3ZWZA

Crystal structure of plasmodium falciparum ama1 in complex with a 39aa pfron2 peptide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
334
structure length
297
Chain Sequence
b'NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCNKDESKRNSMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPDRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVEAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN 1, AMA1
publication title Structural and Functional Insight Into the Malaria Parasite Moving Junction Complex
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 86
structure length 297
sequence length 334
ec nomenclature
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 3zwzA01
2K13X 3SRJA 2HGFA 3HMTA 1GMOA 2Z8WA 4R1CA 4R1BA 5CS9A 5I25A 4UAOA 5CT3A 5CT2A 2Q8BA 5CS3A 3HMRA 5CSQA 2F83A 1YXEA 2YILA 5EODA 4APLA 1GMNA 3HMSA 2J8LA 3MKPA 4R19A 2Q8AA 5COEA 3ZLEA 3ZWZA 1NK1A 4Z0FA 2J8JA 2Z8VA 1GP9A 1I8NA 3SP8A 5CS5A 3HN4A 2YIOA 2X2ZA 5EOKA 1Z40A 3SRIA 2LL4M 1W81A 4Z09A 4APMA 5CP9A 4Z0DA 1HKYA 4IUAA 4DURA 2QJ2A 2Y8RA 5CS1A 4R1AA 4Z0EA 2LL3A 2YIPA 1W8KA 4UV6A 2QJ4A 1BHTA 4A5TS 5CT1A
chains in the Genus database with same CATH superfamily
2K13X 3SRJA 2HGFA 3HMTA 1GMOA 2Z8WA 4R1CA 4R1BA 5CS9A 5I25A 4UAOA 5CT3A 5CT2A 2Q8BA 5CS3A 3HMRA 5CSQA 2F83A 1YXEA 2YILA 5EODA 4APLA 1GMNA 3HMSA 2J8LA 3MKPA 4R19A 2Q8AA 5COEA 3ZLEA 3ZWZA 1NK1A 4Z0FA 2J8JA 2Z8VA 1GP9A 1I8NA 3SP8A 5CS5A 3HN4A 2YIOA 2X2ZA 5EOKA 1Z40A 3SRIA 2LL4M 1W81A 4Z09A 4APMA 5CP9A 2KL5A 4Z0DA 1HKYA 4IUAA 4DURA 2QJ2A 2Y8RA 5CS1A 4R1AA 4Z0EA 2LL3A 2YIPA 1W8KA 4UV6A 2QJ4A 1BHTA 4A5TS 4YIVA 4YIZA 5CT1A
chains in the Genus database with same CATH topology
2K13X 3SRJA 2HGFA 3HMTA 1GMOA 2Z8WA 4R1CA 4R1BA 5CS9A 5I25A 4UAOA 5CT3A 5CT2A 2Q8BA 5CS3A 3HMRA 5CSQA 2F83A 1YXEA 2YILA 5EODA 4APLA 1GMNA 3HMSA 2J8LA 3MKPA 4R19A 2Q8AA 5COEA 3ZLEA 3ZWZA 1NK1A 4Z0FA 2J8JA 2Z8VA 1GP9A 1I8NA 3SP8A 5CS5A 3HN4A 2YIOA 2X2ZA 5EOKA 1Z40A 3SRIA 2LL4M 1W81A 4Z09A 4APMA 5CP9A 2KL5A 4Z0DA 1HKYA 4IUAA 4DURA 2QJ2A 2Y8RA 5CS1A 4R1AA 4Z0EA 2LL3A 2YIPA 1W8KA 4UV6A 2QJ4A 1BHTA 4A5TS 4YIVA 4YIZA 5CT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K13 X;  3SRJ A;  2HGF A;  3HMT A;  1GMO A;  2Z8W A;  4R1C A;  4R1B A;  5CS9 A;  5I25 A;  4UAO A;  5CT3 A;  5CT2 A;  2Q8B A;  5CS3 A;  3HMR A;  5CSQ A;  2F83 A;  1YXE A;  2YIL A;  5EOD A;  4APL A;  1GMN A;  3HMS A;  2J8L A;  3MKP A;  4R19 A;  2Q8A A;  5COE A;  3ZLE A;  3ZWZ A;  1NK1 A;  4Z0F A;  2J8J A;  2Z8V A;  1GP9 A;  1I8N A;  3SP8 A;  5CS5 A;  3HN4 A;  2YIO A;  2X2Z A;  5EOK A;  1Z40 A;  3SRI A;  2LL4 M;  1W81 A;  4Z09 A;  4APM A;  5CP9 A;  4Z0D A;  1HKY A;  4IUA A;  4DUR A;  2QJ2 A;  2Y8R A;  5CS1 A;  4R1A A;  4Z0E A;  2LL3 A;  2YIP A;  1W8K A;  4UV6 A;  2QJ4 A;  1BHT A;  4A5T S;  5CT1 A; 
#chains in the Genus database with same CATH topology
 2K13 X;  3SRJ A;  2HGF A;  3HMT A;  1GMO A;  2Z8W A;  4R1C A;  4R1B A;  5CS9 A;  5I25 A;  4UAO A;  5CT3 A;  5CT2 A;  2Q8B A;  5CS3 A;  3HMR A;  5CSQ A;  2F83 A;  1YXE A;  2YIL A;  5EOD A;  4APL A;  1GMN A;  3HMS A;  2J8L A;  3MKP A;  4R19 A;  2Q8A A;  5COE A;  3ZLE A;  3ZWZ A;  1NK1 A;  4Z0F A;  2J8J A;  2Z8V A;  1GP9 A;  1I8N A;  3SP8 A;  5CS5 A;  3HN4 A;  2YIO A;  2X2Z A;  5EOK A;  1Z40 A;  3SRI A;  2LL4 M;  1W81 A;  4Z09 A;  4APM A;  5CP9 A;  2KL5 A;  4Z0D A;  1HKY A;  4IUA A;  4DUR A;  2QJ2 A;  2Y8R A;  5CS1 A;  4R1A A;  4Z0E A;  2LL3 A;  2YIP A;  1W8K A;  4UV6 A;  2QJ4 A;  1BHT A;  4A5T S;  4YIV A;  4YIZ A;  5CT1 A; 
#chains in the Genus database with same CATH homology
 2K13 X;  3SRJ A;  2HGF A;  3HMT A;  1GMO A;  2Z8W A;  4R1C A;  4R1B A;  5CS9 A;  5I25 A;  4UAO A;  5CT3 A;  5CT2 A;  2Q8B A;  5CS3 A;  3HMR A;  5CSQ A;  2F83 A;  1YXE A;  2YIL A;  5EOD A;  4APL A;  1GMN A;  3HMS A;  2J8L A;  3MKP A;  4R19 A;  2Q8A A;  5COE A;  3ZLE A;  3ZWZ A;  1NK1 A;  4Z0F A;  2J8J A;  2Z8V A;  1GP9 A;  1I8N A;  3SP8 A;  5CS5 A;  3HN4 A;  2YIO A;  2X2Z A;  5EOK A;  1Z40 A;  3SRI A;  2LL4 M;  1W81 A;  4Z09 A;  4APM A;  5CP9 A;  2KL5 A;  4Z0D A;  1HKY A;  4IUA A;  4DUR A;  2QJ2 A;  2Y8R A;  5CS1 A;  4R1A A;  4Z0E A;  2LL3 A;  2YIP A;  1W8K A;  4UV6 A;  2QJ4 A;  1BHT A;  4A5T S;  4YIV A;  4YIZ A;  5CT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...