVA 1X1ZA 1WAWA 2WCAA 1J5SA 4UFLA 4O53A 3TC7A 4UFJA 3JVAA 3CQJA 1UC4A 2X7WA 3U9IA 5PTDA 1WKEA 4ZVJA 2CITA 5G4WA 2G50A 1L8NA 3VIGA 1M7OA 4IP5A 4EAMA 3C56A 4KQNA 1MQPA 3P5YA 1EDQA 1TVNA 1JZ3A 1US0A 3D6NA 1B1YA 3ZVIA 1MYRA 3ABRA 4B4FA 1ZENA 3ZXWA 2XGBA 2ZZ1A 1DXEA 5EMMA 1YXDA 1R85A 3NL5A 6ENLA 3M9YA 4QEHA 5REQA 3GVRA 1TPEA 1CXFA 2GVEA 1LJYA 3LTPA 3EOEA 1Q63A 2ZZ2A 3BMXA 4S3FA 4S3DA 1Q45A 4DZAA 4EAYA 5FA5A 3WBAA 2Y62A 1XLBA 3RLVA 4O8AA 3CPRA 4ES4A 1F05A 4QTGA 3UCCA 3PUOA 1LG2A 3GUWA 3VM5A 2WJDA 3O2LA 2BHZA 3RCMA 1CZ1A 1N8FA 3EWYA 4IZGA 5FF3A 3T44A 1S39A 1UUMA 4AF0B 1TJ0A 5LA1A 1W9UA 3KM8A 4HOZA 4NZ4A 2CZVA 3UQNA 3O05A 2HK0A 4JX6A 1LWJA 1NJJA 4I7UA 4G5DA 2PGWA 5EKYA 4A35A 3VGEA 2POZA 4IQJA 1YDOA 2QR6A 5K3VA 2G3NA 3F4WA 4Z1YA 1I8JA 4AWEA 3G1RA 3BLFA 3ABQA 1FWRA 1SR0A 4DYKA 2ATMA 3E49A 4E2OA 2QCMA 3SUUA 4JBRA 4F3HA 3W1QA 1FRBA 1E9YB 1OD8A 3UFYA 2B7PA 1Y65A 3CHFA 1PDYA 3NOEA 3TEVA 3K46A 4Q3MA 4B9YA 5FEXA 2DDXA 1VHNA 2ZX9A 3V1HA 5G2WA 2G4FA 3AIBA 2GK1A 1BKHA 1P1MA 2PDBA 2Z6JA 2F7FA 3OQ8A 4IUOA 4HIBA 4WDUA 2DSVA 5HBFA 4MAVA 7REQA 4CCDA 2DH2A 4PTDA 2OQLA 3W27A 3EWXA 3O15A 5FKYA 1JR1A 3DERA 8A3HA 2ZX7A 4CCZA 3GVWA 4DUWA 1J0ZA 1H5YA 4MTVA 1K4GA 4IMDA 4BF9A 4YPJA 4ZQRA 4CCCA 5E0FA 2QUTA 3KRSA 3VUSA 1X8CA 1QAPA 3PFMA 3K1GA 4GVFA 3CZKA 1D8CA 3GYEA 3WMBA 2QGYA 3S2NA 2JK2A 3CT2A 2V5BA 2VWTA 4DPPA 2QQ6A 1UMYA 4FO4A 2VC9A 4RZ5A 2OO6A 5TQLA 2HBXA 3W84A 1KXHA 3AIWA 1J79A 3L0GA 4RDYA 5C9ZA 3AYRA 4H6KA 1OVDA 2OT0A 3INPA 1C8YA 1A3XA 3W1UA 3T8QA 3CT7A 1LQ2A 2IKIA 2QT3A 2QDEA 1EC8A 1V51A 2XM2A 5IDZA 3QR3A 1Y5XA 2CLOA 3EBVA 3H4WA 5T91A 4UTMA 1ICPA 1XD0A 1UBSA 3B97A 3R6IA 4MWAA 5C2XA 4GABA 4GWEA 3UGRA 1FHLA 3V0SA 2O9PA 1SJDA 4JPGA 3ZLHA 3KS5A 4YNGA 1BVNP 3VDGA 3NYZA 1UD4A 1E6XM 1V0KA 1UCWA 3RGTA 1J96A 1GTHA 2V69A 4LJ3A 1OJXA 4GYKA 2VCAA 1K9EA 2PDXA 3PB2A 3R0DA 3THQA 1KNWA 1J18A 3B8UA 3SFWA 3ZJKA 3U48A 2J7GA 2WC4A 2VVNA 3L68A 3AIQA 2J9XA 3IUIA 3VC5A 5DF0A 5D9MA 3GIPA 5LNRA 4Y7EA 4I9TA 1KLYA 4DJDA 1GONA 5D8WA 2OODA 3UG4A 4E4PA 2ZTKA 1PL9A 2RJHA 1W5NA 4UTWC 1FH9A 4RXGA 5HJYA 4UTFA 2ZYFA 4YN5A 3UGVA 5XINA 4IMCA 3HFYA 1Q66A 3W24A 2PC8A 2EPHA 2P10A 3ZR4A 3U2ZA 1Q7ZA 4WKAA 3NQBA 1JI1A 3W6MA 3T2QA 1TV3A 3DG7A 4JIRA 4HCDA 4AWSA 3TE9A 3BZJA 3AC0A 1UHVA 3PWIA 3V5CA 3CAWA 1YE6A 2BG5A 2GGGA 4GC3A 1TPFA 3LG3A 1KFBA 2J25A 3G5EA 4WKFA 7PTDA 1OGSA 3K4DA 4ADTA 3IVTA 2JEQA 2DT1A 1CI1A 2OOFA 1QNVA 3ZWSA 4YS1A 3VOCA 1W3NA 4GACA 1C91A 2R14A 4Z0SA 5ECUA 4UC5A 2WJZA 1SO5A 1US2A 3B8WA 3SUVA 4WX2A 3HG2A 2OYLA 2BXYA 4AEEA 3WD3A 4B4HA 3E0FA 4N9BA 3WL0A 3RFAA 3VKKA 4DO7A 1GVIA 4PRWA 3FK4A 1V3KA 1TTQA 2E6AA 3DFOA 3QOKA 2R8WA 3TYZA 1PWLA 3EDKA 3E96A 4F9DA 1OX4B 4TIMA 3CLWA 1WNOA 3GM8A 4OOZA 1V6TA 2Y1HA 4BK9A 3PBVA 1MUCA 1D3CA 3P84A 4H9TA 3QY7A 5AC5A 2B7QA 3RN6A 4GK8A 3T0DA 2VC7A 4IGMA 2V3DA 4MG4A 5IHSA 3VKDA 1ISWA 3HF3A 3IGUA 4KWOA 3I3EA 4MZ1A 3CH9A 3R8GA 3B06A 1JYNA 2PTDA 1YKWA 3CV7A 3ES8A 3ZWTA 4LFYA 1OFOA 5LIUX 1DV7A 3I68A 3UXLA 3EWCA 2V30A 4JTAA 3WLRA 2AGKA 3I3DA 3RMEA 1BRLB 1A5AA 5JH1A 2XH4A 2NSOA 2ACSA 3RPMA 3BZGA 1UA3A 3STGA 1B9BA 1BVZA 1GYNA 3PS7A 1LBLA 3KLKA 2X30A 3CNYA 1DE6A 3AHVA 2X1SA 4DZHA 3EYPA 1YNQA 1QO5A 3M0ZA 1JCXA 1DJGA 4UFHA 5SWUA 4XZBA 3PG9A 4ZL1A 1TREA 2Z26A 3HIJA 4NYUA 4JFUA 2C8NA 2J8TA 1JCLA 1HXJA 1YTKA 3GHSA 2Q8LA 1D7KA 3LHWA 4JCMA 1HVXA 5A8GA 3NVDA 1NQKA 2QVNA 3V0TA 4ZE5A 3WJZA 1CXLA 3LCGA 3GNRA 2YL5A 3VKAA 1H1YA 4KEMA 2XFYA 2BDQA 5CG0A 5A8PA 3AJ7A 3W37A 3WBEA 1XIBA 2NUWA 3ARRA 5H8MA 5LIXX 2XU2A 4Q8MA 4PSRA 1P6CA 1QI4A 1W91A 4C6LA 2YB4A 3WLMA 2ALDA 4IPLA 4ZB2A 4TV5A 1TVPA 3MO7A 3GVVA 4P2VA 1LM1A 4QQ3A 3UP8A 2OWCA 4S3JA 3DFNA 1Q3NA 4LC8A 2AQOA 3BAJA 3NQAA 4MMWA 4O4VA 3UNTA 5D02A 2XM1A 1QFEA 3PZGA 1M01A 2IUZA 1XG3A 1W3IA 4PCSA 3PNZA 3S6OA 3DG6A 3TSBA 2XWDA 2VR2A 4HK6A 4ACZA 5F2MA 4NVTA 1OX5A 5JU6A 1ITQA 2C1IA 3BAWA 3SJ3A 2NQZA 5GJMA 3AXMA 1DJXA 3T0BA 4WDTA 3GIYA 2QUVA 1W9PA 2WHMA 1YBQB 3N9KA 3C2RA 2X1UA 2F61A 1TE1A 1FA2A 3C52A 4BQ4A 2BV9A 1C29A 3VMOA 1S5WA 4M24A 1U5HA 3M0KA 4PB5A 4GKLA 4N4QA 3MZ2A 2ZDSA 4N7QA 4WXYA 4JQ4A 3S9YA 2FHBA 4TQTA 3VOFA 1JI2A 1HKWA 4EK7A 4GX8A 5I7GA 3GFZA 3UJ2A 3KRUA 1Z32X 1QATA 3MO4A 3S1GA 4NNAA 1Q2SA 1TZ7A 1Q8AA 3AXIA 2A6NA 2J78A 4UMAA 7ENLA 3AU2A 4EIVA 1EUNA 1QNPA 1UWQA 4A8IA 5HATA 4HZ8A 2WZHA 2QLYA 5GJNA 3Q2DA 4QNWA 5BNKA 1HG3A 2DZXA 3HG3A 3VD9A 1XYAA 3PTQA 1O66A 5BROA 2PBOA 1EEPA 3VABA 1QPNA 2FYMA 3PPHA 4H9XA 5FF7A 2TYSA 4XG1A 2XIOA 2W27A 3M7SA 3W28A 3WG6A 4MNKA 2F2KA 5I5RA 3T1GA 3TR2A 2QCLA 3TUUA 5M3WA 4HJWA 4ZQMA 4X2RA 3UJEA 5J04A 5K9CA 3G1XA 3WENA 2HK1A 4CU8A 2X0YA 3B9NA 3TWBA 3VFLA 4GQBA 3ATYA 2HVMA 1OC6A 3OVRA 5AHMA 3B0YA 6A3HA 1XBYA 4R34A 5D38A 3BG9A 3WNKA 3FHAA 1MW0A 1XGZA 3NQVA 2NVDA 4DBEA 8CGTA 3TN4A 1VZWA 4DAIA 5I02A 1ICQA 4LV9A 5HPCA 1TV5A 1J2WA 5AYBA 5ABFB 5I09A 3BTNA 4LYQA 1XYMA 4EPDC 5H1WA 4NASA 3W01A 1K02A 4AZCB 4RPPA 3M41A 3RM9A 4PTWA 3WH7A 3AWNA 1Q6QA 1NDZA 4JYFA 3NQMA 3R7MA 1GNXA 2DV0A 3WCZA 3URAA 3SCTA 1IWPA 2ABAA 2WSQA 4WVXA 4PCFA 1W5OA 4V27A 4MNMA 1NH6A 2O7QA 5C2CA 4XBJA 3RCNA 1QW7A 1RBAA 4ZBCA 5A6AA 2E6FA 1W17A 3Q94A 3N2BA 4BWLA 4WD0A 2CHOA 2OSYA 1QNSA 2CERA 2PWGA 3PZ9A 3TFXA 3SECA 3LZ5A 3A21A 2SFPA 1KKRA 1E9LA 3R13A 2XDFA 1R3TA 3VDHA 3VX1A 4LH8A 4M5PA 4M6UA 4GFIA 1I2OA 2D73A 3GDLA 4HHPA 4B2DD 2BWGA 3S8HA 3K13A 5G5IA 3W29A 3PZQA 4JHZA 1ME9A 3WJWA 4C1NB 3QGAC 1R9ZA 3P8IA 1K3UA 3HZ3A 5AC7A 3B8DA 3OU8A 4XISA 3DC8A 3V5FA 4ZXLA 4O15A 1QRQA 3WFLA 2DIKA 3SGGA 4GYPA 3IPWA 4UMCA 1YDVA 4WKHA 4BI7A 3OJGA 3PG8A 3CV2A 5LNSA 1GQJA 2HRWA 4HMEA 3TZFA 1VD6A 1C8XA 3RAOA 5GQBA 2WK2A 4U3AA 3SB0A 1L0PA 4LVAA 4MNJA 5GNZA 3P67A 1DWHM 3AHZA 4TMCA 2O4QA 1EOKA 3NZ1A 1AL8A 2J47A 5EFFA 3VGHA 3RU8X 4DZIA 4QJ4B 3SFKA 5AC8A 4KRUA 3S5NA 2GJLA 1PTAA 3AXXA 3UXAA 3GXIA 4XBKA 3S2MA 4CGTA 5J5RA 4XIAA 5B7YA 2J4GA 3L67A 3K4AA 1EC9A 1B57A 3FY1A 2BOGX 3VIIA 3W7LA 3WBWA 3A5VA 3EX4A 4NU7A 4XVDA 1BXNA 4ZGYA 4IJRA 3F7JA 4J3VA 4JTFA 1LDCA 2Z2UA 3P3BA 4GUGA 1CGUA 2O92A 3W7GA 4EPBC 3IWPA 3AYSA 4GNVA 3W22A 5AC4A 1KC7A 3GXMA 1FHDA 1IR1A 2AQWA 3TJLA 5DFAA 1UH3A 1UR2A 2I9UA 3HGJA 5TD4A 2A3CA 3EXRA 4MDPA 1FWDC 3HGSA 2VWSA 5DN1A 1IV8A 3LS9A 3I7RA 4JNZA 3QY8A 3WD0A 5HAOA 4CD6A 3R4IA 3VC6A 4OBSA 2G97A 2D2OA 1DIDA 3NO3A 4W85A 2X8RA 5IHRA 3L66A 1RPXA 1PHQA 1Z48A 4LV4A 3W7KA 1V3LA 4K7YA 4ZZ9A 3UJRA 3FKKA 3SUWA 3ZT7A 2B7OA 2F84A 4X2PA 1OF6A 4FLOA 5E09A 2WVVA 4DI8A 2GDQA 2Z4GA 3TSDA 2FPYA 3SADA 5HQMA 4JIPA 2WMHA 5CJ5A 2V6AA 3CMFA 1TMQA 1FXPA 5F7UA 3KCJA 1WB0A 2BVTA 2NXIA 4JQAA 3GDMA 1E4NA 2IPFA 1V5XA 4O8RA 4Q7IA 3CUHA 1XFBA 3WLHA 1N8WA 1SSDA 1PIGA 1TG7A 2R9RA 3ZSTA 3M16A 3GR4A 4AXKA 1ALDA 3MUIA 4TVCA 1IWBA 3M5XA 3T2OA 3VIKA 3EMCA 2BGQA 3M0JA 3NQEA 4M56A 3VIMA 1ZCCA 3GG1A 1IEVA 3E9AA 3PR2A 5A2CA 1XIEA 2W92A 5EBUA 2R91A 2AMGA 3NCOA 1XLCA 1R3WA 2PF0A 3CGTA 2DZPA 3KTCA 3LQGA 3DYOA 3VNYA 4U2ZA 2P3EA 3UWQA 4L64A 3GQYA 2YDAA 3WF0A 1EZ2A 1KTBA 4EVZA 1FFQA 1XLGA 2E8YA 2ACUA 2YLAA 1A4MA 3DFHA 1E72M 3AALA 1Z44A 3DHUA 3QV9A 1O60A 4FNTA 2EF9A 3WQ4A 2Q09A 2Z29A 1E6PA 3EB4A 3U7BA 1DJZA 1WOBA 2ZX8A 3BK0A 2RGMA 2WJEA 2HEJA 3KHJA 1QCWA 2P0IA 4H04A 3EB3A 4X3ZA 4BEQA 4C7DA 3AIUA 3W7CA 1XJBA 3P81A 1P0NA 3SQLA 2ATSA 5CC5A 1REQA 4UMBA 5KZEA 3URNA 3UZXA 3KL3A 2ADAA 4C5YA 1W54A 1KRAC 2PDUA 4AZ5A 4PMRA 1TJ1A 1A47A 2NVCA 1OFPA 3G1AA 1TE6A 4F48A 2JIEA 1ECEA 1VRDA 4C6EA 1ZJAA 1V4YA 2E28A 2ZUTA 4GGHA 3THDA 3FA4A 1KWKA 4BF7A 1M53A 1KBKA 4WSKA 4ZSTA 3ZLFA 4DO6A 3F4VA 4U3CA 3CK5A 4A21A 4LVBA 1JPHA 2CBUA 2PCEA 5LNUA 1SW3A 3F5KA 1ZBCA 5DY3A 4GVHA 2OB3A 1TJRA 3G1SA 4YL2A 2J74A 2G5WA 3CAVA 3N04A 2F38A 4JY9A 3B8SA 3AQUA 3FJ6A 2ZUUA 1HW6A 1MW2A 1NP0A 2OZ0A 3AHTA 4PUJA 5T8GA 1DOSA 3GU9A 1SFSA 3ITGA 1H11A 3ARSA 3C0SA 2IQTA 1LBFA 1YQ2A 3KL5A 4U4MA 1J10A 4IGHA 1FWNA 3GS6A 2W9MA 1YTEA 2PA6A 1P0BA 1Y5WA 3N2OA 3FXGA 1ICSA 5G2HA 4JICA 2WBGA 3UD6A 2QNEA 2DY3A 4FXRA 3N73A 1UBPC 3ALFA 2DW6A 5CQ1A 3B9DA 1T40A 2NQ5A 1JDEA 4FHAA 4MWAC 1NTHA 1EYWA 2WHLA 4L9YA 3QPZA 1OC7A 2NX1A 1EBHA 3WSUA 4GFSA 2VNCA 3M5ZA 3S42A 1FX6A 1AJ0A 2PI6A 5F2LA 1K9TA 4CQDA 1SPQA 4KWVA 1MW3A 1SMAA 2QPSA 5K9DA 1ZAJA 5IBXA 4LS0A 2AL2B 2H9AB 4JNMA 4JQ1A 1PE1A 3S47A 4YYCA 1MUWA 1QBBA 3H8AA 3QOMA 3AROA 1AFSA 3H2OA 3ANUA 3HV9A 4PRTA 1IF2A 1LUCB 2RAGA 2P53A 3WDJA 3SZ8A 1TCMA 1DP0A 4UQAA 4NUWA 3MI2A 1BG4A 5MF5A 2YSWA 4GZIA 1KR0A 3LCWA 1VFHA 3GIQA 5CBIA 1M65A 2AAAA 3LEPA 4XKYA 1SSGA 4L1WA 4LS1A 3C2FA 3ZR5A 4O52A 1EYEA 1U2YA 1R46A 3TNOA 1OZQA 4N9CA 1H60A 1BF2A 3DX5A 3OQEA 1U1JA 1FQ0A 2JIWA 2X40A 4FXSA 4HTBA 3TXVA 1XLDA 1RCXB 3FFSA 4KMQA 4X61A 4ZFCA 4PCNA 2RDWA 4MVAA 2DZBA 2A5HA 4L61A 2CZEA 4LPCA 3WEMA 1NFGA 1LBMA 4QNEA 1TPC1 4U33A 1W31A 2ICSA 4I6KA 2CZFA 3BG3A 3EA1A 2XTKA 3IJLA 4DIAA 1YIXA 3NQGA 5FJPA 4DF2A 4H7VA 4ZA0A 1QPKA 2J6VA 2DJXA 5CZSA 2J7FA 3T08A 1TZ9A 1RD5A 1FWTA 3S1UA 4LEFA 4YTSA 1KM2A 1XC6A 2HV5A 1WBJA 1O5QA 2PRHA 4L56A 1FH7A 4FR1A 1MRQA 3SN0A 5REQB 1VS1A 3F4DA 4XSMA 2JBMA 2G96A 4L80A 2PDKA 4RK8A 1S5MA 1XIJA 4LF1A 4W9TA 3NA8A 3FJ4A 1GCYA 1ML1A 3U2EA 4UNLA 4R7WA 2GSEA 1BGGA 2QJHA 3EWDA 4C1LA 2ZA1A 4D6IA 1M1BA 2EEXA 2O9OA 1XH0A 2E0PA 2IQDA 2PDHA 4JHOA 1V0LA 5D2XA 4RZ6A 4U10A 1V02A 1MRAA 1LZOA 1DIKA 4NX0A 4S1FA 1I9CB 1XX1A 3PB0A 4AY8A 2FFIA 3WBXA 4GBDA 3BARA 1GGOA 1M41A 1DKWA 4BHYA 1S3HA 2Y61A 4B9ZA 4QCFA 1PZ2A 2BODX 2Z25A 4ECLA 1MZHA 3ENLA 4Z08A 4QJ5B 4QBXA 2C15A 1W5PA 3KBNA 1G5AA 1UZHA 2BASA 3B9AA 4JXCA 1XIDA 3BLDA 1OYCA 1JZ7A 1KWGA 2Y4SA 1EL3A 2WBKA 2QDGA 2V82A 3DGBA 3AU6A 2QZRA 3CEPA 3ZS4A 4CQAA 2INFA 3WK1A 2AKZA 4NI3A 4L4PA 2GYIA 2DZAA 2OQHA 1M04A 3ARTA 4V33A 2GK1B 3W2UA 3EWZA 3OGVA 1AW2A 4HNVA 4P8XA 3GXTA 1O4UA 2EG6A 4PUNA 2ISVA 3WUFA 7REQB 1JF6A 2XWEA 4ROQA 1LRQA 2W63A 3TQKA 2G8ZA 3VGFA 2DW7A 2IS7A 2QJNA 3OEXA 4J3SA 3UG8A 4IIFA 4NF7A 4HA4A 3DFQA 4GOAA 2Q6ZA 3LMZA 4X0VA 1WDRA 4BKNA 1W2PA 2VYOA 3CL8A 4RDZA 2H3DA 2CXEA 5DXXA 4LY4A 1VLWA 5E9XA 3V3WA 2FDSA 4DBSA 1HKIA 5CPTA 4J3UA 1UKTA 2PS2A 4UTJA 2X09A 1J4EA 2REQA 2V68A 3N2CA 3ANYA 2BGNE 4K2SA 4AX7A 2QULA 1SGJA 3LGEA 4TX6A 4KWWA 1C92A 3MWCA 4MB5A 1DQUA 1RBLA 4R33A 4FZIA 2ACQA 1UIOA 2NQLA 1UR0A 2WCSA 2GWNA 3IGHX 2OWXA 3VGDA 1FXQA 2RKXA 1XLJA 3MWAA 2E3ZA 3POCA 1VJZA 4IISA 4ZCWA 4V15A 2QEZA 2BVWA 2XN0A 3WO8A 3BAYA 4MDOA 4UNIA 3FX4A 1JG9A 3M46A 5M17A 4N0RA 1DWFM 3POHA 4WHBA 3W70A 1MXSA 1G9HA 3W26A 1OG0A 2MANA 3W1LA 3ORWA 5HA7A 2PU1A 4J3TA 3W7MA 3DEQA 4JKLA 3RO8A 3SY5A 3RPTA 4H9YA 2PGFA 3G8EA 2XFWA 4Y9NA 5CGTA 1R30A 5FJIA 4N6FA 1E0XA 4L7ZA 2BXVA 3CLMA 2VEFA 3EEGA 3MB9A 4XZNX 5EGRA 1IXQA 5TIMA 1DE5A 3KP1A 3K1DA 1QHOA 2A3BA 2HROA 4MZ8A 3N11A 2E9LA 1IYXA 1JQXA 3BUVA 7TAAA 1GG0A 2PP3A 4B5NA 1DQWA 4POCA 2JEPA 4OJYA 2BS9A 2ISDA 3U6WA 3WUGA 3QMRA 1JNEA 5DCEA 4HPNA 1KB3A 4H83A 1LWIA 4R7JA 4H7ZA 1OCJA 1T99A 2QPUA 3KBSA 4B16A 2HQAA 1UROA 2Q8ZA 3ITOA 2J7CA 2WKJA 4LCQA 3PZNA 2NX9A 4CNPA 2CLIA 1Q4NX 3WQ6A 4YHEA 4D6JA 1WUFA 4RDVA 4HHLA 3EOLA 1DJQA 1H5VA 5I3JA 3FAWA 2XYLA 2Y8KA 3GX9A 2ACRA 1EHNA 1O7AA 3KBMA 2PDMA 2B81A 1V7AA 3MYPA 4RL3A 2YZ5A 3LPPA 3N4EA 1TTJA 4I6VA 3G77A 3TCSA 3MKCA 4JN8A 2QCEA 1PKMA 2ZOXA 2VTFA 3LSCA 5MKGB 3WNOA 2TRSA 4ILSA 3PY2A 1QI0A 3CYVA 1OWQA 1XQLA 2PWEA 1CECA 4B91A 1BAGA 3QFEA 1BQGA 4LUTA 3FYOA 4AZIA 1JCMP 4HB7A 1C3FA 2F6KA 1VPXA 1ISXA 1NOUA 3CUIA 3KWSA 3OA5A 3LXAA 1J0JA 3GDRA 3G6LA 3OYZA 2YCLB 1H50A 1LRNA 2EKGA 5CPNA 3KCOA 5BRBA 1G4EA 3SRHA 2ZWYA 2PWDA 3NZRA 2WZIA 4IT1A 3W1TA 3GTXA 1Z42A 8XIMA 5LZLA 4ZO6A 4LCRA 5TBOA 3CIXA 3UZWA 2QCFA 2LLEA 1HL8A 4K68A 3G1DA 3UJFA 1VENA 1UR1A 2GSHA 4UQEA 4S2CA 5D2VA 4LUIA 3RM8A 4PULA 3VM7A 1X98A 3W83A 4YU1A 1IWAA 4US6A 4RZ4A 2PDPA 1NWRA 4LYPA 4Q8OA 4HPJA 4BWLC 5CPSA 2D0FA 1XICA 3GXDA 3E0VA 3MT1A 3WZ0E 3KLLA 1B5TA 4KWUA 3TC3A 4A2SA 1RVGA 5C54A 3PZIA 4S3AA 3WD1A 4CNSA 4G1NA 2JF6A 3VX0A 2B7NA 1W9BM 4TVUA 1H63A 4W88A 5K9XA 3WNLA 4GVGA 4ROPA 1TPWA 1ITXA 4DJFC 3GY1A 5E1QA 1J9YA 4Q8UA 2V81A 4ENLA 3OYXA 3AXKA 5CEWA 2XH7A 3JU2A 3C2EA 3EA2A 5AOUA 5BW6A 4XB3A 2PFHA 3SRKA 5EBAA 2VZSA 3SSZA 1Z89A 4M1RA 9XIMA 4L65A 3HN3A 4HZMA 4PMYA 5LIKX 3VMNA 1EGZA 4H6QA 3ZJ8A 4Q33A 3KBWA 4O1AA 3VKJA 4HN8A 4JOMA 4BR1A 4OU1A 2E6YA 2VGBA 1OZMA 4JTJA 1T6MA 1QVBA 5E5CA 3NYDA 4ZTYA 1A5BA 3UEQA 4QLKA 1XUUA 2QHAA 3QQ0A 5CPMA 1QO2A 5HMEA 3IUHA 4ERIA 4R5EA 4IJBA 3QR0A 1EOMA 3K4WA 2GDUA 3O6DA 4IM4A 1GW9A 3MP5A 3AYVA 1EF2A 1XCWA 2FVLA 2NV9A 4P8VA 3ME3A 3QY6A 4LF2A 3GDTA 2HE5A 1W37A 3BLIA 5BZAA 3NR0A 2XIMA 1K03A 2ZZ5A 5AYIA 3STCA 1ECQA 1IEXA 2FPVA 1UKOA 1GORA 3ZJ6A 3TV8A 2ISSA 5GNYA 4E4UA 1XF0A 2PP1A 4CCEA 2DQWA 3PFRA 4FNUA 3QTPA 4C6BA 1V6YA 2YZRA 3UYCA 4TU1A 5KZDA 1UUOA 1TV8A 3R2GA 4PGLA 4E8DA 5KITA 1SR9A 4IMAA 3OO2A 2VRKA 5GNXA 4IFOA 2WMJA 4IIDA 1CGXA 5I00A 1W9DM 3S9ZA 1W56A 1W5QA 1LG1A 5BU6A 1K6WA 3S5SA 3OLDA 2Y85A 1H0GA 3RJXA 3LI0A 4LRSA 1JZ4A 1A5MC 3Q65A 3QV8A 3TTEA 3PNUA 4JFVA 4GE8A 4I7WA 4JL1A 1ITUA 4ICCX 4ML4A 5DANA 4PUEA 4DXXA 4M19A 2NWRA 4DBDA 1GOOA 4NILA 1HJWA 3W2KA 1PZ0A 4MAZA 2GSJA 1I6NA 3CC1A 4DF1A 1V6WA 2H8XA 1XDLA 2WANA 3BOLA 3GTFA 2ONEA 4GISA 1OD0A 4LNCA 4BCEA 3DFTA 2R1KA 5CAKA 3PSWA 2PRLA 1W6TA 1OFAA 2YYTA 1ZS2A 4RE0A 1XYLA 3L4UA 3C86A 3SURA 4PSPA 3FLUA 3HQPA 4QLJA 3M43A 4G7FA 4EXBA 4KEVA 4KW2A 3A9BA 1XSKA 2OWWA 1SZEA 2ESCA 5EU9A 1VIZA 3SGUA 5HWNA 4RX0A 1BGAA 3VYLA 3D0CA 4E2VA 3TYEA 2WPGA 3Q45A 4K39A 4S2BA 3ALGA 1K7XA 5D30A 2FMNA 3NVTA 4L1XA 4M3PA 3ZSSA 5A94A 5JVLA 2ZDRA 1HGYA 3U57A 4H9UA 3KFTA 4G7EA 2BY0A 3QSRA 4U31A 1QTWA 3CB8A 3QEZA 4M1BA 5HNNA 2QUUA 3CPGA 4ZEPA 4IXXA 3S46A 3GW0A 2Z0IA 4J7RA 2DUAA 3W86A 4C6PA 3AOFA 4QG8A 4JX5A 2WZEA 1NM9A 3RUBL 3N6HA 3DXIA 1CLKA 3B0PA 3R8HA 3W1XA 1TVLA 3VCCA 3K30A 3ARUA 3QZEA 3EX6A 3N34A 2I5QA 4Q8QA 1TTPA 4Q6XA 1BEUA 1YPIA 2BVYA 3MJMA 4ZOCA 1FVPA 2OEKA 1LQAA 3M6YA 4JIQA 2VENA 4FALA 5M1TA 4FA3A 3PM6A 5E0CA 2FZ9A 1EEXA 2CLKA 3SO7A 4ZB5A 1V08A 4IP7A 5F1VA 2CHRA 3WK3A 1C8QA 4R9OA 3EEZA 4XVEA 3CASA 2Z00A 3OVGA 4M51A 4A6GA 3M0HA 3LDVA 3VI2A 2Y8VA 4PL1A 2CWXA 4W87A 3M64A 3EWBX 1IGWA 1A5CA 3P80A 4HT3A 3R0UA 4PTXA 3CHCA 3AJXA 3OVPA 3WN6A 3GNNA 3JRKA 1VLIA 2BNJA 1YDNA 2ZA3A 4MYAA 4QAWA 4PC8A 4DWDA 4JTLA 2QCDB 1RY8A 4CNOA 3CXOA 4AZ7A 3QR1A 2X1RA 2WNQA 1DEDA 3HPAA 1KTNA 4FAMA 2D20A 3DU0A 2X7VA 3UETA 3SSJA 5CC6A 4DWSB 4H8HA 1VBRA 4UTWA 1KRBC 3BVJA 1MW1A 1KV5A 1Y8BA 2Y7DA 2Z6IA 4XD6A 1R8LA 1R0MA 2A4AA 2F6XA 5FL1A 4IL0A 4D2JA 1YPFA 2V5DA 2J75A 7TIMA 1OC5A 1Z8AA 3RMJA 1WP6A 2VDHA 1UP3A 3QFWA 2FKPA 1UWRA 4PN2A 4DUVA 4NKCA 4GZJA 4NZ1A 4XAYA 4YTUA 4DXKA 4W5ZA 4L4OA 5LKYA 5D05A 2CLEA 4Q8WA 1KCLA 2VKZG 2P8BA 4YTTA 2HNEA 3H4XA 1V93A 1R9XA 3FDGA 3DUGA 3FA5A 4YIWA 3H7RA 3WQGA 5JBDA 3IVUA 1VYPX 3LNMA 5JUVA 1OCQA 1ONEA 1VFMA 4A29A 3WX7A 2VFDA 2QW5A 1TPH1 4JTSA 1O12A 3GE7A 4B5UA 1FDYA 3BICA 3EB2A 5IBXC 4F2BA 2ZZ3A 3APYA 4D6EA 2BOEX 4C7FA 3G3MA 1HFBA 4GH1A 4DM1A 4XZWA 4MM1A 3H7UA 4GUFA 4EP8C 1OFEA 3HPXA 2VJXA 2VEMA 3SCNA 4QCEA 1WZLA 4LNYA 3UXKA 5CCZA 3I7SA 3E0IA 4GG9A 1PIFA 5H8PA 1HZYA 3OBAA 2WNNA 4PFMA 4J2MA 2CESA 5I2UA 1CCWB 1Z9AA 2FTPA 3EOOA 1N8IA 1TPDA 3QC0A 1ZALA 3HGRA 3EWUA 4AZBA 3P82A 4INFA 4F0RA 3R11A 4NQ1A 2ZX6A 4V2XA 1E56A 1KGXA 2R1MA 1XS2A 3C0JA 2WVVB 4X9YA 3V0UA 3WELA 3VTRA 1RJRA 2XVPA 4JN7A 2PPGA 1HIZA 5CJMA 1J5TA 3FN9A 5HWMA 2Y88A 4LEQA 4NZCA 3WH6A 3OLIA 3VOHA 3S1VA 1TELA 3Q37A 4KGJA 3UZ5A 1JUEA 4CEXC 3L7RA 3W7IA 3SY8A 2OLHA 3JZUA 3I6EA 4FOJA 4MZYA 5DY2A 2FZDA 3KXQA 1GUVA 2A79A 1PYMA 4WJEA 3V35A 2WHJA 1MNSA 1Y7VA 1FWEC 3OHMB 3WLIA 3WQDA 2I16A 4MJZA 2BLEA 2DJLA 3N18A 4HU0A 4PL2A 2NW0A 2J7DA 3NDZA 5FESA 2B4GA 3PZTA 1E40A 5BMXA 1YPXA 2ZRYA 3GAKA 4ZOBA 1GOIA 4LY8A 1WO2A 4CNUA 5K4XA 3UWZA 5CBBA 1AMKA 3MS8A 4DHGA 5B7ZA 1OCNA 1AA1B 3NGJA 4GQGA 3T0AA 1JIBA 4JIEA 4LXFA 3KEHA 2YBVA 4NAFA 1V6VA 4JCLA 4H01A 4D72A 3WF2A 4AAJA 5DLCA 4ZTXA 4GIEA 3WFAA 1GG1A 1QI2A 3T7VA 3RX2A 1TSIA 5LGZA 3W74A 4KBXA 2OU4A 4GPNA 3OGRA 4ASTA 4HA3A 1QOQA 1TQXA 4TR9A 2ZRZA 4X0NA 3KBVA 1AZ2A 3SQMA 3MMTA 4HYVA 4ZO8A 3NUKA 5C6MA 2DVTA 4JIIX 5KZMA 1MO0A 3IIOA 4DJDD 1XCFA 1OY0A 2OLAA 3PWAA 4KCVA 4Y90A 3L4TA 1ZB5A 3WQCA 2FGBA 3NG3A 5AHEA 3G1FA 3TTSA 3UR8A 5EB8A 1PSCA 5IOBA 2BB0A 4WEVX 5FACA 3BV4A 3QHOA 4PYSA 2X42A 1W1VA 4PE8A 2PD5A 4Z1BA 1Q2RA 1ITCA 4Z17A 4KGLA 1E0VA 4CD8A 2CHNA 1RLDA 4B5WA 3IJ7A 1Z7AA 4K38A 4QP0A 1PKYA 3CZGA 1DHPA 3M0LA 2PWFA 3RNDA 5CPLA 4BQ3A 1F3TA 1QMLA 2WM0A 4DBWA 3HB9A 1L8PA 4LS2A 4AD3A 1HX0A 1H51A 2O4MA 1KFKA 2Z2AA 2D2JA 5DT5A 2D24A 4GVIA 2CFFA 1JAEA 4GIRA 2WC3A 2ZFAA 4MNLA 1JDAA 1ISVA 1J12A 1EO5A 2ZXQA 4QJ1A 5AVHA 4O4WA 3PBWA 3OIXA 4OV9A 1KRCC 4MB1A 1Q6LA 1ZTVA 1WQ5A 1BVWA 1PIIA 5H91A 2Q3RA 1IEWA 3E2RA 5DX7A 5A6BD 1UYQA 2RGLA 2PURA 2YFNA 2E1WA 4OBTA 2DGAA 3GVGA 4FIRA 3CBWA 2EAWA 4ZOAA 1KV8A 1LYXA 3F2BA 3HOJA 1DWAM 2D3NA 1CGYA 3B03A 3HQOA 5HJXA 4D6HA 3VCNA 2PZ0A 1QHPA 2J7HA 2QUMA 3H2EA 1UB3A 4K36A 3VNZA 5I3DA 4Q4OA 2O9RA 2W3ZA 1B31A 1KBIA 4P8UA 4HOXA 4AD4A 5I07A 1E1CA 4M0XA 4H2HA 2OZ8A 2F6UA 3B40A 3TYCA 3QKZA 4F9JA 5A6LA 4RV8A 3TMLA 3WK0A 4DN1A 4D1IA 4RE3A 1FWBC 4QE4A 3M5VA 3EKLA 2XZ7A 3E2VA 1XGDA 1EQPA 2D22A 1F9CA 4XKYB 1FP8A 2WWCA 2NQJA 3RU6A 1UH4A 1XYCA 1I45A 1X6LA 4D8AA 4XIMA 4UIOA 3UZJA 2HISA 3H12A 3T0TA 3LUTA 5E70A 1SFJA 3TA6A 3QW4B 2CLMA 3WLPA 5DMNA 4JGDA 2FGLA 3RRAA 3IACA 1GZGA 4LTSA 4FI4A 5B80A 3UVIA 5D04C 5J5DA 3WBYA 1A3WA 6XIAA 4RLIA 4QS5A 2UY4A 2YJQA 2HVOA 3NQDA 1BYDA 1VH7A 2E8ZA 4LRTA 5I06A 4DRSA 1GQKA 3L0KA 1M03A 3NQ8A 5CGMA 5AZ0A 1A80A 4Z42C 2J27A 3PZUA 1H1NA 4M8UA 3ANVA 3NEVA 3OP2A 2BFGA 1KQZA 2DP3A 3SCPA 4ATDA 5K4ZA 4ZR8A 2FVKA 2PDIA 1PDZA 3ITLA 3WF3A 3G1HA 3ABSA 5L6UA 2GVLA 1ONRA 3TKFA 3VIHA 3GB6A 3IEBA 1JFHA 3GH7A 3IS4A 1DIOA 3T4CA 1LROA 1U33A 3GG8A 3TTQA 3S1WA 4KFPA 4B15A 3TJXA 2Y63A 4UXDA 3CTTA 4O50A 3CWHA 3KRBA 2PB1A 2WMGA 3VZXA 2X16A 2NV2A 1AL7A 4HMDA 1Q7QA 4TX8A 1TR1A 1VPYA 2YGYA 2HTMA 2QS8A 3QYQA 3MUXA 4J1OA 2YR1A 1FCUA 4KCTA 1K1DA 4AC1X 4P7LA 3GW3A 2J79A 2XVKA 1O95A 3MI6A 2ZKMX 4LYKA 3USZA 2IW0A 3PJTA 3MHGA 5AC6A 4WF7A 1XSJA 3UZZA 6XIMA 2R1NA 3WNPA 1XC4A 3GKFA 2UBPC 5ABTA 1VCFA 3QZAA 1EJTC 2W62A 3TR9A 3DAQA 1OK6A 3NOYA 4X63A 3NQ6A 3SBFA 1ELSA 2HNHA 4IH3A 2QPXA 1BXCA 3H23A 1KFEA 2A6LA 2EKCA 2J6XA 1W3JA 2WLZA 1BHGA 3DHDA 1CGVA 1U5VA 1IXNA 3E38A 1J01A 4M80A 4RNIA 4KEUA 2Z1XA 4C90A 3RHGA 1XIFA 1FWAC 4IQEA 2G4JA 3CHVA 4KRZA 3TC6A 3LHUA 1NAL1 4J3WA 3O9NA 3IIPA 4DNMA 1U5JA 3CEUA 2C79A 2H8ZA 1KFWA 5CSYA 3ARZA 5JQ9A 1U1HA 3H53A 1U1UA 1VEOA 4HGXA 1J11A 3U5YA 5IRPA 4GNJA 2E67A 4C6QA 4L6DA 2ZRVA 1YNPA 4X9SA 1TTIA 4W8AA 3G0XA 4B5SA 1AJZA 3YPIA 2REQB 1EC7A 3S6TA 2ZUSA 4AIBA 4WSHA 1WCGA 3VMPA 1LT7A 1I1WA 5C70A 1EUAA 3UXIA 3K2GA 3TW9A 4YWIA 4PB4A 3PN8A 3NPVA 3M0IA 4GYFA 4D1JA 2GGJA 4QM1A 1TWZA 3OZYA 1XQKA 2J13A 1R7OA 2E68A 2R1PA 4FX7A 1V6UA 3BO9A 1CW2A 3N13A 4NAEB 1SO4A 1F4AA 1UKPA 4HNOA 1E6ZA 3VDBA 3E0LA 4IIGA 5L9FA 3VNKA 4GH3A 4PUDA 3ABXA 1VCVA 3LBOA 1GKQA 4IMEA 3RLGA 1KM1A 4RPQA 1D7FA 3LCHA 5EMLA 4LAMA 3S2CA 3VCRA 5ABHA 1CLVA 1X8FA 4PCPA 3QLDA 4Q4RA 4CVUA 2PRMA 3C3NA 1E9ZB 3SM0A 2OLSA 1OGBA 4UZSA 4ZO7A 3MUY1 1HL9A 1DWIM 2WQDA 3FOKA 1CENA 2A3HA 2PUZA 1FWIC 1K4HA 1QK2A 3R5EA 4NSBA 3PTKA 3I10A 3OW1A 1NARA 1TQJA 1X1NA 4FLQA 5HWJA 1NFPA 3UY7A 4CU7A 5FEWA 2L5HA 1LQ0A 3DBNA 4UCFA 1D8WA 2Z1SA 2PTWA 3SGZA 4HNNA 5IFTA 4LVGA 2BY3A 5BRPA 1CXIA 4C6CA 2VEKA 4HSHA 3K8KA 3DHPA 1TRDA 2B0MA 4AB4A 2PDYA 4JDYA 2DSWA 3VVGA 3II1A 3BAIA 1XBZA 2HPMA 2J8GA 4R7OA 4GIAA 1AH4A 4P61A 1RR2A 5KSWA 1KLZA 1VC4A 5DCDA 3A22A 4US5D 3T07A 1Q4WA 3T55A 1EWEA 4DWSD 4PRRA 4DVOA 1O1ZA 2QYGA 1GHSA 2CBJA 3W82A 3CIWA 4DLMA 3MV11 3V18A 1C8VA 2EPOA 4OVXA 1I0DA 3GH4A 4G6CA 4FLSA 2P76A 1I2PA 3BG5A 4C6OA 3CMJA 1TPB1 2CC0A 1PX3A 3LXCA 3NO5A 4LUTB 4AXNA 2ALRA 2BX7A 4ICNA 3RM4A 4FNRA 1UR9A 5A95A 3C2YA 2WYSA 1KTCA 4E3TA 5C9RA 2ZUMA 1XPYA 4ML9A 3DIPA 3KVKA 2OMAA 4AFYA 2PWHA 1S3TC 3VPLA 4E6MA 2UWFA 5HXMA 4GZ7A 4RE2A 4DUOA 1NWUA 4D8LA 4B5XA 4L9ZA 5D9OA 2C14A 1TUXA 3VNDA 4D8ZA 1FWSA 2HCVA 2CIPA 2TODA 2NLYA 1CGWA 1MNZA 4NJHA 5CC3A 5DT7A 1M3UA 2POTA 2YL8A 1HQTA 2CEQA 4FF5A 5CGQA 3H21A 1NWTA 3P61A 4Z2KA 4MLJA 3UWEA 2DZVA 1TMLA 4F2TA 5FJOA 1N55A 3E12A 3VKCA 4Z2HA 4JTGA 4KCWA 3VD7A 4J9JA 1EP1A 5E0KA 2YOCA 3CUXA 1P5BA 3CO8A 5MHBA 1R38A 5G1YA 4NG3A 1SW7A 2Z1WA 1ZFJA 1A5SA 3VE9A 3WUBA 4DO5A 3OA3A 3DKJA 3SCQA 5FEPA 3ITTA 2ZXDA 1Q6EA 3NGFA 2OJPA 2C0AA 1I2RA 1X1OA 3OLEA 4ADUA 3I6RA 3I7QA 1Q6CA 1XDJA 2AOSA 2GVYA 2ZICA 1L6WA 3FA3A 2GQ9A 1HTIA 3LHTA 1EBGA 3T2PA 2HS8A 1SUXA 1IEIA 3P74A 3GD6A 3WH5A 2XN1A 1A5KC 3MDWA 3WMLA 1BKSA 3NZQA 1KCXA 3UWVA 5FF0A 3U4FA 3VNJA 1YMYA 3H2MA 2QIWA 2NT1A 3NTYA 1KCKA 2PDJA 3STFA 1RP9A 3U0HA 4IWWA 3UR7A 1G67A 1KM3A 2JKEA 3LSBA 5RUBA 3N2MA 4IL2A 1W3KA 2YCIX 1XW8A 1A3HA 2Y7GA 3N15A 3WQ5A 4H00A 2VELA 1RP8A 4Q4SA 4Q8TA 2IKJA 1KM5A 3C3UA 3RITA 1MQRA 4KWSA 4YCPA 1C93A 3BCJA 4DQWA 1H7NA 4PMZA 2VHLA 4OGZA 4W84A 3CL7A 4JTQA 4TUFA 3T8LA 4UCGA 4H8NA 4F66A 3GZAA 4Z1DA 3IJ8A 3KS6A 2FPTA 3SEPA 2DZUA 3ITCA 1UOZA 2RDXA 5A1AA 4W5UA 4EANA 4HK5A 1P7TB 2HMCA 4BJHA 1JD7A 4Q4MA 3MDUA 4OTKA 1OEPA 2VDGA 3CTLA 2EQDA 2VD8A 2HBVA 3EPMA 2ZZ4A 1LCOA 4K6AA 3RLUA 4O11A 1ZY9A 3S5YA 4O1CA 5EL1A 2BHYA 3QN3A 1TJ2A 2VD9A 2BXZA 1RALA 1LOSA 4RXFA 4Z1CA 4BS0A 1BLIA 1Q6OA 1FY6A 3ZO9A 5DMYA 3ITXA 2YB1A 3RPDA 3U3HA 2Y24A 3M6DA 4GZEA 3TYUA 3DCPA 3TAOA 3S0CA 5D9PA 3T0CA 2QVHA 3WF1A 1PUDA 4BQ2A 4IOTA 4V1XA 1QXLA 4GYJA 1HNYA 3QGKC 2PU0A 1VBGA 4MSSA 1OM0A 5K2ZA 1IR2A 5EMJA 4Q4QA 3JR2A 4Y9PA 1NU5A 1TRIA 3BPWA 4H9ZA 3FSTA 4IJCA 1ZSXA 1DJIA 3DFYA 3MKKA 4HP5A 4HA1A 3TN3A 1F4HA 1H2JA 1IT7A 4AD5A 3FEMA 3KDNA 3VIOA 1EX1A 2YFOA 3LYEA 4UR9A 2R82A 1PEZA 3GNXA 2BBFA 4D6CA 3LCXA 3EXSA 4NT0A 1ME8A 2AMXA 4JL2A 3N4AA 4BY3A 1SMDA 2PDWA 3T42A 3TWAA 2Z2BA 1ZCOA 3A13A 4K7VA 4UQ9A 1EQCA 1XDMA 4EPKA 5AZ1A 2DT0A 2W91A 1OT2A 3LLDA 4OOUA 1TV2A 1VHCA 3PSVA 4XQ6A 3H54A 3L4XA 1EWDA 3S5ZA 4QDWA 1WYIA 1YRRA 1RCQA 3F2CA 3RIKA 3LCIA 2FHFA 1PCKA 3BW3A 3VZYA 4OWGA 4G7EB 3DOPA 3AYTA 3OG2A 4JAWA 1E71M 5JIPA 2Y7EA 1ADOA 1BTCA 1KFJA 1LORA 3IARA 2A7PA 1TWSA 3GSMA 5G1TA 3E2QA 1EGVA 3NM1A 3PK7A 3MBFA 3H6OA 5I6SA 4OUIA 3B9OA 4QSHA 5CH9A 5I3FA 2D23A 1PPIA 4LGXA 3IRSA 1D3HA 2Q71A 3LBMA 2DT2A 3UF9A 3ECQA 3CZ8A 1Q65A 4TO8A 1QNQA 2PWUA 3LTYA 4JS3A 3W81A 4LUSA 2GGEA 2XSBA 3KZPA 2ZC1A 2EJ1A 2VFFA 4IGNA 2Y8UA 4CN4A 2J66A 4LAKA 1P1XA 1C7TA 3S9IA 4IQLA 4MFEA 1E3ZA 3WLQA 1FKXA 3UA3A 3MSYA 3O06A 2A2IA 4HN4A 1S5NA 1WDPA 3ITVA 1KKOA 1XWYA 3GHTA 2XSXA 2ZADA 2FZMA 5CZKA 4AEOA 1JDCA 1TMHA 2XZ9A 3ZM8A 1BSIA 1HN1A 5JH2A 1P6BA 4CEUC 1ZRQA 4Z2LA 1F6KA 4WJ8A 3C4UA 2VC5A 3Q4DA 4PTVA 1ADDA 3PBUA 3IIXA 4REQB 4I9JA 5HULA 4JTRA 4AQLA 1XIHA 3GHUA 1CXEA 3NPXA 4KERA 1E1EA 4W89A 1YE4A 1QNRA 1U22A 4D9PA 5D9NA 3OB8A 4DJED 4WY0F 4EACA 3MMUA 1E43A 1E70M 1WXZA 1JF5A 4W7VA 3UWYA 1HJXA 3WLNA 5CLWA 1ZP4A 2YDQA 3BMWA 6REQA 2PLCA 3MZNA 2DQXA 2E6DA 4HCLA 1HJSA 3PANA 4IQDA 4H7CA 3DESA