3ZWTA

Structure of human dihydroorotate dehydrogenase with a bound inhibitor
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
356
structure length
353
Chain Sequence
HLMPTLQGLLDPESAHRLAVRFTSLGLLRFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE (QUINONE), MITOCHONDRIAL
publication title Factors Influencing the Specificity of Inhibitor Binding to the Human and Malaria Parasite Dihydroorotate Dehydrogenases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 134
structure length 353
sequence length 356
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2011-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3zwtA00
1LROA 1TTIA 3EX6A 3BG9A 4R33A 1LDCA 3LRLA 1MZHA 3B0VC 2Y62A 3O1NA 4TU1A 3NQ8A 1OFQA 3P67A 4ADTA 3DKLA 1K02A 2FIQA 4UTWA 4ORMA 1XBVA 4NXSA 1NEYA 4X3ZA 5AHIA 5D38A 2QCLA 2VC6A 1KA9F 4LW7A 3T44A 4WY0A 1GVRA 3NXFA 3HJZA 4RZ5A 2HS6A 1OYAA 5LGZA 4PL1A 3ABSA 2A5HA 4HNTA 3QMSA 1M5WA 2E09A 3DAQA 5LKYA 1VRDA 1SO3A 3L9CA 4QAIA 1KFCA 1LRTA 1KTBA 4N6FA 1LBLA 1H7NA 2E1DA 4GWEA 3N34A 1VC4A 3P62A 4O4VA 5D33A 3QW4B 4OQVA 5CZTA 1JCJA 1KM5A 3NQ7A 1L2UA 1XUUA 2QJHA 2Y7FA 4JNMA 5KZMA 4EVZA 1ALDA 3LTSA 2I14A 3PY2A 2CLHA 3TSDA 1RQBA 2DZTA 5HR6A 3NA8A 3W7CA 4NJIA 3W84A 3IIOA 5A8GA 1RZMA 1OX5A 1Z42A 1T96A 4MYXA 3TC7A 2EKCA 4ALDA 4HNUA 1ZAIA 2Y88A 1LLWA 4A3UA 2A21A 3W7EA 4DF2A 3DFSA 3UWYA 4K39A 2G96A 3GZ3A 4UFIA 5D37A 3L2IA 1OX4A 5AC7A 5T26A 2CZDA 4DELA 4N02A 3NL6A 4H3DA 4LTSA 3W88A 3U6WA 4BI5A 3PS7A 3ABQA 4E38A 4MLRA 5DN1A 1T8XA 1OFRA 5FF4A 3T55A 4PC8A 3EWBX 4NT0A 2QCGA 1P5BA 3P8IA 1SSDA 1L6WA 4FF7A 3EX1A 3MBFA 1F73A 3WK3A 4BWLA 2RH9A 1YLVA 3BK0A 4K8EA 2ZTJA 3GNDA 4OV4A 4O50A 2XN2A 3C0JA 2VFDA 3C2FA 2E77A 3LBCA 3LX9A 3IIXA 2YZRA 3KRZA 5F4SA 1XL9A 3O07A 4E2DA 1SW0A 3LCGA 3S8HA 3BO9A 1XI3A 4PFMA 1DBTA 3BLEA 1DVJA 3S1XA 3QZEA 3PUOA 3JRKA 5AHMA 4HNVA 2ZZ3A 4LT9A 5K9CA 3F4WA 1UJPA 4O0ZA 4DO6A 1SFLA 1VLIA 3O06A 2OMAA 5TQLA 3KVJA 1J5TA 5F2GA 3W86A 4QITA 3LCWA 1O4UA 2ZRXA 3M41A 2B7PA 5CZSA 4MVAA 4MFEA 3TXZA 1VQTA 3Q37A 2ZZ5A 1PE1A 4HN4A 1JQVA 4S2BA 3DKJA 1GG1A 3EXRA 3STCA 1QAPA 1QO5A 3LOTA 4ORIA 4JX6A 3LCXA 1EPXA 4PODA 1U83A 3N9SA 3UWVA 5D04C 1SFJA 4P2VA 2W0UA 3FS2A 3M47A 1R2SA 5AC8A 5HWNA 4JDBA 4NVTA 4Y96A 5AYZA 1JUKA 2NXHA 1O5KA 4X9SA 2QUUA 1KBIA 3TV8A 1QPQA 1GOXA 3KRUA 3HG5A 1TJRA 1F6PA 2Y6ZA 1WDWA 4BR1A 3SI9A 3LERA 5J5RA 2Z6JA 4QNWA 1GYLA 1KFLA 4CCEA 1PVNA 2YYUA 3N3MA 1EA0A 4UUIA 5CPOA 5CGQA 1TV8A 5AN7A 1HTIA 3CPRA 2QDHA 1KLYA 2GVLA 3A5VA 3GKAA 3TQ0A 4AHQA 3W7QA 4GJ1A 3NQGA 2VEPA 4ONVA 3IIPA 1EX5A 1S3HA 1RQHA 2DZPA 1U5JA 2TMDA 3LLDA 3UZ5A 3ATYA 3HG3A 1H60A 6TIMA 2ABBA 2YCEA 4Z08A 5G2HA 3STFA 3HPXA 1HG3A 3QMRA 4JD4A 3DHDA 3FYOA 1W3IA 3TNOA 5K4ZA 4MPQA 1OFAA 4LRTA 2ZRUA 5HWMA 3G18A 2C18A 1IGSA 1T99A 2WO5A 4XQ6A 3E96A 4O14A 2BZNA 4JDYA 3E49A 3FYPA 3B4UA 4WXYA 3C61A 2A7NA 1FBAA 3L65A 3PR2A 3RK8A 1YTDA 2OT1A 4JY8A 2NX3A 3TH6A 3W75A 3MYOA 2C3ZA 3LHVA 3MJYA 3LHUA 5D2VA 2B4GA 4PEKA 3PWAA 5AB3A 2IQTA 1F05A 1ZAJA 3A24A 4O13A 4WZHA 3D0CA 4D2JA 4AF0B 3S5OA 3R89A 4N9DA 5C55A 3A21A 1GVSA 1YYAA 1PV8A 1QDSA 3W1UA 4C1LA 8TIMA 3O63A 4N9EA 5C6MA 4UMCA 2WNQA 3UY7A 3W2JA 5CKSA 1JCYA 1FCUA 3N19B 1ONRA 3NZ1A 2DZSA 3RFAA 1ZAHA 1NF7A 5FF2A 4AAJA 2C1HA 4XKYB 3W2UA 4IJBA 4LS0A 4AVFA 5IM51 1R30A 3NGJA 2A6NA 3HGOA 3TQKA 1IXQA 2C19A 2EAWA 2HSAA 3O8AA 3WK2A 6ALDA 4PTNA 1RV8A 1XBYA 4LWWA 1HL2A 2J9XA 5F4WA 4RKAA 1J2WA 4JICA 4LVGA 1EP1A 4HSOA 3RLUA 2NUWA 1G4PA 1S5WA 2YR1A 1S5VA 1A50A 1W37A 3SGZA 4G1KA 4JEQA 1MEIA 1E51A 1JR1A 1CX9A 3ZWSA 3W73A 4NQ1A 5HUOA 2F7FA 1OHLA 3TSMA 3MHUA 1XC4A 2OX1A 2J27A 4HSNA 4R7JA 3GX9A 3MP5A 1SZEA 1KW1A 1QPRA 1FWRA 3A22A 3HGJA 2GQAA 5G2IA 1QR7A 1M7OA 3LHZA 3W2LA 3OHIA 3OEXA 5G2WA 3E0IA 4WOZA 1FDZA 3THAA 4NU7A 2J6XA 3LTPA 2VOMA 3RF9A 3NPVA 3R5EA 4ADUA 4JTFA 1NF0A 4KFPA 2V2DA 4JTIA 3LV5A 1LORA 1UB3A 3VE7A 1EEPA 1X6UA 3TJLA 1MSSA 4M6VA 3IRDA 4PH6A 1JRCA 3G1VA 4N9CA 5K9XA 2YGYA 7TIMA 5CPNA 4KFNA 1XDMA 4O1AA 2I1OA 1JQXA 5C2XA 3I7SA 3P8JA 3W7JA 5FEPA 3U8GA 3VKJA 1JRBA 1XKYA 2QAPA 5HMSA 3LI0A 4DPPA 1B4EA 1OJXA 4O0KA 2X2GA 3W7RA 3NL3A 5LHFA 3SECA 4AWUA 4IX2A 3NNTA 3L0NA 4QJ1A 1B9BA 2VFHA 1KFEA 3FJLA 4IOTA 1VLWA 2VFGA 1LOSA 3T7VA 1IXNA 1O95A 5BNKA 5L6UA 5BOOA 3R12A 4YMZA 1HO1A 3VFLA 3NR0A 2GPTA 3C56A 2Q8LA 3EX3A 3RMJA 3TMLA 4A2RA 3Q94A 2YYTA 2TPSA 1OFPA 1OX6A 2FPYA 4UTKA 4JR5A 1FWNA 2ZZ4A 2FQIA 5CSRA 4KWVA 5AFDA 1PS9A 1IXPA 1YDNA 3C52A 2BX7A 5MHBA 3DXIA 4Q32A 4MIMA 2QR6A 3EX4A 1B4KA 1OVDA 1WOAA 4FNPA 1WV2A 4Q33A 1QFEA 1RVGA 2V8ZA 2Z1BA 3UZJA 4EWND 3P61A 1B57A 3CWOX 3DBPA 1SW3A 2DU2A 1JCMP 3KOFA 3KX6A 2Z2UA 4IXHA 2QKFA 1DJQA 3GK0A 3QW3A 1LBMA 3W7IA 1P0KA 1QPNA 1H7OA 5IBXC 3SSJA 4Q4KA 4O17A 4IUOA 4NNAA 5EY5A 1O5XA 1N7KA 1P1XA 3GDLA 3PUEA 1L6SA 4HIBA 1ZJIA 3BGJA 1DORA 3M0ZA 3QPZA 3CWNA 5AHLA 4HNNA 2Y85A 5HJLA 2Y70A 2QCEA 5D2YA 5H91A 3MMTA 2ATMA 5HR7A 4U28A 2J9ZA 5A5WA 4YCOA 3B0UX 2D73A 1WA3A 4I7VA 3TK7A 4FIQA 4O12A 2Y7EA 1Z41A 1FY6A 4RK8A 2PURA 3PULA 3RNDA 1OFEA 1G67A 3EWXA 3QJAA 3W76A 1TPDA 2X16A 1LTDA 2VENA 4HPXA 3KAOA 3W74A 1GEQA 3LGEA 3G0XA 4A29A 4EOUA 4KFOA 2A4AA 2ISVA 3W7KA 1EIXA 2O7QA 2QJIA 1F74A 1BTMA 4FIRA 3MHGA 1H1ZA 4BI6A 1F6KA 3LHWA 2ZDRA 4O1CA 3GR7A 1NAL1 1PCKA 3BG3A 1KBJA 2V30A 4GUIA 3LXAA 3E9AA 3LRMA 3NL2A 4MZ8A 3S5YA 4JTEA 2A85A 2J9YA 3PG8A 1KFKA 4BK9A 3EKLA 3BLIA 2I9EA 1VPXA 2JK2A 3TJXA 4UCGA 4RXGA 5G1YA 3P7YA 3EWWA 3TROA 4UTTC 3G1AA 3S6DA 2CFFA 2E6AA 4O52A 1K3UA 3DI1A 2GJLA 2QCCA 1SZGA 2Y7GA 3LLFA 2H3BA 3S42A 1FWTA 1W0MA 3H54A 4MJMA 3QQ1A 1T0OA 5E0KA 3GXNA 1KM2A 3LTYA 2KZHA 3I68A 5I3JA 3LRKA 3G1YA 4WX2A 4OWGA 4RZ6A 3JS3A 4MOZA 3TQVA 2B7NA 3MI2A 4AWSA 1XBZA 4UTUA 3NM3A 3HG4A 2C0AA 1GVOA 3DGRA 3CQ0A 1TPC1 3WK0A 5DXYA 3KHJA 3SGUA 3FLUA 2CU0A 3VE9A 5DY2A 1UCWA 3M5VA 4LRSA 2XN1A 3B8DA 5G1TA 4NXKA 3NQDA 3K30A 4BFAA 1BWKA 3IEBA 3C2VA 2ZQ0A 1OYBA 1WQ5A 3V75A 4IPJA 1ZALA 2DZXA 2V82A 2QF7A 4FNRA 1KV8A 1XCFA 4NZFA 3FJ6A 3OIXA 2QDGA 5GVJA 1H7XA 1TPH1 1VCGA 1H7PA 4JX4A 3CB8A 4GNJA 4TMBA 5D2XA 4WD0A 3MP3A 2FB2A 4JTGA 3G1DA 2QCHA 3KVKA 1WX0A 4AHPA 1OF8A 2OZ0A 1K8YA 5K9DA 3CLMA 3ZS4A 3P60A 2JGYA 3SR7A 1I45A 3TFXA 3TKFA 1PL9A 5KZEA 2VFFA 3NEVA 1K7FA 4CNPA 1FXQA 4ZQOA 3B04A 5EYWA 3W1PA 4A2SA 1JVNA 4CQAA 4R53A 1W1ZA 4EF8A 1MXSA 5HUPA 1VCFA 2C15A 3NPWA 4IQLA 3NDOA 2ZZ7A 3W2MA 4XBSA 3USBA 4JYEA 1A53A 3TMQA 3INPA 3GLCA 1KM6A 4IXXA 4MZYA 1YADA 1DV7A 4CCDA 2CLFA 2YX0A 2CZEA 3IVSA 1HFBA 2EGZA 1VGAA 3NPUA 3NPXA 5EA9A 5HULA 3STEA 4O11A 5DCBA 5DELA 2CLEA 3HPSA 1WOBA 1YDOA 3OA3A 1SR9A 4N9BA 3C3NA 4AB4A 1FCQA 3GAYA 1Y0EA 1J4EA 3IV3A 1GQNA 5CZJA 3N9RA 1RR2A 1TMHA 1BKSA 5LNWA 3DENA 2HS8A 3IGSA 1NSJA 4R34A 3HPZA 3WJWA 3DFNA 3C2OA 1PHQA 2ZZ2A 4M7TA 4RX0A 3P5YA 1W54A 5BW6A 1FUYA 5CPMA 1Q45A 3QMTA 4KWWA 5HINA 1OFOA 3FIGA 3WJSA 2C13A 4OHQA 3Q58A 4DQWA 2GVJA 4FB7A 1EB3A 4FHAA 3PC0A 2CLMA 3M1ZA 4ZQNA 3LHTA 1SU5A 2OJPA 2YXGA 2PRLA 3CEPA 1K8ZA 3S0CA 1KM1A 3TAKA 1SPQA 5KITA 4PL2A 2CWNA 1TREA 4IX0A 1R46A 1I2PA 3LCFA 5D05A 1XDLA 3CU2A 3LCIA 1IIHA 5C5YA 4ZQPA 1SZFA 4FX8A 1AW2A 4M5PA 4FNQA 1TCDA 2NXGA 3B05A 4BI7A 4NUWA 5KSWA 1SQ7A 3NO5A 1K03A 1PIIA 4GUGA 1TSIA 2VEKA 4GFSA 1TTJA 2Z0IA 4ML9A 2Y89A 1R2TA 1QNVA 1K8XA 1UASA 3A5FA 5DCDA 5F4XA 1FWSA 1SUXA 4UR8A 4PCFA 3SFKA 1WAUA 2E5DA 1F7BA 1GTHA 5U7SA 3W1MA 1GTEA 1HO4A 4WOQA 2VEIA 1KV5A 3TU9A 3MUXA 3NAVA 3EXSA 3LM7A 1DOSA 4AWTA 3H53A 3W1TA 1G4EA 3IVTA 5AHEA 3PAJA 4B5NA 2VXNA 4JXCA 4YCPA 4IMGA 1QOQA 4W9TA 1DQWA 4X2RA 1TPVA 4JGDA 4LVDA 1V5XA 3TCEA 4JS3A 4HHPA 2XN0A 4CCCA 2CLLA 5AHFA 1VZWA 4UIOA 3NQ6A 4LVAA 3HGSA 4NZJA 4JTSA 4TMCA 1GZGA 2A7PA 2ALDA 4DBEA 2Y7DA 4ADSA 3F03K 1ICSA 2CLOA 3MI6A 3W87A 3LXBA 3WJYA 3LI1A 3CM4A 1XUZA 1R2RA 4DPQA 4UTMA 4ZMGA 2RHGA 3C8FA 3P81A 1OX4B 3M5XA 4MJZA 2NUXA 3L0GA 3NVTA 1X1ZA 3L68A 3NQCA 3NQFA 4UMAA 2R8WA 1AW1A 2WKJA 5H2ZA 3ATZA 2CLKA 1VYRA 2FLIA 2DP3A 5K3VA 1G69A 4N4QA 4LUJA 3M7WA 1WYIA 2J24A 4K38A 5DXXA 3QRHA 1F5ZA 1TYGA 3ABOA 3TIMA 2JBMA 2Q3OA 2ZFAA 4E2BA 1H7WA 3TX9A 5DCEA 4M19A 1C8VA 1EWDA 3QSRA 5FF0A 3LDVA 4OBTA 2WNZA 4HT3A 4GC4A 3WJZA 1JCXA 3W07A 1LOQA 4JY9A 2GOUA 5F1UA 5LHEA 4UMBA 2FPVA 4IMDA 3UWUA 3GDKA 3TW6A 3M43A 4AEOA 1N8FA 1TJPA 1NFBA 3PSWA 4U4MA 3W7HA 1W5NA 1GVQA 3TXVA 4O19A 2NV1A 2C6QA 1MEHA 1VHCA 1I8JA 1XFBA 4LU0A 3T40A 1Q3NA 3ABRA 1I2QA 3FKRA 1FCVA 3HO8A 2QEZA 1OG0A 1GWJA 1GYNA 1OABA 1X1OA 4ZVJA 3GVGA 4GXMA 3NQ2A 3G24A 1TTQA 1AL7A 4UFHA 3W7NA 3G1FA 4Z1BA 2DZWA 2QCNA 2R94A 4JTKA 2H90A 5EPDA 3DFPA 2F84A 3NM1A 3I7RA 5AYYA 5I3KA 1Q6QA 3QPYA 3TUUA 4ZQCA 4WJEA 1W3NA 3W7OA 1X7FA 3MBDA 3QF0A 1BWLA 1TRIA 4LUIA 5CZ0A 5L9FA 2V81A 4MYAA 1AL8A 2A2IA 4O1BA 4IWWA 4FNUA 2ZRYA 3PBUA 5DBUA 3O6CA 1SZNA 1YDVA 2TYSA 3MP4A 1KLZA 4LC6A 2FJKA 3UWQA 5I3FA 1A5AA 4HPJA 4H4IA 3MW7A 1DKWA 4POCA 4RJEA 4N2YA 1Q6OA 4LVFA 2GQ8A 3T4CA 4ZQRA 4QQ3A 5LGXA 4BF9A 1TPWA 1VH7A 4LV9A 1IXOA 2WSQA 3OVPA 3W22A 2NX1A 2DORA 4QM1A 5TBOA 2HMCA 4Y90A 4X22A 1VS1A 1O94A 3BVJA 3SJ3A 1AK5A 4NNBA 5CSSA 4YLWA 1L6YA 4YXGA 4EF9A 3HGRA 2ABAA 2AQWA 4KKXA 4FXSA 1S5TA 3W3OA 4C1KA 1D3GA 1M7PA 1C9DA 2XFWA 3HQ1A 1VYSX 4NJKA 1ZY9A 1DJNA 1Q6LA 3WJXA 3W1XA 3FA5A 5KZDA 4O16A 1AG1O 3HIJA 1AW5A 4O8RA 1GPWA 3TR2A 2RKXA 1TV7A 3I6RA 4JIQA 4ZZ9A 3CTLA 2G5WA 4PA8A 3CT7A 4UXDA 3W7GA 1TV5A 3W83A 2OCZA 1LZOA 5CG7A 5DLCA 1GVFA 5K7JA 3C6CA 3GKFA 4O28A 3OVQA 4XTDA 3W23A 1JCNA 3IVUA 1WXJA 2ZRVA 4NJGA 3Q2DA 1H7RA 3FFSA 3O15A 5U4NA 1FDYA 4DXVA 1R47A 4MKNA 4DO4A 5LNUA 4WXZA 1I4NA 1LM1A 3BW3A 3BLFA 3DZ1A 2CW6A 5IBXA 3UWZA 4LVBA 3HB9A 4IGHA 3E12A 1GG0A 4RXFA 1TPEA 1GJPA 3KFTA 1VJIA 1TRDA 4WQ6A 4UTWC 2WQPA 3IGXA 2C14A 2NX9A 1QWGA 2ZZ6A 4FX6M 4K36A 1P0NA 1G7VA 4AHOA 5J5DA 2A1YA 1QPOA 1BEUA 3MHFA 3MWAA 1X8FA 1JULA 3G1HA 3NL5A 4ICNA 4FEZA 1LOLA 1FDJA 2ATSA 4XBKA 4NJJA 3R8RA 4XZ9A 4M6PA 2QUVA 1FWWA 2NUYA 1RQEA 1OFDA 3DHFA 5FF3A 3P5ZA 2CZFA 2E6FA 3NYZA 4S1FA 5HQEA 2Z6IA 4A21A 3G8EA 2RDTA 4JYFA 4OU1A 1HUVA 4Z0JA 1YXDA 3M6YA 3GNNA 4HKPA 4AF0A 3GR8A 1LYXA 4Z1DA 3BARA 1L9WA 3QH2A 3W1NA 2NZLA 4UNKA 2GJNA 4OV9A 2V5BA 2X1TA 4NX5A 3DU0A 3H55A 1D9EA 3G1XA 5KTLA 3TC6A 2FDSA 5FEWA 1K7XA 3PSVA 4XUGA 3DFQA 3UY8A 4QSHA 3EB2A 3IIVA 4XKYA 5FEZA 2TSYA 3NQMA 3BGGA 1G6CA 4UTTA 1A5BA 4FNTA 3THQA 4CLMA 2JGQA 3ZWTA 4J9JA 3W1AA 3TA6A 3VCRA 5BMWA 5LNRA 5AHNA 5D03A 1RPXA 2H6RA 5G4EA 5F1VA 5LNVA 2QCDB 1IF2A 2DZUA 3EWUA 2V2HA 4LS2A 4Z1AA 3G22A 2QAFA 3GYEA 3HOJA 2WNNA 1H51A 3GDRA 1W5MA 3FEMA 4BWLC 4GBUA 1LRQA 3V1PA 4GUJA 1GT8A 1PCWA 3RU6A 2WV8A 4Y8FA 3W7PA 4JTJA 4ZL1A 1F76A 1W5PA 2A7RA 2ZA3A 5LZLA 3KXQA 3QFEA 2YFNA 4LY8A 4MY9A 3W7MA 2AAMA 1EP3A 4MY1A 3W7LA 3BPWA 3PUDA 3W2KA 3G8RA 3M5ZA 3JR2A 1YTKA 2O7SA 4Z1CA 3EXTA 2BWGA 5KINA 3LHYA 4O10A 3R2GA 4FNSA 1JUEA 5ABTA 1QCWA 5I3HA 4LV4A 2NLIA 5AOUA 3ZFHA 2WSYA 2OT0A 5FEXA 4K37A 4UR7A 3N73A 2ISWA 3DFTA 4MFDA 1ZHAA 2FFCA 1SO5A 1TPUA 3KVLA 3LCLA 4CNNA 3TE9A 3GAKA 5AYXA 2ZRZA 4O4WA 5BMXA 4IPIA 3L5MA 1D3HA 3F4NA 1YPFA 3W72A 5F2IA 3OBKA 3G3MA 3PB2A 4UTIA 1V7YA 1W5OA 3M44A 1RD5A 3QQ0A 4O54A 2A0NA 1ZCOA 3W85A 1W31A 2E6DA 3PB0A 3G3DA 3PBVA 3L67A 4UTHA 2PC4A 3GIYA 4FX7A 3IIZA 2VEMA 2DZVA 4RV8A 4LC8A 4NJHA 4LOCA 1KFBA 1ADOA 3SZ8A 3W1LA 1JCLA 3DH7A 4TIMA 3R13A 3LCHA 4UNLA 1K7EA 3O16A 3S1VA 3UNDA 3UWWA 1TTPA 4DF0A 2YDAA 3BW2A 3BV4A 3CIXA 3M9YA 4I7UA 5LNSA 3LV6A 2YFOA 2FB3A 3VNDA 1A5CA 3W70A 1H5YA 1OK6A 1FCBA 3I7QA 4IMCA 1TPB1 3NG3A 4MUZA 4Y9AA 4CNOA 3L66A 4M7SA 4H6KA 1SW7A 2X1SA 1N55A 2E5BA 4DEFA 4DO5A 2EHHA 5TIMA 1A5SA 3B06A 3QC3A 4WY0F 4JX5A 4P61A 5FI8A 2FTPA 3TFCA 1DQXA 1UBSA 2TRSA 2V5LA 3G0SA 4GE8A 1TQJA 3C2RA 5HWJA 2Q3RA 1VCVA 3KVMA 1OYCA 5D2WA 2E6YA 2B7QA 1KM4A 3EEGA 4JTUA 5FF7A 1EWEA 1ICPA 4YL2A 1ME9A 1UUOA 1LLZA 4XTIA 3S1WA 1THFD 5I3GA 3I65A 1W8SA 3UXAA 1OF6A 1KTNA 4A22A 3WFAA 2NWRA 3EWZA 5F2LA 1ZENA 1H63A 3N2XA 1TPFA 2V0TA 4AXKA 4UFLA 2B0MA 3G0UA 5CPLA 1KFJA 1CI1A 3PBYA 1LCOA 1QMLA 3SY5A 3FKKA 4MZ1A 1EP2A 4S2CA 1B3OA 1WBJA 4MLJA 5EL1A 5BRBA 3HG2A 3L21A 3CC1A 5EBUA 2Y61A 3AJXA 4I9AA 3QSTA 1VYPX 3BW4A 4WY0B 1TB3A 1H62A 3M5YA 3GDTA 1W5QA 3UPWA 4K7YA 4O1DA 3QEZA 1KM0A 5EKYA 1TQXA 3TSBA 1I2OA 1H1YA 3W2NA 1Q6RA 3PVFA 3W9ZA 1G7UA 2YW3A 2DJXA 4O18A 5I3IA 2ZTKA 2Q8ZA 3HF3A 2DJLA 1DL3A 3N2MA 3EWYA 4UFKA 2W6RA 4GRSA 4JTTA 3S9YA 2H8XA 3NZRA 2RFGA 2B7OA 1QOPA 3W71A 1ZNNA 4MY8A 3G1SA 4ZQMA 4WUIA 3NQEA 2RDUA 1SO6A 4JTHA 3ELFA 1I2RA 3WK1A 5DBTA 1XBXA 4YWIA 2YSWA 2X1UA 3U2OA 3OG3A 1LBFA 4Y6GA 3EX2A 4LS1A 1XM3A 2GUUA 1W56A 5D32A 2Y63A 5G4WA 2WOQA 2VFEA 2CLIA 4RZ4A 5E1QA 3P80A 4Z0SA 3UD6A 4CQ9A 3PF3A 1ZFJA 3VI2A 3L5LA 1SSGA 3LBMA 2JKPA 5C54A 5F2MA 1XXXA 3L0KA 4K7VA 3A23A 3STGA 5K2ZA 2A6LA 1CW2A 5DY3A 2VKZG 2ZRWA 4TR9A 2BXVA 1YXYA 2BTMA 1G4SA 2ZYFA 4N6EA 2V9DA 4FXRA 1EUNA 5K4XA 4JIPA 3PM6A 4JTLA 5D09A 1YPIA 2PE4A 5SWUA 2ZZ1A 4TX9A 5D2TA 4UTJA 4QISA 4QNEA 3RLVA 3S1UA 2WPBA 2UV8G 3W6YA 2AGKA 2QCDA 4XWUA 3GXPA 1Z44A 1WBHA 5EMUA 1H50A 1VR6A 1FQ0A 3W7DA 2ISSA 2QCFA 4O15A 4OE7A 3S5ZA 1QO2A 1PHWA 2GQ9A 4EIVA 1C29A 2G95A 1P4CA 2PCQA 3CEUA 3L5AA 4O57A 2HTMA 2BLEA 2R91A 2V2CA 3O05A 4OT7A 1W3TA 2C16A 3F1QA 1ME7A 5LSMA 4K6AA 4AH7A 2P0OA 1YXCA 1SO4A 2E68A 2ZA1A 3EKZA 4FO4A 1F2JA 2PRHA 4AMAA 3TDFA 2YPIA 4RR4A 1H61A 2EF9A 4JN6A 4GUFA 2QUTA 3MYPA 2X30A 2WJZA 2H8ZA 2G97A 3YPIA 3E02A 2EPHA 4DF1A 2ZBTA 1DHPA 3IGUA 2R14A 3SW6A 2NV2A 2E5CA 2JKAA 2RDWA 3UPBA 2VELA 2ZCGA 3PG9A 2FPTA 4OGZA 3S5NA 2J88A 2NXIA 3UYCA 5G5IA 5E93A 2WSRA 4L4LA 2LLEA 3CHVA 4L4MA 3C2EA 4UTLA 2W79A 3P84A 1MEWA 1ML1A 4I7WA 1ICQA 2GVGA 3BG5A 1Z48A 2CZ5A 1JUBA 3MI3A 3ANYA 3W1QA 3ZR4A 3NQAA 4M6QA 3OVRA 1NVMA 2BSLA 3DI0A 1M6JA 4UC5A 1G4TA 1UUMA 4GUHA 2JKEA 3GDMA 1ME8A 1OK4A 4RCXA 2VFIA 3W1RA 3SIZA 3P74A 3PBWA 4NX0A 4QIUA 3QYQA 3UQNA 3M16A 4RLIA 3UXDA 2X1RA 2QJGA 2ZA2A 3TW7A 4O53A 3HMJG 3N14A 4IMEA 1MO0A 1OFBA 4DBDA 1VHNA 4UFMA 4TO8A 1LP6A 3NQVA 3QM3A 2P10A 3LXCA 1AMKA 3DFOA 4CQ8A 3GXTA 1JJKA 2NWSA 2PRMA 3FOKA 3A9IA 1TIMA 1FXPA 3P82A 4N4PA 2QCMA 3O6DA 5KMYA 1EUAA 3TAOA 2YW4A 3CIWA 2H3DA 3MO7A 1IIGA 3KRSA 5AC6A 5D30A 1KM3A 3T78A 4K8HA 3B0PA 4JYDA 4NNCA 3C4UA 3NOEA 1TO3A 5FESA 4UFJA 5D02A 4LNYA 1YTEA 1I2NA 5HNRA 3HBLA 1O60A 1FX6A 1KTCA 3GB6A 4IMFA 3O6YX 1LRNA 3B03A 3LB0A 2P1FA 3AO0A 4E0CA
chains in the Genus database with same CATH superfamily
3LQGA 2W4XA 1TTIA 2DSUA 3FJNA 3EX6A 1EJVC 4Z2KA 3B0VC 2B81A 2VYOA 3O1NA 4IIHA 1EX1A 3H2FA 2PDUA 1R3SA 1XBVA 2EPNA 5KEZA 4JTDA 2PF8A 6CGTA 4K8GA 2AGTA 3GG0A 2JF7A 2CITA 3ITCA 4ZA0A 3UCCA 2HS6A 1U1UA 2ZXQA 4O1EA 1KGXA 3WLNA 1NELA 4JIEA 1KFCA 2GDVA 1LRTA 4AY8A 1KTBA 4XO7A 3N34A 2EG8A 3UPMA 4QDPA 4DBSA 3NQ7A 4UQEA 1V6WA 1XUUA 3GUWA 5FAJA 5A6KA 1XIMA 2DW7A 5E6YA 4AFYA 3TSDA 3F4DA 1UR2A 3CHDA 3CAKA 3NA8A 3OZYA 2NQ9A 2W67A 1NWUA 4UR9A 1QWKA 1QNSA 1W1TA 1T96A 3TC7A 2EKCA 4HNUA 2Y88A 1UWUA 2A21A 3GZ3A 3OGSA 4UFIA 1OX4A 1L8NA 4AD4A 4LTSA 3W88A 3U6WA 2WMGA 3BDKA 2YLAA 1JYXA 4E38A 4I6KA 4IQEA 4MLRA 1EF2A 1KRBC 2VRKA 4DM2A 4MNMA 4URIA 3RRXA 4PC8A 3EWBX 4NT0A 1EGVA 3P8IA 1SSDA 5H8UA 4FF7A 3EX1A 1P6BA 1IQ8A 1NQ6A 2RH9A 3H8AA 3ABZA 3RYSA 3TZNA 3L2MA 2PD5A 1MZRA 2WWCA 4HZ7A 4BCEA 1XL9A 1NWSA 4PUUA 3RPTA 1UPMB 2HWGA 5C9WA 1XG4A 5AHMA 3PUOA 4JBRA 1UR9A 2F2HA 3F4WA 1UJPA 3MC5A 3P2VA 4KS0A 3WH6A 3T8QA 4ILSA 2Y2WA 4BEQA 4DO6A 3I3EA 4V1YA 1ITXA 4KQNA 4US5D 2WLYA 3GY1A 2QF8A 3OQ8A 4QITA 2WWDA 5JBEA 1SJCA 1Z9AA 5CZSA 1RHCA 1BVNP 3WIJA 2WB5A 4GKLA 1PE1A 4ZO6A 4LYPA 5CPTA 3DKJA 3EXRA 4J40A 4H6QA 5XIMA 1O7AA 3S6OA 4YIWA 3TWAA 5CG0A 2G41A 3RDKA 2PZNA 7CGTA 5PTDA 1QVBA 2JE8A 1RA5A 4Q6XA 1R2SA 5HWNA 2BBFA 2VO5A 3VYLA 1JUKA 2NXHA 4U3CA 1O5KA 2QUUA 1KBIA 4WR3A 2WAGA 4D8AA 4RNJA 3NVDA 2VDHA 4PUWA 5J5RA 3EMQA 3HJEA 4GX8A 3S9IA 1KFLA 3WL1A 4CCEA 2PDNA 3CUGA 4ZO9A 9XIAA 1IEWA 4QJ4B 3IJ8A 4XUYA 2WHMA 3A5VA 3W7QA 2VEPA 3FSTA 1KXQA 1VJZA 1KCLA 1RQHA 1U5JA 2TMDA 2VR5A 2PDPA 1FWCC 4Z08A 3HPXA 1HG3A 4JD4A 4HA3A 4DWSC 1W3IA 2PCEA 1TX2A 1MXGA 2HISA 2C18A 3AXIA 1L8PA 1T99A 1YPXA 2BZNA 4DAIA 4ASTA 1DEDA 3E49A 3E2SA 3FYPA 3TYBA 4QSFA 1BRLA 4WXYA 4J3TA 1WUFA 4S3AA 2A7NA 3L65A 3A4AA 1HGWA 2A3AA 4JHMA 3TQPA 2REQA 1IV8A 1R5YA 1YTDA 2OT1A 4JY8A 3W75A 5BXSA 1DWFM 2C3ZA 2ZX8A 3FX4A 3LHVA 3MJYA 4R27A 4TVUA 5A8NA 2PWGA 1BYDA 4I5UA 2IQTA 5I03A 1E1EA 2X05A 1F05A 4KCWA 4R7OA 3FAWA 4WZHA 4D2JA 1B3YA 4K1WA 4G1NA 3WL0A 3QZ6A 3DX5A 1XLJA 3O63A 5CXPA 3PZMA 1FCUA 1BG4A 4DAFA 1Z6KA 1JPDX 2ZUUA 5JIPA 1NF7A 1FKWA 3PPFA 3FW6A 1XLKA 1R30A 2WC3A 2A6NA 1TZ9A 3WD0A 1D7KA 3ITOA 2EAWA 4GKTA 1WO2A 3KHDA 4AIEA 4PTNA 2AL1A 4PMQA 4LWWA 2CKSA 3R58A 4PUNA 2J9XA 6REQB 5HOSA 3EOEA 1EC8A 2G3IA 4HSOA 1S5WA 1W37A 5AYBA 3N15A 1CX9A 3MUAA 4IIFA 4QG8A 1FH8A 1OHLA 3MHUA 2HPMA 4AC1X 1RXOB 5A69A 2OWWA 3GX9A 3MP5A 1SZEA 2W61A 4GQ0A 2E7FA 4S3CA 3A22A 3CWHA 3VGHA 3HGJA 2X1IA 1HJSA 1M7OA 3CXOA 4KRZA 4HB7A 1FH9A 4JNZA 3THAA 1O1HA 1A47A 3S46A 1XYAA 1LT7A 1SZRA 3N17A 3EOLA 3TR9A 3NPVA 2YZ5A 2WMKA 3WQEA 4W7WA 3BL3A 2V2DA 3B9DA 3VE7A 3AHTA 1MSSA 2ISFA 1XSJA 3FYYA 3N6HA 3MVIA 4B2DD 1FHUA 2D69A 4LUYA 4PH6A 2IKHA 3VNIA 2YGYA 7TIMA 1XDMA 4KRTA 1JQXA 5C2XA 5LXEA 4L4PA 4AISA 4BJHA 1XKYA 5HMSA 4GY1A 1M04A 2VGGA 3GIPA 4O0KA 1A5LC 2NVAA 2NLYA 2X42A 4IX2A 2HCVA 1HNYA 1X39A 4QJ1A 4DXXA 3BC9A 1B9BA 4Y9PA 3CZKA 3WZ0E 1EDGA 3T7VA 1IXNA 1XC6A 5BOOA 1EQPA 4S3KA 3TYUA 1HO1A 1H2JA 4I8DA 3NR0A 1NOFA 3MCOA 3UG3A 4MM1A 1DJWA 3UR2A 4A2RA 2YYTA 3SUTA 3F2CA 4Q22A 4AZHA 1OFPA 1UD4A 4DHGA 4H83A 3VX1A 3GW3A 1JG9A 4L9XA 1FWNA 2O9PA 2ZZ4A 2YCLB 4KWUA 4X2PA 2DUXA 3C52A 3PPHA 2QR6A 1U1JA 4NSBA 1B4KA 1VEMA 1WV2A 4OZOA 3VNLA 1RVGA 3VXGA 4NI8A 1EZ2A 1MW0A 3RM4A 1SW3A 3GH5A 2YL9A 3DYMA 1V7AA 3KOFA 3VOHA 4PCTA 4D6JA 1DJQA 3RM9A 1IYXA 3QW3A 4WEVX 2D20A 2FGZA 1V03A 4QE4A 1XH0A 3VK5A 3SSJA 3T0AA 4O17A 4IUOA 1O5XA 1EDTA 1C8XA 3EOSA 2IPGA 4Q4MA 3CK5A 3VOIA 3PUEA 3N4EA 1BWVA 3EAUA 5FJIA 3WD2A 4HNNA 2Y70A 1XLEA 2VTFA 2IS7A 4B3KA 1JDFA 1WA3A 4I7VA 3TK7A 1FY6A 2PGWA 2R24A 3NTYA 5TNVA 2ZC8A 1G67A 4J3WA 3MZ2A 2Y8UA 4EPEC 2VC5A 4LANA 4XAPA 4EPBC 3PJUA 3W74A 2G4JA 3LGEA 2O9TA 1IWAA 2Z7GA 1TWDA 4AY1A 1A0DA 2A4AA 2ISVA 1EIXA 2O7QA 2QJIA 4FIRA 4KMQA 2PBGA 4ATLA 4Z2HA 1F6KA 1KBJA 2OEKA 3LA4A 3NL2A 4YWSA 3PG8A 3V7PA 3KS5A 3RU8X 4DM1A 2JK2A 3TJXA 1MFUA 4UCGA 1VBHA 4UTTC 2CC0A 2E6AA 4B5VA 2QCCA 2WXDM 3TA9A 2Y7GA 3S42A 3BJTA 3H4XA 1W0MA 3T0CA 1PX8A 5E0KA 3RRAA 8RUCA 3KTSA 3LTYA 2DZAA 2KZHA 2D2HA 3I68A 5I3JA 1N82A 3G1YA 7PTDA 1E9IA 1NH6A 4OWGA 2FZBA 3JS3A 4MOZA 3MI2A 3OLIA 1LT8A 4UTUA 3PZOA 4DUWA 7ENLA 2VX4A 6REQA 1GVOA 3CQ0A 3R11A 4MJ2A 5DXYA 4B5WA 1E15A 4LRSA 2XN1A 1JNEA 4NXKA 3THUA 1ZBVA 3GG1A 4S38A 1O12A 2VGIA 3IEBA 3DC0A 4BF7A 3UZYA 1ZALA 1BLIA 1KCKA 1XCFA 2WM1A 2FHBA 5LA2A 4PMXA 1VCGA 4IJRA 4GNJA 1P43A 3MANA 4L4OA 4HU3A 3G1DA 2J77A 4WKFA 3EA1A 4NASA 3ZS4A 5KZEA 1K7FA 4CNPA 3BZJA 3PJTA 5EFDA 3W02A 3NSMA 2WMJA 4IQLA 2GSJA 2ZZ7A 3CZEA 4JHOA 4JYEA 1KM6A 4IP7A 4MZYA 1YADA 1DV7A 4GHRA 4CCDA 1UD8A 2IQ0A 1XLCA 1X96A 2CESA 3IVSA 2DW6A 1VGAA 2GL5A 3MWCA 5HULA 2P53A 4A05A 2J7BA 3STEA 1WKYA 1P7TB 2XISA 2CLEA 1LQ2A 1YDOA 2BY1A 3OA3A 5A6BA 1W3JA 2ZE0A 2BY0A 4NIRA 3U3HA 3C3NA 3GAYA 3ZM8A 3N9RA 1RR2A 3F4VA 3HU7A 2HS8A 4XIAA 3H22A 1E0XA 4OVXA 3WJWA 4YTSA 2WKGA 5IXEA 3DFNA 5GJMA 2J7EA 3C2OA 2E8YA 1E5JA 4FPSA 2ZZ2A 4M7TA 1WKEA 4RX0A 3GXIA 5CPMA 1Q45A 4O8AA 3QMTA 1OFOA 3FIGA 2GVYA 2C13A 2ZXBA 4XZMX 1EC7A 3AHXA 2YA2A 4DQWA 1TVNA 1CXHA 5CJNA 4L9ZA 4IPPA 3GBEA 4ZOBA 4AD2A 3PZTA 1LF1A 1UR0A 3TAKA 1D8CA 1ONXA 4CD4A 4LBUA 3DCPA 4IX0A 1I2PA 1XRVA 4Y8EA 1EHNA 4ZB5A 3OG2A 2AQVA 5E5CA 7TAAA 3VCCA 3NZGA 4FX8A 1GQJA 3VAVA 2VZVA 2WSPA 1V3JA 4HCLA 4V27A 1QUMA 2EXOA 2NXGA 4ROQA 4C6JA 1KXTA 1E40A 3TYCA 3DHPA 4PMJA 3PTKA 5T9BG 4X0VA 4ML9A 3BLOA 1R2TA 3QR3A 4PCFA 1WAUA 2E5DA 4RW3A 1G01A 3W1MA 1VENA 3S5SA 1R3WA 3BOXA 4QCFA 4J3ZA 3WLMA 4AWTA 4IL2A 3H53A 4CQBA 3MV01 3RILA 2PDFA 3OB8A 1G4EA 3CUHA 5AHEA 4DJED 3PAJA 4B5NA 3BLDA 4YCPA 3WQ8A 4FOUA 4IICA 4DIAA 1L0PA 3R8HA 1TPVA 4F48A 2XN0A 3KZPA 1POKA 4LVAA 1IE7C 1HL9A 4NZJA 2X7VA 4QFUA 4NYYA 2D2OA 4JTSA 1BPLB 1ELSA 1ZGDA 2J7CA 1ICSA 3W87A 3AI0A 1C91A 2OLAA 1QI5A 3LXBA 3WJYA 1DIOA 2IUZA 2YXOA 4U2YA 3AXHA 4JIRA 4EXBA 1DYSA 1EJUC 1XLFA 2GWNA 1RAKA 2PFHA 1JDDA 3P81A 2OZ3A 4MJZA 4W8AA 1PUDA 4AVNA 2NUXA 4XKMA 1X1ZA 3L68A 4PCSA 4UMAA 5H2ZA 3AU6A 3ATZA 4HZ8A 4F0HA 4MKVA 4N4QA 2YBTA 3M7WA 1TV4A 2GGEA 4AY7A 4DYEA 4D72A 2Q3OA 4E2BA 1H7WA 3V16A 2G3MA 1C8VA 1EWDA 2ZXAA 3LDVA 4OBTA 3O0KA 1E1CB 2NW0A 2UY5A 2GOUA 1PTDA 3QYSA 1ISZA 1UP0A 4WJXA 3M0LA 4U4MA 3W7HA 4ZTXA 1W5NA 4ZO8A 1GVQA 3CAVA 1JXJA 1JGIA 1I8JA 2QIWA 3T40A 4AX7A 2QEZA 4XD5A 3G6LA 3QC0A 3WF0A 1GWJA 3GVGA 4R7WA 4GYPC 3G24A 2OX4A 1AL7A 3EOUA 2QCNA 3PHAA 5CCZA 1FWHC 5CSYA 5AYYA 3LLXA 4F0MA 3M07A 5TF0A 3GNXA 4ZSUA 4RPPA 3GXFA 5HMFA 2V81A 4MYAA 1AL8A 4BHYA 3RO8A 2ZRYA 4S3EA 1NFGA 3VIHA 4MAZA 2W27A 1S2AA 5DBUA 3O6CA 1F3EA 3MP4A 4LC6A 3UWQA 4AU0A 4HPJA 3MW7A 4POCA 3H2MA 2XGBA 1Q6OA 3T4CA 5CH9A 4QQ3A 2Z4GA 3KZSA 2HVOA 2WSQA 3NXLA 3VD5A 4QM1A 2HMCA 1R3VA 1S39A 4IT1A 4YXGA 1UBPC 3GHUA 2HEJA 1NOWA 3W28A 2BY3A 1M7PA 2GSEA 1JYWA 3HQ1A 1QOXA 1DJNA 4GH3A 3VINA 2JALA 3R6IA 3H26A 5HQLA 1GPWA 5CC6A 2RKXA 4AZ5A 4KBXA 4ZZ9A 3N2BA 4PA8A 1G0CA 3CT7A 4UXDA 1TV5A 4DZIA 1Y5VA 4J3SA 4BQ4A 1RVKA 3FVMA 1GVFA 3LSCA 4LAZA 3I3DA 3WQOA 1JCNA 3IVUA 4Z2IA 3WDJA 4MTVA 2RDXA 3GQYA 3LBOA 1TE6A 3FFSA 5U4NA 3V36A 1R47A 4MKNA 1XICA 1GHRA 4WXZA 4FR6A 3RHGA 1Q13A 3V5CA 2VX6A 4DJFA 3CPUA 2QW5A 5HQMA 3E12A 1GG0A 1GJPA 4CCZA 2OPJA 4DB7A 4UTWC 3IGXA 1AFSA 3AXMA 4FX6M 3ZVHB 1FH7A 1GK8A 2INEA 4AHOA 1AVAA 2A1YA 1J9YA 3MWAA 4F2BA 1XKJA 2DQXA 3SN0A 4ZE5A 1FDJA 5C9ZA 5AC5A 4XZ9A 4RE2A 1AJZA 1RQEA 2G3JA 3P5ZA 3QV8A 1VFMA 1NP2A 2Z6IA 4JYFA 4LBRA 4PE8A 3VC5A 1HUVA 1YXDA 3UERA 4FXJA 4HKPA 1DIDA 2XIBA 3IJDA 4HNCA 4P7LA 1R85A 2GJNA 4OV9A 4QDMA 3PFMA 4AZIA 4XAFA 4UOJA 1W3LA 5AVHA 2FDSA 5FEWA 1K7XA 3UY8A 3SRKA 3H23A 4KEZA 5CGMA 1B90A 4FNTA 4CLMA 3HV9A 5A94A 1SFSA 1Q4WA 3GC5A 4J9JA 3XINA 3G77A 1KO0A 2FZNA 5D03A 3FDKA 4AUBA 1RPXA 5F1VA 3QV9A 5LNVA 2XVPA 3LD5A 2XINA 3EWUA 4LS2A 5CEWA 3HOJA 3AUJA 3EEZA 3GDRA 4WHBA 1RP8A 3IWPA 5I02A 1CGWA 3ARQA 4M82A 5FL1A 4Y8FA 1F76A 1W5PA 2A7RA 2O9OA 3KXQA 4PTWA 1V6VA 3QY6A 2R1MA 4MY1A 4PFHA 5AZ1A 3AMKA 3M5ZA 1YTKA 1H5VA 1UR4A 2ZADA 4Z1CA 1NJJA 1Q7QA 1E1CA 2FH6A 5KINA 3R2GA 4J35A 4XAYA 1QI2A 2PC8A 5AOUA 1EA9C 2ZX5A 2XVGA 3BMXA 4EE9A 2A3LA 3KDNA 4MFDA 2CWXA 1EGMA 2FFCA 4PMZA 1TPUA 3APTA 3KVLA 5AYXA 1DQUA 4HYWA 4O4WA 4IPIA 4CD7A 1D3HA 1YPFA 4BQ3A 3G3MA 3PB2A 2J78A 4ICMA 4QLJA 1JPHA 3M44A 3A12A 4HGXA 3IJ9A 1RLCL 1GEHA 4XX6A 3PB0A 4Z2GA 3ITXA 2VEMA 5HNUA 2QS8A 4LC8A 4NJHA 4M51A 4QS6A 1ADOA 3W1LA 1JCLA 4TIMA 4JTRA 1K7EA 5I09A 4D6FA 2XIOA 3B9OA 4CVWA 2DSZA 5HJYA 2MNRA 2GJPA 3R43A 4HA4A 3CIXA 3BV4A 3OJGA 1ZBKA 1OGBA 1XRFA 1PBGA 1A5CA 2XH4A 2OELA 3W70A 4R88A 1MQQA 4LEQA 3ICJA 1OK6A 3SRHA 2VURA 1EFZA 4OOUA 1W9PA 1BQCA 2BHYA 1LG1A 4QLLA 1F6YA 1PKMA 4M7SA 2J47A 4PRWA 5TIMA 2XWDA 3DDMA 2ASHA 3CQKA 4NP7A 4WY0F 5BRQA 4JX5A 3IAPA 4PTXA 2V5CA 1UROA 3KVMA 7ODCA 1D3CA 3SADA 1TMLA 3N18A 3BTNA 2E6YA 2B7QA 1KM4A 1Q6CA 3EEGA 3KBWA 2HE8A 4JTUA 4ZE4A 1V02E 1XWYA 3WUBA 1W3HA 4S3BA 2OO6A 3ONBA 1W8SA 4B91A 4D6EA 4AXKA 4UFLA 1FWIC 4PTVA 1TMQA 2A3EA 3PBYA 1QMLA 2G50A 3QOMA 2FTWA 3SY5A 5JQ9A 1LUCB 1ZQ5A 4J2PA 4S2CA 1B3OA 3OODA 1WBJA 5EL1A 1JNDA 1TJ1A 2Q02A 3GFZA 3HG2A 3L12A 3L21A 4JOMA 3NURA 4I9AA 3WF2A 3MZNA 2X40A 1NFPA 4B5SA 4A4AA 3BW4A 4WY0B 1TB3A 3GFXA 4UQ9A 1PO9A 3UPWA 1W5QA 1ONWA 3QEZA 3TSBA 1I2OA 1A0CA 3AIVA 1XYCA 3N3TA 2Q8ZA 4YN5A 2PODA 4GISA 3ZVHA 3N2MA 1YE4A 3WH9A 2WZIA 3FA3A 3WX7A 2P50A 3W71A 3TTEA 2GGIA 4WUIA 1UWAA 2INFA 2XYLA 3ARYA 5DBTA 4KEUA 4C7GA 3DOPA 1XM3A 4XAGA 4XK2A 1W56A 1S5MA 3ECQA 5D32A 2Y63A 2WOQA 3M0VA 1R9ZA 4YU1A 3VI2A 4JFWA 1NIUA 3T4WA 4GG9A 1UOZA 2VZTA 1V3MA 5K2ZA 1CGXA 4GJIA 3AIUA 1XINA 2ZRWA 4TR9A 2BXVA 2BTMA 4FXRA 1EUNA 2IXUA 5K4XA 4JIPA 3PM6A 1BGAA 4GQGA 4NG3A 5D2TA 2R9RA 3RLVA 1EJSC 1D2KA 3S1UA 2UY2A 3AYRA 3W6YA 3VZZA 1AQFA 3N6QA 4G2DA 5FSDC 2VGBA 3GXPA 5A2CA 4EX4A 1H50A 1FQ0A 1VFHA 2BXYA 1FOBA 2ISSA 2QCFA 3N1AA 3S5ZA 1PHWA 2BP1A 3S9ZA 1C29A 2G95A 4IIBA 1JPIA 1XIBA 2JF6A 2R91A 3GUGA 2X2YA 1ME7A 1QHZA 4FI4A 1AJ0A 1KB3A 1R0MA 6A3HA 3F4CA 1TCMA 2P0OA 1YXCA 3SN4A 1V6YA 4FO4A 1JDEA 2PRHA 2ZWZA 2P0IA 4YTUA 5A6TC 1F9CA 4H2CA 4GUFA 3DC8A 4QLKA 4L6HA 3AC0A 2QUTA 1HZYA 1NU5A 2O0TA 1E6SM 2W91A 2G97A 4WGHA 3HQNA 4J1OA 3IGUA 3VD7A 4F3HA 1EO5A 3UPBA 4H8UA 2VELA 1EKOA 2PEVA 4E6MA 5E93A 3ZLGA 1J10A 2OKTA 3CHVA 4W93A 1CXEA 4L4MA 4AZ6A 3MKCA 3QY7A 1MEWA 2X0SA 1ML1A 2PDWA 1Z48A 1I0DA 4QXIA 5HK4A 3N04A 3MI3A 1GYMA 1I9CB 3IAQA 3NQAA 4NAEB 3OVRA 4MG4A 1M68A 4EP8C 5H1WA 1XIFA 3VD4A 1EXPA 1ME8A 3FXGA 1CECA 3PBWA 4ZOCA 4RLIA 1ZZMA 1U33A 3OYXA 4LH8A 2QJGA 3TW7A 3MO4A 3HMJG 3N14A 1MO0A 1O1ZA 3THCA 1E73M 3DFOA 4GQBA 2OZ8A 3SN1A 1TJ2A 3P82A 4AZGA 1CENA 3FVDA 4JQ1A 1FWFC 1RLDA 2POZA 3E2VA 5H6HA 4IL0A 3SRDA 2H3DA 3MO7A 4W5UA 3KRSA 5FD0A 3B0PA 4NNCA 1H1NA 3A4XA 3CMGA 3NOEA 3KBJA 2PLJA 3HFTA 4XZBA 3VZXA 4FOJA 4HJFA 4KPLA 3CUFA 4GVFA 3EYPA 5GJNA 1NDYA 1H41A 1LRNA 1V0LA 4CKQA 3ITTA 1EYEA 3BG9A 4R33A 1K9TA 3LRLA 1YNQA 4TU1A 1LUCA 3NQ8A 1OFQA 4XO6A 4ADTA 1UYQA 3DKLA 1K02A 3MCMA 1EF3A 4NXSA 3E74A 4X3ZA 1KA9F 2VI0A 4LW7A 3T44A 1CZ1A 4WY0A 3NCOA 3WLQA 1HF6A 3B40A 3NXFA 3NSNA 1W1YA 4V1XA 1OYAA 1J0HA 1FWJC 4J28A 2C7FA 1F3TA 3L9CA 1GOKA 2GDQA 1XSKA 3TWBA 3W6LA 1BD0A 1H7NA 4GWEA 4C7DA 4O4VA 5D33A 3VMPA 4AD0A 1GQKA 2D2JA 1KM5A 2CXEA 1AD1A 2Y7FA 3H70A 4JNYA 4JNMA 3I3BA 4BS0A 2NT0A 4F79A 4GVHA 3LTSA 2PDJA 4ERGA 2I14A 1UKPA 2CLHA 2CNCA 4IFRA 3TYDA 1L6GA 5HR6A 3W7CA 1RZMA 3T08A 1LQAA 5CGTA 4MYXA 3TTYA 5JVLA 1LLWA 1XQKA 3W7EA 3DFSA 5D37A 5AC7A 5T26A 1I6NA 4DELA 4ZO7A 2I5GA 1BKHA 4TTUA 3NL6A 4H3DA 3ZR5A 1CYGA 4BI5A 2OSWA 1EOMA 4MWAB 5GQBA 3T55A 2Z1XA 1L6WA 1E6NA 2GJRA 2VL4A 4ZODA 1KD0A 2AOSA 3MBFA 3WK3A 4B9YA 1BXCA 1X98A 3QXBA 1WDQA 1YLVA 4K8EA 2ZTJA 2H9AB 3GNDA 1O66A 1D8WA 4OV4A 1Y5WA 4O50A 3C0JA 3RLHA 5GPRA 1YEYA 3LPGA 3H2EA 1UKOA 5CPQA 4NZ4A 5CQ1A 4E2DA 1N2VA 4H9VA 3LCGA 3RJYA 4KERA 3BO9A 3G5EA 2ZZ3A 1KQYA 2V5KA 4HN8A 3MV11 3QBUA 4CN1A 2WJDA 2Y24A 1S5NA 4O0ZA 4JQ2A 2YBVA 2QGHA 3U2ZA 3O06A 3QV7A 4KIRA 2QPUA 2WHKA 1P0EA 2OMAA 1J5TA 3LCWA 1KRCC 3TTQA 1E6RA 2XH2A 4F4RA 1DE5A 4MFEA 1UZDA 3AJ7A 2ZZ5A 3WFLA 3CNYA 2DPEA 4C1NA 1GG1A 1NM9A 3LOTA 3LCXA 1OIFA 4PODA 1OC7A 3UWVA 1SFJA 3ISIX 5EU9A 2VWTA 2XIMA 2W0UA 3FS2A 2Z2AA 2PTXA 4AMCA 5HXMA 1EJRC 3MSGA 2PGRA 1F8MA 4IISA 4DJDD 2FMNA 3URBA 3SQSA 1R3RA 2XGIA 3VMOA 2C91A 4JN7A 4YVXA 3HG5A 3C2YA 2Y6ZA 4PBEA 4BR1A 4HNOA 4DJEC 3LERA 4Q8WA 4QNWA 1GYLA 2DGAA 2YYUA 3A13A 1AH0A 1OSEA 2CHRA 5GNZA 3UEQA 5CGQA 1UC5A 4ERIA 3VDBA 1TV8A 1M53A 4DN1A 1QI3A 2QDHA 4FAMA 3LG3A 3LGDA 5C8BB 4AHQA 3ZSSA 2VGFA 4RDVA 3W26A 4LUSB 3IIPA 1S3HA 1J93A 3VMNA 1V77A 2WCGA 3LLDA 3VO0A 3HG3A 1H60A 6TIMA 2FDMA 1JZ3A 2YCEA 1V8EA 4TV5A 5G2HA 1JDAA 3QMRA 5IOBA 3FYOA 4LRTA 4M29A 4MWAE 2YL8A 4AIBA 1CCWB 4AXNA 4R9XA 1IGSA 3ME3A 4O14A 3VOGA 3U5YA 3B4UA 4QCEA 3VGBA 4DUVA 3F5JA 2BODX 1GHSA 3PR2A 1HW6A 3STPA 1XDJA 5BXTA 4L64A 5IFTA 3N29A 1E4IA 4I5XA 4IH3A 3KBVA 2QHAA 5D2VA 2OXNA 4J3VA 2B4GA 4PEKA 3VGFA 1E4LA 2WCSA 3A24A 4O13A 5FJUA 5CBBA 1HX0A 4MDPA 4N9DA 1QPKA 3POCA 1PV8A 1QDSA 8TIMA 1RBLA 4ECLA 3RM8A 1V6TA 5C6MA 3W2JA 3Q67A 2DZSA 3RFAA 2UBPC 4GO9A 1ZAHA 5E9AA 1C7TA 2C1HA 4XKYB 3WO8A 3AS0A 2VQTA 3WQPA 5IM51 3Q4DA 3SCQA 1GVYA 4WK9A 1IXQA 2G4FA 2HSAA 1U5HA 5REQB 2QPSA 2XJ7A 4KIEA 3H4GA 4E5TA 4TOQA 3GDBA 1EP1A 4B9ZA 1XYLA 3WQ5A 3RLUA 2NUWA 2FZ8A 1ZU8A 1S5VA 3BH4A 3SGZA 4G1KA 3VIMA 4QX4A 4JL2A 3S2MA 3MJMA 5HUOA 3VKDA 4GIAA 2F7FA 2DZBA 4LF2A 5HAOA 2W9MA 1DXIA 1KW1A 2WW5A 3SCVA 5G2IA 2GQAA 3MB9A 1QR7A 3LHZA 3OEXA 1MUWA 4GIRA 5G2WA 4WOZA 2VDIA 1XLDA 5MKGB 1HVXA 4NU7A 1W3KA 4Q3MA 4M3PA 2VOMA 4MWAA 4GA8A 3U2CA 2HXTA 4ADUA 5EGRA 4KFPA 2BVWA 2V63A 4AZ7A 2P3ZA 3B8IA 1EEPA 1X6UA 3TJLA 2O4QA 3EDFA 1OWQA 2D3LA 2HE5A 4N9CA 2H9AA 2WMHA 1I0BA 5K9XA 2OSYA 3S6TA 3H2OA 3PPCA 2DEPA 2Z1SA 3I7SA 1EBGA 5FEPA 1DP0A 3WEOA 5A2AA 2X2GA 3NL3A 2NQLA 3T1GA 4Q8QA 3SECA 4AWUA 3L0NA 4F0RA 1OZMA 5JH2A 5LIXX 4P7OA 4JN8A 3FJLA 2HNHA 1EXBA 2VFGA 1SR0A 1O95A 1H0GA 3GNRA 2XGZA 3R12A 1NTHA 2D1ZA 4C6LA 5A8PA 3GVWA 5FOOA 2J66A 1FA2A 3Q94A 5BOFA 3I6TA 2VMFA 5A95A 4KWVA 4ZBCA 3RR4A 3SO7A 1CLKA 3DESA 2Z1WA 3GIQA 8A3HA 1AH4A 1PS9A 3CHEA 1M7XA 1POJA 5FA5A 2AMXA 1UZHA 5MHBA 1CPUA 3WF1A 4GNKB 3MS8A 1OVDA 4FNPA 1VB9A 4Q33A 3T2QA 2V8ZA 1LL6A 3GTNA 1Q2SA 1CLVA 2Z1BA 3UZJA 4EWND 3P61A 1XD1A 3GO2A 3CWOX 1A49A 2DU2A 3PJXA 4XB3A 3TLLA 4IXHA 1GCYA 2POTA 2QKFA 1MVYA 4GGBA 3GK0A 1F4HA 1LBMA 2ON3A 4LFYA 4A3YA 2QZRA 4PMDA 1CIUA 2R1KA 1H7OA 5IBXC 6XIAA 1T5AA 2V3FA 2PP3A 1QTWA 2F6UA 1L6SA 4DWSB 3SCPA 4HIBA 2YBUA 1ZJIA 1DORA 1E55A 4LUSA 1ONEA 3WUEA 5HJLA 4L61A 3GVVA 3MMTA 1EZWA 2J8GA 3KP1A 3ZLHA 2J9ZA 3RCNA 2E4TA 1AA1B 1YNYA 5C2GA 2Y7EA 1Z41A 3AIEA 1L2QA 1OFEA 3T07A 1PZ2A 3KDOA 1TZZA 4GI4A 4QS5A 3QJAA 1UJQA 1P0DA 4C6PA 1LTDA 1IEIA 3PFRA 4HPXA 3T81A 3H2CA 1F74A 1S2CA 1GZ1A 1DE6A 3M4HA 2OSXA 4PMNA 4O1CA 3TLQA 4GUIA 3LXAA 2VOTA 3E9AA 3OLEA 4MZ8A 3BMWA 1KFKA 1W1IE 1VPXA 4I5RA 3FSUA 1E3XA 2A3BA 3EWWA 3DG7A 3AHYA 4B4HA 2VC7A 4O52A 1K3UA 3DI1A 2GJLA 2XIIA 1NDVA 4D9PA 1V3IA 2XHYA 4AW7A 3GXNA 3WQ4A 3CIVA 4W84A 3LRKA 2P76A 3AMGA 2PDCA 4WX2A 1B0IA 1XBZA 2DUAA 2XDFA 3GBDA 2HXUA 1ENUA 5HNNA 4OUEA 3WK0A 1DJXA 1OGSA 3SGUA 2XIQA 4I9MA 4DZAA 3FLUA 3CQJA 1UCWA 4DI9A 1VBGA 5G1TA 5JH1A 4BFAA 3SJNA 1BWKA 2WVSA 3JVAA 3V75A 4H6RA 2V82A 4H04A 3FJ6A 3OIXA 2QDGA 1H7XA 1TPH1 1H7PA 2Y5SA 4JX4A 3AWNA 3CB8A 4TMBA 3TEVA 2WZHA 4HCDA 5MKGA 2DH2A 1K6AA 4PTDA 1LL4A 2QCHA 3KVKA 1A4MA 4K1GA 4O1FA 2HROA 4AHPA 3GXDA 3KWXA 1KKRA 5K9DA 3CLMA 3N11A 3SR7A 2VRQA 3TKFA 2VM8A 2OO0A 4U5IA 1PL9A 2WBGA 1FXQA 4ZQOA 3B04A 4CEUC 1QBAA 4EF8A 3MCNA 1TWZA 4DO7A 1VCFA 3S3GA 2C15A 3NDOA 3H2NA 4BKNA 3W2MA 4LBSA 4XBSA 4G7FA 3USBA 3GLCA 3DN5A 2FYMA 3GHRA 1KBKA 3MT1A 1N8WA 1OG6A 5A8MA 2VJXA 1A0EA 2EGZA 4HP5A 4D71A 5EA9A 1UWRA 1VBJA 4O11A 2J79A 3B3DA 3R0UA 2Y4SA 2QJNA 1AD4A 4N9BA 2NSXA 3ZJKA 2IPWA 4FZIA 1FCQA 2XU2A 2Z26A 4H41A 3CL8A 3IV3A 1GQNA 2YCKX 5M3WA 4V2XA 1TMHA 3PN8A 3BUVA 3OBEA 2ACRA 2F6KA 2C1IA 3HPZA 1PHQA 3ABXA 3TTOA 3KCOA 3B8UA 1F07A 3U5UA 3M0MA 4KWWA 5HMEA 4NILA 1Y65A 1B31A 4OHQA 2V38A 4FB7A 3MSDA 1OCJA 1DJYA 1OGGA 4FHAA 3AOFA 4ZQNA 1SU5A 3WD3A 5DF0A 3CMFA 1K8ZA 3S0CA 1JAEA 4PL2A 3UCDA 3EOOA 1TREA 3LCFA 4G6CA 1XDLA 1Q8AA 3AXXA 4DBWA 2EJAA 2VRJA 3LYEA 5I77A 1Q6EA 2PUZA 2WK2A 3U48A 1TCDA 4NRSA 1WP6A 2EQDA 1PIIA 4GUGA 4U3AA 1TSIA 2GGGA 2DFAA 4DWSA 4Z2JA 1C8YA 1K8XA 1UASA 2WC4A 5F4XA 4ZENA 1VAHA 2OQLA 3GWQA 1B54A 1PPIA 1HO4A 1H0IA 2OOGA 4FSAA 3MUXA 3BGAA 4ZEPA 3VIJA 2Y5JA 4W4QA 4V15A 1L6FA 5I06A 1FKXA 1GKPA 3WH5A 1ZCCA 1DQWA 4LVDA 1BF2A 3TCEA 4UIOA 5DX7A 1HL8A 3HGSA 3WNMA 2Y7DA 4ADSA 3T9PA 4MDOA 2CLOA 4HTYA 1PYFA 4GY0A 3KOZA 2UY3A 2YA0A 3O2LA 5A6SA 4WDUA 1XUZA 4UTMA 4HHLA 2PWEA 3C8FA 3SQMA 4DZHA 4WJ8A 3T8LA 1WDDA 3GTXA 1ISWA 2OKOA 1YDYA 1OX4B 3M5XA 1UWSA 3NSXA 1FFQA 3L0GA 3NVTA 5I7GA 5ABFB 4NI3A 5T9CE 2R8WA 2WKJA 5KETA 3QV6A 5BWAA 5AECA 4IUGA 1VYRA 2FLIA 3GU2A 1F5ZA 1TYGA 2AAAA 4C90A 1GJUA 3WQDA 3TX9A 4M19A 1J12A 5FF0A 1DWJM 1A5KC 1C9WA 3WJZA 3W07A 4J5NA 1MW1A 3SFWA 3EDDA 5F1UA 1EJWC 2QXWA 4UMBA 1TA3B 2ICSA 4IMDA 1UPPA 1A80A 3GDKA 2V5JA 4AEOA 3EGJA 1QI0A 1FP9A 3CAQA 2G37A 3VX0A 3H21A 3LN3A 3UGRA 4ZFCA 2NV1A 4DRSA 1XISA 1Q3NA 4E4FA 7XIMA 1W9VA 1AQ0A 1OG0A 1X1OA 3RITA 1YBQB 3NDZA 1HJUA 4ZVJA 2Y8VA 3NQ2A 1TTQA 2BV9A 4Q7IA 4UFHA 3G1FA 3O6AA 2DZWA 1XSIA 4GCXA 2F84A 3AS3A 2F61A 3I7RA 3KTXA 5I3KA 3QPYA 5FSEC 4G56A 3OHMB 1M41A 3TUUA 5FJJA 4ZQCA 4JKMA 3QF0A 4BQ2A 1BWLA 2R82A 1TRIA 3MMWA 4KEMA 3V5OA 4IWWA 3CYJA 4FNUA 3E1F1 4UWMA 3SBFA 4KGLA 1UUQA 2TYSA 4HTBA 2Q6ZA 4OUIA 3L7RA 3ZJ6A 1SMAA 3LY0A 4LVFA 5LGXA 4BF9A 4UOZA 1XIHA 1IXOA 3E38A 2VVNA 2NX1A 2DORA 5TBOA 4C6NA 2QNEA 1O94A 2CHOA 5C9RA 3KL5A 4NHVA 4OIFA 2PDKA 3WLLA 3C0LA 4E2OA 3C0QA 4IPNB 1GQIA 1MRQA 2AQWA 1Q66A 1S5TA 2PD9A 3W3OA 4C1KA 4C6QA 4CNUA 4PMVA 1C9DA 2XFWA 1EH9A 4NJKA 5A8OA 3WJXA 4PUKA 1ZLPA 1XV8A 5KZDA 4O16A 2HBVA 2JIEA 4A8NA 3A47A 3HIJA 5HANA 3EPOA 3TR2A 3D3FA 3I6RA 4JIQA 3WUGA 1E6PA 4RE3A 4I90A 3E0VA 3W7GA 5C7VA 1E71M 4IM4A 1UWIA 1K8CA 2BDQA 3GKFA 3PBGA 1C7SA 2ZUTA 3B0XA 1UIPA 5DT7A 3HQOA 2DSVA 2ZRVA 1H7RA 2X41A 3O15A 1DWAM 2Z25A 5LNUA 3A3HA 2ZUSA 3CQHA 3BLFA 2WSKA 3RR1A 3CZ8A 4HU4A 2D23A 1W32A 1GOIA 3KFTA 1VJIA 4PSPA 1E3ZA 4J4KA 1NP0A 4K36A 1G7VA 3AXKA 4IIEA 5J5DA 1QPOA 3ID7A 4AZCB 1GPFA 1X8FA 3VKAA 1JULA 3G1HA 4ICNA 3SSZA 3TOYA 2ATSA 4UB9A 4XBKA 8XIAA 1J0KA 1V6UA 1VFTA 4M6PA 2QUVA 3B9EA 2NUYA 5EBAA 2J7FA 1XQLA 2CZFA 3IJQA 2E6FA 4DWDA 5HQEA 4RUBA 3G8EA 2RDTA 3MUIA 5D4YA 4Z0JA 2PLMA 3B0YA 4AF0A 4AVOA 3GR8A 1LYXA 4C65A 4KCTA 3BARA 2Q01A 4UNKA 2VCCA 3FHQA 3OW1A 2ANUA 3G1XA 5BXRA 4ERAA 3DFQA 3KL0A 3PNZA 2PB1A 3VKKA 5FEZA 1TV3A 1WZMA 2V68A 4HK6A 4UTTA 1QNOA 1Q6DA 4LYRA 5J8LA 3ZWTA 1H49A 3OZPA 3TCSA 2QMJA 4HK5A 3TA6A 4GOAA 1A5OC 1XLGA 5AHNA 4GZJA 4CU7A 2VC9A 5G4EA 1IF2A 1ADDA 2DZUA 2V2HA 3GYEA 4XVEA 1H51A 1F3WA 5CBIA 4BWLC 1UR3M 5ABFA 4GUJA 3D3AA 1JIBA 1PCWA 1E72M 2F8QA 2DVTA 4JTJA 4ZL1A 2ZA3A 4NZ1A 3MUY1 4NAFB 4GVGA 3W7MA 2AAMA 1MXDA 3BPWA 3E5PA 1WXZA 4DJDC 3V4BA 4FLOA 2DY3A 3RX3A 2O7SA 4W8LA 1BTCA 3D46A 3MVTA 3LHYA 2I9UA 3SCNA 4FNSA 3U57A 5ABTA 1E0UA 1TA3A 4JIHA 4AEFA 2GSHA 3ZFHA 2WSYA 4GNVA 3NGFA 2WHJA 3DFTA 1KR0A 1SO5A 3FHAA 3GAKA 1UWQA 2ZRZA 1HGYA 3L5MA 4LB3A 4F40A 1E9YB 5F2IA 1W5OA 2WVUA 1YBQA 3QQ0A 1ECQA 1W31A 3G3DA 3PBVA 2VX7A 2QUMA 2HNEA 4UTHA 4P8XA 4FX7A 4NZ5A 3WEZA 4GYKA 3R13A 1BXNA 5A6LA 1GKRA 3O16A 4B3LA 3BJSA 3S1VA 3ZOAA 3UWWA 3VM7A 1F3XA 3VA8A 1TTPA 4DF0A 2P8CA 4X60A 1U2YA 3M9YA 3PZ9A 3WLTA 5HNTA 4ZGYA 5D9OA 4J2MA 1K1DA 5A8QA 4IMCA 4Y9MA 2XSAA 4Y9AA 3AROA 2Z27A 2DSKA 4UZUA 1N55A 2Z1KA 4DO5A 1IT7A 3QC3A 3MKKA 4S3GA 3MKVA 2CETA 2TRSA 2V5LA 3G0SA 4H9UA 5EMYA 3GXMA 4QAWA 1VCVA 1ZL1A 4MNKA 1RH9A 4FLSA 1EEXA 1OYCA 1VEOA 2DV0A 1WCGA 3GU9A 3KP0A 2XH0A 3IACA 1EWEA 3UG8A 4H2HA 1ICPA 4YL2A 1W6TA 1LLZA 4TXEA 1E6ZA 2AKMA 5A6JA 3VDGA 4XTIA 4HSHA 1NY1A 1Q4NX 5I3GA 1OF6A 3KCLA 1ADSA 3N2XA 1V3LA 3C5QA 1TPFA 1OEPA 2XZ7A 3ZLFA 2GDUA 3G0UA 1TX0A 1XJBA 3TONA 5CPLA 1KFJA 1XPYA 4XD4A 3GH4A 3TYEA 4MZ1A 1JD7A 1EP2A 3AAMA 3PZIA 4NZ3A 4MLJA 3ARPA 3DG6A 4IMAA 1ITQA 4PRRA 3QSTA 4Z42C 1IZCA 4XG1A 4P7QA 1H62A 1KM0A 2QULA 5EKYA 4F9JA 3QVQA 2ZX9A 3DGBA 2OOFA 2V3GA 4WSJA 1R87A 3EB3A 2PWVA 3VOFA 1E4MM 4GRSA 4JTTA 3TYAA 3VNMA 4HPHA 3CL7A 1T40A 2YL5A 3NZRA 4AZCA 4YYFA 4F8XA 2BVTA 4ZQMA 1PKNA 3WK1A 1I2RA 1XBXA 1HJQA 4DUXA 3WBAA 3U2OA 1LBFA 2GUUA 2VNCA 2ZUVA 1S2TA 5G4WA 2PU0A 5FJRA 4E4UA 4RZ4A 1R3TA 4PMOA 2PDYA 1Q8JA 3P80A 1S1PA 1FTXA 4S3FA 1A5MC 1BSIA 4TQTA 2PLCA 3UXIA 2VUNA 3L0KA 3DFHA 2E3ZA 4K7VA 3STGA 5DRCA 3REQB 1YRRA 2JIWA 3CV6A 1PAMA 5DY3A 1YXYA 2VCAA 3LENA 2VR4A 4Q4RA 3BAXA 5D09A 2PE4A 1AZ1A 4GMEA 4QISA 4QNEA 1LWIA 4OTKA 5ABEA 1ITUA 4DYJA 2PWUA 5GNYA 1WBHA 3WLHA 4PSRA 1VR6A 4PEEA 4OE7A 1HKIA 4Y9NA 3WLRA 4EIVA 3VDHA 4JIIX 1P4CA 2B31A 3RN6A 2HTMA 1RALA 5FIPA 2W5FA 2GLKA 3VDAA 4LSBA 4NAFA 3SDOA 4KW2A 3O9NA 3WQWA 3S2NA 4GI9A 1US2A 3N4FA 4W88A 4AH7A 2XM1A 2FTYA 1M65A 1ZS2A 4HQVA 2YPIA 4RR4A 1UH4A 2EF9A 1XRTA 3MSRA 2NSOA 5EMKA 5J04A 2X30A 1GOWA 4GYPA 4L1WA 3YPIA 3GVQA 2EPHA 2ZBTA 1LG2A 5CZKA 1DHPA 3CLWA 2ACQA 1TWWA 2BHZA 2E5CA 1RK6A 3KE0A 3VKCA 3ORWA 2ZCGA 4JFUA 4WF7A 1XIIA 3EBVA 3URNA 2FPTA 1EJ7L 5G5IA 3VD9A 4CGTA 2GGJA 3CL6A 4UTLA 3P84A 4N7QA 4I7WA 1XLAA 1G1YA 3BG5A 3T6CA 1JUBA 2BASA 5D9PA 3W1QA 1GQLA 4M6QA 1NVMA 4DZ5A 2E9LA 1M6JA 5FACA 1UUMA 3WQFA 2JKEA 4H9YA 2XVLA 4LX4A 3W1RA 1G9HA 4JPGA 3P74A 4QIUA 3QYQA 3UQNA 3M16A 3UXDA 4LEFA 2UY4A 3IS4A 2A79A 2X1RA 5A2BA 1UD2A 2ZA2A 2CZVA 1UKSA 2WM0A 3GS6A 3VZYA 2ZUNA 1AMKA 3GXTA 1GW1A 5IRPA 1JJKA 2NWSA 3A9IA 2PDIA 1HKWA 2FJUB 1EUAA 3BSGA 3L23A 5AC6A 1KM3A 3T78A 4K8HA 3AHVA 4NYUA 2Z00A 3GHTA 4EAYA 5FESA 1TFVA 4UFJA 2YA1A 5D02A 2J8FA 4LNYA 3PTQA 1YTEA 3BWWA 2P3EA 3OBAA 1O60A 3MA8A 3GB6A 4IMFA 2YDQA 1PSCA 4ACYA 4E0CA 1VFLA 4NF7A 2Y62A 1U30A 1JF6A 4JTQA 4OJYA 4UTWA 1CXKA 2ZE3A 4FP1A 3WDPP 5D38A 1VIWA 2X0YA 4CU8A 4ATWA 4US6A 4RZ5A 5LGZA 4UQAA 3QMSA 3ZT5A 4WSHA 1ISXA 1M5WA 2E09A 3DAQA 1CXLA 1VRDA 1HXJA 3WFZA 4KEVA 9CGTA 5E09A 4ACZA 5JIWA 5LIYX 1LBLA 2E1DA 2CBJA 3NUKA 4KCUA 3P62A 1N8IA 1JCJA 2HVMA 2OWXA 3UJ2A 5KZMA 4LALA 4EVZA 2BGSA 3USZA 3NEHA 1ALDA 1REQB 3PY2A 2CKRA 1RJPA 1RQBA 4NJIA 5ABGA 2IKGA 3ANVA 1B30A 1WKFA 5FJOA 4BF5A 1Z42A 4ALDA 1ZSXA 1DTNA 5CJMA 4A3UA 4DF2A 4US5A 3ALGA 4J27A 3UWYA 2G96A 3U4FA 4H6EA 2J7HA 3L2IA 3CS2A 4PR4A 2CZDA 1UZ4A 3CV1A 1TR9A 1RBOB 3ABQA 2Z1VA 3VGEA 3REQA 5DN1A 3ZQ9A 1T8XA 1OFRA 1PKYA 5FF4A 2GK1A 1E70M 1P5BA 5AC4A 2VQUA 1CWYA 1F73A 2FVLA 3BK0A 4PBGA 4HD5A 1IR2A 3GNOA 5RUBA 4JCLA 3RUBL 4D6HA 2FMOA 2VFDA 3C2FA 1J8VA 2YZRA 4HOWA 4HBKA 3KRZA 4A35A 1Y8BA 5I6SA 4W85A 3O07A 2XPKA 3WLPA 4QJ5B 2E0PA 3S8HA 1V3HA 4PFMA 1DBTA 1DVJA 3S1XA 3QZEA 8CGTA 1UQYA 4HNVA 4LT9A 1PX4A 5B80A 5K9CA 1UIOA 2ALRA 4PMRA 3WBWA 1BHGA 1SFLA 1K9EA 1XP3A 1XH2A 4QGCA 3S4TA 3ITVA 5F2GA 1O4UA 1E0WA 1WB0A 3M41A 2B7PA 1XD0A 1ESWA 3TXZA 1VQTA 3WQ6A 3Q37A 2FVKA 4XSLA 1JQVA 4PB5A 1HN1A 2WJFA 4S2BA 3STCA 1QAPA 1QO5A 3B8SA 4ORIA 1XYBA 1K4GA 3GE7A 1IHIA 3N9SA 5D04C 1XYMA 3WNKA 3R7MA 3RMEA 4MNJA 1CBGA 1A5NC 1I60A 1UD5A 3UFYA 4CQCA 3WLSA 1UP2A 2RJGA 5AC8A 3SCRA 4NVTA 1DJHA 4WDXA 3RCYA 2EJ1A 2OWCA 1XGEA 2OVLA 3J7HA 4CD8A 3KRUA 1TJRA 1WDWA 3T0BA 2EKGA 4TX8A 3GYCA 2GOKA 4IP5A 4PULA 4ZXOA 4E8CA 3UR8A 1EA0A 4H8HA 5I00A 4IG2A 4UUIA 5CPOA 2DH3A 4XZLX 2OODA 3CPRA 1WDSA 2Q8XA 3OA5A 2GVLA 3EA2A 3TQ0A 1Q63A 3NQGA 2Q71A 3N12A 1P6WA 3ZJ8A 4C60A 2WLZA 2DZPA 4RE4A 5D8ZA 3UZ5A 3ATYA 3NYDA 1W8GA 3A4JA 1BQGA 3STFA 1IT8A 3DHDA 5K4ZA 2DQWA 3TNOA 4BEUA 1JFXA 3SCWA 3WLKX 1CXIA 1OFAA 4H19A 3OZOA 5HWMA 6TAAA 4XQ6A 3E96A 2BOFX 4JDYA 2I5IA 1S2VA 2L5HA 2G8ZA 4E8DA 1C8QA 5IDIA 1PB0A 4JEJA 2RAGA 1WKDA 1XLLA 4WGXA 1CNVA 3M0JA 2WNWA 3TYZA 2WPGA 5D9NA 4B90A 3TH6A 3MYOA 4C6FA 3LHUA 5ABHA 1BGGA 1XIJA 2NVDA 3PWAA 3KOYA 5AB3A 3AIWA 1JAKA 2PDBA 3A21A 3EPNA 1YYAA 3W1UA 4C1LA 1OC5A 3WLIA 4GVIA 3SRFA 2WNQA 3UY7A 4GLEA 3N19B 4TUFA 3K13A 1UMYA 1UH2A 3U0HA 2OLSA 4QHRA 4AAJA 4IJBA 5AKQA 1H4PA 5D9MA 1I75A 3OIHA 1V0MA 2HDJA 3O8AA 1Q5MA 1VJSA 6ALDA 4B2DA 2NT1A 1LWHA 1HL2A 1RJQA 4RKAA 2QJMA 4LVGA 3WBXA 2CCRA 2E1WA 3M6DA 1W9UA 1W2PA 4ZXLA 2YR1A 1A50A 1REQA 2ESCA 4JEQA 1MEIA 2X8RA 1E51A 3ZWSA 3H12A 3W73A 1T7LA 4RDZA 5BWFA 3ZT7A 3CUJA 3TSMA 1XC4A 2OX1A 2J27A 4HSNA 4R7JA 1T6MA 4IFOA 4IZGA 1QPRA 1FWRA 3MUCA 4XZIA 2D0FA 3W2LA 3OHIA 3E0IA 4PUJA 2J6XA 3T2OA 3RF9A 1PTAA 4Q4SA 3KBSA 3S1GA 1XYZA 2AQOA 2ZC1A 4GCAA 4A8IA 3BAIA 4JTIA 3LV5A 1LORA 3PZQA 3UZWA 1UB3A 3I10A 1YE6A 1W9BM 2WZEA 1CEOA 1OADA 2VUYA 3ARWA 1EC9A 4U31A 4KFNA 1Q7ZA 2I1OA 4UQDA 4Y2WA 3P8JA 4L9YA 3U8GA 3VKJA 5EMMA 1JRBA 2QAPA 4S39A 4GD0A 1B4EA 1OJXA 3O3RA 3W7RA 1JFHA 5LHFA 3CO8A 3NNTA 5G4HC 2VFHA 5G1MA 3SUSA 3IJ6A 4IOTA 1R9YA 1PX3A 5BZAA 1VLWA 1LOSA 4L80A 4ZR8A 5L6UA 5ECUA 1VFSA 5I24A 3U7BA 3VFLA 2GPTA 3VNJA 3HMCA 3C56A 4J3UA 2Q8LA 3PNUA 3RMJA 5EMLA 5IHSA 2TPSA 2BGNE 2UZ9A 2CIPA 3I4EA 3LPPA 1W2VA 4UTKA 4AYSA 1KNWA 5BYWA 5CSRA 5AFDA 2EG6A 1TZ7A 2ZOXA 1QJWA 1JZ5A 2BX7A 5AYIA 3DXIA 4Q32A 1V6XA 3BLKA 3CZLA 4Q7BA 1B2YA 3UJSA 4L6OA 1QFEA 1VBRA 2ZX6A 1B57A 1JCMP 1TVPA 3WF4A 4EPDC 4LPCA 1RPKA 5GNXA 1ODUA 3CAWA 3W7IA 1QPNA 3OOQA 4Q4KA 1VIZA 4NNAA 2V3EA 1N7KA 2FFIA 3GDLA 3UBPC 4K68A 4ZB0A 2GQ3A 1GJWA 4Q8PA 3E0WA 3JZEA 4AIOA 1SM9A 3M0ZA 3CWNA 3MUZ1 3QPZA 4GQRA 2QCEA 3LM3A 3PUGA 5D2YA 4NRRA 3G6MA 5H91A 3B8WA 2ATMA 5HR7A 5A5WA 3CASA 1H09A 4RK8A 1IEXA 1QNPA 3RNDA 1UQZA 2FGBA 1TPDA 4YVVA 3VTRA 1VFOA 4LQ1A 4JFTA 2CYGA 1WXYA 3IV8A 1IZKA 4P8UA 3SY1A 4Q4QA 1GEQA 4UQBA 3G0XA 4HYRA 4AZBA 3K4DA 4EOUA 4M81A 1BTMA 4AD1A 4BI6A 1H1ZA 3CUZA 3CZGA 1IWBA 2ZDRA 1JZ8A 4CD6A 1MFVA 3LRMA 3S5YA 4JTEA 2TAAA 3APGA 5GJPA 4D1JA 5G1YA 1DJZA 4RXGA 1J0YA 4LYKA 2Z2BA 3TROA 3G1AA 2DDXA 5JU6A 5M1TA 3BICA 2H3BA 4CVUA 2V67A 3AWOA 1FWTA 3H54A 3XISA 3QQ1A 1T0OA 4QEEA 1E56A 4UQCA 1KM2A 5CLTA 1B3ZA 3K1DA 2PA6A 3TQVA 3HN3A 4AWSA 2GWGA 3H24A 3T05A 1A3HA 2DT0A 3DGRA 1IEQA 3BAJA 1R6WA 2PGEA 3IUIA 2D2GA 4ROPA 1PEZA 3RO6A 1O5QA 2WYSA 1F61A 4C6CA 3VE9A 5DY2A 3M5VA 3BSHA 4RE0A 3K30A 3UYIA 5DANA 1W1VA 3C2VA 2ZQ0A 9RUBA 1OYBA 1WQ5A 4IPJA 2O56A 4N42A 2BOGX 4KCVA 4B4FA 3N4AA 2EG7A 2OGYA 1VRXA 1XLIA 1J11A 3L4ZA 4WD0A 3HQPA 2CHNA 1GKQA 4PUMA 4P8WA 4Q4OA 3R8GA 1QATA 1OF8A 2OZ0A 1K8YA 4LUTB 3KBNA 3ARTA 3LU2A 3WLOA 4A3HA 1I45A 1MYRA 1AJ2A 1Z7AA 3NEVA 3KTCA 3AS2A 2PDGA 5EYWA 4EKJA 3W1PA 1JVNA 4CQAA 4R53A 4A6GA 3CPGA 1MXSA 3PBMA 2FKPA 1BXBA 4MB5A 3ZZ1A 1PZ3A 4C91A 4WDWA 1TWSA 3V0TA 1AZ2A 2CLFA 1SJAA 1XFCA 1HFBA 3NPXA 5DCBA 1NOUA 3WDRA 1J0IA 3GFYA 1P1MA 1ISYA 4Q8OA 3F2DA 1WOBA 2G3NA 3ARSA 4RNHA 1GOMA 2GZXA 3UT0A 4AB4A 2VEFA 4PGLA 1J4EA 5CZJA 2I7GA 5IFPA 1NSJA 3LMYA 1OCBA 3ES8A 2HPIA 4GZIA 1W54A 3RCMA 1FUYA 4YNGA 1DHKA 5D8WA 1AH3A 2XG9A 2PDMA 3AALA 3WD1A 1A3WA 3TN6A 3Q58A 1RK5A 2GVJA 3VABA 1EB3A 5DMNA 3II1A 3LHTA 4DJEA 3W25A 2YXGA 3IRSA 2WBKA 5I78A 1KM1A 3GU1A 3UVIA 5KITA 4IF2A 2CWNA 4QBXA 3SY8A 1O6IA 3BCFA 1R46A 2HK1A 4JQ4A 1CXFA 3LCIA 3VDCA 3BAKA 1IIHA 5C5YA 3R0KA 1DIEA 3ARZA