3ZX3A

Crystal structure and domain rotation of ntpdase1 cd39
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
406
structure length
399
Chain Sequence
b'NVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGASTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNNSHCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
publication title Crystallographic Evidence for a Domain Motion in Rat Nucleoside Triphosphate Diphosphohydrolase (Ntpdase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 125
structure length 399
sequence length 406
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx3A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx3A02
1SAZA 5KQDA 1P8ZA 4B1ZA 4BR7A 1T44A 1HKCA 4BVOA 4DCHA 1BG3A 3D2EA 2HMPA 4JD2A 5AQUA 5AQFA 1TYQA 1LCUA 4XEIA 3A8YA 3R6MA 3C7NA 3DWLA 4L3QA 4BRPA 3H3OB 2ZWHA 2YHWA 3HM8A 3LM9A 2F9TA 1NMDA 4CI6A 1GLEG 3SMPA 3D2FA 4FWNA 3KZBA 3WQTA 4QS8A 3HZ6A 5AZJB 3ATUA 2CH5A 4CZFA 3U9DA 1MWKA 1H1VA 5EVZA 1TUUA 2E2QA 4AM6A 1HKGA 1Z05A 3FGUA 2A42A 3H6EA 4LC9B 4YDUA 5AQMA 1RFQA 4IO8A 1U6ZA 3IDHA 1R59O 3L6QA 4JHDB 3H1QA 2AA4A 4FOEA 3ZX2A 3QFUA 1WUAA 4PL7A 1G99A 4CJ7A 3DXMB 4H5TA 4I6MA 3MN7A 4A61A 4A2BA 3R8EA 3ID8A 5AFUH 3KHYA 1T6CA 1U2VB 1HPMA 3CJ7A 1MDUB 4FL9A 3TU5A 1IJJA 4FWPA 2GWKA 3M3ZA 1HLUA 5BREA 3SK3A 3VEZA 3VF4A 2AP1A 1HUXA 2CGJA 2YHXA 3LDOA 1XC3A 4BRNA 3CQYA 2QWMA 2A5XA 4CZMA 4H0XB 2I7NA 3ZEUB 2E20A 1KAZA 1JCGA 1MWMA 3EN9A 3P4IA 5AR0A 3UKRB 3DAWA 3B8AX 5FPNA 4KBOA 5AFUA 1HX1A 4EHUA 1QQOA 3LDQA 4MLHA 3MDQA 1YAGA 3A5LC 3DJCA 3WXLA 3WXIA 4IJAA 5AQJA 1SQKA 4MO4A 1DKGD 3LDNA 4H0VB 5E84A 1RDWX 1ATRA 1TUYA 3FE1A 3FZMA 5EXWA 3U4LA 4H0TB 5BR9A 3DXKA 5EOYA 4A2AA 1V4SA 3C7NB 1JCFA 2P9SA 4BR0A 1CZAN 5AQQA 3H3NO 3EKSA 3LDPA 2ZGYA 4BRAA 4HTLA 2ZF5O 3SMSA 2YI1A 3W0LA 3CIPA 1GLCG 4O8KA 2HOEA 1S3XA 4BRGA 3WXKA 5FPMA 1KAXA 1NBWA 2BUPA 4Y0WA 3WQUA 2IVNA 2D0OA 3GBTA 5BRDA 4IXCA 4A62A 3QB0A 1YXQA 4XH5A 5F0XA 2ITMA 5AQTA 1GLDG 1V4TA 4ISGA 1C0GA 3QBWA 4M7YA 3I8BA 4WYBA 1X3MA 3ENHA 4RTFD 3IUCA 5LJWA 2V7ZA 4CZHA 3BF3A 3MN9A 4M7XA 2QM1A 4BR4A 3GE1A 2I7PA 1GLLO 4PKGA 4BQLA 2HF3A 5AQRA 2ASPA 3IFRA 3J8AA 3CJCA 2V51B 3EO3A 1BA1A 4DHYA 4NO7A 3AAPA 1ZC6A 4XH1A 4BVPA 2P9LB 4FO0A 3MCPA 4C23A 2ASMA 3QMLA 5EY4A 3LM2A 4K25A 3VF6A 4BGBA 3MMVA 3CHWA 1NGGA 1QQMA 4H0PA 1MA9B 4CBUA 5AQKA 4CZGA 3M1FA 2GWJA 1KXPA 4E1JA 5JLFA 3WUHA 2P9UA 1X9JA 5LY3A 4FWMA 5AQXA 2FLOA 1YVNA 2PBDA 2Q1NA 2P9NB 3LDLA 4B1WB 3IMXA 5JICA 1K8KA 3QICA 4BG8A 4HWIA 3KVGA 3UKUA 5KPRA 5AQIA 3D7EO 3DXKB 4CD1A 4FWRA 4K43A 4Z94A 2Q31A 1NGAA 2P9SB 3ULEA 4WQ4C 5KPZA 2WUSA 2YJEA 1EQYA 4FSVA 4PKIA 2Q0RA 4EIAA 1NM1A 4IJNA 4CZKA 4BRKA 2P9KA 2VYPA 1NGIA 2QXLA 5BRHA 4RWTA 1NGDA 3HBTA 4F9OA 4BC5A 3O4WA 3MN5A 4FWOA 1D4XA 2Q97A 4CZJA 3VGLA 1Q18A 4BRFA 2DPNA 3VEWA 3WEEB 3GG4A 3O1WA 3FZLA 3EZWA 2VWBA 3O80A 4H03B 2IVOA 2GEMA 3JXUA 4BRLA 3TPQA 4BRDA 1ATNA 3O08A 2FSNA 4FWLA 1LOTB 4GNIA 1GLJO 3FZKA 5BN9A 4FOIA 2Q2RA 5AZJA 1HJOA 3D2EB 3I33A 1XQSC 4JD2B 4K42A 4WQ4A 5AQOA 4BGAA 1TYQB 4XH4A 1ESVA 1NGJA 1RGIA 3O6WA 2E88A 3RSEA 5JLHA 3D2FB 4BRQA 4J8FA 1NGBA 1BOTO 3DXMA 1GLAG 4CBXA 4GY2B 3MN6A 5AQYA 2Q0UA 2FSKA 5AQPA 3SJHA 3FFKB 3OHRA 1SZ2A 3FZHA 2HF4A 1E4GT 3BUZB 4MO5A 4H5NA 2QWOA 2GTDA 3AAQA 5BRFA 1DEJA 3F9MA 4JN4A 1Y64A 2IIRA 4EFHA 3QBXA 4PL8A 5E26A 4BRHA 2H3GX 1ATSA 2P9IA 2YCHA 5LJVA 4CZLA 3VEOA 4B1XB 3GOIA 4BC3A 4BRIA 2A40A 4I6MB 5AQZA 4BREA 3CERA 3CJ1A 3VF2A 4BROA 1BDGA 1DGKN 1K8KB 4BQZA 5ADXH 2FF6A 4BR9A 3CJBA 4CBWA 3CETA 2FSJA 5B8HA 3VENA 1X3NA 5ELZA 4CZIA 5BN8A 3ULEB 1BO5O 5AZIA 2EWSA 3O8MA 3QFPA 2P9PA 1NLVA 3G25A 4IZ9A 4QS9A 2W41A 2Q36A 3CJAA 3EL2A 2F9WA 5AQWA 3VPZA 4DQ8A 1BWFO 2P9KB 2QWNA 4ISEA 5AQSA 3VEVA 5AQLA 4K41A 2QW9A 2QWRA 4QS7A 4M63C 1T6DA 1XUPO 2E2PA 3O1BA 4BC4A 3VEXA 5ADXA 1KAYA 2E8AA 2VCPA 3QDKA 3VOVA 1ZXOA 4EAHD 2NZTA 4H5WA 1WOQA 3U8XA 4JNEA 3VGMA 2NRHA 3C0BA 4FWSA 5AQGA 4H5VA 3A0IX 4BR5A 1Z6RA 4WQ5C 5AQHA 3AY9A 3VERA 3WT0A 1IG8A 3WXJA 1C0FA 3GDQA 3BF1A 4H0OA 1BUPA 5AQVA 1GLBG 1QZ5A 2YJFA 4O5FA 3ZX3A 2BTFA 4FPBA 5KPTA 5KQ8A 5TKYA 3RSEB 4RCHA 4B9QA 5AQNA 4MLEA 3ZX0A 3ZETA 4BRCA 4CZEA 1NGEA 3VESA 3FZFA 5FPEA 3W3DA 5EX5A 2ZGZA 1BA0A 2E2OA 3SLCA 3VGKA 2GUPA 2V7YA 5BPLA 2OANA 3H45C 3LL3A 3FR0A 2CGLA 1HKBA 4NB4A 1YUWA 2A3ZA 2GELA 2V52B 2FF3B 2ASOA 3HTVA 2P9IB 2QWLA 3ATVA 4WQ5A 3H46O 3VETA 4AM7A 1QZ6A 4FWKA 2E1YA 2A41A 1J6ZA 2J4RA 2P9LA 3CI5A 4EHTA 5F1XA 1E4FT 5CE3A 1GLFO 2D0PA 2E1ZA 3BP8A 5AZIB 4FWQA 1QQNA 4DB3A 2E2NA 3A5MC 2P9PB 3M6GA 4JHDA 2NLXA 3FLCO 2QWQA 2A6AA 4JAXA 2UYTA 2P9NA 3R9PA 5JMVA 2IVPA 4BG9A 4BR2A 5BPNA 3U9ZA 5FPDA 2W40A 1OKJA 1U2VA 4IWVA 4CD3A 3H1VX 4H5RA 5F2RA 1NGFA 1S22A 2QWPA 3S41A 3ENOA 5BPMA 2CH6A 2FXUA 3O5BA 2P9UB 1JCEA 3A5OC 4B1UB 3ZEUA 1NWKA 3GL1A 3UE5A 3L4IA 3UB5A 3JS6A 3BEXA 1NGCA 4H0YB 3HI0A 4ISFA 3AARA 2CGKA 3HSCA 3VEYA 3UKUB 3CQXA 1ZBSA 2YHYA 1QHAA 2PAVA 1NGHA 4FPAA 5I9EB 3UKRA 4B1YB 4PKHA 3MK6A 2KHOA 3WEEA 3L0QA 3A5NC 4BRMA 3EKUA 1BU6O 4YDUC 3CJ9A 2D4WA 3ZETB 4BC2A 2D1KA 4B1VA
chains in the Genus database with same CATH superfamily
3QEVA 4N56A 4FM2A 3E1YA 1WBDA 2E6LA 3CMAN 1HKCA 3CCQN 1YT3A 2HMPA 4JD2A 1C6VA 3R6MA 1HMVA 1DT9A 5T7BA 3H3OB 4C8OA 2YHWA 2F9TA 4NLCA 1GLEG 3SMPA 4FLZA 3PV8A 2AJQA 3AVIA 3KK2A 2IAJA 3A2FA 4JI4K 3VQ9A 5EVZA 4FM1A 2E2QA 4DFJA 4KB1A 3C94A 3FGUA 2A42A 4LC9B 5AQMA 2IDOA 5J2PA 4M3WA 1LAVA 4ILJA 3CFOA 5GIPA 4GV3A 4JHDB 3QFUA 5C25A 3DXMB 3AA4A 4H5TA 3MN7A 1JLAA 3QEWA 4A61A 4Z4EA 4A2BA 5AFUH 3KHYA 1HPMA 3IAYA 1WSJA 4KHNA 4JKBA 1HLUA 2EX3A 3AO3A 4RW7A 3VEZA 1EP4A 3VF4A 1HUXA 3LDOA 4I9QA 4BRNA 1I94K 3QIPA 1J9AA 3ZEUB 3CM6A 5GADP 3HVTA 1ZBHA 5KI6A 1JCGA 4A5BA 3SQ0A 1OVQA 3M5RA 1MWMA 1RDBA 2LSNA 4DTOA 1TKZA 2HHSA 4WF9L 1CZ9A 3DM2A 4MLHA 3MDQA 2YKNA 3DRSA 4Z4FA 1DKGD 1SUQA 3N4PA 4KO0A 4DR6K 1SV5A 1RTJA 1RDWX 3TAPA 1D9FA 2E4LA 4H0TB 3LAKA 3HYFA 4N47A 1J5EK 3HPOA 1IKWA 1S6QA 4AHVA 1CZAN 3F2KA 1FKPA 3BZKA 1VQ6N 1Q82O 3VQQA 3L3UA 3OYKA 1FK9A 2HOEA 3ZSOA 2O8FA 3NH1A 3VN5A 3SAFA 5FPMA 3CC4N 3P31A 1XMQK 4JRPA 5BR8K 3WQUA 2IVNA 5FROA 4A62A 4DV4K 3LPTA 5MLCQ 1YJ9N 2ITMA 5AQTA 4OKJA 4CJSA 1IBKK 4KFBA 3DOLA 4IG3A 1VRTA 2OA8A 4ISGA 3QBWA 4CIFA 3AA2A 2BGGA 1TGOA 2V7ZA 2WFBA 4L8RB 3L4QA 4HUGA 3GE1A 2I7PA 3S3OA 4ILHA 4B9TA 1VQ9N 4OVLA 3V9UA 1WN7A 4FCYA 3C6TA 4DQRA 2HBKA 4NO7A 4Z4GA 3OYGA 1ZC6A 3PO4A 3SAGA 4FO0A 1SL1A 2DFFA 2ASMA 5EY4A 3DMJA 4FZYA 4E1MA 1MA9B 4CBUA 1ASVA 5AQKA 1SKSA 2HBMA 2F7TA 3VQ6A 4JI8K 2HBJA 1L3UA 1S1WA 1X9JA 4LF7K 3M8QA 5LY3A 4OJRA 2QXFA 3L2QA 4J2DA 3IMXA 5JICA 2A1SA 4YY3K 4HWIA 3S9HA 5KTQA 4JKGB 4CK2A 3D7EO 4F8RA 2NRZA 2P9SB 2O8CB 4JI7K 1VSHA 4EIAA 4LH4A 3KTQA 1J5OA 3OYEA 4BRKA 2UXCK 2NRWA 1LWFA 3DLEA 3OA9A 2QXLA 4CGGA 3O3FA 3TSPA 4F9OA 1L3TA 1N36K 4Q5VA 4JRQA 1SS6A 3MN5A 3SI6A 1WSEA 4RW8A 1YJNN 4JKCA 3U3GA 1KVCA 2XHBA 1RDAA 3EZWA 1ASUA 4H03B 2GEMA 3JXUA 4BRDA 1KCFA 2GUIA 3MEDA 3ZT3A 4KTZA 3AA5X 1LOTB 4GNIA 3AVMA 5BN9A 2Q2RA 3D2EB 1K9MO 3ZSRA 4CGDA 3CCJN 1NJIO 1RGIA 3UIQA 1Z25A 4CW7B 3NVMA 4CE9A 1TAUA 1VQKN 3T69A 1QVFM 3V9WA 1YF5L 4JK8A 4GY2B 3S3NA 5AQYA 2FSKA 3THVA 3FFKB 2D0AA 5GAHP 2O8EA 3NGZA 1E4GT 1IBLK 2BANA 4DU4A 3SQ2A 1DEJA 3CC7N 4JN4A 2IIRA 4E3SA 1ATSA 3QNNA 1MU2A 3GOIA 4ILGB 2HMIA 4HCBA 4BREA 1X1PA 3ID6A 1K8KB 1ILYA 3SQ1A 1NJWA 3CJBA 4CBWA 4FLXA 4B9NA 3NCIA 3CETA 2E5LK 5B8HA 3ZYYX 1Z26A 4CZIA 5BN8A 1TK5A 4KTQA 3NF7A 1JKHA 3QFPA 4TSXA 3C65A 2P9PA 5C24A 2W41A 4F2SA 4DR1K 3HPGA 3CJAA 3RMDA 4FK0A 3O4NA 2F9WA 2WONA 3CQ8A 3K5LA 3ITHA 1L5UA 4LF6K 3B6PA 4QS7A 3ZSQA 2HW3A 3T7ZA 2E2PA 5CYQA 3O1BA 4FJ8A 2VCPA 2UU9K 5CYMA 3RMBA 4EAHD 2NRHA 3C0BA 3M8RA 3A0IX 4BR5A 1Q86O 4XIUA 3RMCA 4H0OA 2Z1HA 1F21A 5LMNK 5AQVA 4KHYA 4OLBA 5FDLA 2BTFA 5KPTA 3RSEB 1ITGA 4RCHA 4B9QA 4PA1A 4MLEA 2IC3A 4CJQA 4BRCA 3VESA 1BI4B 3FZFA 3W3DA 3I55N 5EX5A 1HYSA 4ZTJA 1HJRA 3E9PA 5HL7L 1BA0A 3KD1E 1RILA 4O44A 4E7LA 3PO5A 4JI2K 2OANA 3E01A 4H8KA 4CGIA 3ZLJA 2CGLA 1HKBA 2HHWA 3AV9A 2FF3B 5C10A 1D8YA 2ZQBA 2B5JA 4C1NK 3EYZA 3DLBA 4WQ5A 4W5TA 4GVEA 3MWTA 4JKAA 3L3VA 4Z4IA 4YNQA 3CI5A 2P9LA 2J4RA 1XNRK 5I3UA 1GLFO 4NXMK 4G1QA 2VGNA 3BP8A 3P83D 1VSMA 1U49A 3AVHA 2OZMA 4FVUA 3A5MC 4LFBK 2NLXA 3E66A 1T7PA 3CMEN 2XRIA 4BDPA 5M1QA 2UXDK 3JAMO 4U7BA 4F2RA 1IG9A 4E0DA 2O8BB 3R9PA 1RT3A 5JVGL 1C1BA 4CF9A 4IWVA 1KFSA 1LAWA 3OYBA 4X64K 1U45A 3NMUA 1NGFA 4FJMA 3S41A 3ENOA 5BPMA 3VQ5A 3A5OC 1KFDA 3UB5A 1NGCA 4X62K 1ZBSA 2WC9A 4CJ3A 4O0IA 4J2AA 3CYMA 4GVMA 1NMNA 3UKRA 4B1YB 4DKWA 3B6OA 1VSFA 2KHOA 5HOOA 3L0QA 3A5NC 3EKUA 1BU6O 4C8NA 2HNDA 5C15A 3CJ9A 4ELTA 3OBWA 2XY6A 1HNZK 3V1RA 4FK2A 1SAZA 5KQDA 2ETJA 1S9EA 1P8ZA 3NGIA 4B1ZA 3PSFA 1ZBIA 2VGMA 3RTVA 2D0CA 4RG8A 4U67L 1TYQA 1VQ8N 4N76A 3IS9A 1R0AA 1JXEA 3A8YA 2G8HA 1IKYA 3DWLA 4L3QA 2ZWHA 1NMDA 4AHRA 1DTTA 4DR3K 3D2FA 3PX6A 1W2BM 4I9LA 3KZBA 4B9UA 2JWKA 4O4GA 4JKEA 4QS8A 3HZ6A 3ATUA 2CH5A 2ZE2A 4CHYA 3T1AA 4DLGA 1H1VA 1RT4A 3OTOK 1HKGA 1U6ZA 3IDHA 1R59O 3TABA 3L6QA 3MCAB 3H1QA 3ZX2A 2NRRA 3P5JA 4CJ7A 4BWJA 2KTQA 4CCHA 4FJJA 3R8EA 2HB5A 1T6CA 2KKZA 3OYNA 4FL9A 1MDUB 4O55A 3ZSYA 4DTJA 3THWA 1BGXT 5BREA 4M41A 2YHXA 4MDAA 4CHPA 3K5NA 1DTQA 3CQYA 2A5XA 2I7NA 3HM9A 2E20A 4JKDA 3AO5A 1KLNA 4BY9C 2HHHK 5HRRA 3DOKA 5GAEP 3P4IA 5AR0A 3B8AX 2Q3SA 4KBOA 4AHCA 1X9SA 4GKKK 3BZCA 5HRNA 3G6EN 3S3MA 5M1PA 3TSUA 1M1KO 3DJCA 4OPAA 3NVKA 4IJAA 3QLHA 1SQKA 3NAEA 1TKXA 5E84A 4Z0UA 4OPKA 2WTUA 1Q9XA 1S9GA 4KKOA 4ID5A 3U4LA 2F8SA 4DWIA 5EOYA 1VQPN 4A2AA 1BCMA 1V4SA 1J53A 1BL3A 4BR0A 2QKBA 3AVNA 4DV5K 3H3NO 4HTLA 3V6DA 3W0LA 3SMSA 3SUNA 2HNZA 4HTUA 3ZSVA 1KAXA 2BUPA 3VQCA 3TANA 4PUOA 3MXJA 1UOCA 3MEGA 3CD6N 2G8KA 1YJWN 3EEQA 3K59A 1GLDG 1V4TA 1BQMA 3KK1A 3HP6A 1FKOA 4KHUA 3I8BA 3ENHA 1I39A 1NNEA 3KIOA 4CZHA 3MN9A 2QM1A 4BR4A 3SAHA 3G71N 2HBLA 4NCGA 5J2NA 1WSGA 1GLLO 4PKGA 3VTIA 3OYFA 4BQLA 3ALYA 2HF3A 4LF9K 5AQRA 1M90O 4IOXA 4CFDA 4DSEA 2V51B 1BA1A 4UY8O 3ZSZA 3SV3A 2OTJN 4XH1A 4BVPA 4EZ6A 3G0ZA 4CEBA 4IO9L 1QQMA 4H0PA 1RBSA 4OX9K 3J7YP 4FLWA 3WUHA 3V9ZA 4DV7K 2P9UA 2W6LA 4FWMA 5AQXA 2FLOA 1JLGA 1YVNA 2PBDA 2P9NB 2PY5A 4BWMA 3QICA 2HHUA 3UKUA 2KQ2A 3QEXA 1OH5A 4FWRA 4K43A 1NGAA 3ULEA 1IBMK 4WQ4C 4DFPA 3J7ZO 1EQYA 4FSVA 3HO1A 2HHVA 4KB0A 4RW6A 4RW9A 1X9WA 4DSLA 1RT2A 4YOUA 2VYPA 3D0PA 2O8FB 4KRFA 1XHXA 4RWTA 3Q7BA 2W42A 4BC5A 1VQ7N 5M1NA 4JYAK 4JS5A 2DPNA 1OH8A 3WEEB 3LWLA 1Q8IA 3THYB 2VWBA 3O80A 3CCVN 1RBVA 4HCCA 2IVOA 3DLKA 2XO7A 2FBYA 2ATQA 2FSNA 2DY4A 3IRXA 4FOIA 1HJOA 3I33A 1XMOK 3K57A 3AVJA 1GOBA 1ESVA 3DRPA 1K8AO 4I2QA 4A57A 2VG6A 4DUZK 4CJKA 3HOTA 1N6QA 2PZSA 4W5RA 2X74A 4BRQA 1NGBA 4FJGA 4CJFA 3DXMA 3O3HA 1N33K 1VSJA 4DTSA 5IT9O 5AQPA 3D45A 1SZ2A 2NUBA 1QQCA 4B8CA 1JJ2M 3BGRA 4H5NA 5BRFA 4EFHA 5DM7L 4PL8A 4MFBA 4BRHA 4B3TK 2P9IA 5LJVA 4HUFA 3ZT4A 1RT6A 3PX4A 2UUCK 4BRIA 4I6MB 5AQZA 3CERA 3VF2A 4BROA 5JS2A 4B9LA 3LAMA 3DLGA 1A5XA 4QAGA 2FSJA 5E41A 5ELZA 2EWSA 4I7FA 1N32K 2O4IA 1VSIA 1TL1A 2Q36A 3HPHA 3M8PA 5AQWA 4N5SA 2QWNA 3KLIA 4ISEA 5AQSA 3DLLL 1HPZA 2RN2A 4CEEA 4K41A 4NCAA 2RPIA 4CJVA 4K0KK 1XNQK 2ITGA 3P39A 1G15A 4LF4K 2WBNA 3VOVA 2NZTA 1WOQA 3QEPA 5AQGA 4CERA 4X66K 1GOAA 4BDZA 4LH5A 5DM6L 1Z6RA 3VERA 2P51A 1C0FA 3C6AA 4Z4CA 4CVNE 2DTUA 4CEDA 1KD1O 3KWIA 1QZ5A 4O5FA 4JI6K 3SV4A 1RBTA 1QSYA 1C1CA 3I0SA 5K14A 3SUQA 3ZETA 1IKVA 1Q9YA 2OPQA 5FPEA 4DQSA 3TR8A 3QO9A 1WSHA 2OCEA 3AVBA 2E2OA 4AF1A 2HSTA 1QTMA 2UXBK 4JKFA 3VGKA 2YX6A 2O8EB 5HBMA 1L3VA 2V7YA 1VHXA 1BHLA 1NK4A 3LL3A 4IEIA 1X9MA 2GELA 4B08A 4BE1A 3CFRA 1HYZA 3H08A 2QWLA 3ATVA 1UAXA 1ZBUA 2YNHA 4JEPA 4AM7A 3V1QA 2YHAA 1EETA 3CM5A 4CEAA 3IKMA 2A41A 1J6ZA 4CIGA 4EHTA 5F1XA 3MAQA 4AHSA 3TAGA 4LF5K 2E1ZA 3AGKA 2HHTA 3R1XA 2D5RA 2I5JA 4DB3A 2P9PB 3M6GA 2O8DB 1T03A 4KH4A 1KVBA 1NK9A 2F8TA 3CPWM 3QESA 2A6AA 4NYFA 4JAXA 4X65K 2FBTA 3RVCA 2RHKA 4CJWA 3CCUN 1NOZA 2IVPA 1EXQA 4BG9A 3U9ZA 1U2VA 4JKGA 3OW2M 1HRHA 5F2RA 4GV9A 4KREA 2QWPA 3U6FA 1K6YA 3OYDA 3TAEA 4IFEA 4FZZA 1NWKA 3UE5A 3L4IA 1FW6A 2NRXA 2YNIA 3QIOA 1XC9A 3HI0A 3K5OA 3HSCA 4PQUA 3SCXA 4CGFA 1LWEA 2F4VK 5I9EB 3MK6A 1RTIA 4CJPA 4ZTFA 4DUYK 3LZIA 4CEQA 3TAMA 1P90A 4R79A 4BDYA 3TSQA 5GIOA 1N5YA 4F3TA 3L2RA 4YDUC 4DQPA 1VSDA 3AA3A 2KW4A 5CZ1A 1HNWK 4BVOA 3TI0A 3D2EA 5AQUA 3WNHA 5AQFA 1YHQN 1VSKA 1SKRA 3C7NA 4OPJA 3LM9A 1JL1A 3HT3A 5HLFA 4FWNA 1TK8A 1S1XA 3E9LA 5AZJB 5CHIA 3OYIA 1NK8A 4B3MK 3SYZA 3J80O 1QSSA 1FXXA 4AM6A 3H6EA 3K58A 3KK7A 1C0UA 3LPUA 3C6UA 5FLXO 2ZJPL 1U48A 4C1NI 3AVLA 3OY9A 1WUAA 3K5MA 1G99A 4OGEA 3SBGA 2JGUA 3SQ4A 4ELUA 2PYLA 4FJHA 3TU5A 1IJJA 4FWPA 2OYQA 2GWKA 4DS4A 1HQUA 2JWLA 5CZ2A 1XC3A 4M42A 2QWMA 4FJNA 4CZMA 3KLFA 3SPYA 1KAZA 5LMUK 2Z1GA 3MECA 4DR7K 3EN9A 3DLRA 3UKRB 3VQAA 5FPNA 4H4MA 4DTNA 1VQLN 5FRMA 4EHUA 4E19A 4CF0A 4CEZA 4DR5K 1YAGA 3A5LC 2ZJRL 1VQ4N 3WXIA 2G8WA 5KGWA 3SBTA 4MO4A 4DG1A 3O3GA 4JK7A 2NNWA 3FE1A 3FZMA 1JL2A 4G9ZA 3DXKA 1EX4A 1JCFA 1QHTA 1U04A 4NLBA 4CJ5A 3ISNC 2VQFK 1N8RO 3IG1A 2DFHA 1D5AA 3C6HA 3V1OA 3L2VA 2HHXA 3EKSA 1JLQA 5M1OA 1NJZA 1BI4A 4DSFA 2ZF5O 3F9KA 3CIPA 3QETA 4YOYA 3CF5L 4M3XA 1S3XA 4YOTA 4BRGA 3WXKA 4HVJA 4KHPK 2HVIA 4DF8A 1KVAA 1RCHA 1NBWA 2F96A 4Y0WA 5BRDA 4N41A 4IXCA 3QB0A 1YXQA 4XH5A 1XWLA 4E7KA 3F73A 1NKBA 3HL8A 4WYBA 3MXIA 1X3MA 5LJWA 3BF3A 4DS5A 4QCLA 2YHBA 2G8IA 4IOCL 4MQ3A 4CJ4A 3LDSA 3V9SA 3AVFA 3LZJA 2ASPA 2QK9A 4AHTA 3IFRA 1XHZA 4Z4HA 4IBNA 1B92A 3AAPA 1S72N 3O9SA 4O5BA 3MEEA 3HXMA 2O8BA 3LP2A 2QEXN 3MCPA 3O9RA 3LM2A 2QA4N 3MX2A 4K25A 1RBRA 4BGBA 1NG9A 3MMVA 3CHWA 1NGGA 3RRGA 2ZD1A 4Y1DA 5C2FA 3NBPA 3THXA 3M1FA 4WE1A 4DV2K 4DSKA 1HNXK 3VQ8A 1WNSA 4E1JA 4J2EA 2YV0X 4JI5K 3I8DA 4DFKA 3ZT1A 3LDLA 4B1WB 3SNNA 3R3LA 4AHUA 4KPYA 4EP4A 3KVGA 1TL3A 1KRPA 1WBBA 4CD1A 1JLFA 4Z94A 2DFEA 5J1EA 5KPZA 2OPSA 4DSIA 4M45A 2WUSA 3SUOA 4PKIA 3KLHA 2Q0RA 2PYJA 3OYLA 2P9KA 1YIJN 3DRRA 3O4WA 1EWQA 4FWOA 3JSMA 2Q97A 3VGLA 3SJJA 4BRFA 1Q7YO 4ID1A 3VEWA 3GG4A 2G8UA 2W6KA 3F5TA 4IFYA 3MWPA 2OPRA 3AVAA 4MDBA 4FW1A 4BRLA 2KFZA 3TPQA 3AO1A 2YNGA 3O08A 2Y1JA 1LWCA 4FWLA 4CF1A 1NJYA 3FZKA 3CCRN 1XQSC 4JD2B 4LY7A 4WQ4A 3I56N 1D9DA 4BGAA 1WAFA 1EWRA 2A1RA 3I0RA 2WOMA 1FJGK 1WLJA 3O6WA 3FFIA 1TKTA 5IWAK 5JLHA 4JI1K 2XY8A 4B3RK 4J8FA 4FJKA 3T3FA 4GMJB 3AVCA 2IGIA 3MN6A 3EZ5A 3SJHA 1HNIA 3FZHA 3U3YA 3L8BA 2Z1IA 1WSIA 3VMFB 2QWOA 4DTXA 3F9MA 4CF2A 4DV6K 4DMNA 3QBXA 2VG7A 2RE2A 2H3GX 4CZLA 4H4OA 2A40A 3PX0A 4F3OA 3DI6A 1BDGA 3AO2A 4GV6A 2BDPA 4DTMA 3DYAA 1DGKN 4IKFA 4BR9A 4FW2A 4K8XA 4IEEA 1X3NA 4KTWA 3ULEB 5AZIA 4FLYA 4KH5A 4BE2A 3G25A 4IZ9A 2HHQA 3CC2N 4W5NA 3VPZA 3QNOA 1VQ5N 4B3SK 4A5AA 4KHWA 4E7JA 3O9UA 3J7AP 3VEVA 3NHGA 5AQLA 2QW9A 2QWRA 3ASMA 1T6DA 1XUPO 3RMAA 3ZSXA 5ADXA 1KAYA 3NE6A 3TWHA 4LSNA 1C1AA 2NRTA 4WFBL 4M3ZA 3K9KA 3QDKA 3OYJA 1QS4A 1ZXOA 2PFUA 4H5WA 3U8XA 4Q0BA 3VGMA 3VTHA 1WB9A 3RRHA 5AQHA 1VK0A 3VQEA 4R5PA 3WT0A 1IG8A 3GDQA 3BF1A 4FVMA 1RDCA 1RDUA 1BUPA 2VWJA 1HNVA 2O4GA 1GLBG 3KLEA 2GV9A 4WCEL 5J2QA 4RW4A 3KJVA 4DU3A 4DSJA 4M3YA 4DV1K 4IDHA 2OTLN 4F4KA 3NDKA 4KI6A 5D3GA 3VQDA 4EZ9A 3HJFA 4CGJA 5BPLA 3FR0A 4JKHA 1NJXA 1YVUA 1YUWA 1RNHA 2V52B 4DR4K 2ASOA 3HTVA 4BE0A 4FJ7A 2P9IB 4KI4A 3N4QA 4YORA 4OKKA 4E7IA 3QINA 1HYVA 3TTCA 3QERA 3P38A 3H46O 4CGHA 1O13A 4GW6A 1E3MA 4KH6A 1RT7A 5CE3A 1CXUA 2D0PA 3JYTA 3ZSWA 2FBXA 5SZTA 3LANA 4E89A 3VA0A 1QQNA 1YTUA 4JHDA 1TAQA 1S1TA 4CJLA 2QWQA 5H1SQ 2P9NA 5JMVA 5BPNA 4BR2A 3LP0A 5FPDA 4IDKA 2W40A 4CD3A 3KKRA 2OPPA 4FJ5A 1S22A 4KV8A 1SKWA 1W0HA 2CH6A 2FXUA 3O5BA 2VG5A 1YI2N 1JCEA 4B8AB 1TV6A 3HP9A 3ZEUA 3QEIA 3JS6A 3BEXA 3EY1A 4ISFA 3AARA 3VEYA 4GKJK 3CQXA 3ENBA 2YHYA 3O9QA 3PIOL 4YFUA 4FPAA 3ULDA 5EU7A 4PKHA 3VQ7A 3WEEA 5J2MA 4BRMA 3AGRA 2E6MA 3THYA 2D4WA 3ZETB 4BC2A 3KWGA 4E1NA 1TVRA 3VQBA 5KRTA 4B1VA 5C2DA 1OH6A 3PLAA 4BR7A 1JLEA 1T44A 4DCHA 1BG3A 1Q81O 1J54A 1RT1A 1VQNN 1TKDA 1LCUA 4XEIA 1U47A 4M3UA 4BRPA 1IO2A 4CFCA 1S5JA 1NKCA 3HM8A 4CI6A 4O0JA 3L2WA 2GX9A 4E7HA 4LSLA 3WQTA 3SZ2A 4CZFA 3U9DA 1MWKA 1TUUA 1Z05A 4YDUA 1BISA 5M1FA 1RFQA 4IO8A 5C0YA 2B4JA 4ICLA 1ZYQA 2AA4A 4FOEA 1XI1A 4PL7A 5HRPA 2OZSA 4I6MA 3Q7CA 4DU1A 1KC8O 1KTQA 3ID8A 3VQPA 2P5OA 1BQNA 1RBUA 1U2VB 4HHTA 3CJ7A 4CESA 4OO1J 3E9OA 3M3ZA 3SK3A 4AILC 4CHZA 2AP1A 2CGJA 5KGXA 4FLTA 3HOSA 4H0XB 3SPZA 1HR0K 5JS1A 4UQGA 1QVGM 4IG0A 3OYCA 1JXBA 3EE9A 3O4QA 3OJUA 4CJRA 3DAWA 4NCBA 2UUAK 1UA1A 1T05A 1VQON 5AFUA 1HX1A 1QQOA 3LDQA 4W5QA 3OYMA 3WXLA 5C42A 3WNGA 5AQJA 2B6AA 3AO4A 3LDNA 4FM0A 4DTUA 3ZT2A 4H0VB 1BIZA 3T19A 4PY5A 1TUYA 1ATRA 2YKMA 4FJIA 3T1HK 5EXWA 5BR9A 1N34K 2JLEA 4ZHRA 3C7NB 2P9SA 2O8CA 4CFBA 1SL2A 1REVA 3OYHA 5AQQA 1W9HA 3LDPA 3WXMB 3CG7A 2ZGYA 4BRAA 1VSLA 2YI1A 3J81O 1GLCG 5I42A 4O8KA 1YITN 1QE1A 4M3RA 4IOAL 3G4SN 4DF4A 2NRVA 1LW2A 4Y1CA 4PHTX 1JLBA 3DLHA 2IS3A 5DK5A 4B9VA 1O1WA 3V4IA 2D0OA 4CEOA 3GBTA 4NYNA 5HRSA 5F0XA 5CR4A 4CJUA 4JK9A 1T8EA 3CPEA 5GAGP 1L3SA 3PUFA 4KHSA 1C0GA 1IKXA 4M7YA 2D0BA 2R7YA 1T3VA 3WNEA 1HQEA 2BE2A 3ZT0A 4RTFD 3IUCA 1ASWA 4FLVA 2VWKA 4M7XA 1IV0A 5A2QO 5LL6Z 4OLAA 2O8DA 4FLUA 4A59A 3SUPA 3J8AA 3AVGA 3G10A 3CJCA 3EO3A 4DHYA 3TTFA 1Y97A 2P9LB 4C23A 3QMLA 4NXNK 2FC0A 4CFAA 3VF6A 1K73O 4CZGA 1TK0A 2GWJA 1KXPA 4LFCK 5JLFA 2VQEK 1S1UA 2QKKA 5FRNA 3HVRA 1S1VA 2Q1NA 4C8MA 3NFAA 4K8ZA 1K8KA 4BG8A 4DFMA 5KPRA 5AQIA 5SWMA 3DXKB 4FZXC 2Q31A 4DR2K 3EE8A 3HRGA 3K0SA 3LWMA 1KSPA 2YJEA 4WFNL 1CLQA 4DTPA 4HUEA 1UA0A 2GBZA 1NM1A 4IJNA 4CZKA 1I3AA 4IFVA 1CXQA 2IOCA 1NGIA 5BRHA 3NF9A 3OYAA 1NGDA 3HBTA 3NF8A 4C8KA 1LW0A 4CECA 4DV0K 1D4XA 4OKEA 4CZJA 1Q18A 1NU0A 2RF2A 3O1WA 3AVKA 1A5WA 2XY7A 4DQIA 1C0MA 3FZLA 4LFAK 3CCMN 2P5GA 4CK3A 2QTDA 3V81A 4CJEA 1ATNA 4M3TA 1GLJO 5AZJA 5HROA 1SL0A 3OJSA 2ZJQL 3OVNA 1KQSM 4K42A 5AQOA 3L2UA 4CIEA 1TYQB 3MX5A 2HNYA 1YTAA 4XH4A 4CK1A 1NGJA 4ELVA 4OPHA 1RTDA 1OVYA 4DLEA 2E88A 3RSEA 3OBYA 4LD0A 2G8VA 4FJLA 1RT5A 4EP5A 3KD5E 3D2FB 4YHHK 4O8UA 4CHNA 3TARA 1BOTO 1GLAG 3LP3A 3PY8A 5KRSA 3K2PA 3BDPA 3O9TA 4CBXA 4KHQA 2Q0UA 1VQMN 1RDDA 3OHRA 2HF4A 3BY5A 3D6RA 3BUZB 4MO5A 3NH0A 2GTDA 3AAQA 3P1GA 3THXB 1Y64A 5E26A 1BCOA 2YCHA 4CEFA 3CCLN 1VSEA 3VEOA 4JI3K 4B1XB 1NK5A 1W7AA 4BC3A 3C95A 4FK4A 3PSIA 1WSFA 3MXMA 3CJ1A 4V19S 4FXDA 1QSLA 4BQZA 3LALA 5ADXH 2FF6A 4AH9A 4C8LA 3LP1A 2Y1IA 3OS1A 3VENA 1WAJA 3THWB 4CJTA 1BO5O 3VA3A 3O8MA 1NLVA 4QS9A 3PIPL 3EL2A 4DQ8A 4J2BA 5TKWA 1BWFO 2P9KB 3NF6A 3OS0A 5HP1A 1LV5A 2P1JA 4M63C 3TTDA 1CZBA 3ZCMA 4DQQA 2KLAA 4DTRA 3K9JA 3T1YK 4BC4A 3VEXA 4YOXA 2Z1JA 4CF8A 2E8AA 5GINA 2ZM6K 4JNEA 4FWSA 4JI0K 1NK6A 4QOZB 4H5VA 4B9MA 1KLMA 4WQ5C 3AY9A 4OGCA 1VAZA 3WXJA 3NH2A 4JLHA 4CHOA 2YJFA 3ZX3A 4FPBA 5DMRA 5KQ8A 5TKYA 5C12A 2RKIA 5AQNA 1NKEA 3ZX0A 4KAZA 4CZEA 1NGEA 3KK3A 3M8SA 4FJXA 2ZGZA 2X78A 1S6PA 4FYDA 3SLCA 2HVHA 3TAQA 1U4BA 2G8FA 2EHGA 2GUPA 4AQYK 2UUBK 3H45C 3TAFA 2X6SA 4NB4A 4B9SA 2A3ZA 4DV3K 1VRUA 3CCSN 4FJ9A 4YOWA 5JVHL 5CY4A 1OH7A 1DLOA 3VETA 1QZ6A 4FWKA 1C0TA 3WNFA 4YOVA 2E1YA 3KKSA 1UWBA 1IH7A 2FBVA 1E4FT 4W5OA 1ZBFA 1EKEA 5AZIB 3OS2A 4FWQA 3HSTB 2E2NA 1GOCA 1NK7A 2KFNA 3FLCO 5M1KA 2QI2A 3NGYA 1B9DA 1ZBLA 2UYTA 1NOYA 3CFPA 4LF8K 4BACA 1OKJA 5AJ3K 2KZMA 4WFAL 2KZZA 3RR7A 3RR8A 3H1VX 4H5RA 4PWDA 1A5VA 4JS4A 3CCEN 3V9XA 4JV5K 1BIUA 4CHQA 2P9UB 3VQ4A 4B1UB 2XY5A 3GL1A 2X6NA 1NK0A 4H0YB 2CGKA 3UKUB 2BH1A 3RWUA 1W97L 3KLGA 1QHAA 1EO1A 2PAVA 1NGHA 1JLCA 1RTHA 4B3OA 3CXCM 4I2PA 3HK2A 2D1KA 1B9FA 2YNFA
chains in the Genus database with same CATH topology
1SAZA 5KQDA 5C2DA 3PLAA 1P8ZA 4B1ZA 4BR7A 1T44A 3E1YA 3CCQN 3CMAN 1HKCA 4BVOA 4DCHA 1BG3A 3D2EA 2VGMA 1Q81O 2HMPA 4JD2A 5AQUA 1VQNN 4U67L 5AQFA 1TYQA 1VQ8N 1YHQN 1LCUA 4XEIA 3A8YA 3R6MA 3C7NA 1DT9A 3DWLA 4L3QA 4BRPA 3H3OB 2ZWHA 2YHWA 3HM8A 3LM9A 2F9TA 4NLCA 1NMDA 4CI6A 2GX9A 1GLEG 3SMPA 3D2FA 4FWNA 1W2BM 3KZBA 3WQTA 2JWKA 3E9LA 4JKEA 4QS8A 3HZ6A 5AZJB 3ATUA 5CHIA 2CH5A 4CZFA 3U9DA 1MWKA 1H1VA 5EVZA 1TUUA 2E2QA 4AM6A 1HKGA 1Z05A 3FGUA 2A42A 3H6EA 4LC9B 4YDUA 5AQMA 5M1FA 3KK7A 1RFQA 4ILJA 4IO8A 1U6ZA 3IDHA 5C0YA 1R59O 2ZJPL 5GIPA 4GV3A 4C1NI 3L6QA 3MCAB 4JHDB 3H1QA 2AA4A 4FOEA 3ZX2A 2NRRA 3QFUA 1WUAA 4PL7A 1G99A 4CJ7A 3DXMB 4H5TA 4I6MA 3MN7A 3Q7CA 3SBGA 1KC8O 4A61A 4A2BA 3R8EA 3ID8A 5AFUH 3KHYA 1T6CA 2KKZA 1U2VB 1HPMA 3CJ7A 1MDUB 4FL9A 3TU5A 1IJJA 4FWPA 4OO1J 4JKBA 2GWKA 3E9OA 3M3ZA 1HLUA 5BREA 3SK3A 3VEZA 3VF4A 2AP1A 1HUXA 2CGJA 2JWLA 2YHXA 3LDOA 4MDAA 1XC3A 4BRNA 3CQYA 2QWMA 2A5XA 3HOSA 4CZMA 4H0XB 2I7NA 3ZEUB 2E20A 1KAZA 4JKDA 5GADP 1QVGM 4BY9C 1JCGA 4A5BA 3M5RA 3EE9A 5GAEP 1MWMA 3EN9A 3P4IA 5AR0A 3UKRB 3DAWA 3B8AX 5FPNA 4WF9L 4KBOA 1VQLN 1VQON 5AFUA 1HX1A 4EHUA 3G6EN 5M1PA 1QQOA 3LDQA 4MLHA 3TSUA 3MDQA 1M1KO 1YAGA 3A5LC 2ZJRL 3DJCA 3WXLA 1VQ4N 4OPAA 3WXIA 3NVKA 4IJAA 5AQJA 3SBTA 1SQKA 4MO4A 1DKGD 3LDNA 3N4PA 4H0VB 4JK7A 2NNWA 5E84A 1RDWX 1ATRA 1TUYA 3FE1A 3FZMA 4G9ZA 5EXWA 3U4LA 4H0TB 5BR9A 3DXKA 5EOYA 4A2AA 1VQPN 1V4SA 3C7NB 1JCFA 2P9SA 1N8RO 4NLBA 4BR0A 1CZAN 5AQQA 3C6HA 3F2KA 3H3NO 1VQ6N 3EKSA 3LDPA 3WXMB 2ZGYA 4BRAA 5M1OA 1Q82O 4HTLA 2ZF5O 3SMSA 2YI1A 3W0LA 3CIPA 1GLCG 4O8KA 1YITN 4YOYA 3CF5L 2HOEA 4IOAL 1S3XA 3G4SN 4YOTA 2NRVA 4BRGA 3WXKA 3SAFA 5FPMA 3CC4N 1KAXA 4PHTX 3P31A 1NBWA 2BUPA 4Y0WA 3WQUA 2IVNA 2D0OA 3GBTA 5BRDA 4IXCA 4A62A 3QB0A 1YXQA 4XH5A 5MLCQ 5F0XA 1YJ9N 2ITMA 5CR4A 3CD6N 5AQTA 4JK9A 1YJWN 3CPEA 5GAGP 1GLDG 1V4TA 4ISGA 1C0GA 3QBWA 4M7YA 3I8BA 1T3VA 4WYBA 1X3MA 3ENHA 4RTFD 3IUCA 5LJWA 2V7ZA 2WFBA 4CZHA 3BF3A 3MN9A 4M7XA 2QM1A 4BR4A 3SAHA 3L4QA 3G71N 3GE1A 2HBLA 2I7PA 4ILHA 4IOCL 1GLLO 4PKGA 1VQ9N 3VTIA 4BQLA 2HF3A 5AQRA 1M90O 4IOXA 2ASPA 4A59A 3IFRA 3J8AA 3CJCA 2V51B 3EO3A 1BA1A 2HBKA 4DHYA 4UY8O 4NO7A 3AAPA 1ZC6A 1S72N 3TTFA 2OTJN 4XH1A 3O9SA 4BVPA 2P9LB 3SAGA 4FO0A 2QEXN 3MCPA 4C23A 2ASMA 3QMLA 5EY4A 3O9RA 4IO9L 3LM2A 2QA4N 3MX2A 4K25A 3VF6A 4BGBA 3MMVA 3CHWA 1NGGA 1QQMA 4H0PA 1K73O 1MA9B 4CBUA 5AQKA 4CZGA 3M1FA 5C2FA 2GWJA 1KXPA 2HBMA 2F7TA 4E1JA 5JLFA 3WUHA 2HBJA 2P9UA 1X9JA 5LY3A 4FWMA 5AQXA 2FLOA 1YVNA 2PBDA 2Q1NA 2P9NB 3LDLA 3R3LA 4B1WB 3IMXA 5JICA 1K8KA 3QICA 4BG8A 4HWIA 3KVGA 3UKUA 4JKGB 5AQIA 3D7EO 5KPRA 3DXKB 4CD1A 4FWRA 4K43A 4Z94A 2Q31A 2NRZA 1NGAA 2P9SB 3EE8A 3ULEA 3HRGA 4WQ4C 5KPZA 3J7ZO 2WUSA 2YJEA 4WFNL 1EQYA 4FSVA 4PKIA 2Q0RA 4EIAA 1NM1A 4IJNA 4CZKA 4BRKA 2P9KA 1YIJN 4YOUA 2NRWA 2VYPA 1NGIA 2QXLA 3OA9A 5BRHA 4RWTA 1NGDA 3HBTA 3Q7BA 3TSPA 4BC5A 4F9OA 3O4WA 1VQ7N 1SS6A 3MN5A 4FWOA 5M1NA 1D4XA 2Q97A 4CZJA 3VGLA 1Q18A 4BRFA 1YJNN 1Q7YO 2DPNA 4JKCA 3VEWA 3GG4A 3WEEB 3O1WA 3F5TA 3MWPA 3FZLA 3EZWA 3CCMN 2VWBA 3O80A 3CCVN 4H03B 4MDBA 2QTDA 2IVOA 2GEMA 3JXUA 4BRLA 3TPQA 4BRDA 1ATNA 3O08A 2FSNA 4FWLA 1LOTB 4GNIA 1GLJO 3FZKA 5BN9A 4FOIA 2Q2RA 5AZJA 3CCRN 1HJOA 2ZJQL 3D2EB 1KQSM 3I33A 1XQSC 4JD2B 4K42A 4WQ4A 5AQOA 3I56N 3CCJN 1K9MO 4BGAA 1TYQB 3MX5A 4XH4A 1ESVA 1NJIO 1NGJA 1RGIA 4OPHA 3O6WA 1K8AO 1OVYA 2E88A 3RSEA 3OBYA 4A57A 3NVMA 5JLHA 3HOTA 1VQKN 3D2FB 4O8UA 4J8FA 4BRQA 1NGBA 1BOTO 3DXMA 1GLAG 3T69A 1QVFM 1YF5L 3O9TA 4JK8A 4CBXA 4GY2B 3MN6A 5AQYA 2Q0UA 1VQMN 2FSKA 5AQPA 3SJHA 3FFKB 3OHRA 5GAHP 1SZ2A 1JJ2M 3FZHA 2HF4A 1E4GT 3D6RA 3BUZB 4MO5A 4H5NA 3VMFB 2QWOA 2GTDA 3AAQA 5BRFA 1DEJA 3CC7N 3F9MA 4JN4A 1Y64A 2IIRA 4EFHA 5DM7L 3QBXA 4PL8A 2RE2A 5E26A 4BRHA 2H3GX 1ATSA 2P9IA 2YCHA 5LJVA 4CZLA 3CCLN 3VEOA 4B1XB 3GOIA 4ILGB 4BC3A 4BRIA 2A40A 4I6MB 5AQZA 4BREA 3CERA 3CJ1A 3VF2A 4BROA 3ID6A 1BDGA 4GV6A 1DGKN 1K8KB 4BQZA 5ADXH 1ILYA 2FF6A 4BR9A 3CJBA 4CBWA 3CETA 2FSJA 5B8HA 3VENA 4IEEA 3ZYYX 1X3NA 5ELZA 4CZIA 5BN8A 3ULEB 1BO5O 5AZIA 2EWSA 4KH5A 3O8MA 3QFPA 3C65A 2P9PA 1NLVA 3G25A 4IZ9A 4QS9A 2W41A 3CC2N 2Q36A 3CJAA 3PIPL 3EL2A 2F9WA 5AQWA 3VPZA 4A5AA 4DQ8A 1VQ5N 5TKWA 1BWFO 2P9KB 2QWNA 3O9UA 4ISEA 5AQSA 3DLLL 3VEVA 5AQLA 4K41A 2QW9A 2QWRA 4QS7A 4M63C 3TTDA 1T6DA 1XUPO 3T7ZA 2KLAA 2E2PA 3P39A 3K9JA 3O1BA 4BC4A 3VEXA 4YOXA 5ADXA 1KAYA 2E8AA 4WFBL 2NRTA 2VCPA 5GINA 2WBNA 3K9KA 3QDKA 3VOVA 1ZXOA 4EAHD 2PFUA 2NZTA 4H5WA 1WOQA 3U8XA 4JNEA 3VGMA 2NRHA 3C0BA 3VTHA 4FWSA 5AQGA 4H5VA 5DM6L 3A0IX 4BR5A 1Z6RA 4WQ5C 5AQHA 3AY9A 1Q86O 3VERA 1VAZA 1IG8A 3WT0A 3WXJA 1C0FA 3C6AA 3BF1A 3GDQA 4H0OA 1KD1O 1RDUA 1BUPA 5AQVA 3KWIA 1GLBG 1QZ5A 2YJFA 4O5FA 3ZX3A 2BTFA 4FPBA 5KPTA 5KQ8A 5TKYA 3RSEB 4WCEL 4RCHA 4B9QA 5C12A 5AQNA 4MLEA 3ZX0A 3ZETA 4BRCA 4CZEA 1NGEA 3VESA 3FZFA 5FPEA 3W3DA 3I55N 5EX5A 2ZGZA 4IDHA 2OTLN 3E9PA 5HL7L 1BA0A 2E2OA 2HSTA 4AF1A 3SLCA 4JKFA 3VGKA 2YX6A 2GUPA 2V7YA 5BPLA 2OANA 3H45C 3LL3A 3FR0A 4IEIA 4JKHA 2CGLA 1HKBA 4NB4A 1YUWA 2A3ZA 2GELA 2V52B 3CCSN 2FF3B 2ASOA 3HTVA 2P9IB 5C10A 4YOWA 5JVHL 3N4QA 4YORA 2QWLA 4C1NK 3ATVA 4WQ5A 3TTCA 3P38A 4GVEA 3H46O 3MWTA 4JKAA 4JEPA 3VETA 4AM7A 1QZ6A 4FWKA 4YOVA 1O13A 2E1YA 3IKMA 2A41A 1J6ZA 2J4RA 2P9LA 3CI5A 4EHTA 5F1XA 4KH6A 1E4FT 5CE3A 1GLFO 2D0PA 2E1ZA 3AGKA 2VGNA 3R1XA 3BP8A 5AZIB 4FWQA 1QQNA 4FVUA 4DB3A 2E2NA 3A5MC 2P9PB 3M6GA 4JHDA 2NLXA 4KH4A 3FLCO 5M1KA 2QI2A 3E66A 3CMEN 3CPWM 2QWQA 5M1QA 2A6AA 4U7BA 4JAXA 2UYTA 5H1SQ 2P9NA 3R9PA 2RHKA 3RVCA 5JMVA 3CCUN 5JVGL 2IVPA 4BG9A 4BR2A 5BPNA 3U9ZA 5FPDA 2W40A 1OKJA 1U2VA 4IWVA 4JKGA 4CD3A 4WFAL 3H1VX 4H5RA 3OW2M 5F2RA 4GV9A 3NMUA 1NGFA 1S22A 3CCEN 2QWPA 3S41A 3ENOA 5BPMA 2CH6A 2FXUA 3O5BA 2P9UB 4IFEA 1YI2N 1JCEA 3A5OC 4B1UB 3ZEUA 1NWKA 3GL1A 3UE5A 3L4IA 3UB5A 2NRXA 3BEXA 3JS6A 1NGCA 4H0YB 3HI0A 4ISFA 3AARA 2CGKA 3HSCA 3VEYA 3UKUB 3CQXA 1ZBSA 2BH1A 2WC9A 1W97L 3ENBA 2YHYA 3O9QA 1QHAA 3PIOL 1EO1A 2PAVA 1NGHA 4FPAA 5I9EB 3UKRA 4B1YB 4PKHA 4DKWA 3MK6A 2KHOA 5HOOA 3WEEA 3L0QA 4R79A 1P90A 3A5NC 3AGRA 3TSQA 3EKUA 1BU6O 4BRMA 5GIOA 4YDUC 5C15A 3CJ9A 3CXCM 2D4WA 3OBWA 3ZETB 3KWGA 4BC2A 2D1KA 4B1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SAZ A;  5KQD A;  1P8Z A;  4B1Z A;  4BR7 A;  1T44 A;  1HKC A;  4BVO A;  4DCH A;  1BG3 A;  3D2E A;  2HMP A;  4JD2 A;  5AQU A;  5AQF A;  1TYQ A;  1LCU A;  4XEI A;  3A8Y A;  3R6M A;  3C7N A;  3DWL A;  4L3Q A;  4BRP A;  3H3O B;  2ZWH A;  2YHW A;  3HM8 A;  3LM9 A;  2F9T A;  1NMD A;  4CI6 A;  1GLE G;  3SMP A;  3D2F A;  4FWN A;  3KZB A;  3WQT A;  4QS8 A;  3HZ6 A;  5AZJ B;  3ATU A;  2CH5 A;  4CZF A;  3U9D A;  1MWK A;  1H1V A;  5EVZ A;  1TUU A;  2E2Q A;  4AM6 A;  1HKG A;  1Z05 A;  3FGU A;  2A42 A;  3H6E A;  4LC9 B;  4YDU A;  5AQM A;  1RFQ A;  4IO8 A;  1U6Z A;  3IDH A;  1R59 O;  3L6Q A;  4JHD B;  3H1Q A;  2AA4 A;  4FOE A;  3ZX2 A;  3QFU A;  1WUA A;  4PL7 A;  1G99 A;  4CJ7 A;  3DXM B;  4H5T A;  4I6M A;  3MN7 A;  4A61 A;  4A2B A;  3R8E A;  3ID8 A;  5AFU H;  3KHY A;  1T6C A;  1U2V B;  1HPM A;  3CJ7 A;  1MDU B;  4FL9 A;  3TU5 A;  1IJJ A;  4FWP A;  2GWK A;  3M3Z A;  1HLU A;  5BRE A;  3SK3 A;  3VEZ A;  3VF4 A;  2AP1 A;  1HUX A;  2CGJ A;  2YHX A;  3LDO A;  1XC3 A;  4BRN A;  3CQY A;  2QWM A;  2A5X A;  4CZM A;  4H0X B;  2I7N A;  3ZEU B;  2E20 A;  1KAZ A;  1JCG A;  1MWM A;  3EN9 A;  3P4I A;  5AR0 A;  3UKR B;  3DAW A;  3B8A X;  5FPN A;  4KBO A;  5AFU A;  1HX1 A;  4EHU A;  1QQO A;  3LDQ A;  4MLH A;  3MDQ A;  1YAG A;  3A5L C;  3DJC A;  3WXL A;  3WXI A;  4IJA A;  5AQJ A;  1SQK A;  4MO4 A;  1DKG D;  3LDN A;  4H0V B;  5E84 A;  1RDW X;  1ATR A;  1TUY A;  3FE1 A;  3FZM A;  5EXW A;  3U4L A;  4H0T B;  5BR9 A;  3DXK A;  5EOY A;  4A2A A;  1V4S A;  3C7N B;  1JCF A;  2P9S A;  4BR0 A;  1CZA N;  5AQQ A;  3H3N O;  3EKS A;  3LDP A;  2ZGY A;  4BRA A;  4HTL A;  2ZF5 O;  3SMS A;  2YI1 A;  3W0L A;  3CIP A;  1GLC G;  4O8K A;  2HOE A;  1S3X A;  4BRG A;  3WXK A;  5FPM A;  1KAX A;  1NBW A;  2BUP A;  4Y0W A;  3WQU A;  2IVN A;  2D0O A;  3GBT A;  5BRD A;  4IXC A;  4A62 A;  3QB0 A;  1YXQ A;  4XH5 A;  5F0X A;  2ITM A;  5AQT A;  1GLD G;  1V4T A;  4ISG A;  1C0G A;  3QBW A;  4M7Y A;  3I8B A;  4WYB A;  1X3M A;  3ENH A;  4RTF D;  3IUC A;  5LJW A;  2V7Z A;  4CZH A;  3BF3 A;  3MN9 A;  4M7X A;  2QM1 A;  4BR4 A;  3GE1 A;  2I7P A;  1GLL O;  4PKG A;  4BQL A;  2HF3 A;  5AQR A;  2ASP A;  3IFR A;  3J8A A;  3CJC A;  2V51 B;  3EO3 A;  1BA1 A;  4DHY A;  4NO7 A;  3AAP A;  1ZC6 A;  4XH1 A;  4BVP A;  2P9L B;  4FO0 A;  3MCP A;  4C23 A;  2ASM A;  3QML A;  5EY4 A;  3LM2 A;  4K25 A;  3VF6 A;  4BGB A;  3MMV A;  3CHW A;  1NGG A;  1QQM A;  4H0P A;  1MA9 B;  4CBU A;  5AQK A;  4CZG A;  3M1F A;  2GWJ A;  1KXP A;  4E1J A;  5JLF A;  3WUH A;  2P9U A;  1X9J A;  5LY3 A;  4FWM A;  5AQX A;  2FLO A;  1YVN A;  2PBD A;  2Q1N A;  2P9N B;  3LDL A;  4B1W B;  3IMX A;  5JIC A;  1K8K A;  3QIC A;  4BG8 A;  4HWI A;  3KVG A;  3UKU A;  5KPR A;  5AQI A;  3D7E O;  3DXK B;  4CD1 A;  4FWR A;  4K43 A;  4Z94 A;  2Q31 A;  1NGA A;  2P9S B;  3ULE A;  4WQ4 C;  5KPZ A;  2WUS A;  2YJE A;  1EQY A;  4FSV A;  4PKI A;  2Q0R A;  4EIA A;  1NM1 A;  4IJN A;  4CZK A;  4BRK A;  2P9K A;  2VYP A;  1NGI A;  2QXL A;  5BRH A;  4RWT A;  1NGD A;  3HBT A;  4F9O A;  4BC5 A;  3O4W A;  3MN5 A;  4FWO A;  1D4X A;  2Q97 A;  4CZJ A;  3VGL A;  1Q18 A;  4BRF A;  2DPN A;  3VEW A;  3WEE B;  3GG4 A;  3O1W A;  3FZL A;  3EZW A;  2VWB A;  3O80 A;  4H03 B;  2IVO A;  2GEM A;  3JXU A;  4BRL A;  3TPQ A;  4BRD A;  1ATN A;  3O08 A;  2FSN A;  4FWL A;  1LOT B;  4GNI A;  1GLJ O;  3FZK A;  5BN9 A;  4FOI A;  2Q2R A;  5AZJ A;  1HJO A;  3D2E B;  3I33 A;  1XQS C;  4JD2 B;  4K42 A;  4WQ4 A;  5AQO A;  4BGA A;  1TYQ B;  4XH4 A;  1ESV A;  1NGJ A;  1RGI A;  3O6W A;  2E88 A;  3RSE A;  5JLH A;  3D2F B;  4BRQ A;  4J8F A;  1NGB A;  1BOT O;  3DXM A;  1GLA G;  4CBX A;  4GY2 B;  3MN6 A;  5AQY A;  2Q0U A;  2FSK A;  5AQP A;  3SJH A;  3FFK B;  3OHR A;  1SZ2 A;  3FZH A;  2HF4 A;  1E4G T;  3BUZ B;  4MO5 A;  4H5N A;  2QWO A;  2GTD A;  3AAQ A;  5BRF A;  1DEJ A;  3F9M A;  4JN4 A;  1Y64 A;  2IIR A;  4EFH A;  3QBX A;  4PL8 A;  5E26 A;  4BRH A;  2H3G X;  1ATS A;  2P9I A;  2YCH A;  5LJV A;  4CZL A;  3VEO A;  4B1X B;  3GOI A;  4BC3 A;  4BRI A;  2A40 A;  4I6M B;  5AQZ A;  4BRE A;  3CER A;  3CJ1 A;  3VF2 A;  4BRO A;  1BDG A;  1DGK N;  1K8K B;  4BQZ A;  5ADX H;  2FF6 A;  4BR9 A;  3CJB A;  4CBW A;  3CET A;  2FSJ A;  5B8H A;  3VEN A;  1X3N A;  5ELZ A;  4CZI A;  5BN8 A;  3ULE B;  1BO5 O;  5AZI A;  2EWS A;  3O8M A;  3QFP A;  2P9P A;  1NLV A;  3G25 A;  4IZ9 A;  4QS9 A;  2W41 A;  2Q36 A;  3CJA A;  3EL2 A;  2F9W A;  5AQW A;  3VPZ A;  4DQ8 A;  1BWF O;  2P9K B;  2QWN A;  4ISE A;  5AQS A;  3VEV A;  5AQL A;  4K41 A;  2QW9 A;  2QWR A;  4QS7 A;  4M63 C;  1T6D A;  1XUP O;  2E2P A;  3O1B A;  4BC4 A;  3VEX A;  5ADX A;  1KAY A;  2E8A A;  2VCP A;  3QDK A;  3VOV A;  1ZXO A;  4EAH D;  2NZT A;  4H5W A;  1WOQ A;  3U8X A;  4JNE A;  3VGM A;  2NRH A;  3C0B A;  4FWS A;  5AQG A;  4H5V A;  3A0I X;  4BR5 A;  1Z6R A;  4WQ5 C;  5AQH A;  3AY9 A;  3VER A;  3WT0 A;  1IG8 A;  3WXJ A;  1C0F A;  3GDQ A;  3BF1 A;  4H0O A;  1BUP A;  5AQV A;  1GLB G;  1QZ5 A;  2YJF A;  4O5F A;  3ZX3 A;  2BTF A;  4FPB A;  5KPT A;  5KQ8 A;  5TKY A;  3RSE B;  4RCH A;  4B9Q A;  5AQN A;  4MLE A;  3ZX0 A;  3ZET A;  4BRC A;  4CZE A;  1NGE A;  3VES A;  3FZF A;  5FPE A;  3W3D A;  5EX5 A;  2ZGZ A;  1BA0 A;  2E2O A;  3SLC A;  3VGK A;  2GUP A;  2V7Y A;  5BPL A;  2OAN A;  3H45 C;  3LL3 A;  3FR0 A;  2CGL A;  1HKB A;  4NB4 A;  1YUW A;  2A3Z A;  2GEL A;  2V52 B;  2FF3 B;  2ASO A;  3HTV A;  2P9I B;  2QWL A;  3ATV A;  4WQ5 A;  3H46 O;  3VET A;  4AM7 A;  1QZ6 A;  4FWK A;  2E1Y A;  2A41 A;  1J6Z A;  2J4R A;  2P9L A;  3CI5 A;  4EHT A;  5F1X A;  1E4F T;  5CE3 A;  1GLF O;  2D0P A;  2E1Z A;  3BP8 A;  5AZI B;  4FWQ A;  1QQN A;  4DB3 A;  2E2N A;  3A5M C;  2P9P B;  3M6G A;  4JHD A;  2NLX A;  3FLC O;  2QWQ A;  2A6A A;  4JAX A;  2UYT A;  2P9N A;  3R9P A;  5JMV A;  2IVP A;  4BG9 A;  4BR2 A;  5BPN A;  3U9Z A;  5FPD A;  2W40 A;  1OKJ A;  1U2V A;  4IWV A;  4CD3 A;  3H1V X;  4H5R A;  5F2R A;  1NGF A;  1S22 A;  2QWP A;  3S41 A;  3ENO A;  5BPM A;  2CH6 A;  2FXU A;  3O5B A;  2P9U B;  1JCE A;  3A5O C;  4B1U B;  3ZEU A;  1NWK A;  3GL1 A;  3UE5 A;  3L4I A;  3UB5 A;  3JS6 A;  3BEX A;  1NGC A;  4H0Y B;  3HI0 A;  4ISF A;  3AAR A;  2CGK A;  3HSC A;  3VEY A;  3UKU B;  3CQX A;  1ZBS A;  2YHY A;  1QHA A;  2PAV A;  1NGH A;  4FPA A;  5I9E B;  3UKR A;  4B1Y B;  4PKH A;  3MK6 A;  2KHO A;  3WEE A;  3L0Q A;  3A5N C;  4BRM A;  3EKU A;  1BU6 O;  4YDU C;  3CJ9 A;  2D4W A;  3ZET B;  4BC2 A;  2D1K A;  4B1V A; 
#chains in the Genus database with same CATH topology
 3QEV A;  4N56 A;  4FM2 A;  3E1Y A;  1WBD A;  2E6L A;  3CMA N;  1HKC A;  3CCQ N;  1YT3 A;  2HMP A;  4JD2 A;  1C6V A;  3R6M A;  1HMV A;  1DT9 A;  5T7B A;  3H3O B;  4C8O A;  2YHW A;  2F9T A;  4NLC A;  1GLE G;  3SMP A;  4FLZ A;  3PV8 A;  2AJQ A;  3AVI A;  3KK2 A;  2IAJ A;  3A2F A;  4JI4 K;  3VQ9 A;  5EVZ A;  4FM1 A;  2E2Q A;  4DFJ A;  4KB1 A;  3C94 A;  3FGU A;  2A42 A;  4LC9 B;  5AQM A;  2IDO A;  5J2P A;  4M3W A;  1LAV A;  4ILJ A;  3CFO A;  5GIP A;  4GV3 A;  4JHD B;  3QFU A;  5C25 A;  3DXM B;  3AA4 A;  4H5T A;  3MN7 A;  1JLA A;  3QEW A;  4A61 A;  4Z4E A;  4A2B A;  5AFU H;  3KHY A;  1HPM A;  3IAY A;  1WSJ A;  4KHN A;  4JKB A;  1HLU A;  2EX3 A;  3AO3 A;  4RW7 A;  3VEZ A;  1EP4 A;  3VF4 A;  1HUX A;  3LDO A;  4I9Q A;  4BRN A;  1I94 K;  3QIP A;  1J9A A;  3ZEU B;  3CM6 A;  5GAD P;  3HVT A;  1ZBH A;  5KI6 A;  1JCG A;  4A5B A;  3SQ0 A;  1OVQ A;  3M5R A;  1MWM A;  1RDB A;  2LSN A;  4DTO A;  1TKZ A;  2HHS A;  4WF9 L;  1CZ9 A;  3DM2 A;  4MLH A;  3MDQ A;  2YKN A;  3DRS A;  4Z4F A;  1DKG D;  1SUQ A;  3N4P A;  4KO0 A;  4DR6 K;  1SV5 A;  1RTJ A;  1RDW X;  3TAP A;  1D9F A;  2E4L A;  4H0T B;  3LAK A;  3HYF A;  4N47 A;  1J5E K;  3HPO A;  1IKW A;  1S6Q A;  4AHV A;  1CZA N;  3F2K A;  1FKP A;  3BZK A;  1VQ6 N;  1Q82 O;  3VQQ A;  3L3U A;  3OYK A;  1FK9 A;  2HOE A;  3ZSO A;  2O8F A;  3NH1 A;  3VN5 A;  3SAF A;  5FPM A;  3CC4 N;  3P31 A;  1XMQ K;  4JRP A;  5BR8 K;  3WQU A;  2IVN A;  5FRO A;  4A62 A;  4DV4 K;  3LPT A;  5MLC Q;  1YJ9 N;  2ITM A;  5AQT A;  4OKJ A;  4CJS A;  1IBK K;  4KFB A;  3DOL A;  4IG3 A;  1VRT A;  2OA8 A;  4ISG A;  3QBW A;  4CIF A;  3AA2 A;  2BGG A;  1TGO A;  2V7Z A;  2WFB A;  4L8R B;  3L4Q A;  4HUG A;  3GE1 A;  2I7P A;  3S3O A;  4ILH A;  4B9T A;  1VQ9 N;  4OVL A;  3V9U A;  1WN7 A;  4FCY A;  3C6T A;  4DQR A;  2HBK A;  4NO7 A;  4Z4G A;  3OYG A;  1ZC6 A;  3PO4 A;  3SAG A;  4FO0 A;  1SL1 A;  2DFF A;  2ASM A;  5EY4 A;  3DMJ A;  4FZY A;  4E1M A;  1MA9 B;  4CBU A;  1ASV A;  5AQK A;  1SKS A;  2HBM A;  2F7T A;  3VQ6 A;  4JI8 K;  2HBJ A;  1L3U A;  1S1W A;  1X9J A;  4LF7 K;  3M8Q A;  5LY3 A;  4OJR A;  2QXF A;  3L2Q A;  4J2D A;  3IMX A;  5JIC A;  2A1S A;  4YY3 K;  4HWI A;  3S9H A;  5KTQ A;  4JKG B;  4CK2 A;  3D7E O;  4F8R A;  2NRZ A;  2P9S B;  2O8C B;  4JI7 K;  1VSH A;  4EIA A;  4LH4 A;  3KTQ A;  1J5O A;  3OYE A;  4BRK A;  2UXC K;  2NRW A;  1LWF A;  3DLE A;  3OA9 A;  2QXL A;  4CGG A;  3O3F A;  3TSP A;  4F9O A;  1L3T A;  1N36 K;  4Q5V A;  4JRQ A;  1SS6 A;  3MN5 A;  3SI6 A;  1WSE A;  4RW8 A;  1YJN N;  4JKC A;  3U3G A;  1KVC A;  2XHB A;  1RDA A;  3EZW A;  1ASU A;  4H03 B;  2GEM A;  3JXU A;  4BRD A;  1KCF A;  2GUI A;  3MED A;  3ZT3 A;  4KTZ A;  3AA5 X;  1LOT B;  4GNI A;  3AVM A;  5BN9 A;  2Q2R A;  3D2E B;  1K9M O;  3ZSR A;  4CGD A;  3CCJ N;  1NJI O;  1RGI A;  3UIQ A;  1Z25 A;  4CW7 B;  3NVM A;  4CE9 A;  1TAU A;  1VQK N;  3T69 A;  1QVF M;  3V9W A;  1YF5 L;  4JK8 A;  4GY2 B;  3S3N A;  5AQY A;  2FSK A;  3THV A;  3FFK B;  2D0A A;  5GAH P;  2O8E A;  3NGZ A;  1E4G T;  1IBL K;  2BAN A;  4DU4 A;  3SQ2 A;  1DEJ A;  3CC7 N;  4JN4 A;  2IIR A;  4E3S A;  1ATS A;  3QNN A;  1MU2 A;  3GOI A;  4ILG B;  2HMI A;  4HCB A;  4BRE A;  1X1P A;  3ID6 A;  1K8K B;  1ILY A;  3SQ1 A;  1NJW A;  3CJB A;  4CBW A;  4FLX A;  4B9N A;  3NCI A;  3CET A;  2E5L K;  5B8H A;  3ZYY X;  1Z26 A;  4CZI A;  5BN8 A;  1TK5 A;  4KTQ A;  3NF7 A;  1JKH A;  3QFP A;  4TSX A;  3C65 A;  2P9P A;  5C24 A;  2W41 A;  4F2S A;  4DR1 K;  3HPG A;  3CJA A;  3RMD A;  4FK0 A;  3O4N A;  2F9W A;  2WON A;  3CQ8 A;  3K5L A;  3ITH A;  1L5U A;  4LF6 K;  3B6P A;  4QS7 A;  3ZSQ A;  2HW3 A;  3T7Z A;  2E2P A;  5CYQ A;  3O1B A;  4FJ8 A;  2VCP A;  2UU9 K;  5CYM A;  3RMB A;  4EAH D;  2NRH A;  3C0B A;  3M8R A;  3A0I X;  4BR5 A;  1Q86 O;  4XIU A;  3RMC A;  4H0O A;  2Z1H A;  1F21 A;  5LMN K;  5AQV A;  4KHY A;  4OLB A;  5FDL A;  2BTF A;  5KPT A;  3RSE B;  1ITG A;  4RCH A;  4B9Q A;  4PA1 A;  4MLE A;  2IC3 A;  4CJQ A;  4BRC A;  3VES A;  1BI4 B;  3FZF A;  3W3D A;  3I55 N;  5EX5 A;  1HYS A;  4ZTJ A;  1HJR A;  3E9P A;  5HL7 L;  1BA0 A;  3KD1 E;  1RIL A;  4O44 A;  4E7L A;  3PO5 A;  4JI2 K;  2OAN A;  3E01 A;  4H8K A;  4CGI A;  3ZLJ A;  2CGL A;  1HKB A;  2HHW A;  3AV9 A;  2FF3 B;  5C10 A;  1D8Y A;  2ZQB A;  2B5J A;  4C1N K;  3EYZ A;  3DLB A;  4WQ5 A;  4W5T A;  4GVE A;  3MWT A;  4JKA A;  3L3V A;  4Z4I A;  4YNQ A;  3CI5 A;  2P9L A;  2J4R A;  1XNR K;  5I3U A;  1GLF O;  4NXM K;  4G1Q A;  2VGN A;  3BP8 A;  3P83 D;  1VSM A;  1U49 A;  3AVH A;  2OZM A;  4FVU A;  3A5M C;  4LFB K;  2NLX A;  3E66 A;  1T7P A;  3CME N;  2XRI A;  4BDP A;  5M1Q A;  2UXD K;  3JAM O;  4U7B A;  4F2R A;  1IG9 A;  4E0D A;  2O8B B;  3R9P A;  1RT3 A;  5JVG L;  1C1B A;  4CF9 A;  4IWV A;  1KFS A;  1LAW A;  3OYB A;  4X64 K;  1U45 A;  3NMU A;  1NGF A;  4FJM A;  3S41 A;  3ENO A;  5BPM A;  3VQ5 A;  3A5O C;  1KFD A;  3UB5 A;  1NGC A;  4X62 K;  1ZBS A;  2WC9 A;  4CJ3 A;  4O0I A;  4J2A A;  3CYM A;  4GVM A;  1NMN A;  3UKR A;  4B1Y B;  4DKW A;  3B6O A;  1VSF A;  2KHO A;  5HOO A;  3L0Q A;  3A5N C;  3EKU A;  1BU6 O;  4C8N A;  2HND A;  5C15 A;  3CJ9 A;  4ELT A;  3OBW A;  2XY6 A;  1HNZ K;  3V1R A;  4FK2 A;  1SAZ A;  5KQD A;  2ETJ A;  1S9E A;  1P8Z A;  3NGI A;  4B1Z A;  3PSF A;  1ZBI A;  2VGM A;  3RTV A;  2D0C A;  4RG8 A;  4U67 L;  1TYQ A;  1VQ8 N;  4N76 A;  3IS9 A;  1R0A A;  1JXE A;  3A8Y A;  2G8H A;  1IKY A;  3DWL A;  4L3Q A;  2ZWH A;  1NMD A;  4AHR A;  1DTT A;  4DR3 K;  3D2F A;  3PX6 A;  1W2B M;  4I9L A;  3KZB A;  4B9U A;  2JWK A;  4O4G A;  4JKE A;  4QS8 A;  3HZ6 A;  3ATU A;  2CH5 A;  2ZE2 A;  4CHY A;  3T1A A;  4DLG A;  1H1V A;  1RT4 A;  3OTO K;  1HKG A;  1U6Z A;  3IDH A;  1R59 O;  3TAB A;  3L6Q A;  3MCA B;  3H1Q A;  3ZX2 A;  2NRR A;  3P5J A;  4CJ7 A;  4BWJ A;  2KTQ A;  4CCH A;  4FJJ A;  3R8E A;  2HB5 A;  1T6C A;  2KKZ A;  3OYN A;  4FL9 A;  1MDU B;  4O55 A;  3ZSY A;  4DTJ A;  3THW A;  1BGX T;  5BRE A;  4M41 A;  2YHX A;  4MDA A;  4CHP A;  3K5N A;  1DTQ A;  3CQY A;  2A5X A;  2I7N A;  3HM9 A;  2E20 A;  4JKD A;  3AO5 A;  1KLN A;  4BY9 C;  2HHH K;  5HRR A;  3DOK A;  5GAE P;  3P4I A;  5AR0 A;  3B8A X;  2Q3S A;  4KBO A;  4AHC A;  1X9S A;  4GKK K;  3BZC A;  5HRN A;  3G6E N;  3S3M A;  5M1P A;  3TSU A;  1M1K O;  3DJC A;  4OPA A;  3NVK A;  4IJA A;  3QLH A;  1SQK A;  3NAE A;  1TKX A;  5E84 A;  4Z0U A;  4OPK A;  2WTU A;  1Q9X A;  1S9G A;  4KKO A;  4ID5 A;  3U4L A;  2F8S A;  4DWI A;  5EOY A;  1VQP N;  4A2A A;  1BCM A;  1V4S A;  1J53 A;  1BL3 A;  4BR0 A;  2QKB A;  3AVN A;  4DV5 K;  3H3N O;  4HTL A;  3V6D A;  3W0L A;  3SMS A;  3SUN A;  2HNZ A;  4HTU A;  3ZSV A;  1KAX A;  2BUP A;  3VQC A;  3TAN A;  4PUO A;  3MXJ A;  1UOC A;  3MEG A;  3CD6 N;  2G8K A;  1YJW N;  3EEQ A;  3K59 A;  1GLD G;  1V4T A;  1BQM A;  3KK1 A;  3HP6 A;  1FKO A;  4KHU A;  3I8B A;  3ENH A;  1I39 A;  1NNE A;  3KIO A;  4CZH A;  3MN9 A;  2QM1 A;  4BR4 A;  3SAH A;  3G71 N;  2HBL A;  4NCG A;  5J2N A;  1WSG A;  1GLL O;  4PKG A;  3VTI A;  3OYF A;  4BQL A;  3ALY A;  2HF3 A;  4LF9 K;  5AQR A;  1M90 O;  4IOX A;  4CFD A;  4DSE A;  2V51 B;  1BA1 A;  4UY8 O;  3ZSZ A;  3SV3 A;  2OTJ N;  4XH1 A;  4BVP A;  4EZ6 A;  3G0Z A;  4CEB A;  4IO9 L;  1QQM A;  4H0P A;  1RBS A;  4OX9 K;  3J7Y P;  4FLW A;  3WUH A;  3V9Z A;  4DV7 K;  2P9U A;  2W6L A;  4FWM A;  5AQX A;  2FLO A;  1JLG A;  1YVN A;  2PBD A;  2P9N B;  2PY5 A;  4BWM A;  3QIC A;  2HHU A;  3UKU A;  2KQ2 A;  3QEX A;  1OH5 A;  4FWR A;  4K43 A;  1NGA A;  3ULE A;  1IBM K;  4WQ4 C;  4DFP A;  3J7Z O;  1EQY A;  4FSV A;  3HO1 A;  2HHV A;  4KB0 A;  4RW6 A;  4RW9 A;  1X9W A;  4DSL A;  1RT2 A;  4YOU A;  2VYP A;  3D0P A;  2O8F B;  4KRF A;  1XHX A;  4RWT A;  3Q7B A;  2W42 A;  4BC5 A;  1VQ7 N;  5M1N A;  4JYA K;  4JS5 A;  2DPN A;  1OH8 A;  3WEE B;  3LWL A;  1Q8I A;  3THY B;  2VWB A;  3O80 A;  3CCV N;  1RBV A;  4HCC A;  2IVO A;  3DLK A;  2XO7 A;  2FBY A;  2ATQ A;  2FSN A;  2DY4 A;  3IRX A;  4FOI A;  1HJO A;  3I33 A;  1XMO K;  3K57 A;  3AVJ A;  1GOB A;  1ESV A;  3DRP A;  1K8A O;  4I2Q A;  4A57 A;  2VG6 A;  4DUZ K;  4CJK A;  3HOT A;  1N6Q A;  2PZS A;  4W5R A;  2X74 A;  4BRQ A;  1NGB A;  4FJG A;  4CJF A;  3DXM A;  3O3H A;  1N33 K;  1VSJ A;  4DTS A;  5IT9 O;  5AQP A;  3D45 A;  1SZ2 A;  2NUB A;  1QQC A;  4B8C A;  1JJ2 M;  3BGR A;  4H5N A;  5BRF A;  4EFH A;  5DM7 L;  4PL8 A;  4MFB A;  4BRH A;  4B3T K;  2P9I A;  5LJV A;  4HUF A;  3ZT4 A;  1RT6 A;  3PX4 A;  2UUC K;  4BRI A;  4I6M B;  5AQZ A;  3CER A;  3VF2 A;  4BRO A;  5JS2 A;  4B9L A;  3LAM A;  3DLG A;  1A5X A;  4QAG A;  2FSJ A;  5E41 A;  5ELZ A;  2EWS A;  4I7F A;  1N32 K;  2O4I A;  1VSI A;  1TL1 A;  2Q36 A;  3HPH A;  3M8P A;  5AQW A;  4N5S A;  2QWN A;  3KLI A;  4ISE A;  5AQS A;  3DLL L;  1HPZ A;  2RN2 A;  4CEE A;  4K41 A;  4NCA A;  2RPI A;  4CJV A;  4K0K K;  1XNQ K;  2ITG A;  3P39 A;  1G15 A;  4LF4 K;  2WBN A;  3VOV A;  2NZT A;  1WOQ A;  3QEP A;  5AQG A;  4CER A;  4X66 K;  1GOA A;  4BDZ A;  4LH5 A;  5DM6 L;  1Z6R A;  3VER A;  2P51 A;  1C0F A;  3C6A A;  4Z4C A;  4CVN E;  2DTU A;  4CED A;  1KD1 O;  3KWI A;  1QZ5 A;  4O5F A;  4JI6 K;  3SV4 A;  1RBT A;  1QSY A;  1C1C A;  3I0S A;  5K14 A;  3SUQ A;  3ZET A;  1IKV A;  1Q9Y A;  2OPQ A;  5FPE A;  4DQS A;  3TR8 A;  3QO9 A;  1WSH A;  2OCE A;  3AVB A;  2E2O A;  4AF1 A;  2HST A;  1QTM A;  2UXB K;  4JKF A;  3VGK A;  2YX6 A;  2O8E B;  5HBM A;  1L3V A;  2V7Y A;  1VHX A;  1BHL A;  1NK4 A;  3LL3 A;  4IEI A;  1X9M A;  2GEL A;  4B08 A;  4BE1 A;  3CFR A;  1HYZ A;  3H08 A;  2QWL A;  3ATV A;  1UAX A;  1ZBU A;  2YNH A;  4JEP A;  4AM7 A;  3V1Q A;  2YHA A;  1EET A;  3CM5 A;  4CEA A;  3IKM A;  2A41 A;  1J6Z A;  4CIG A;  4EHT A;  5F1X A;  3MAQ A;  4AHS A;  3TAG A;  4LF5 K;  2E1Z A;  3AGK A;  2HHT A;  3R1X A;  2D5R A;  2I5J A;  4DB3 A;  2P9P B;  3M6G A;  2O8D B;  1T03 A;  4KH4 A;  1KVB A;  1NK9 A;  2F8T A;  3CPW M;  3QES A;  2A6A A;  4NYF A;  4JAX A;  4X65 K;  2FBT A;  3RVC A;  2RHK A;  4CJW A;  3CCU N;  1NOZ A;  2IVP A;  1EXQ A;  4BG9 A;  3U9Z A;  1U2V A;  4JKG A;  3OW2 M;  1HRH A;  5F2R A;  4GV9 A;  4KRE A;  2QWP A;  3U6F A;  1K6Y A;  3OYD A;  3TAE A;  4IFE A;  4FZZ A;  1NWK A;  3UE5 A;  3L4I A;  1FW6 A;  2NRX A;  2YNI A;  3QIO A;  1XC9 A;  3HI0 A;  3K5O A;  3HSC A;  4PQU A;  3SCX A;  4CGF A;  1LWE A;  2F4V K;  5I9E B;  3MK6 A;  1RTI A;  4CJP A;  4ZTF A;  4DUY K;  3LZI A;  4CEQ A;  3TAM A;  1P90 A;  4R79 A;  4BDY A;  3TSQ A;  5GIO A;  1N5Y A;  4F3T A;  3L2R A;  4YDU C;  4DQP A;  1VSD A;  3AA3 A;  2KW4 A;  5CZ1 A;  1HNW K;  4BVO A;  3TI0 A;  3D2E A;  5AQU A;  3WNH A;  5AQF A;  1YHQ N;  1VSK A;  1SKR A;  3C7N A;  4OPJ A;  3LM9 A;  1JL1 A;  3HT3 A;  5HLF A;  4FWN A;  1TK8 A;  1S1X A;  3E9L A;  5AZJ B;  5CHI A;  3OYI A;  1NK8 A;  4B3M K;  3SYZ A;  3J80 O;  1QSS A;  1FXX A;  4AM6 A;  3H6E A;  3K58 A;  3KK7 A;  1C0U A;  3LPU A;  3C6U A;  5FLX O;  2ZJP L;  1U48 A;  4C1N I;  3AVL A;  3OY9 A;  1WUA A;  3K5M A;  1G99 A;  4OGE A;  3SBG A;  2JGU A;  3SQ4 A;  4ELU A;  2PYL A;  4FJH A;  3TU5 A;  1IJJ A;  4FWP A;  2OYQ A;  2GWK A;  4DS4 A;  1HQU A;  2JWL A;  5CZ2 A;  1XC3 A;  4M42 A;  2QWM A;  4FJN A;  4CZM A;  3KLF A;  3SPY A;  1KAZ A;  5LMU K;  2Z1G A;  3MEC A;  4DR7 K;  3EN9 A;  3DLR A;  3UKR B;  3VQA A;  5FPN A;  4H4M A;  4DTN A;  1VQL N;  5FRM A;  4EHU A;  4E19 A;  4CF0 A;  4CEZ A;  4DR5 K;  1YAG A;  3A5L C;  2ZJR L;  1VQ4 N;  3WXI A;  2G8W A;  5KGW A;  3SBT A;  4MO4 A;  4DG1 A;  3O3G A;  4JK7 A;  2NNW A;  3FE1 A;  3FZM A;  1JL2 A;  4G9Z A;  3DXK A;  1EX4 A;  1JCF A;  1QHT A;  1U04 A;  4NLB A;  4CJ5 A;  3ISN C;  2VQF K;  1N8R O;  3IG1 A;  2DFH A;  1D5A A;  3C6H A;  3V1O A;  3L2V A;  2HHX A;  3EKS A;  1JLQ A;  5M1O A;  1NJZ A;  1BI4 A;  4DSF A;  2ZF5 O;  3F9K A;  3CIP A;  3QET A;  4YOY A;  3CF5 L;  4M3X A;  1S3X A;  4YOT A;  4BRG A;  3WXK A;  4HVJ A;  4KHP K;  2HVI A;  4DF8 A;  1KVA A;  1RCH A;  1NBW A;  2F96 A;  4Y0W A;  5BRD A;  4N41 A;  4IXC A;  3QB0 A;  1YXQ A;  4XH5 A;  1XWL A;  4E7K A;  3F73 A;  1NKB A;  3HL8 A;  4WYB A;  3MXI A;  1X3M A;  5LJW A;  3BF3 A;  4DS5 A;  4QCL A;  2YHB A;  2G8I A;  4IOC L;  4MQ3 A;  4CJ4 A;  3LDS A;  3V9S A;  3AVF A;  3LZJ A;  2ASP A;  2QK9 A;  4AHT A;  3IFR A;  1XHZ A;  4Z4H A;  4IBN A;  1B92 A;  3AAP A;  1S72 N;  3O9S A;  4O5B A;  3MEE A;  3HXM A;  2O8B A;  3LP2 A;  2QEX N;  3MCP A;  3O9R A;  3LM2 A;  2QA4 N;  3MX2 A;  4K25 A;  1RBR A;  4BGB A;  1NG9 A;  3MMV A;  3CHW A;  1NGG A;  3RRG A;  2ZD1 A;  4Y1D A;  5C2F A;  3NBP A;  3THX A;  3M1F A;  4WE1 A;  4DV2 K;  4DSK A;  1HNX K;  3VQ8 A;  1WNS A;  4E1J A;  4J2E A;  2YV0 X;  4JI5 K;  3I8D A;  4DFK A;  3ZT1 A;  3LDL A;  4B1W B;  3SNN A;  3R3L A;  4AHU A;  4KPY A;  4EP4 A;  3KVG A;  1TL3 A;  1KRP A;  1WBB A;  4CD1 A;  1JLF A;  4Z94 A;  2DFE A;  5J1E A;  5KPZ A;  2OPS A;  4DSI A;  4M45 A;  2WUS A;  3SUO A;  4PKI A;  3KLH A;  2Q0R A;  2PYJ A;  3OYL A;  2P9K A;  1YIJ N;  3DRR A;  3O4W A;  1EWQ A;  4FWO A;  3JSM A;  2Q97 A;  3VGL A;  3SJJ A;  4BRF A;  1Q7Y O;  4ID1 A;  3VEW A;  3GG4 A;  2G8U A;  2W6K A;  3F5T A;  4IFY A;  3MWP A;  2OPR A;  3AVA A;  4MDB A;  4FW1 A;  4BRL A;  2KFZ A;  3TPQ A;  3AO1 A;  2YNG A;  3O08 A;  2Y1J A;  1LWC A;  4FWL A;  4CF1 A;  1NJY A;  3FZK A;  3CCR N;  1XQS C;  4JD2 B;  4LY7 A;  4WQ4 A;  3I56 N;  1D9D A;  4BGA A;  1WAF A;  1EWR A;  2A1R A;  3I0R A;  2WOM A;  1FJG K;  1WLJ A;  3O6W A;  3FFI A;  1TKT A;  5IWA K;  5JLH A;  4JI1 K;  2XY8 A;  4B3R K;  4J8F A;  4FJK A;  3T3F A;  4GMJ B;  3AVC A;  2IGI A;  3MN6 A;  3EZ5 A;  3SJH A;  1HNI A;  3FZH A;  3U3Y A;  3L8B A;  2Z1I A;  1WSI A;  3VMF B;  2QWO A;  4DTX A;  3F9M A;  4CF2 A;  4DV6 K;  4DMN A;  3QBX A;  2VG7 A;  2RE2 A;  2H3G X;  4CZL A;  4H4O A;  2A40 A;  3PX0 A;  4F3O A;  3DI6 A;  1BDG A;  3AO2 A;  4GV6 A;  2BDP A;  4DTM A;  3DYA A;  1DGK N;  4IKF A;  4BR9 A;  4FW2 A;  4K8X A;  4IEE A;  1X3N A;  4KTW A;  3ULE B;  5AZI A;  4FLY A;  4KH5 A;  4BE2 A;  3G25 A;  4IZ9 A;  2HHQ A;  3CC2 N;  4W5N A;  3VPZ A;  3QNO A;  1VQ5 N;  4B3S K;  4A5A A;  4KHW A;  4E7J A;  3O9U A;  3J7A P;  3VEV A;  3NHG A;  5AQL A;  2QW9 A;  2QWR A;  3ASM A;  1T6D A;  1XUP O;  3RMA A;  3ZSX A;  5ADX A;  1KAY A;  3NE6 A;  3TWH A;  4LSN A;  1C1A A;  2NRT A;  4WFB L;  4M3Z A;  3K9K A;  3QDK A;  3OYJ A;  1QS4 A;  1ZXO A;  2PFU A;  4H5W A;  3U8X A;  4Q0B A;  3VGM A;  3VTH A;  1WB9 A;  3RRH A;  5AQH A;  1VK0 A;  3VQE A;  4R5P A;  3WT0 A;  1IG8 A;  3GDQ A;  3BF1 A;  4FVM A;  1RDC A;  1RDU A;  1BUP A;  2VWJ A;  1HNV A;  2O4G A;  1GLB G;  3KLE A;  2GV9 A;  4WCE L;  5J2Q A;  4RW4 A;  3KJV A;  4DU3 A;  4DSJ A;  4M3Y A;  4DV1 K;  4IDH A;  2OTL N;  4F4K A;  3NDK A;  4KI6 A;  5D3G A;  3VQD A;  4EZ9 A;  3HJF A;  4CGJ A;  5BPL A;  3FR0 A;  4JKH A;  1NJX A;  1YVU A;  1YUW A;  1RNH A;  2V52 B;  4DR4 K;  2ASO A;  3HTV A;  4BE0 A;  4FJ7 A;  2P9I B;  4KI4 A;  3N4Q A;  4YOR A;  4OKK A;  4E7I A;  3QIN A;  1HYV A;  3TTC A;  3QER A;  3P38 A;  3H46 O;  4CGH A;  1O13 A;  4GW6 A;  1E3M A;  4KH6 A;  1RT7 A;  5CE3 A;  1CXU A;  2D0P A;  3JYT A;  3ZSW A;  2FBX A;  5SZT A;  3LAN A;  4E89 A;  3VA0 A;  1QQN A;  1YTU A;  4JHD A;  1TAQ A;  1S1T A;  4CJL A;  2QWQ A;  5H1S Q;  2P9N A;  5JMV A;  5BPN A;  4BR2 A;  3LP0 A;  5FPD A;  4IDK A;  2W40 A;  4CD3 A;  3KKR A;  2OPP A;  4FJ5 A;  1S22 A;  4KV8 A;  1SKW A;  1W0H A;  2CH6 A;  2FXU A;  3O5B A;  2VG5 A;  1YI2 N;  1JCE A;  4B8A B;  1TV6 A;  3HP9 A;  3ZEU A;  3QEI A;  3JS6 A;  3BEX A;  3EY1 A;  4ISF A;  3AAR A;  3VEY A;  4GKJ K;  3CQX A;  3ENB A;  2YHY A;  3O9Q A;  3PIO L;  4YFU A;  4FPA A;  3ULD A;  5EU7 A;  4PKH A;  3VQ7 A;  3WEE A;  5J2M A;  4BRM A;  3AGR A;  2E6M A;  3THY A;  2D4W A;  3ZET B;  4BC2 A;  3KWG A;  4E1N A;  1TVR A;  3VQB A;  5KRT A;  4B1V A;  5C2D A;  1OH6 A;  3PLA A;  4BR7 A;  1JLE A;  1T44 A;  4DCH A;  1BG3 A;  1Q81 O;  1J54 A;  1RT1 A;  1VQN N;  1TKD A;  1LCU A;  4XEI A;  1U47 A;  4M3U A;  4BRP A;  1IO2 A;  4CFC A;  1S5J A;  1NKC A;  3HM8 A;  4CI6 A;  4O0J A;  3L2W A;  2GX9 A;  4E7H A;  4LSL A;  3WQT A;  3SZ2 A;  4CZF A;  3U9D A;  1MWK A;  1TUU A;  1Z05 A;  4YDU A;  1BIS A;  5M1F A;  1RFQ A;  4IO8 A;  5C0Y A;  2B4J A;  4ICL A;  1ZYQ A;  2AA4 A;  4FOE A;  1XI1 A;  4PL7 A;  5HRP A;  2OZS A;  4I6M A;  3Q7C A;  4DU1 A;  1KC8 O;  1KTQ A;  3ID8 A;  3VQP A;  2P5O A;  1BQN A;  1RBU A;  1U2V B;  4HHT A;  3CJ7 A;  4CES A;  4OO1 J;  3E9O A;  3M3Z A;  3SK3 A;  4AIL C;  4CHZ A;  2AP1 A;  2CGJ A;  5KGX A;  4FLT A;  3HOS A;  4H0X B;  3SPZ A;  1HR0 K;  5JS1 A;  4UQG A;  1QVG M;  4IG0 A;  3OYC A;  1JXB A;  3EE9 A;  3O4Q A;  3OJU A;  4CJR A;  3DAW A;  4NCB A;  2UUA K;  1UA1 A;  1T05 A;  1VQO N;  5AFU A;  1HX1 A;  1QQO A;  3LDQ A;  4W5Q A;  3OYM A;  3WXL A;  5C42 A;  3WNG A;  5AQJ A;  2B6A A;  3AO4 A;  3LDN A;  4FM0 A;  4DTU A;  3ZT2 A;  4H0V B;  1BIZ A;  3T19 A;  4PY5 A;  1TUY A;  1ATR A;  2YKM A;  4FJI A;  3T1H K;  5EXW A;  5BR9 A;  1N34 K;  2JLE A;  4ZHR A;  3C7N B;  2P9S A;  2O8C A;  4CFB A;  1SL2 A;  1REV A;  3OYH A;  5AQQ A;  1W9H A;  3LDP A;  3WXM B;  3CG7 A;  2ZGY A;  4BRA A;  1VSL A;  2YI1 A;  3J81 O;  1GLC G;  5I42 A;  4O8K A;  1YIT N;  1QE1 A;  4M3R A;  4IOA L;  3G4S N;  4DF4 A;  2NRV A;  1LW2 A;  4Y1C A;  4PHT X;  1JLB A;  3DLH A;  2IS3 A;  5DK5 A;  4B9V A;  1O1W A;  3V4I A;  2D0O A;  4CEO A;  3GBT A;  4NYN A;  5HRS A;  5F0X A;  5CR4 A;  4CJU A;  4JK9 A;  1T8E A;  3CPE A;  5GAG P;  1L3S A;  3PUF A;  4KHS A;  1C0G A;  1IKX A;  4M7Y A;  2D0B A;  2R7Y A;  1T3V A;  3WNE A;  1HQE A;  2BE2 A;  3ZT0 A;  4RTF D;  3IUC A;  1ASW A;  4FLV A;  2VWK A;  4M7X A;  1IV0 A;  5A2Q O;  5LL6 Z;  4OLA A;  2O8D A;  4FLU A;  4A59 A;  3SUP A;  3J8A A;  3AVG A;  3G10 A;  3CJC A;  3EO3 A;  4DHY A;  3TTF A;  1Y97 A;  2P9L B;  4C23 A;  3QML A;  4NXN K;  2FC0 A;  4CFA A;  3VF6 A;  1K73 O;  4CZG A;  1TK0 A;  2GWJ A;  1KXP A;  4LFC K;  5JLF A;  2VQE K;  1S1U A;  2QKK A;  5FRN A;  3HVR A;  1S1V A;  2Q1N A;  4C8M A;  3NFA A;  4K8Z A;  1K8K A;  4BG8 A;  4DFM A;  5KPR A;  5AQI A;  5SWM A;  3DXK B;  4FZX C;  2Q31 A;  4DR2 K;  3EE8 A;  3HRG A;  3K0S A;  3LWM A;  1KSP A;  2YJE A;  4WFN L;  1CLQ A;  4DTP A;  4HUE A;  1UA0 A;  2GBZ A;  1NM1 A;  4IJN A;  4CZK A;  1I3A A;  4IFV A;  1CXQ A;  2IOC A;  1NGI A;  5BRH A;  3NF9 A;  3OYA A;  1NGD A;  3HBT A;  3NF8 A;  4C8K A;  1LW0 A;  4CEC A;  4DV0 K;  1D4X A;  4OKE A;  4CZJ A;  1Q18 A;  1NU0 A;  2RF2 A;  3O1W A;  3AVK A;  1A5W A;  2XY7 A;  4DQI A;  1C0M A;  3FZL A;  4LFA K;  3CCM N;  2P5G A;  4CK3 A;  2QTD A;  3V81 A;  4CJE A;  1ATN A;  4M3T A;  1GLJ O;  5AZJ A;  5HRO A;  1SL0 A;  3OJS A;  2ZJQ L;  3OVN A;  1KQS M;  4K42 A;  5AQO A;  3L2U A;  4CIE A;  1TYQ B;  3MX5 A;  2HNY A;  1YTA A;  4XH4 A;  4CK1 A;  1NGJ A;  4ELV A;  4OPH A;  1RTD A;  1OVY A;  4DLE A;  2E88 A;  3RSE A;  3OBY A;  4LD0 A;  2G8V A;  4FJL A;  1RT5 A;  4EP5 A;  3KD5 E;  3D2F B;  4YHH K;  4O8U A;  4CHN A;  3TAR A;  1BOT O;  1GLA G;  3LP3 A;  3PY8 A;  5KRS A;  3K2P A;  3BDP A;  3O9T A;  4CBX A;  4KHQ A;  2Q0U A;  1VQM N;  1RDD A;  3OHR A;  2HF4 A;  3BY5 A;  3D6R A;  3BUZ B;  4MO5 A;  3NH0 A;  2GTD A;  3AAQ A;  3P1G A;  3THX B;  1Y64 A;  5E26 A;  1BCO A;  2YCH A;  4CEF A;  3CCL N;  1VSE A;  3VEO A;  4JI3 K;  4B1X B;  1NK5 A;  1W7A A;  4BC3 A;  3C95 A;  4FK4 A;  3PSI A;  1WSF A;  3MXM A;  3CJ1 A;  4V19 S;  4FXD A;  1QSL A;  4BQZ A;  3LAL A;  5ADX H;  2FF6 A;  4AH9 A;  4C8L A;  3LP1 A;  2Y1I A;  3OS1 A;  3VEN A;  1WAJ A;  3THW B;  4CJT A;  1BO5 O;  3VA3 A;  3O8M A;  1NLV A;  4QS9 A;  3PIP L;  3EL2 A;  4DQ8 A;  4J2B A;  5TKW A;  1BWF O;  2P9K B;  3NF6 A;  3OS0 A;  5HP1 A;  1LV5 A;  2P1J A;  4M63 C;  3TTD A;  1CZB A;  3ZCM A;  4DQQ A;  2KLA A;  4DTR A;  3K9J A;  3T1Y K;  4BC4 A;  3VEX A;  4YOX A;  2Z1J A;  4CF8 A;  2E8A A;  5GIN A;  2ZM6 K;  4JNE A;  4FWS A;  4JI0 K;  1NK6 A;  4QOZ B;  4H5V A;  4B9M A;  1KLM A;  4WQ5 C;  3AY9 A;  4OGC A;  1VAZ A;  3WXJ A;  3NH2 A;  4JLH A;  4CHO A;  2YJF A;  3ZX3 A;  4FPB A;  5DMR A;  5KQ8 A;  5TKY A;  5C12 A;  2RKI A;  5AQN A;  1NKE A;  3ZX0 A;  4KAZ A;  4CZE A;  1NGE A;  3KK3 A;  3M8S A;  4FJX A;  2ZGZ A;  2X78 A;  1S6P A;  4FYD A;  3SLC A;  2HVH A;  3TAQ A;  1U4B A;  2G8F A;  2EHG A;  2GUP A;  4AQY K;  2UUB K;  3H45 C;  3TAF A;  2X6S A;  4NB4 A;  4B9S A;  2A3Z A;  4DV3 K;  1VRU A;  3CCS N;  4FJ9 A;  4YOW A;  5JVH L;  5CY4 A;  1OH7 A;  1DLO A;  3VET A;  1QZ6 A;  4FWK A;  1C0T A;  3WNF A;  4YOV A;  2E1Y A;  3KKS A;  1UWB A;  1IH7 A;  2FBV A;  1E4F T;  4W5O A;  1ZBF A;  1EKE A;  5AZI B;  3OS2 A;  4FWQ A;  3HST B;  2E2N A;  1GOC A;  1NK7 A;  2KFN A;  3FLC O;  5M1K A;  2QI2 A;  3NGY A;  1B9D A;  1ZBL A;  2UYT A;  1NOY A;  3CFP A;  4LF8 K;  4BAC A;  1OKJ A;  5AJ3 K;  2KZM A;  4WFA L;  2KZZ A;  3RR7 A;  3RR8 A;  3H1V X;  4H5R A;  4PWD A;  1A5V A;  4JS4 A;  3CCE N;  3V9X A;  4JV5 K;  1BIU A;  4CHQ A;  2P9U B;  3VQ4 A;  4B1U B;  2XY5 A;  3GL1 A;  2X6N A;  1NK0 A;  4H0Y B;  2CGK A;  3UKU B;  2BH1 A;  3RWU A;  1W97 L;  3KLG A;  1QHA A;  1EO1 A;  2PAV A;  1NGH A;  1JLC A;  1RTH A;  4B3O A;  3CXC M;  4I2P A;  3HK2 A;  2D1K A;  1B9F A;  2YNF A; 
#chains in the Genus database with same CATH homology
 1SAZ A;  5KQD A;  5C2D A;  3PLA A;  1P8Z A;  4B1Z A;  4BR7 A;  1T44 A;  3E1Y A;  3CCQ N;  3CMA N;  1HKC A;  4BVO A;  4DCH A;  1BG3 A;  3D2E A;  2VGM A;  1Q81 O;  2HMP A;  4JD2 A;  5AQU A;  1VQN N;  4U67 L;  5AQF A;  1TYQ A;  1VQ8 N;  1YHQ N;  1LCU A;  4XEI A;  3A8Y A;  3R6M A;  3C7N A;  1DT9 A;  3DWL A;  4L3Q A;  4BRP A;  3H3O B;  2ZWH A;  2YHW A;  3HM8 A;  3LM9 A;  2F9T A;  4NLC A;  1NMD A;  4CI6 A;  2GX9 A;  1GLE G;  3SMP A;  3D2F A;  4FWN A;  1W2B M;  3KZB A;  3WQT A;  2JWK A;  3E9L A;  4JKE A;  4QS8 A;  3HZ6 A;  5AZJ B;  3ATU A;  5CHI A;  2CH5 A;  4CZF A;  3U9D A;  1MWK A;  1H1V A;  5EVZ A;  1TUU A;  2E2Q A;  4AM6 A;  1HKG A;  1Z05 A;  3FGU A;  2A42 A;  3H6E A;  4LC9 B;  4YDU A;  5AQM A;  5M1F A;  3KK7 A;  1RFQ A;  4ILJ A;  4IO8 A;  1U6Z A;  3IDH A;  5C0Y A;  1R59 O;  2ZJP L;  5GIP A;  4GV3 A;  4C1N I;  3L6Q A;  3MCA B;  4JHD B;  3H1Q A;  2AA4 A;  4FOE A;  3ZX2 A;  2NRR A;  3QFU A;  1WUA A;  4PL7 A;  1G99 A;  4CJ7 A;  3DXM B;  4H5T A;  4I6M A;  3MN7 A;  3Q7C A;  3SBG A;  1KC8 O;  4A61 A;  4A2B A;  3R8E A;  3ID8 A;  5AFU H;  3KHY A;  1T6C A;  2KKZ A;  1U2V B;  1HPM A;  3CJ7 A;  1MDU B;  4FL9 A;  3TU5 A;  1IJJ A;  4FWP A;  4OO1 J;  4JKB A;  2GWK A;  3E9O A;  3M3Z A;  1HLU A;  5BRE A;  3SK3 A;  3VEZ A;  3VF4 A;  2AP1 A;  1HUX A;  2CGJ A;  2JWL A;  2YHX A;  3LDO A;  4MDA A;  1XC3 A;  4BRN A;  3CQY A;  2QWM A;  2A5X A;  3HOS A;  4CZM A;  4H0X B;  2I7N A;  3ZEU B;  2E20 A;  1KAZ A;  4JKD A;  5GAD P;  1QVG M;  4BY9 C;  1JCG A;  4A5B A;  3M5R A;  3EE9 A;  5GAE P;  1MWM A;  3EN9 A;  3P4I A;  5AR0 A;  3UKR B;  3DAW A;  3B8A X;  5FPN A;  4WF9 L;  4KBO A;  1VQL N;  1VQO N;  5AFU A;  1HX1 A;  4EHU A;  3G6E N;  5M1P A;  1QQO A;  3LDQ A;  4MLH A;  3TSU A;  3MDQ A;  1M1K O;  1YAG A;  3A5L C;  2ZJR L;  3DJC A;  3WXL A;  1VQ4 N;  4OPA A;  3WXI A;  3NVK A;  4IJA A;  5AQJ A;  3SBT A;  1SQK A;  4MO4 A;  1DKG D;  3LDN A;  3N4P A;  4H0V B;  4JK7 A;  2NNW A;  5E84 A;  1RDW X;  1ATR A;  1TUY A;  3FE1 A;  3FZM A;  4G9Z A;  5EXW A;  3U4L A;  4H0T B;  5BR9 A;  3DXK A;  5EOY A;  4A2A A;  1VQP N;  1V4S A;  3C7N B;  1JCF A;  2P9S A;  1N8R O;  4NLB A;  4BR0 A;  1CZA N;  5AQQ A;  3C6H A;  3F2K A;  3H3N O;  1VQ6 N;  3EKS A;  3LDP A;  3WXM B;  2ZGY A;  4BRA A;  5M1O A;  1Q82 O;  4HTL A;  2ZF5 O;  3SMS A;  2YI1 A;  3W0L A;  3CIP A;  1GLC G;  4O8K A;  1YIT N;  4YOY A;  3CF5 L;  2HOE A;  4IOA L;  1S3X A;  3G4S N;  4YOT A;  2NRV A;  4BRG A;  3WXK A;  3SAF A;  5FPM A;  3CC4 N;  1KAX A;  4PHT X;  3P31 A;  1NBW A;  2BUP A;  4Y0W A;  3WQU A;  2IVN A;  2D0O A;  3GBT A;  5BRD A;  4IXC A;  4A62 A;  3QB0 A;  1YXQ A;  4XH5 A;  5MLC Q;  5F0X A;  1YJ9 N;  2ITM A;  5CR4 A;  3CD6 N;  5AQT A;  4JK9 A;  1YJW N;  3CPE A;  5GAG P;  1GLD G;  1V4T A;  4ISG A;  1C0G A;  3QBW A;  4M7Y A;  3I8B A;  1T3V A;  4WYB A;  1X3M A;  3ENH A;  4RTF D;  3IUC A;  5LJW A;  2V7Z A;  2WFB A;  4CZH A;  3BF3 A;  3MN9 A;  4M7X A;  2QM1 A;  4BR4 A;  3SAH A;  3L4Q A;  3G71 N;  3GE1 A;  2HBL A;  2I7P A;  4ILH A;  4IOC L;  1GLL O;  4PKG A;  1VQ9 N;  3VTI A;  4BQL A;  2HF3 A;  5AQR A;  1M90 O;  4IOX A;  2ASP A;  4A59 A;  3IFR A;  3J8A A;  3CJC A;  2V51 B;  3EO3 A;  1BA1 A;  2HBK A;  4DHY A;  4UY8 O;  4NO7 A;  3AAP A;  1ZC6 A;  1S72 N;  3TTF A;  2OTJ N;  4XH1 A;  3O9S A;  4BVP A;  2P9L B;  3SAG A;  4FO0 A;  2QEX N;  3MCP A;  4C23 A;  2ASM A;  3QML A;  5EY4 A;  3O9R A;  4IO9 L;  3LM2 A;  2QA4 N;  3MX2 A;  4K25 A;  3VF6 A;  4BGB A;  3MMV A;  3CHW A;  1NGG A;  1QQM A;  4H0P A;  1K73 O;  1MA9 B;  4CBU A;  5AQK A;  4CZG A;  3M1F A;  5C2F A;  2GWJ A;  1KXP A;  2HBM A;  2F7T A;  4E1J A;  5JLF A;  3WUH A;  2HBJ A;  2P9U A;  1X9J A;  5LY3 A;  4FWM A;  5AQX A;  2FLO A;  1YVN A;  2PBD A;  2Q1N A;  2P9N B;  3LDL A;  3R3L A;  4B1W B;  3IMX A;  5JIC A;  1K8K A;  3QIC A;  4BG8 A;  4HWI A;  3KVG A;  3UKU A;  4JKG B;  5AQI A;  3D7E O;  5KPR A;  3DXK B;  4CD1 A;  4FWR A;  4K43 A;  4Z94 A;  2Q31 A;  2NRZ A;  1NGA A;  2P9S B;  3EE8 A;  3ULE A;  3HRG A;  4WQ4 C;  5KPZ A;  3J7Z O;  2WUS A;  2YJE A;  4WFN L;  1EQY A;  4FSV A;  4PKI A;  2Q0R A;  4EIA A;  1NM1 A;  4IJN A;  4CZK A;  4BRK A;  2P9K A;  1YIJ N;  4YOU A;  2NRW A;  2VYP A;  1NGI A;  2QXL A;  3OA9 A;  5BRH A;  4RWT A;  1NGD A;  3HBT A;  3Q7B A;  3TSP A;  4BC5 A;  4F9O A;  3O4W A;  1VQ7 N;  1SS6 A;  3MN5 A;  4FWO A;  5M1N A;  1D4X A;  2Q97 A;  4CZJ A;  3VGL A;  1Q18 A;  4BRF A;  1YJN N;  1Q7Y O;  2DPN A;  4JKC A;  3VEW A;  3GG4 A;  3WEE B;  3O1W A;  3F5T A;  3MWP A;  3FZL A;  3EZW A;  3CCM N;  2VWB A;  3O80 A;  3CCV N;  4H03 B;  4MDB A;  2QTD A;  2IVO A;  2GEM A;  3JXU A;  4BRL A;  3TPQ A;  4BRD A;  1ATN A;  3O08 A;  2FSN A;  4FWL A;  1LOT B;  4GNI A;  1GLJ O;  3FZK A;  5BN9 A;  4FOI A;  2Q2R A;  5AZJ A;  3CCR N;  1HJO A;  2ZJQ L;  3D2E B;  1KQS M;  3I33 A;  1XQS C;  4JD2 B;  4K42 A;  4WQ4 A;  5AQO A;  3I56 N;  3CCJ N;  1K9M O;  4BGA A;  1TYQ B;  3MX5 A;  4XH4 A;  1ESV A;  1NJI O;  1NGJ A;  1RGI A;  4OPH A;  3O6W A;  1K8A O;  1OVY A;  2E88 A;  3RSE A;  3OBY A;  4A57 A;  3NVM A;  5JLH A;  3HOT A;  1VQK N;  3D2F B;  4O8U A;  4J8F A;  4BRQ A;  1NGB A;  1BOT O;  3DXM A;  1GLA G;  3T69 A;  1QVF M;  1YF5 L;  3O9T A;  4JK8 A;  4CBX A;  4GY2 B;  3MN6 A;  5AQY A;  2Q0U A;  1VQM N;  2FSK A;  5AQP A;  3SJH A;  3FFK B;  3OHR A;  5GAH P;  1SZ2 A;  1JJ2 M;  3FZH A;  2HF4 A;  1E4G T;  3D6R A;  3BUZ B;  4MO5 A;  4H5N A;  3VMF B;  2QWO A;  2GTD A;  3AAQ A;  5BRF A;  1DEJ A;  3CC7 N;  3F9M A;  4JN4 A;  1Y64 A;  2IIR A;  4EFH A;  5DM7 L;  3QBX A;  4PL8 A;  2RE2 A;  5E26 A;  4BRH A;  2H3G X;  1ATS A;  2P9I A;  2YCH A;  5LJV A;  4CZL A;  3CCL N;  3VEO A;  4B1X B;  3GOI A;  4ILG B;  4BC3 A;  4BRI A;  2A40 A;  4I6M B;  5AQZ A;  4BRE A;  3CER A;  3CJ1 A;  3VF2 A;  4BRO A;  3ID6 A;  1BDG A;  4GV6 A;  1DGK N;  1K8K B;  4BQZ A;  5ADX H;  1ILY A;  2FF6 A;  4BR9 A;  3CJB A;  4CBW A;  3CET A;  2FSJ A;  5B8H A;  3VEN A;  4IEE A;  3ZYY X;  1X3N A;  5ELZ A;  4CZI A;  5BN8 A;  3ULE B;  1BO5 O;  5AZI A;  2EWS A;  4KH5 A;  3O8M A;  3QFP A;  3C65 A;  2P9P A;  1NLV A;  3G25 A;  4IZ9 A;  4QS9 A;  2W41 A;  3CC2 N;  2Q36 A;  3CJA A;  3PIP L;  3EL2 A;  2F9W A;  5AQW A;  3VPZ A;  4A5A A;  4DQ8 A;  1VQ5 N;  5TKW A;  1BWF O;  2P9K B;  2QWN A;  3O9U A;  4ISE A;  5AQS A;  3DLL L;  3VEV A;  5AQL A;  4K41 A;  2QW9 A;  2QWR A;  4QS7 A;  4M63 C;  3TTD A;  1T6D A;  1XUP O;  3T7Z A;  2KLA A;  2E2P A;  3P39 A;  3K9J A;  3O1B A;  4BC4 A;  3VEX A;  4YOX A;  5ADX A;  1KAY A;  2E8A A;  4WFB L;  2NRT A;  2VCP A;  5GIN A;  2WBN A;  3K9K A;  3QDK A;  3VOV A;  1ZXO A;  4EAH D;  2PFU A;  2NZT A;  4H5W A;  1WOQ A;  3U8X A;  4JNE A;  3VGM A;  2NRH A;  3C0B A;  3VTH A;  4FWS A;  5AQG A;  4H5V A;  5DM6 L;  3A0I X;  4BR5 A;  1Z6R A;  4WQ5 C;  5AQH A;  3AY9 A;  1Q86 O;  3VER A;  1VAZ A;  1IG8 A;  3WT0 A;  3WXJ A;  1C0F A;  3C6A A;  3BF1 A;  3GDQ A;  4H0O A;  1KD1 O;  1RDU A;  1BUP A;  5AQV A;  3KWI A;  1GLB G;  1QZ5 A;  2YJF A;  4O5F A;  3ZX3 A;  2BTF A;  4FPB A;  5KPT A;  5KQ8 A;  5TKY A;  3RSE B;  4WCE L;  4RCH A;  4B9Q A;  5C12 A;  5AQN A;  4MLE A;  3ZX0 A;  3ZET A;  4BRC A;  4CZE A;  1NGE A;  3VES A;  3FZF A;  5FPE A;  3W3D A;  3I55 N;  5EX5 A;  2ZGZ A;  4IDH A;  2OTL N;  3E9P A;  5HL7 L;  1BA0 A;  2E2O A;  2HST A;  4AF1 A;  3SLC A;  4JKF A;  3VGK A;  2YX6 A;  2GUP A;  2V7Y A;  5BPL A;  2OAN A;  3H45 C;  3LL3 A;  3FR0 A;  4IEI A;  4JKH A;  2CGL A;  1HKB A;  4NB4 A;  1YUW A;  2A3Z A;  2GEL A;  2V52 B;  3CCS N;  2FF3 B;  2ASO A;  3HTV A;  2P9I B;  5C10 A;  4YOW A;  5JVH L;  3N4Q A;  4YOR A;  2QWL A;  4C1N K;  3ATV A;  4WQ5 A;  3TTC A;  3P38 A;  4GVE A;  3H46 O;  3MWT A;  4JKA A;  4JEP A;  3VET A;  4AM7 A;  1QZ6 A;  4FWK A;  4YOV A;  1O13 A;  2E1Y A;  3IKM A;  2A41 A;  1J6Z A;  2J4R A;  2P9L A;  3CI5 A;  4EHT A;  5F1X A;  4KH6 A;  1E4F T;  5CE3 A;  1GLF O;  2D0P A;  2E1Z A;  3AGK A;  2VGN A;  3R1X A;  3BP8 A;  5AZI B;  4FWQ A;  1QQN A;  4FVU A;  4DB3 A;  2E2N A;  3A5M C;  2P9P B;  3M6G A;  4JHD A;  2NLX A;  4KH4 A;  3FLC O;  5M1K A;  2QI2 A;  3E66 A;  3CME N;  3CPW M;  2QWQ A;  5M1Q A;  2A6A A;  4U7B A;  4JAX A;  2UYT A;  5H1S Q;  2P9N A;  3R9P A;  2RHK A;  3RVC A;  5JMV A;  3CCU N;  5JVG L;  2IVP A;  4BG9 A;  4BR2 A;  5BPN A;  3U9Z A;  5FPD A;  2W40 A;  1OKJ A;  1U2V A;  4IWV A;  4JKG A;  4CD3 A;  4WFA L;  3H1V X;  4H5R A;  3OW2 M;  5F2R A;  4GV9 A;  3NMU A;  1NGF A;  1S22 A;  3CCE N;  2QWP A;  3S41 A;  3ENO A;  5BPM A;  2CH6 A;  2FXU A;  3O5B A;  2P9U B;  4IFE A;  1YI2 N;  1JCE A;  3A5O C;  4B1U B;  3ZEU A;  1NWK A;  3GL1 A;  3UE5 A;  3L4I A;  3UB5 A;  2NRX A;  3BEX A;  3JS6 A;  1NGC A;  4H0Y B;  3HI0 A;  4ISF A;  3AAR A;  2CGK A;  3HSC A;  3VEY A;  3UKU B;  3CQX A;  1ZBS A;  2BH1 A;  2WC9 A;  1W97 L;  3ENB A;  2YHY A;  3O9Q A;  1QHA A;  3PIO L;  1EO1 A;  2PAV A;  1NGH A;  4FPA A;  5I9E B;  3UKR A;  4B1Y B;  4PKH A;  4DKW A;  3MK6 A;  2KHO A;  5HOO A;  3WEE A;  3L0Q A;  4R79 A;  1P90 A;  3A5N C;  3AGR A;  3TSQ A;  3EKU A;  1BU6 O;  4BRM A;  5GIO A;  4YDU C;  5C15 A;  3CJ9 A;  3CXC M;  2D4W A;  3OBW A;  3ZET B;  3KWG A;  4BC2 A;  2D1K A;  4B1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...