3ZWZA

Crystal structure of plasmodium falciparum ama1 in complex with a 39aa pfron2 peptide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
334
structure length
297
Chain Sequence
NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCNKDESKRNSMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPDRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVEAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN 1, AMA1
publication title Structural and Functional Insight Into the Malaria Parasite Moving Junction Complex
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 86
structure length 297
sequence length 334
ec nomenclature
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 3zwzA01
3SRIA 4APLA 2K13X 3HN4A 2X2ZA 1YXEA 2HGFA 1BHTA 5CS5A 4Z0EA 4R1CA 5EODA 5CT2A 2YILA 3HMSA 5COEA 2YIOA 5I25A 1Z40A 1GMOA 2Z8VA 3HMRA 3ZWZA 2F83A 1GMNA 5CS3A 4IUAA 4Z09A 2J8JA 4R1BA 5EOKA 4DURA 2YIPA 2LL4M 2J8LA 3ZLEA 4UV6A 2QJ2A 2Z8WA 2Q8BA 1HKYA 4R19A 3HMTA 4UAOA 5CP9A 4Z0DA 1W81A 4APMA 1I8NA 2LL3A 3SRJA 5CS1A 4Z0FA 5CT1A 1GP9A 1W8KA 4A5TS 1NK1A 3MKPA 4R1AA 5CS9A 5CT3A 5CSQA 2QJ4A 2Y8RA 3SP8A 2Q8AA
chains in the Genus database with same CATH superfamily
3SRIA 4APLA 2K13X 3HN4A 2X2ZA 1YXEA 2HGFA 1BHTA 5CS5A 4Z0EA 4R1CA 5EODA 5CT2A 2YILA 3HMSA 5COEA 2YIOA 5I25A 4YIVA 1Z40A 1GMOA 2Z8VA 3HMRA 3ZWZA 2F83A 1GMNA 5CS3A 4IUAA 4Z09A 2J8JA 4R1BA 5EOKA 4DURA 2YIPA 2LL4M 2J8LA 3ZLEA 4UV6A 2QJ2A 2Z8WA 2Q8BA 1HKYA 4R19A 2KL5A 3HMTA 4UAOA 5CP9A 4Z0DA 1W81A 4APMA 1I8NA 2LL3A 3SRJA 5CS1A 4Z0FA 5CT1A 1GP9A 1W8KA 4A5TS 1NK1A 3MKPA 4R1AA 5CS9A 5CT3A 5CSQA 2QJ4A 2Y8RA 4YIZA 3SP8A 2Q8AA
chains in the Genus database with same CATH topology
3SRIA 4APLA 2K13X 3HN4A 2X2ZA 1YXEA 2HGFA 1BHTA 5CS5A 4Z0EA 4R1CA 5EODA 5CT2A 2YILA 3HMSA 5COEA 2YIOA 5I25A 4YIVA 1Z40A 1GMOA 2Z8VA 3HMRA 3ZWZA 2F83A 1GMNA 5CS3A 4IUAA 4Z09A 2J8JA 4R1BA 5EOKA 4DURA 2YIPA 2LL4M 2J8LA 3ZLEA 4UV6A 2QJ2A 2Z8WA 2Q8BA 1HKYA 4R19A 2KL5A 3HMTA 4UAOA 5CP9A 4Z0DA 1W81A 4APMA 1I8NA 2LL3A 3SRJA 5CS1A 4Z0FA 5CT1A 1GP9A 1W8KA 4A5TS 1NK1A 3MKPA 4R1AA 5CS9A 5CT3A 5CSQA 2QJ4A 2Y8RA 4YIZA 3SP8A 2Q8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SRI A;  4APL A;  2K13 X;  3HN4 A;  2X2Z A;  1YXE A;  2HGF A;  1BHT A;  5CS5 A;  4Z0E A;  4R1C A;  5EOD A;  5CT2 A;  2YIL A;  3HMS A;  5COE A;  2YIO A;  5I25 A;  1Z40 A;  1GMO A;  2Z8V A;  3HMR A;  3ZWZ A;  2F83 A;  1GMN A;  5CS3 A;  4IUA A;  4Z09 A;  2J8J A;  4R1B A;  5EOK A;  4DUR A;  2YIP A;  2LL4 M;  2J8L A;  3ZLE A;  4UV6 A;  2QJ2 A;  2Z8W A;  2Q8B A;  1HKY A;  4R19 A;  3HMT A;  4UAO A;  5CP9 A;  4Z0D A;  1W81 A;  4APM A;  1I8N A;  2LL3 A;  3SRJ A;  5CS1 A;  4Z0F A;  5CT1 A;  1GP9 A;  1W8K A;  4A5T S;  1NK1 A;  3MKP A;  4R1A A;  5CS9 A;  5CT3 A;  5CSQ A;  2QJ4 A;  2Y8R A;  3SP8 A;  2Q8A A; 
#chains in the Genus database with same CATH topology
 3SRI A;  4APL A;  2K13 X;  3HN4 A;  2X2Z A;  1YXE A;  2HGF A;  1BHT A;  5CS5 A;  4Z0E A;  4R1C A;  5EOD A;  5CT2 A;  2YIL A;  3HMS A;  5COE A;  2YIO A;  5I25 A;  4YIV A;  1Z40 A;  1GMO A;  2Z8V A;  3HMR A;  3ZWZ A;  2F83 A;  1GMN A;  5CS3 A;  4IUA A;  4Z09 A;  2J8J A;  4R1B A;  5EOK A;  4DUR A;  2YIP A;  2LL4 M;  2J8L A;  3ZLE A;  4UV6 A;  2QJ2 A;  2Z8W A;  2Q8B A;  1HKY A;  4R19 A;  2KL5 A;  3HMT A;  4UAO A;  5CP9 A;  4Z0D A;  1W81 A;  4APM A;  1I8N A;  2LL3 A;  3SRJ A;  5CS1 A;  4Z0F A;  5CT1 A;  1GP9 A;  1W8K A;  4A5T S;  1NK1 A;  3MKP A;  4R1A A;  5CS9 A;  5CT3 A;  5CSQ A;  2QJ4 A;  2Y8R A;  4YIZ A;  3SP8 A;  2Q8A A; 
#chains in the Genus database with same CATH homology
 3SRI A;  4APL A;  2K13 X;  3HN4 A;  2X2Z A;  1YXE A;  2HGF A;  1BHT A;  5CS5 A;  4Z0E A;  4R1C A;  5EOD A;  5CT2 A;  2YIL A;  3HMS A;  5COE A;  2YIO A;  5I25 A;  4YIV A;  1Z40 A;  1GMO A;  2Z8V A;  3HMR A;  3ZWZ A;  2F83 A;  1GMN A;  5CS3 A;  4IUA A;  4Z09 A;  2J8J A;  4R1B A;  5EOK A;  4DUR A;  2YIP A;  2LL4 M;  2J8L A;  3ZLE A;  4UV6 A;  2QJ2 A;  2Z8W A;  2Q8B A;  1HKY A;  4R19 A;  2KL5 A;  3HMT A;  4UAO A;  5CP9 A;  4Z0D A;  1W81 A;  4APM A;  1I8N A;  2LL3 A;  3SRJ A;  5CS1 A;  4Z0F A;  5CT1 A;  1GP9 A;  1W8K A;  4A5T S;  1NK1 A;  3MKP A;  4R1A A;  5CS9 A;  5CT3 A;  5CSQ A;  2QJ4 A;  2Y8R A;  4YIZ A;  3SP8 A;  2Q8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...