3ZX3A

Crystal structure and domain rotation of ntpdase1 cd39
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
406
structure length
399
Chain Sequence
NVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGASTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNNSHCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
publication title Crystallographic Evidence for a Domain Motion in Rat Nucleoside Triphosphate Diphosphohydrolase (Ntpdase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 125
structure length 399
sequence length 406
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx3A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx3A02
4BRGA 1HPMA 1U2VB 4FPBA 4CI6A 4B1ZA 2QXLA 4CBUA 3EO3A 1ATNA 4BRMA 3GDQA 3GG4A 5KPRA 3FZHA 4ISFA 4BRCA 2YJEA 1BUPA 1GLAG 3FZMA 4H5WA 2D1KA 2YI1A 5AZJB 4BC4A 4FWMA 1BDGA 4BRFA 3WT0A 3CERA 3IMXA 2V7ZA 4WQ5A 2BUPA 4BRKA 2PBDA 4BG8A 2D0OA 4CZIA 1RFQA 2YHYA 4MO4A 4H03B 4B1YB 4FWOA 4JHDB 5E84A 1HLUA 1HKBA 2HOEA 5FPEA 4H0TB 2V7YA 1Z05A 2NRHA 1U6ZA 4BRQA 5CE3A 2Q36A 2V51B 4H5NA 4H0YB 4FSVA 3WEEA 3H3OB 1X3NA 1IJJA 4BR7A 3A5NC 4J8FA 5AQRA 5BN8A 4AM6A 4FWSA 3B8AX 2E2QA 5KQ8A 4B9QA 1NGJA 3AARA 4BRHA 4FOIA 3H1VX 3GE1A 5AZIB 5AZJA 2CH6A 1JCFA 2P9KB 3ZX2A 1ATSA 4LC9B 4NO7A 3H3NO 1ZBSA 5ADXA 3ULEA 4Z94A 2V52B 4BR9A 1QQNA 2I7PA 1Z6RA 3KVGA 3QMLA 4EHTA 2GEMA 2CGJA 2A41A 1D4XA 5E26A 2AA4A 3QFUA 3FGUA 3WXLA 3ZETB 3UB5A 5KPZA 2D4WA 5F2RA 3FZKA 3A5OC 3GL1A 2J4RA 3EZWA 3L4IA 2P9UA 2P9SA 3SK3A 5JLFA 3DXKB 3JS6A 5AQPA 1BG3A 3RSEB 5BPNA 1DKGD 4PKHA 4BQZA 4IWVA 2GTDA 4JAXA 1YUWA 2A40A 1GLEG 1NGBA 1T44A 2GWJA 1NM1A 3F9MA 3WXKA 3ATVA 1YVNA 3BEXA 4K41A 5AFUA 5FPDA 3U4LA 2FF3B 1ATRA 1S22A 2P9IB 3ENHA 4CBXA 4C23A 5AQTA 2FSNA 1C0FA 3CJBA 3M1FA 2E1ZA 5AZIA 1V4TA 1MWMA 4FWPA 5AQGA 3UKRB 1KAZA 1CZAN 1NBWA 4IXCA 1P8ZA 3IUCA 4GNIA 3U8XA 2CGLA 2P9LA 3MN7A 3QBXA 2QWNA 3L0QA 4EAHD 1JCGA 4CZFA 3S41A 3VEYA 1SAZA 1R59O 1KAXA 4BRDA 3MN6A 4IJAA 3AAPA 5AQQA 5B8HA 3MN9A 3ZEUA 3VEXA 1OKJA 4XH1A 5BRHA 3MCPA 3CETA 2ASPA 3RSEA 1HKGA 1KAYA 1YXQA 3A0IX 3GBTA 1MDUB 2HMPA 5EXWA 4DB3A 4A62A 3D2EB 4H0OA 4BRPA 5EX5A 3DWLA 5FPMA 5AQLA 5AQSA 3CIPA 5JLHA 2F9TA 3C7NB 1GLDG 1DEJA 3FLCO 2CGKA 3WXJA 4PL7A 3W3DA 2WUSA 1HX1A 3UKUA 3SLCA 3EL2A 2QM1A 4I6MA 4IJNA 2IVOA 4O5FA 2P9NA 3WQTA 3FZLA 4IZ9A 3A5MC 2Q2RA 4BRLA 3W0LA 4FWRA 3D2FA 1QQMA 3I8BA 4ISEA 4RWTA 1QQOA 2HF3A 2VYPA 2YCHA 2ITMA 3BF3A 4BC3A 1U2VA 3HSCA 1XUPO 2QWLA 3EKSA 1NGGA 1MA9B 1BU6O 4B1UB 5AQIA 2VCPA 4A2BA 5I9EB 3LDPA 1NMDA 3KZBA 1QZ6A 4QS7A 3O1WA 1NLVA 3VGKA 4BGAA 4BREA 3SMPA 2Q0RA 3LDLA 4PKGA 5AQZA 4BR4A 4CZGA 1NGIA 2Q97A 1ZXOA 1T6CA 4AM7A 5AR0A 4BRIA 1XQSC 3LDQA 1K8KB 4O8KA 1X9JA 3WQUA 3A5LC 3A8YA 1GLBG 4CZLA 3O1BA 4XH5A 4JHDA 2HF4A 5BPMA 4QS9A 5LJVA 2Q1NA 2FXUA 5AQMA 3HM8A 4FWLA 2F9WA 4JD2B 1S3XA 5AQHA 4JNEA 5BRFA 4FO0A 3VERA 4BRNA 3VF4A 2P9PB 3O4WA 1V4SA 4CZKA 5AQVA 4F9OA 3CJ7A 4BR5A 3M6GA 2A3ZA 4A61A 4CZJA 1RDWX 1TYQB 1BWFO 2PAVA 4BR2A 1QHAA 3MDQA 2NZTA 4FOEA 3AY9A 3DXMB 1HJOA 2GUPA 3O6WA 4EFHA 4BC2A 2A5XA 5F0XA 3KHYA 3EKUA 2E2NA 4ISGA 4CJ7A 4XH4A 3CQXA 5AQUA 4CD3A 2P9KA 3WUHA 5BPLA 1G99A 1T6DA 2H3GX 5BRDA 3R6MA 5AQYA 4BR0A 1LOTB 2QWOA 2E1YA 4CZHA 3VGLA 3DAWA 3R8EA 3SMSA 4MLHA 5KQDA 4CZEA 3MK6A 1J6ZA 1BOTO 4B1XB 2A42A 3HZ6A 3ZETA 3MN5A 3M3ZA 5AQJA 3VEZA 2QW9A 2ZGYA 3VENA 3DXKA 4FWQA 3TU5A 1H1VA 1XC3A 3LDNA 3CI5A 2Q31A 3ENOA 4FWKA 5LY3A 1Y64A 5LJWA 3VEWA 3H6EA 2P9IA 2ZF5O 3DJCA 3BP8A 4B1VA 1TUUA 3TPQA 1HUXA 2KHOA 4H0XB 3H46O 3WEEB 2FF6A 3C0BA 4DCHA 4DQ8A 3O8MA 3QDKA 1E4FT 3HBTA 3UKRA 1WOQA 2QWPA 3MMVA 4EIAA 5AQKA 1DGKN 3ZX0A 3IDHA 4K42A 4H5VA 2GWKA 2FSJA 1QZ5A 2BTFA 2QWRA 3I33A 1NGDA 5FPNA 4BVPA 3G25A 4YDUA 2W41A 2YHWA 3JXUA 1EQYA 4H5TA 3BUZB 4GY2B 3FE1A 2D0PA 1MWKA 4DHYA 1GLFO 3HI0A 4CZMA 2OANA 4HTLA 2I7NA 3ULEB 1GLCG 2A6AA 4PKIA 4M7XA 1GLLO 2QWMA 5BR9A 4BROA 4FL9A 3LDOA 1NGEA 3D2EA 3QICA 4QS8A 4PL8A 5EVZA 5TKYA 4K43A 3VF2A 3H1QA 2E88A 4BGBA 3L6QA 4B1WB 3R9PA 3O5BA 3C7NA 1ZC6A 2P9UB 2P9SB 3CJAA 3FFKB 4YDUC 1NGFA 2IVNA 2E20A 3VOVA 4H5RA 3UE5A 3U9ZA 5EY4A 1KXPA 2YHXA 4IO8A 2FLOA 4WQ5C 3GOIA 1GLJO 1BA0A 1NWKA 2YJFA 2QWQA 3CJ9A 3VGMA 2Q0UA 5BN9A 4E1JA 3HTVA 2ZWHA 2EWSA 2E2PA 1Q18A 1NGAA 5ELZA 1TUYA 4BQLA 3CJCA 1NGCA 3IFRA 5AQNA 3WXIA 3VESA 3FZFA 4FWNA 3FR0A 4WQ4A 3VETA 1LCUA 4EHUA 3O08A 4M63C 4BRAA 2UYTA 4CBWA 3LM2A 3ZX3A 1ESVA 1SZ2A 2P9LB 4A2AA 4MO5A 3ATUA 4NB4A 3VF6A 4XEIA 2AP1A 2ASOA 5ADXH 2CH5A 5BREA 2IIRA 3OHRA 3ZEUB 4BG9A 4WYBA 2ZGZA 5JICA 5KPTA 4H0PA 2ASMA 5AQWA 3H45C 3LL3A 3P4IA 3U9DA 4WQ4C 2E2OA 3D7EO 5F1XA 4K25A 3BF1A 1K8KA 3QFPA 1WUAA 3EN9A 4L3QA 5AQFA 3ID8A 1BA1A 4HWIA 4Y0WA 1SQKA 4FPAA 1YAGA 3CJ1A 3QBWA 4MLEA 1BO5O 3O80A 5EOYA 2FSKA 3LM9A 1IG8A 5AQXA 5AFUH 3QB0A 4JD2A 2DPNA 2IVPA 1RGIA 2NLXA 3UKUB 4RTFD 5AQOA 1X3MA 1E4GT 1NGHA 4I6MB 1JCEA 3CQYA 2P9PA 3VEOA 4BVOA 2E8AA 4M7YA 2P9NB 3AAQA 4RCHA 2VWBA 1TYQA 1C0GA 4JN4A 3VEVA 2GELA 4H0VB 4KBOA 1HKCA 3DXMA 4CD1A 3D2FB 5JMVA 4BC5A 3CHWA 3VPZA 3SJHA 3J8AA 2W40A
chains in the Genus database with same CATH superfamily
4JKGA 4FPBA 3THXB 4DSKA 4BRMA 5FLXO 3HPGA 1WSFA 2HNDA 1EXQA 3FZHA 3HRGA 3QO9A 4M3XA 4BRCA 4JI6K 4WF9L 3KKRA 2P5OA 4QAGA 1TKXA 4DV6K 4DTRA 3DI6A 3SCXA 4BC4A 4FWMA 3SQ1A 3J7AP 4PUOA 1XWLA 4JI8K 4WQ5A 4W5QA 3O3GA 2PBDA 2ZE2A 4H03B 3O9SA 4FWOA 4E89A 4OLBA 4NLBA 4ILGB 1HQUA 1U6ZA 3ZCMA 2ZJQL 4GVMA 4M45A 4AH9A 2Q36A 2V51B 3LAMA 4H5NA 3V1OA 3WEEA 3K57A 3H3OB 3VQCA 3A5NC 4AILC 5AQRA 5BN8A 4FWSA 1YHQN 3E9LA 1CZ9A 4DLEA 3OYBA 1JLCA 3J81O 4BWMA 3V4IA 4ELTA 1NGJA 2QKBA 4B3RK 2WBNA 3V9ZA 4DU1A 3K0SA 4FOIA 3OY9A 5AZIB 3V1RA 4YOXA 1VSIA 2P9KB 3ZX2A 4CCHA 1RBVA 3LP2A 3EY1A 4Z94A 1X9WA 4BR9A 4DQSA 2I7PA 3DLEA 4F4KA 3AVCA 2GEMA 2A41A 3ZT4A 1K8AO 4F3OA 3FGUA 3ZETB 5J2NA 1LV5A 1D9FA 3A5OC 2ITGA 3EZWA 3L4IA 3SK3A 2P9SA 3C95A 4ILJA 3RSEB 2XY5A 1DKGD 1XMOK 3RMAA 3CCRN 4YOWA 4IWVA 3CC7N 1GLEG 3F9MA 2QK9A 4CGDA 3WXKA 2YHAA 4K41A 3QNNA 3QEPA 4KV8A 2KFZA 3HP6A 3THYA 4CEBA 2HHSA 1RBUA 3CJBA 4BDPA 2E1ZA 3VQ4A 4CW7B 1V4TA 1VSDA 1RT2A 4FWPA 1WN7A 1KAZA 3KLHA 3DRRA 5FDLA 3IUCA 4KHSA 3U8XA 4C8MA 3MN7A 3TAGA 2O8CA 2QWNA 4CGJA 2WC9A 4B8CA 3VEYA 1SAZA 1YF5L 1KAXA 4BRDA 2G8VA 3AAPA 3ZEUA 4CGFA 2A1SA 4GV3A 1OKJA 3CM6A 4W5NA 3HPHA 5DM6L 3SAHA 2UUAK 1TGOA 1HKGA 1R0AA 4CEZA 3NH2A 1VQLN 1NK5A 5IT9O 4H0OA 2WONA 1LWCA 2Y1JA 2HMIA 1JLBA 3G4SN 3VQ5A 3DRSA 3TTCA 3J7ZO 1DEJA 4BDYA 3TANA 4NCAA 2ZD1A 4CEDA 1KVCA 4PL7A 1WLJA 3W3DA 1J5OA 1HX1A 3EL2A 1RDUA 5JVGL 4CGIA 3S3NA 2ZJRL 3WQTA 3FZLA 4IZ9A 4BRLA 4JRPA 5HRRA 3D2FA 4Q0BA 1JL1A 4N5SA 3BF3A 4CEQA 2QXFA 1MA9B 1VQON 4KH4A 3O1WA 1NLVA 4WFBL 4AHCA 4BREA 4LD0A 1XNQK 1S1VA 1SKWA 4CHOA 2NRZA 2YKNA 1FKOA 5AR0A 2IOCA 4BRIA 2GUIA 1K8KB 3IRXA 3SZ2A 1RNHA 2O8BA 1VSHA 1BGXT 1GLBG 3A8YA 1NG9A 4CGHA 3CPWM 4JKBA 4CJUA 5BPMA 4YOYA 4K0KK 2FXUA 4QCLA 4B9UA 4JD2B 3OTOK 1S3XA 1M90O 4JNEA 2KQ2A 1IH7A 4O8UA 4JKDA 3VF4A 4FJ8A 1EX4A 1Q8IA 4NLCA 3CJ7A 4RW8A 4DR2K 3M6GA 4A61A 4CZJA 1RDWX 4MDAA 5GINA 4BR2A 3PX4A 1FKPA 2RHKA 1HQEA 4BC2A 1TAUA 5F0XA 4CK2A 3IG1A 3KHYA 3EKUA 4ISGA 5AQUA 3CQXA 4CD3A 3WUHA 4CF0A 5BPLA 1T6DA 3MWPA 3DLRA 4LF5K 4DLGA 1Y97A 3DAWA 3AVIA 3L8BA 2XHBA 4LSLA 1KCFA 2A42A 3R1XA 4HCCA 5AQJA 4DQIA 4ILHA 5HRSA 1N8RO 4C8NA 3ZSYA 3JSMA 3OYNA 1XC3A 4DUZK 3HVRA 2GV9A 4FK2A 4FWKA 3VQ6A 1YJ9N 3MXMA 4AF1A 2DTUA 4JKFA 3MEEA 5KI6A 2YX6A 1J5EK 3RTVA 3VA3A 2KW4A 2P9IA 3B6OA 1XI1A 1EWQA 2KHOA 5GAHP 3H46O 1RBRA 4DQ8A 3O8MA 1VQ8N 5EU7A 4CIEA 3QDKA 1E4FT 3UKRA 1O1WA 4DFMA 4B9MA 4EIAA 1DGKN 3S9HA 4OKEA 4CHNA 4FLVA 4H5VA 4NXNK 5CR4A 1QZ5A 1XC9A 1TL1A 2UXCK 5C2FA 2QWRA 3MX2A 4E7HA 4DTSA 4ID5A 3SJJA 3MEGA 3CXCM 1NGDA 5J2PA 3G25A 4H8KA 1BCMA 3ZSVA 3OYKA 1EQYA 1VK0A 3OW2M 3BUZB 1Q86O 1J9AA 4KB0A 4LH4A 4HTLA 3CPEA 3DOKA 4JK8A 3V9SA 4DF4A 2A6AA 4PKIA 3LDOA 4CEFA 1NGEA 4B9NA 1HYZA 5C24A 3QICA 5AJ3K 4FYDA 4IG3A 4CFCA 5EVZA 4QOZB 1HYVA 4K43A 3VF2A 1C1AA 4KTQA 3CFRA 1JKHA 2KLAA 3VTIA 1BQMA 1HYSA 4M3WA 2P9UB 4KH6A 5TKWA 3FFKB 1NGFA 2IVNA 5KRTA 3PY8A 5EY4A 3LWLA 2YHXA 3OYCA 2HNZA 1W0HA 5MLCQ 1HNWK 4KFBA 3O9QA 4IFVA 4WQ5C 3GOIA 3OYMA 1GLJO 3CJ9A 4AHSA 2VG5A 3NGYA 3RR8A 3VGMA 1VHXA 2FC0A 2UU9K 3CYMA 2Q0UA 5BN9A 1MU2A 5T7BA 4CJRA 2O8FA 1C1BA 1Q18A 1NGAA 5ELZA 3OA9A 5HP1A 3DYAA 3CD6N 3CJCA 2OA8A 1NGCA 3ZSZA 5AQNA 3WXIA 3VETA 4FWNA 3FR0A 4ELVA 3AVHA 1QVFM 3LM2A 4O44A 3T1AA 3WNFA 4HVJA 4CEEA 3O4QA 4XEIA 2AP1A 2CH5A 3TSQA 4BG9A 4DQPA 1RCHA 3HJFA 5KPTA 3KK3A 3VTHA 3S3OA 4B08A 1N6QA 3U3GA 3AA5X 1WAJA 4CEAA 5I42A 2RE2A 5CYQA 3QFPA 1QQCA 4RW9A 5JS2A 3V6DA 3R3LA 3ID8A 1BA1A 4HWIA 2QTDA 1U48A 4Y0WA 1NOZA 1JLQA 1FXXA 3O80A 4HTUA 4AHUA 2FSKA 3LM9A 1W2BM 4O0IA 1YTAA 3EYZA 3K5LA 3F9KA 5AFUH 2HBMA 4JI5K 2IVPA 2NLXA 1Q82O 3AO2A 5AQOA 4BWJA 1VSFA 1JCEA 3V9UA 2P9PA 2YNHA 3VEOA 1YVUA 2E8AA 3ZT0A 3AA2A 2VWBA 3C6AA 3K9JA 2G8WA 4OKJA 4KHNA 3ZT2A 2X78A 3AO5A 3DLKA 1IV0A 2GELA 1A5XA 4E1NA 1HKCA 3AA3A 1B9DA 4BC5A 4DG1A 3RMDA 3VPZA 5LMNK 3DLHA 3KK1A 3LZIA 1LAWA 1U2VB 4KO0A 4I9QA 4B1ZA 2QXLA 4DFJA 3PUFA 2OPRA 2R7YA 3AVAA 1SL2A 2OTJN 5KPRA 2DFEA 4ISFA 4O5BA 3LP1A 3NH1A 1DTTA 5GIPA 4BRFA 4F3TA 1VSJA 3SUPA 3ZLJA 4JKEA 2D0AA 4KHQA 4BG8A 2D0OA 4CZIA 2UUCK 1GOCA 4B1YB 1GOAA 4KB1A 1S1UA 2PYLA 4JHDB 4Z4EA 1VSEA 1HKBA 5FPEA 4YHHK 1Z05A 3PX0A 1U4BA 2NRHA 2O8DA 3PV8A 3N4PA 5CE3A 4FJNA 3O9UA 2FBXA 1W9HA 5FROA 3M8PA 4AM6A 4ZTJA 3TI0A 3B8AX 1WBBA 1RTIA 5KQ8A 1I3AA 1C0UA 2VQEK 3H1VX 3NBPA 3O3HA 1ZBFA 1IKWA 1NMNA 2F8TA 1KFDA 2X6NA 1RDBA 3KJVA 1HPZA 1ZBSA 3C65A 3H3NO 3ULEA 1C0MA 2GBZA 1VQ9N 3KVGA 4EHTA 1D4XA 4GKJK 5E26A 2AA4A 2IC3A 2HHTA 4DSJA 4JYAK 3GL1A 3NGIA 2J4RA 4GKKK 1NJXA 4K8ZA 3DXKB 3JS6A 3EE8A 1DT9A 4JK9A 4PKHA 3L3UA 1KQSM 5HBMA 4CVNE 3AA4A 1NM1A 1OH7A 2F96A 3BEXA 4IO9L 3U4LA 5HRNA 4DR1K 5HOOA 4CBXA 1T7PA 3OYGA 5AZIA 2W42A 1T03A 1KD1O 3NDKA 3LPUA 3HT3A 1VQ4N 3F5TA 1CZAN 3Q7BA 1NBWA 3P39A 4B9LA 4FZZA 1IBLK 4IXCA 3RMCA 4DV0K 2DY4A 3CFOA 1JJ2M 4B3SK 3E1YA 3AVLA 3L0QA 2NRTA 4HUFA 4IJAA 3L2VA 3TARA 4RW7A 4CF8A 4CK3A 1QS4A 3MN9A 4KI4A 4XH1A 1VQ5N 1NK9A 1IKYA 3I55N 1ASVA 4LFCK 3RSEA 1KAYA 3A0IX 1TK0A 5I3UA 5M1FA 3D2EB 3ID6A 3DWLA 2D0CA 4CFBA 4DWIA 4BE2A 1NKEA 1SV5A 2F9TA 3I8DA 4DMNA 3VN5A 3FLCO 3OYFA 2CGKA 3CCJN 3SLCA 2D0BA 4AQYK 3KLIA 2QM1A 1S72N 4I6MA 4IJNA 4IEEA 2IVOA 3G10A 3AVNA 2PY5A 4IBNA 1NJYA 3F2KA 4PHTX 4FWRA 4CHPA 5IWAK 1QQOA 2VYPA 4HUGA 2G8KA 3CCSN 3SYZA 4FJGA 3EKSA 1NGGA 3ZSQA 5J2QA 4YNQA 2E5LK 3T1HK 5I9EB 2O8EA 4IFEA 3CCQN 3ALYA 1XNRK 2YHBA 4CE9A 3QNOA 4L8RB 4JI1K 3TAQA 3SI6A 1RBSA 3HYFA 1NGIA 4CIFA 1T6CA 4CHQA 4FZYA 2Z1IA 2XY8A 1RT4A 1XQSC 1X9JA 3WQUA 3KD1E 1TV6A 4DFPA 3L3VA 2OCEA 3HP9A 4MQ3A 4QS9A 5LJVA 4OPKA 4DR5K 4IDHA 2NUBA 2QKKA 3HM8A 4FWLA 1S6PA 1ZYQA 3IS9A 4DQRA 4DV5K 2HHUA 4BRNA 3TTFA 3F73A 3O4WA 1V4SA 2Z1JA 2RPIA 3U3YA 2PAVA 3JAMO 4DTJA 1KC8O 1QHAA 4FW2A 1QSYA 3DXMB 4C1NK 4EFHA 4CJ3A 2KTQA 4JKGB 4KH5A 2HHQA 2H3GX 4ZTFA 3R6MA 3RVCA 1TK5A 3I56N 3DLLL 4A57A 1LOTB 1HNXK 4JI0K 4DR3K 4CZHA 3THWA 5CZ1A 3MXIA 1VQNN 4M3YA 3E9PA 1J6ZA 1BOTO 4J2BA 1HJRA 5LL6Z 1VSLA 4B3TK 1IKXA 1JLEA 3VEZA 2QW9A 4FCYA 1OH8A 2ZGYA 1VRTA 3VENA 3K58A 4FM0A 3AVKA 2HVHA 1S5JA 3ISNC 3CI5A 2Q31A 5LY3A 1EKEA 1C6VA 4J2DA 4NYNA 4CK1A 3B6PA 4Z4GA 2ZF5O 5GAGP 3DJCA 3BP8A 1TUUA 3TPQA 1HUXA 4YY3K 3WEEB 2YV0X 3C0BA 1WSJA 4KHWA 4GW6A 3CCLN 1SKRA 5AQKA 3U6FA 3ZX0A 4K42A 3KD5E 1LW0A 1KLMA 3SNNA 4LF9K 1NOYA 2PFUA 2Q3SA 4W5TA 3PSFA 4BVPA 4CHYA 1RT1A 3MX5A 4DTPA 2YHWA 4H5TA 3FE1A 2OANA 2WOMA 3T7ZA 4M7XA 5BR8K 2QWMA 5BR9A 4BROA 3AVJA 4FL9A 3LWMA 4CF1A 2UXDK 4CECA 1RDAA 4A59A 4QS8A 4DSLA 1VQMN 5TKYA 4GV9A 4LY7A 3ZSOA 4Y1DA 1LWFA 3R9PA 5H1SQ 3C7NA 3NFAA 1ZC6A 4JI4K 4GVEA 4F2RA 2P9SB 1TKZA 4YDUC 4FJIA 3ZSXA 3VOVA 3QESA 3RMBA 2HHHK 2YKMA 4Z0UA 5KGXA 1BA0A 2QWQA 3VQ9A 3NMUA 3N4QA 4I7FA 1T3VA 4M3TA 3HTVA 2ZWHA 1BIUA 3PSIA 2W6KA 4IOCL 1OVYA 4E19A 2WTUA 1UWBA 2JWLA 3LP0A 5K14A 1TUYA 3CCMN 4BQLA 3G71N 4BY9C 3QIPA 3IFRA 4H4MA 3VESA 2E6LA 1L5UA 2G8HA 4EHUA 4CHZA 1Z26A 1I94K 3O08A 3DLBA 4OGCA 1ASUA 4O4GA 2UYTA 4BRAA 3CMAN 1ILYA 4CBWA 2O8CB 4FK0A 3ZX3A 1SZ2A 4MO5A 4DF8A 3VF6A 4JI7K 2ASOA 4ID1A 4DU4A 4Z4HA 4FJJA 3OBYA 3ZEUB 5HL7L 1U45A 4EZ6A 4WYBA 3P38A 3Q7CA 2ASMA 5AQWA 3P4IA 3U9DA 4WQ4C 2E2OA 4I2QA 4JLHA 4K25A 4FJKA 3EN9A 4GMJB 1CXQA 4DR7K 1BCOA 4JKCA 1UOCA 2IS3A 3QBWA 1WNSA 4MLEA 1BO5O 1NKCA 3LANA 4Z4IA 1IG8A 2VG7A 2HB5A 2VWJA 2DPNA 4JI3K 1Q9XA 3OBWA 3KLFA 3VQ8A 5FRMA 1E4GT 3NF8A 3MAQA 4CJ5A 3NAEA 4RCHA 1TYQA 1C0GA 4JN4A 2YNFA 4H0VB 1KVAA 4KBOA 4C8KA 3D2FB 5JMVA 3M5RA 1OH5A 3NF7A 3CC2N 2W40A 4BRGA 4OGEA 4CI6A 3KLGA 2RF2A 3EO3A 3O9RA 1IBMK 3GDQA 3GG4A 1LAVA 4CF9A 2JWKA 3RWUA 1KTQA 4DU3A 1IKVA 3T1YK 2YJEA 1BUPA 3CCUN 3FZMA 2OZSA 3CQ8A 1S1TA 2YI1A 3ZT1A 5AZJB 4B9TA 1XHXA 5C15A 3OJUA 3P83D 3LALA 2P51A 3CERA 3IMXA 1HNIA 2V7ZA 4BRKA 4OPAA 1RFQA 2YHYA 4CJVA 4MO4A 1HLUA 2BDPA 2UXBK 1RT3A 2IDOA 4H0TB 3PO5A 2V7YA 4LF6K 2NRWA 3SUNA 3EZ5A 4DSIA 4LSNA 4BRQA 2ZJPL 1LW2A 4DV2K 4H0YB 4FSVA 4Y1CA 4DTMA 1IJJA 3DMJA 3VQQA 4BR7A 1A5WA 4J8FA 1NJIO 4F8RA 2F8SA 2ETJA 1C1CA 4OLAA 2E2QA 1EO1A 3C94A 1W97L 3AO3A 4B9QA 1JXEA 3AARA 4JKHA 2BH1A 4DFKA 1BQNA 3ZSRA 4CEOA 3GE1A 4FJLA 1JCFA 4DS5A 4ELUA 3KLEA 5ADXA 4WFAL 3LDSA 1N34K 3QMLA 3KK2A 2NRXA 3L2QA 3SAFA 2CGJA 4DR4K 5KPZA 3WXLA 5F2RA 1JLGA 3FZKA 3TWHA 2HHXA 4CFAA 5DMRA 4CGGA 5BPNA 1W7AA 2XO7A 3A2FA 3G6EN 1CXUA 4BQZA 4JAXA 3ZSWA 1T44A 3BDPA 5J1EA 5FPDA 2FF3B 1ATRA 1S22A 2P9IB 4R5PA 3ENHA 3QETA 2WFBA 3ITHA 4NYFA 4EZ9A 5HLFA 1VQKN 4EP5A 5AQGA 3UKRB 5M1KA 2Y1IA 2A1RA 4KHYA 4IOAL 3WNHA 5C2DA 2BANA 4DTOA 1DLOA 4E0DA 4GNIA 2CGLA 2P9LA 3QBXA 3SQ0A 4EAHD 5FRNA 4G1QA 1R59O 3MN6A 2B4JA 4DUYK 1JLFA 1HNZK 3CETA 2ASPA 1RTHA 1WSEA 5SWMA 1YXQA 5GADP 3BZCA 2HMPA 5EXWA 5A2QO 4A62A 4KPYA 2ZQBA 4V19S 4BRPA 4GV6A 3LPTA 5AQLA 3DOLA 4CIGA 3VA0A 3C6TA 3K9KA 1QSLA 4FJXA 3QEXA 3D0PA 3VQAA 1GLDG 4OPHA 2QI2A 4PY5A 4FJ5A 3CG7A 3WXJA 2WUSA 3UKUA 1WB9A 1BISA 1OVQA 4CJQA 2RN2A 2P9NA 2O8FB 3G0ZA 4PQUA 3W0LA 3ZYYX 1WAFA 1QQMA 4ISEA 4RWTA 5M1PA 2HF3A 4E7LA 2YCHA 4BC3A 3THXA 3HSCA 2FBVA 4OKKA 1EETA 1XUPO 2QWLA 1ZBHA 4CJPA 1T05A 3LDPA 3KZBA 4QS7A 2YNGA 3VGKA 4BGAA 2P1JA 3IAYA 3K5NA 3CC4N 2OPPA 3LDLA 5M1OA 3J80O 5AQZA 4BR4A 1OH6A 4CZGA 1N5YA 2HHWA 2NRRA 1ZXOA 4O55A 4FVUA 1RILA 1SUQA 4JS4A 4OJRA 1UA0A 3LDQA 3MXJA 4IFYA 3A5LC 3QLHA 4CZLA 3O1BA 2HBLA 4XH5A 3NVKA 3VMFB 2OZMA 2HF4A 3KWIA 5AQMA 5KRSA 2F9WA 1TKDA 3OYJA 1REVA 3CCEN 5AQHA 5BRFA 3VERA 4M3ZA 1JXBA 2P9PB 1KSPA 4CZKA 1EWRA 4FW1A 5AQVA 4DS4A 1BWFO 4FJ9A 3RRGA 3MDQA 2NZTA 4FOEA 3AVMA 3WNGA 3EE9A 2A5XA 5GIOA 2UUBK 2P9KA 5BRDA 2VWKA 5AQYA 2QWOA 2E1YA 1VQ6N 4JKAA 3SMSA 3HSTB 1XMQK 4CZEA 3MK6A 1WSHA 2VGMA 4B1XB 4YOVA 3ZETA 2QEXN 3MN5A 3FFIA 4KKOA 2KKZA 3OYAA 4DV1K 2IGIA 4FWQA 3TU5A 1H1VA 3HVTA 5M1NA 4CJLA 4E3SA 4FJ7A 1U04A 5LJWA 5HRPA 4TSXA 4LFAK 3L2RA 2O8DB 3V9WA 3O9TA 4B1VA 1HR0K 4X62K 4FLUA 4H0XB 4JEPA 2FF6A 3HBTA 4MDBA 1WOQA 4LH5A 3O4NA 3MMVA 3E9OA 2X74A 3IDHA 1D9DA 4W5OA 2FSJA 2Z1HA 1BI4B 1SS6A 3C6HA 4KHPK 1K9MO 3QIOA 1FK9A 3JYTA 2ATQA 3OYDA 3WXMB 2W41A 2D0PA 4DHYA 1GLFO 3HI0A 4M41A 4CZMA 2HHVA 3ULEB 1GLCG 4EP4A 2X6SA 1GLLO 3TSPA 2I5JA 1YITN 1YTUA 3NH0A 4PL8A 4N47A 5HROA 2NRVA 4HUEA 3E66A 1S9GA 3LAKA 3H1QA 4KTWA 5C12A 2E88A 1KFSA 4DV4K 3ULDA 5E41A 3ASMA 1B9FA 4IO8A 4O0JA 4OX9K 2FLOA 1J53A 3OVNA 2P5GA 3BGRA 2EWSA 1TKTA 2E2PA 5J2MA 3DLGA 2W6LA 3QEIA 4OPJA 1BL3A 1NJWA 2DFFA 3FZFA 3SBTA 1LCUA 1YT3A 1NK8A 4DV3K 1ESVA 4A2AA 2BGGA 1DTQA 4NB4A 1N36K 4FXDA 3SQ4A 1QHTA 3AV9A 3K5OA 3SBGA 5BREA 3OHRA 1WBDA 3V1QA 2ZGZA 5JICA 4H0PA 2HBJA 3L2WA 3H45C 3RRHA 1ITGA 2G8FA 3CFPA 4H4OA 5F1XA 2VGNA 4M42A 3BF1A 1K8KA 1WUAA 4IOXA 3M8QA 3MEDA 3BY5A 1SQKA 1XHZA 1Q9YA 3THVA 3NF9A 5D3GA 4YORA 4JD2A 1NKBA 4RTFD 1X3MA 3HOSA 1NGHA 4I6MB 4JK7A 2HVIA 3CQYA 2Z1GA 4BVOA 3TAEA 1P90A 4M7YA 1D8YA 4E7KA 3OS0A 3VEVA 3ZT3A 1HNVA 1E3MA 4CD1A 1ZBIA 2PYJA 3K5MA 1NK4A 3CHWA 1I39A 1SKSA 3SJHA 5JVHL 2EHGA 4DKWA 3KIOA 3T3FA 1HPMA 4CJKA 2FBYA 3AGKA 4CBUA 4I9LA 4FZXC 1ATNA 4BACA 3I0SA 2D5RA 3I0RA 3D45A 1NU0A 3VQPA 2O8EB 2F7TA 4FVMA 1GLAG 1C0TA 4H5WA 2O4IA 4C1NI 2D1KA 4ICLA 1L3SA 1BDGA 1N32K 3SPZA 3WT0A 1Q81O 2RKIA 3CM5A 3M8SA 2BUPA 4FM1A 1YJNN 5SZTA 4AHVA 1RT6A 3HOTA 4YOUA 5E84A 1CLQA 5JS1A 4DTXA 2HOEA 3J7YP 5CY4A 3SUOA 3MCAB 1UA1A 3V81A 3ENBA 3TAFA 1X3NA 1QSSA 5DM7L 3OYHA 4B3MK 2F4VK 4FM2A 3THYB 4HHTA 1Q7YO 4X66K 4BRHA 3TABA 3S3MA 2B5JA 5AZJA 2CH6A 3NF6A 2ZM6K 2IAJA 1ATSA 4LC9B 3QERA 4NO7A 1Z25A 3OYEA 4RW6A 2V52B 4BDZA 4N41A 3THWB 1QQNA 1Z6RA 4N56A 1J54A 4B8AB 1KVBA 3QFUA 3UB5A 2D4WA 4DQQA 1KLNA 3UIQA 4E7JA 3M8RA 3TAPA 3KK7A 2P9UA 5JLFA 1X9MA 5AQPA 3SV3A 3OYLA 1BG3A 3OYIA 3NGZA 3PX6A 2GTDA 1YUWA 2A40A 3NVMA 1NGBA 2GWJA 1RTJA 1BIZA 2XY6A 3D6RA 1A5VA 3ATVA 1YVNA 5AFUA 4BE0A 1F21A 5C10A 1QTMA 4C23A 5AQTA 1C0FA 2FSNA 3QEVA 3M1FA 4R79A 1NK7A 1VAZA 1MWMA 4KHUA 4G9ZA 1L3TA 4NCBA 1P8ZA 4KRFA 1M1KO 1JCGA 4CZFA 3S41A 4IEIA 1WSIA 5AQQA 5B8HA 4CESA 3VEXA 4AHRA 5BRHA 3MCPA 1U49A 2YNIA 2PZSA 3SV4A 4CJFA 3GBTA 3KWGA 1MDUB 4DB3A 3LP3A 5C42A 1L3UA 5EX5A 5FPMA 4UY8O 1RDCA 1TL3A 2LSNA 4IDKA 5AQSA 1EP4A 3CIPA 5JLHA 3SUQA 3C7NB 4J2AA 2VG6A 4FJHA 1FJGK 1X1PA 1YJWN 3OS1A 5CZ2A 3NCIA 1SL0A 3SQ2A 3HO1A 4ZHRA 4BE1A 1YI2N 3E01A 2O8BB 1S9EA 3IKMA 4O5FA 1TK8A 3A5MC 2Q2RA 4E1MA 1SL1A 4DTUA 3DRPA 2G8UA 3WNEA 4Z4FA 3PO4A 3I8BA 2EX3A 4FJMA 2XRIA 4FLWA 2ITMA 1U2VA 2JGUA 4WCEL 2NNWA 4LF8K 1TAQA 1S1WA 3CCVN 2G8IA 2KFNA 4JV5K 1CZBA 1BU6O 4B1UB 5AQIA 2VCPA 4A2BA 4WFNL 1NMDA 1QZ6A 4OVLA 4U67L 3HL8A 4IG0A 1N33K 3SMPA 2Q0RA 3KKSA 4PKGA 1U47A 4CFDA 3VQDA 2Q97A 4JS5A 3PLAA 4CJWA 4XIUA 1NK6A 4AM7A 3AVGA 1VSMA 3K2PA 4O8KA 4M3RA 3T19A 1FW6A 4WE1A 2AJQA 4A5BA 5CYMA 4JHDA 1NJZA 4CJ4A 4NXMK 2Q1NA 1IG9A 3OS2A 4CJEA 1K6YA 4LF7K 4PWDA 4FO0A 2XY7A 2E4LA 1HRHA 3P1GA 5C25A 4MFBA 4F9OA 4BR5A 2A3ZA 1TYQB 4DTNA 1X9SA 4CJSA 4C8OA 4B3OA 2O4GA 4Z4CA 3AY9A 1HJOA 2GUPA 3O6WA 2HW3A 1RTDA 2E2NA 4HCBA 4CJ7A 3AVBA 4XH4A 2OPSA 1G99A 4Q5VA 4LF4K 4B9VA 2OTLN 3K59A 4BR0A 3PIPL 3HM9A 3QINA 1VSKA 3VGLA 1QE1A 3R8EA 4MLHA 3T69A 5KQDA 2BE2A 1S1XA 1WSGA 4NCGA 3HZ6A 3KTQA 4OO1J 3M3ZA 4K8XA 3HXMA 1UAXA 5KTQA 4UQGA 4FLTA 1NNEA 3DXKA 2E6MA 3EEQA 3VQ7A 2HBKA 3LDNA 3TSUA 1IO2A 3ENOA 3SPYA 1Y64A 1BHLA 2OYQA 3VEWA 4KTZA 3TTDA 1B92A 3H08A 3H6EA 4X65K 5C0YA 4M3UA 4JRQA 2GX9A 4DCHA 1TVRA 5CHIA 5LMUK 2JLEA 1ZBUA 4KAZA 3L4QA 4FLYA 1ZBLA 2QWPA 4JI2K 4IKFA 4YFUA 3HPOA 4KREA 2GWKA 2BTFA 4J2EA 3I33A 3P31A 1ASWA 2VQFK 5FPNA 1JLAA 4I2PA 4YDUA 3AVFA 1VQ7N 3C6UA 3JXUA 4GY2B 1MWKA 2I7NA 2KZMA 1LWEA 2QA4N 4C8LA 3D2EA 4FLXA 3HK2A 4DR6K 4BGBA 3L6QA 4B1WB 3P5JA 3O5BA 3PIOL 3BZKA 3CJAA 2E20A 4H5RA 3UE5A 4DSEA 3U9ZA 1KXPA 4LFBK 4DV7K 4YOTA 4AHTA 5M1QA 1NWKA 2YJFA 4RG8A 3SAGA 4CJTA 4DSFA 2B6AA 1O13A 1BI4A 4E1JA 1VRUA 1YIJN 1HMVA 4B9SA 1JL2A 3TR8A 3OJSA 3NHGA 3V9XA 1NK0A 4WQ4A 2OPQA 5GAEP 3VQBA 4M63C 1L3VA 3AO4A 3AGRA 5KGWA 2P9LB 1RT5A 4F2SA 2FBTA 3RR7A 3ATUA 4FK4A 3L2UA 5ADXH 1S6QA 2IIRA 3MWTA 4A5AA 2HNYA 4CERA 3LL3A 3TAMA 2HSTA 4E7IA 1T8EA 1RDDA 3D7EO 4L3QA 5AQFA 3VQEA 3LZJA 4FLZA 1VQPN 3AO1A 1D5AA 1G15A 4FPAA 4CF2A 4U7BA 1YAGA 3CJ1A 5EOYA 1RT7A 1GOBA 3MECA 3QEWA 5AQXA 4X64K 3QB0A 4W5RA 1RGIA 3UKUB 1IBKK 5DK5A 3O3FA 2P9NB 3AAQA 4RW4A 1RBTA 4N76A 4PA1A 1KRPA 2DFHA 3CF5L 3NE6A 1QVGM 3CMEN 3DM2A 3DXMA 1K73O 2KZZA 4KI6A 3J8AA
chains in the Genus database with same CATH topology
4BRGA 1HPMA 4JKGA 1U2VB 4FPBA 4CI6A 4B1ZA 2QXLA 3AGKA 4CBUA 3EO3A 3O9RA 1ATNA 4BRMA 3GDQA 3GG4A 2OTJN 2JWKA 5KPRA 3FZHA 3HRGA 4ISFA 4BRCA 2YJEA 1BUPA 2F7TA 3CCUN 1GLAG 3FZMA 4H5WA 4C1NI 4WF9L 2D1KA 2YI1A 5AZJB 4BC4A 4FWMA 5C15A 1BDGA 5GIPA 4BRFA 1Q81O 3WT0A 3CERA 3IMXA 4JKEA 2V7ZA 4WQ5A 2BUPA 4BRKA 4OPAA 2PBDA 4BG8A 2D0OA 4CZIA 1RFQA 1YJNN 2YHYA 4MO4A 4H03B 3O9SA 4B1YB 4FWOA 3HOTA 4JHDB 4YOUA 4NLBA 5E84A 1HLUA 1HKBA 2HOEA 4ILGB 5FPEA 4H0TB 2V7YA 1Z05A 2NRHA 2NRWA 1U6ZA 2ZJQL 3MCAB 4BRQA 2ZJPL 3N4PA 5CE3A 2Q36A 2V51B 4H5NA 4H0YB 4FSVA 3WEEA 3ENBA 3O9UA 3H3OB 1X3NA 1IJJA 4BR7A 5DM7L 3A5NC 4J8FA 1NJIO 5AQRA 5BN8A 4AM6A 4FWSA 1YHQN 3E9LA 3B8AX 2E2QA 1EO1A 5KQ8A 1W97L 4B9QA 1NGJA 1Q7YO 2WBNA 3AARA 4JKHA 2BH1A 4BRHA 4FOIA 3H1VX 3GE1A 5AZIB 4YOXA 5AZJA 2CH6A 1JCFA 2P9KB 3ZX2A 1ATSA 4LC9B 4NO7A 3H3NO 1ZBSA 3C65A 5ADXA 3ULEA 4Z94A 4WFAL 2V52B 4BR9A 1QQNA 2I7PA 1VQ9N 1Z6RA 3KVGA 3QMLA 4EHTA 2NRXA 2GEMA 3SAFA 2CGJA 2A41A 1D4XA 1K8AO 5E26A 2AA4A 3QFUA 3FGUA 3WXLA 3ZETB 3UB5A 5KPZA 2D4WA 5F2RA 3FZKA 3A5OC 3GL1A 2J4RA 3EZWA 3KK7A 2P9UA 2P9SA 3L4IA 3SK3A 5JLFA 3DXKB 3JS6A 4ILJA 5AQPA 3EE8A 1BG3A 3RSEB 5BPNA 1DT9A 1DKGD 4JK9A 4PKHA 3G6EN 3CCRN 4YOWA 4BQZA 1KQSM 4IWVA 2GTDA 4JAXA 1YUWA 2A40A 3CC7N 3NVMA 1GLEG 1NGBA 1T44A 2GWJA 1NM1A 3F9MA 3WXKA 3D6RA 3ATVA 1YVNA 3BEXA 4IO9L 4K41A 5AFUA 5FPDA 3U4LA 2FF3B 1ATRA 1S22A 2P9IB 5C10A 3ENHA 5HOOA 4CBXA 4C23A 5AQTA 2WFBA 2FSNA 1C0FA 3CJBA 3M1FA 4R79A 2E1ZA 5AZIA 1VAZA 1V4TA 1VQKN 1MWMA 4FWPA 5AQGA 3UKRB 5M1KA 4G9ZA 1KD1O 4IOAL 5C2DA 1VQ4N 1KAZA 3F5TA 1CZAN 3Q7BA 1NBWA 3P39A 4IXCA 1P8ZA 3IUCA 1JJ2M 4GNIA 3U8XA 2CGLA 2P9LA 3MN7A 3E1YA 2QWNA 3QBXA 1M1KO 3L0QA 4EAHD 2NRTA 1JCGA 2WC9A 4CZFA 3S41A 3VEYA 1SAZA 1YF5L 1R59O 1KAXA 4IEIA 4BRDA 3MN6A 4IJAA 3AAPA 5AQQA 5B8HA 3MN9A 3ZEUA 3VEXA 1OKJA 4XH1A 5BRHA 3MCPA 1VQ5N 4GV3A 3CETA 5DM6L 2ASPA 3SAHA 3I55N 3RSEA 1HKGA 1KAYA 1YXQA 5GADP 3A0IX 1VQLN 3GBTA 3KWGA 1MDUB 2HMPA 5EXWA 4DB3A 4A62A 5M1FA 3D2EB 3ID6A 4H0OA 4BRPA 5EX5A 3DWLA 4GV6A 5FPMA 5AQLA 4UY8O 5AQSA 3G4SN 3K9KA 3CIPA 5JLHA 2F9TA 3C7NB 3TTCA 3J7ZO 1GLDG 4OPHA 2QI2A 1DEJA 3FLCO 1YJWN 2CGKA 3WXJA 4PL7A 3W3DA 2WUSA 1HX1A 3UKUA 3SLCA 3CCJN 3EL2A 1RDUA 5JVGL 2QM1A 1S72N 4I6MA 4IJNA 4IEEA 1YI2N 2IVOA 3IKMA 2ZJRL 4O5FA 2P9NA 3WQTA 3FZLA 4IZ9A 3A5MC 2Q2RA 4BRLA 3F2KA 4PHTX 3W0LA 4FWRA 3ZYYX 3D2FA 1QQMA 3I8BA 4ISEA 4RWTA 5M1PA 1QQOA 2HF3A 2VYPA 2YCHA 2ITMA 3BF3A 3CCSN 4BC3A 1U2VA 4WCEL 2NNWA 3CCVN 3HSCA 1XUPO 2QWLA 3EKSA 1NGGA 1MA9B 1BU6O 4B1UB 5AQIA 2VCPA 4A2BA 5I9EB 4WFNL 3LDPA 1NMDA 3KZBA 1QZ6A 4QS7A 1VQON 4KH4A 3O1WA 1NLVA 4IFEA 3VGKA 4BGAA 4U67L 4WFBL 3CCQN 3CC4N 4BREA 3SMPA 2Q0RA 3LDLA 5M1OA 4PKGA 5AQZA 4BR4A 4CZGA 2NRRA 1NGIA 2Q97A 1ZXOA 3PLAA 4FVUA 1T6CA 2NRZA 4AM7A 5AR0A 4BRIA 1XQSC 3LDQA 1K8KB 4O8KA 1X9JA 3WQUA 3A5LC 3A8YA 1GLBG 4A5BA 4CZLA 3O1BA 2HBLA 4XH5A 3NVKA 4JHDA 3VMFB 3CPWM 2HF4A 4JKBA 5BPMA 3KWIA 4QS9A 5LJVA 4YOYA 2Q1NA 2FXUA 5AQMA 4IDHA 3HM8A 4FWLA 2F9WA 4JD2B 1S3XA 1M90O 3CCEN 5AQHA 4JNEA 5BRFA 4FO0A 4O8UA 3VERA 4BRNA 3TTFA 4JKDA 3VF4A 2P9PB 3O4WA 1V4SA 4CZKA 5AQVA 4NLCA 3CJ7A 4BR5A 4F9OA 3M6GA 2A3ZA 4A61A 4CZJA 1RDWX 1TYQB 1BWFO 2PAVA 4MDAA 5GINA 4BR2A 1KC8O 1QHAA 3MDQA 2RHKA 2NZTA 4FOEA 3AY9A 3DXMB 3EE9A 1HJOA 4C1NK 2GUPA 3O6WA 4EFHA 4BC2A 2A5XA 5F0XA 5GIOA 3KHYA 3EKUA 2E2NA 4ISGA 4CJ7A 4XH4A 3CQXA 5AQUA 4CD3A 2P9KA 3WUHA 5BPLA 1G99A 4JKGB 4KH5A 1T6DA 2H3GX 3MWPA 5JVHL 5BRDA 3R6MA 5AQYA 2OTLN 3RVCA 3I56N 3DLLL 4BR0A 4A57A 1LOTB 2QWOA 3PIPL 2E1YA 1VQ6N 4CZHA 3VGLA 3DAWA 4JKAA 3R8EA 3SMSA 1VQNN 4MLHA 3T69A 5KQDA 4CZEA 3MK6A 3E9PA 1J6ZA 1BOTO 2VGMA 4B1XB 4YOVA 2A42A 3HZ6A 3R1XA 3ZETA 2QEXN 3MN5A 4OO1J 3M3ZA 2KKZA 5AQJA 3VEZA 2QW9A 4ILHA 2ZGYA 3VENA 1N8RO 3DXKA 4FWQA 3TU5A 1H1VA 1XC3A 2HBKA 5M1NA 3LDNA 3TSUA 3CI5A 2Q31A 3ENOA 4FWKA 5LY3A 1Y64A 5LJWA 1YJ9N 4AF1A 4JKFA 3TTDA 3VEWA 2YX6A 3H6EA 5C0YA 2P9IA 2ZF5O 5GAGP 3DJCA 3BP8A 3O9TA 4B1VA 1TUUA 3TPQA 1HUXA 2KHOA 4H0XB 4JEPA 3H46O 3WEEB 2FF6A 2GX9A 3C0BA 5GAHP 4DCHA 4DQ8A 3O8MA 1VQ8N 5CHIA 3QDKA 1E4FT 3HBTA 3UKRA 4MDBA 1WOQA 3L4QA 2QWPA 3MMVA 4EIAA 3CCLN 3E9OA 5AQKA 1DGKN 3ZX0A 3IDHA 4K42A 4H5VA 2GWKA 2FSJA 5CR4A 1QZ5A 2BTFA 5C2FA 2QWRA 3MX2A 2PFUA 1SS6A 3I33A 3P31A 3C6HA 3CXCM 1K9MO 1NGDA 5FPNA 4BVPA 3G25A 4YDUA 3MX5A 1VQ7N 3WXMB 2W41A 2YHWA 3JXUA 1EQYA 4H5TA 3OW2M 3BUZB 4GY2B 1Q86O 2D0PA 3FE1A 1MWKA 4DHYA 1GLFO 3HI0A 4CZMA 2OANA 4HTLA 2I7NA 3CPEA 4JK8A 1GLCG 3T7ZA 3ULEB 2A6AA 4PKIA 4M7XA 1GLLO 3TSPA 2QWMA 5BR9A 4BROA 1YITN 4FL9A 3LDOA 1NGEA 2QA4N 3D2EA 3QICA 4A59A 4QS8A 4PL8A 1VQMN 5EVZA 5TKYA 2NRVA 4GV9A 3E66A 4K43A 3VF2A 5C12A 3H1QA 2E88A 2KLAA 3L6QA 4B1WB 3R9PA 4BGBA 5H1SQ 3O5BA 3C7NA 3VTIA 3PIOL 1ZC6A 4GVEA 2P9UB 2P9SB 4KH6A 5TKWA 3CJAA 3FFKB 4YDUC 1NGFA 2IVNA 2E20A 3VOVA 4H5RA 3UE5A 3U9ZA 5EY4A 1KXPA 2YHXA 4IO8A 2FLOA 5MLCQ 4YOTA 3O9QA 4WQ5C 3GOIA 5M1QA 1GLJO 1BA0A 1NWKA 2YJFA 2QWQA 3CJ9A 3SAGA 3VGMA 3NMUA 3N4QA 2Q0UA 1O13A 5BN9A 1T3VA 4E1JA 3HTVA 2ZWHA 1YIJN 2EWSA 4IOCL 1OVYA 2E2PA 2JWLA 1Q18A 1NGAA 5ELZA 3OA9A 1TUYA 3CCMN 4BQLA 3G71N 4BY9C 3CD6N 3CJCA 1NGCA 3IFRA 5AQNA 3WXIA 3VESA 3FZFA 4FWNA 3FR0A 4WQ4A 3VETA 3SBTA 1QVFM 1LCUA 4EHUA 5GAEP 3O08A 4M63C 4BRAA 2UYTA 3CMAN 1ILYA 3AGRA 4CBWA 3LM2A 3ZX3A 1ESVA 1SZ2A 2P9LB 4A2AA 4MO5A 3ATUA 4NB4A 3VF6A 4XEIA 2AP1A 2ASOA 3SBGA 5ADXH 2CH5A 3TSQA 2IIRA 5BREA 3MWTA 3OBYA 3OHRA 3ZEUB 4BG9A 4A5AA 5HL7L 4WYBA 3P38A 3Q7CA 2ZGZA 5JICA 5KPTA 4H0PA 2HBJA 2ASMA 5AQWA 3H45C 3LL3A 3P4IA 3U9DA 3VTHA 4WQ4C 2HSTA 2E2OA 3D7EO 5F1XA 2VGNA 2RE2A 4K25A 3BF1A 1K8KA 3QFPA 1WUAA 4IOXA 3EN9A 4L3QA 5AQFA 3R3LA 3ID8A 1BA1A 4HWIA 2QTDA 1VQPN 4Y0WA 1SQKA 4JKCA 4FPAA 4U7BA 1YAGA 3CJ1A 3QBWA 4MLEA 1BO5O 3O80A 5EOYA 2FSKA 3LM9A 1W2BM 1IG8A 4YORA 5AQXA 5AFUH 3QB0A 4JD2A 2HBMA 2DPNA 2IVPA 1RGIA 2NLXA 3OBWA 3UKUB 4RTFD 1Q82O 5AQOA 1X3MA 3HOSA 1E4GT 1NGHA 4I6MB 1JCEA 4JK7A 3CQYA 2P9PA 3VEOA 4BVOA 1P90A 2E8AA 4M7YA 2P9NB 3AAQA 4RCHA 2VWBA 3C6AA 3K9JA 1TYQA 1C0GA 4JN4A 3CF5L 3VEVA 2GELA 4H0VB 4KBOA 1QVGM 3CMEN 1HKCA 3DXMA 4CD1A 3D2FB 1K73O 5JMVA 4BC5A 3CHWA 3M5RA 3VPZA 3SJHA 3J8AA 3CC2N 2W40A 4DKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRG A;  1HPM A;  1U2V B;  4FPB A;  4CI6 A;  4B1Z A;  2QXL A;  4CBU A;  3EO3 A;  1ATN A;  4BRM A;  3GDQ A;  3GG4 A;  5KPR A;  3FZH A;  4ISF A;  4BRC A;  2YJE A;  1BUP A;  1GLA G;  3FZM A;  4H5W A;  2D1K A;  2YI1 A;  5AZJ B;  4BC4 A;  4FWM A;  1BDG A;  4BRF A;  3WT0 A;  3CER A;  3IMX A;  2V7Z A;  4WQ5 A;  2BUP A;  4BRK A;  2PBD A;  4BG8 A;  2D0O A;  4CZI A;  1RFQ A;  2YHY A;  4MO4 A;  4H03 B;  4B1Y B;  4FWO A;  4JHD B;  5E84 A;  1HLU A;  1HKB A;  2HOE A;  5FPE A;  4H0T B;  2V7Y A;  1Z05 A;  2NRH A;  1U6Z A;  4BRQ A;  5CE3 A;  2Q36 A;  2V51 B;  4H5N A;  4H0Y B;  4FSV A;  3WEE A;  3H3O B;  1X3N A;  1IJJ A;  4BR7 A;  3A5N C;  4J8F A;  5AQR A;  5BN8 A;  4AM6 A;  4FWS A;  3B8A X;  2E2Q A;  5KQ8 A;  4B9Q A;  1NGJ A;  3AAR A;  4BRH A;  4FOI A;  3H1V X;  3GE1 A;  5AZI B;  5AZJ A;  2CH6 A;  1JCF A;  2P9K B;  3ZX2 A;  1ATS A;  4LC9 B;  4NO7 A;  3H3N O;  1ZBS A;  5ADX A;  3ULE A;  4Z94 A;  2V52 B;  4BR9 A;  1QQN A;  2I7P A;  1Z6R A;  3KVG A;  3QML A;  4EHT A;  2GEM A;  2CGJ A;  2A41 A;  1D4X A;  5E26 A;  2AA4 A;  3QFU A;  3FGU A;  3WXL A;  3ZET B;  3UB5 A;  5KPZ A;  2D4W A;  5F2R A;  3FZK A;  3A5O C;  3GL1 A;  2J4R A;  3EZW A;  3L4I A;  2P9U A;  2P9S A;  3SK3 A;  5JLF A;  3DXK B;  3JS6 A;  5AQP A;  1BG3 A;  3RSE B;  5BPN A;  1DKG D;  4PKH A;  4BQZ A;  4IWV A;  2GTD A;  4JAX A;  1YUW A;  2A40 A;  1GLE G;  1NGB A;  1T44 A;  2GWJ A;  1NM1 A;  3F9M A;  3WXK A;  3ATV A;  1YVN A;  3BEX A;  4K41 A;  5AFU A;  5FPD A;  3U4L A;  2FF3 B;  1ATR A;  1S22 A;  2P9I B;  3ENH A;  4CBX A;  4C23 A;  5AQT A;  2FSN A;  1C0F A;  3CJB A;  3M1F A;  2E1Z A;  5AZI A;  1V4T A;  1MWM A;  4FWP A;  5AQG A;  3UKR B;  1KAZ A;  1CZA N;  1NBW A;  4IXC A;  1P8Z A;  3IUC A;  4GNI A;  3U8X A;  2CGL A;  2P9L A;  3MN7 A;  3QBX A;  2QWN A;  3L0Q A;  4EAH D;  1JCG A;  4CZF A;  3S41 A;  3VEY A;  1SAZ A;  1R59 O;  1KAX A;  4BRD A;  3MN6 A;  4IJA A;  3AAP A;  5AQQ A;  5B8H A;  3MN9 A;  3ZEU A;  3VEX A;  1OKJ A;  4XH1 A;  5BRH A;  3MCP A;  3CET A;  2ASP A;  3RSE A;  1HKG A;  1KAY A;  1YXQ A;  3A0I X;  3GBT A;  1MDU B;  2HMP A;  5EXW A;  4DB3 A;  4A62 A;  3D2E B;  4H0O A;  4BRP A;  5EX5 A;  3DWL A;  5FPM A;  5AQL A;  5AQS A;  3CIP A;  5JLH A;  2F9T A;  3C7N B;  1GLD G;  1DEJ A;  3FLC O;  2CGK A;  3WXJ A;  4PL7 A;  3W3D A;  2WUS A;  1HX1 A;  3UKU A;  3SLC A;  3EL2 A;  2QM1 A;  4I6M A;  4IJN A;  2IVO A;  4O5F A;  2P9N A;  3WQT A;  3FZL A;  4IZ9 A;  3A5M C;  2Q2R A;  4BRL A;  3W0L A;  4FWR A;  3D2F A;  1QQM A;  3I8B A;  4ISE A;  4RWT A;  1QQO A;  2HF3 A;  2VYP A;  2YCH A;  2ITM A;  3BF3 A;  4BC3 A;  1U2V A;  3HSC A;  1XUP O;  2QWL A;  3EKS A;  1NGG A;  1MA9 B;  1BU6 O;  4B1U B;  5AQI A;  2VCP A;  4A2B A;  5I9E B;  3LDP A;  1NMD A;  3KZB A;  1QZ6 A;  4QS7 A;  3O1W A;  1NLV A;  3VGK A;  4BGA A;  4BRE A;  3SMP A;  2Q0R A;  3LDL A;  4PKG A;  5AQZ A;  4BR4 A;  4CZG A;  1NGI A;  2Q97 A;  1ZXO A;  1T6C A;  4AM7 A;  5AR0 A;  4BRI A;  1XQS C;  3LDQ A;  1K8K B;  4O8K A;  1X9J A;  3WQU A;  3A5L C;  3A8Y A;  1GLB G;  4CZL A;  3O1B A;  4XH5 A;  4JHD A;  2HF4 A;  5BPM A;  4QS9 A;  5LJV A;  2Q1N A;  2FXU A;  5AQM A;  3HM8 A;  4FWL A;  2F9W A;  4JD2 B;  1S3X A;  5AQH A;  4JNE A;  5BRF A;  4FO0 A;  3VER A;  4BRN A;  3VF4 A;  2P9P B;  3O4W A;  1V4S A;  4CZK A;  5AQV A;  4F9O A;  3CJ7 A;  4BR5 A;  3M6G A;  2A3Z A;  4A61 A;  4CZJ A;  1RDW X;  1TYQ B;  1BWF O;  2PAV A;  4BR2 A;  1QHA A;  3MDQ A;  2NZT A;  4FOE A;  3AY9 A;  3DXM B;  1HJO A;  2GUP A;  3O6W A;  4EFH A;  4BC2 A;  2A5X A;  5F0X A;  3KHY A;  3EKU A;  2E2N A;  4ISG A;  4CJ7 A;  4XH4 A;  3CQX A;  5AQU A;  4CD3 A;  2P9K A;  3WUH A;  5BPL A;  1G99 A;  1T6D A;  2H3G X;  5BRD A;  3R6M A;  5AQY A;  4BR0 A;  1LOT B;  2QWO A;  2E1Y A;  4CZH A;  3VGL A;  3DAW A;  3R8E A;  3SMS A;  4MLH A;  5KQD A;  4CZE A;  3MK6 A;  1J6Z A;  1BOT O;  4B1X B;  2A42 A;  3HZ6 A;  3ZET A;  3MN5 A;  3M3Z A;  5AQJ A;  3VEZ A;  2QW9 A;  2ZGY A;  3VEN A;  3DXK A;  4FWQ A;  3TU5 A;  1H1V A;  1XC3 A;  3LDN A;  3CI5 A;  2Q31 A;  3ENO A;  4FWK A;  5LY3 A;  1Y64 A;  5LJW A;  3VEW A;  3H6E A;  2P9I A;  2ZF5 O;  3DJC A;  3BP8 A;  4B1V A;  1TUU A;  3TPQ A;  1HUX A;  2KHO A;  4H0X B;  3H46 O;  3WEE B;  2FF6 A;  3C0B A;  4DCH A;  4DQ8 A;  3O8M A;  3QDK A;  1E4F T;  3HBT A;  3UKR A;  1WOQ A;  2QWP A;  3MMV A;  4EIA A;  5AQK A;  1DGK N;  3ZX0 A;  3IDH A;  4K42 A;  4H5V A;  2GWK A;  2FSJ A;  1QZ5 A;  2BTF A;  2QWR A;  3I33 A;  1NGD A;  5FPN A;  4BVP A;  3G25 A;  4YDU A;  2W41 A;  2YHW A;  3JXU A;  1EQY A;  4H5T A;  3BUZ B;  4GY2 B;  3FE1 A;  2D0P A;  1MWK A;  4DHY A;  1GLF O;  3HI0 A;  4CZM A;  2OAN A;  4HTL A;  2I7N A;  3ULE B;  1GLC G;  2A6A A;  4PKI A;  4M7X A;  1GLL O;  2QWM A;  5BR9 A;  4BRO A;  4FL9 A;  3LDO A;  1NGE A;  3D2E A;  3QIC A;  4QS8 A;  4PL8 A;  5EVZ A;  5TKY A;  4K43 A;  3VF2 A;  3H1Q A;  2E88 A;  4BGB A;  3L6Q A;  4B1W B;  3R9P A;  3O5B A;  3C7N A;  1ZC6 A;  2P9U B;  2P9S B;  3CJA A;  3FFK B;  4YDU C;  1NGF A;  2IVN A;  2E20 A;  3VOV A;  4H5R A;  3UE5 A;  3U9Z A;  5EY4 A;  1KXP A;  2YHX A;  4IO8 A;  2FLO A;  4WQ5 C;  3GOI A;  1GLJ O;  1BA0 A;  1NWK A;  2YJF A;  2QWQ A;  3CJ9 A;  3VGM A;  2Q0U A;  5BN9 A;  4E1J A;  3HTV A;  2ZWH A;  2EWS A;  2E2P A;  1Q18 A;  1NGA A;  5ELZ A;  1TUY A;  4BQL A;  3CJC A;  1NGC A;  3IFR A;  5AQN A;  3WXI A;  3VES A;  3FZF A;  4FWN A;  3FR0 A;  4WQ4 A;  3VET A;  1LCU A;  4EHU A;  3O08 A;  4M63 C;  4BRA A;  2UYT A;  4CBW A;  3LM2 A;  3ZX3 A;  1ESV A;  1SZ2 A;  2P9L B;  4A2A A;  4MO5 A;  3ATU A;  4NB4 A;  3VF6 A;  4XEI A;  2AP1 A;  2ASO A;  5ADX H;  2CH5 A;  5BRE A;  2IIR A;  3OHR A;  3ZEU B;  4BG9 A;  4WYB A;  2ZGZ A;  5JIC A;  5KPT A;  4H0P A;  2ASM A;  5AQW A;  3H45 C;  3LL3 A;  3P4I A;  3U9D A;  4WQ4 C;  2E2O A;  3D7E O;  5F1X A;  4K25 A;  3BF1 A;  1K8K A;  3QFP A;  1WUA A;  3EN9 A;  4L3Q A;  5AQF A;  3ID8 A;  1BA1 A;  4HWI A;  4Y0W A;  1SQK A;  4FPA A;  1YAG A;  3CJ1 A;  3QBW A;  4MLE A;  1BO5 O;  3O80 A;  5EOY A;  2FSK A;  3LM9 A;  1IG8 A;  5AQX A;  5AFU H;  3QB0 A;  4JD2 A;  2DPN A;  2IVP A;  1RGI A;  2NLX A;  3UKU B;  4RTF D;  5AQO A;  1X3M A;  1E4G T;  1NGH A;  4I6M B;  1JCE A;  3CQY A;  2P9P A;  3VEO A;  4BVO A;  2E8A A;  4M7Y A;  2P9N B;  3AAQ A;  4RCH A;  2VWB A;  1TYQ A;  1C0G A;  4JN4 A;  3VEV A;  2GEL A;  4H0V B;  4KBO A;  1HKC A;  3DXM A;  4CD1 A;  3D2F B;  5JMV A;  4BC5 A;  3CHW A;  3VPZ A;  3SJH A;  3J8A A;  2W40 A; 
#chains in the Genus database with same CATH topology
 4JKG A;  4FPB A;  3THX B;  4DSK A;  4BRM A;  5FLX O;  3HPG A;  1WSF A;  2HND A;  1EXQ A;  3FZH A;  3HRG A;  3QO9 A;  4M3X A;  4BRC A;  4JI6 K;  4WF9 L;  3KKR A;  2P5O A;  4QAG A;  1TKX A;  4DV6 K;  4DTR A;  3DI6 A;  3SCX A;  4BC4 A;  4FWM A;  3SQ1 A;  3J7A P;  4PUO A;  1XWL A;  4JI8 K;  4WQ5 A;  4W5Q A;  3O3G A;  2PBD A;  2ZE2 A;  4H03 B;  3O9S A;  4FWO A;  4E89 A;  4OLB A;  4NLB A;  4ILG B;  1HQU A;  1U6Z A;  3ZCM A;  2ZJQ L;  4GVM A;  4M45 A;  4AH9 A;  2Q36 A;  2V51 B;  3LAM A;  4H5N A;  3V1O A;  3WEE A;  3K57 A;  3H3O B;  3VQC A;  3A5N C;  4AIL C;  5AQR A;  5BN8 A;  4FWS A;  1YHQ N;  3E9L A;  1CZ9 A;  4DLE A;  3OYB A;  1JLC A;  3J81 O;  4BWM A;  3V4I A;  4ELT A;  1NGJ A;  2QKB A;  4B3R K;  2WBN A;  3V9Z A;  4DU1 A;  3K0S A;  4FOI A;  3OY9 A;  5AZI B;  3V1R A;  4YOX A;  1VSI A;  2P9K B;  3ZX2 A;  4CCH A;  1RBV A;  3LP2 A;  3EY1 A;  4Z94 A;  1X9W A;  4BR9 A;  4DQS A;  2I7P A;  3DLE A;  4F4K A;  3AVC A;  2GEM A;  2A41 A;  3ZT4 A;  1K8A O;  4F3O A;  3FGU A;  3ZET B;  5J2N A;  1LV5 A;  1D9F A;  3A5O C;  2ITG A;  3EZW A;  3L4I A;  3SK3 A;  2P9S A;  3C95 A;  4ILJ A;  3RSE B;  2XY5 A;  1DKG D;  1XMO K;  3RMA A;  3CCR N;  4YOW A;  4IWV A;  3CC7 N;  1GLE G;  3F9M A;  2QK9 A;  4CGD A;  3WXK A;  2YHA A;  4K41 A;  3QNN A;  3QEP A;  4KV8 A;  2KFZ A;  3HP6 A;  3THY A;  4CEB A;  2HHS A;  1RBU A;  3CJB A;  4BDP A;  2E1Z A;  3VQ4 A;  4CW7 B;  1V4T A;  1VSD A;  1RT2 A;  4FWP A;  1WN7 A;  1KAZ A;  3KLH A;  3DRR A;  5FDL A;  3IUC A;  4KHS A;  3U8X A;  4C8M A;  3MN7 A;  3TAG A;  2O8C A;  2QWN A;  4CGJ A;  2WC9 A;  4B8C A;  3VEY A;  1SAZ A;  1YF5 L;  1KAX A;  4BRD A;  2G8V A;  3AAP A;  3ZEU A;  4CGF A;  2A1S A;  4GV3 A;  1OKJ A;  3CM6 A;  4W5N A;  3HPH A;  5DM6 L;  3SAH A;  2UUA K;  1TGO A;  1HKG A;  1R0A A;  4CEZ A;  3NH2 A;  1VQL N;  1NK5 A;  5IT9 O;  4H0O A;  2WON A;  1LWC A;  2Y1J A;  2HMI A;  1JLB A;  3G4S N;  3VQ5 A;  3DRS A;  3TTC A;  3J7Z O;  1DEJ A;  4BDY A;  3TAN A;  4NCA A;  2ZD1 A;  4CED A;  1KVC A;  4PL7 A;  1WLJ A;  3W3D A;  1J5O A;  1HX1 A;  3EL2 A;  1RDU A;  5JVG L;  4CGI A;  3S3N A;  2ZJR L;  3WQT A;  3FZL A;  4IZ9 A;  4BRL A;  4JRP A;  5HRR A;  3D2F A;  4Q0B A;  1JL1 A;  4N5S A;  3BF3 A;  4CEQ A;  2QXF A;  1MA9 B;  1VQO N;  4KH4 A;  3O1W A;  1NLV A;  4WFB L;  4AHC A;  4BRE A;  4LD0 A;  1XNQ K;  1S1V A;  1SKW A;  4CHO A;  2NRZ A;  2YKN A;  1FKO A;  5AR0 A;  2IOC A;  4BRI A;  2GUI A;  1K8K B;  3IRX A;  3SZ2 A;  1RNH A;  2O8B A;  1VSH A;  1BGX T;  1GLB G;  3A8Y A;  1NG9 A;  4CGH A;  3CPW M;  4JKB A;  4CJU A;  5BPM A;  4YOY A;  4K0K K;  2FXU A;  4QCL A;  4B9U A;  4JD2 B;  3OTO K;  1S3X A;  1M90 O;  4JNE A;  2KQ2 A;  1IH7 A;  4O8U A;  4JKD A;  3VF4 A;  4FJ8 A;  1EX4 A;  1Q8I A;  4NLC A;  3CJ7 A;  4RW8 A;  4DR2 K;  3M6G A;  4A61 A;  4CZJ A;  1RDW X;  4MDA A;  5GIN A;  4BR2 A;  3PX4 A;  1FKP A;  2RHK A;  1HQE A;  4BC2 A;  1TAU A;  5F0X A;  4CK2 A;  3IG1 A;  3KHY A;  3EKU A;  4ISG A;  5AQU A;  3CQX A;  4CD3 A;  3WUH A;  4CF0 A;  5BPL A;  1T6D A;  3MWP A;  3DLR A;  4LF5 K;  4DLG A;  1Y97 A;  3DAW A;  3AVI A;  3L8B A;  2XHB A;  4LSL A;  1KCF A;  2A42 A;  3R1X A;  4HCC A;  5AQJ A;  4DQI A;  4ILH A;  5HRS A;  1N8R O;  4C8N A;  3ZSY A;  3JSM A;  3OYN A;  1XC3 A;  4DUZ K;  3HVR A;  2GV9 A;  4FK2 A;  4FWK A;  3VQ6 A;  1YJ9 N;  3MXM A;  4AF1 A;  2DTU A;  4JKF A;  3MEE A;  5KI6 A;  2YX6 A;  1J5E K;  3RTV A;  3VA3 A;  2KW4 A;  2P9I A;  3B6O A;  1XI1 A;  1EWQ A;  2KHO A;  5GAH P;  3H46 O;  1RBR A;  4DQ8 A;  3O8M A;  1VQ8 N;  5EU7 A;  4CIE A;  3QDK A;  1E4F T;  3UKR A;  1O1W A;  4DFM A;  4B9M A;  4EIA A;  1DGK N;  3S9H A;  4OKE A;  4CHN A;  4FLV A;  4H5V A;  4NXN K;  5CR4 A;  1QZ5 A;  1XC9 A;  1TL1 A;  2UXC K;  5C2F A;  2QWR A;  3MX2 A;  4E7H A;  4DTS A;  4ID5 A;  3SJJ A;  3MEG A;  3CXC M;  1NGD A;  5J2P A;  3G25 A;  4H8K A;  1BCM A;  3ZSV A;  3OYK A;  1EQY A;  1VK0 A;  3OW2 M;  3BUZ B;  1Q86 O;  1J9A A;  4KB0 A;  4LH4 A;  4HTL A;  3CPE A;  3DOK A;  4JK8 A;  3V9S A;  4DF4 A;  2A6A A;  4PKI A;  3LDO A;  4CEF A;  1NGE A;  4B9N A;  1HYZ A;  5C24 A;  3QIC A;  5AJ3 K;  4FYD A;  4IG3 A;  4CFC A;  5EVZ A;  4QOZ B;  1HYV A;  4K43 A;  3VF2 A;  1C1A A;  4KTQ A;  3CFR A;  1JKH A;  2KLA A;  3VTI A;  1BQM A;  1HYS A;  4M3W A;  2P9U B;  4KH6 A;  5TKW A;  3FFK B;  1NGF A;  2IVN A;  5KRT A;  3PY8 A;  5EY4 A;  3LWL A;  2YHX A;  3OYC A;  2HNZ A;  1W0H A;  5MLC Q;  1HNW K;  4KFB A;  3O9Q A;  4IFV A;  4WQ5 C;  3GOI A;  3OYM A;  1GLJ O;  3CJ9 A;  4AHS A;  2VG5 A;  3NGY A;  3RR8 A;  3VGM A;  1VHX A;  2FC0 A;  2UU9 K;  3CYM A;  2Q0U A;  5BN9 A;  1MU2 A;  5T7B A;  4CJR A;  2O8F A;  1C1B A;  1Q18 A;  1NGA A;  5ELZ A;  3OA9 A;  5HP1 A;  3DYA A;  3CD6 N;  3CJC A;  2OA8 A;  1NGC A;  3ZSZ A;  5AQN A;  3WXI A;  3VET A;  4FWN A;  3FR0 A;  4ELV A;  3AVH A;  1QVF M;  3LM2 A;  4O44 A;  3T1A A;  3WNF A;  4HVJ A;  4CEE A;  3O4Q A;  4XEI A;  2AP1 A;  2CH5 A;  3TSQ A;  4BG9 A;  4DQP A;  1RCH A;  3HJF A;  5KPT A;  3KK3 A;  3VTH A;  3S3O A;  4B08 A;  1N6Q A;  3U3G A;  3AA5 X;  1WAJ A;  4CEA A;  5I42 A;  2RE2 A;  5CYQ A;  3QFP A;  1QQC A;  4RW9 A;  5JS2 A;  3V6D A;  3R3L A;  3ID8 A;  1BA1 A;  4HWI A;  2QTD A;  1U48 A;  4Y0W A;  1NOZ A;  1JLQ A;  1FXX A;  3O80 A;  4HTU A;  4AHU A;  2FSK A;  3LM9 A;  1W2B M;  4O0I A;  1YTA A;  3EYZ A;  3K5L A;  3F9K A;  5AFU H;  2HBM A;  4JI5 K;  2IVP A;  2NLX A;  1Q82 O;  3AO2 A;  5AQO A;  4BWJ A;  1VSF A;  1JCE A;  3V9U A;  2P9P A;  2YNH A;  3VEO A;  1YVU A;  2E8A A;  3ZT0 A;  3AA2 A;  2VWB A;  3C6A A;  3K9J A;  2G8W A;  4OKJ A;  4KHN A;  3ZT2 A;  2X78 A;  3AO5 A;  3DLK A;  1IV0 A;  2GEL A;  1A5X A;  4E1N A;  1HKC A;  3AA3 A;  1B9D A;  4BC5 A;  4DG1 A;  3RMD A;  3VPZ A;  5LMN K;  3DLH A;  3KK1 A;  3LZI A;  1LAW A;  1U2V B;  4KO0 A;  4I9Q A;  4B1Z A;  2QXL A;  4DFJ A;  3PUF A;  2OPR A;  2R7Y A;  3AVA A;  1SL2 A;  2OTJ N;  5KPR A;  2DFE A;  4ISF A;  4O5B A;  3LP1 A;  3NH1 A;  1DTT A;  5GIP A;  4BRF A;  4F3T A;  1VSJ A;  3SUP A;  3ZLJ A;  4JKE A;  2D0A A;  4KHQ A;  4BG8 A;  2D0O A;  4CZI A;  2UUC K;  1GOC A;  4B1Y B;  1GOA A;  4KB1 A;  1S1U A;  2PYL A;  4JHD B;  4Z4E A;  1VSE A;  1HKB A;  5FPE A;  4YHH K;  1Z05 A;  3PX0 A;  1U4B A;  2NRH A;  2O8D A;  3PV8 A;  3N4P A;  5CE3 A;  4FJN A;  3O9U A;  2FBX A;  1W9H A;  5FRO A;  3M8P A;  4AM6 A;  4ZTJ A;  3TI0 A;  3B8A X;  1WBB A;  1RTI A;  5KQ8 A;  1I3A A;  1C0U A;  2VQE K;  3H1V X;  3NBP A;  3O3H A;  1ZBF A;  1IKW A;  1NMN A;  2F8T A;  1KFD A;  2X6N A;  1RDB A;  3KJV A;  1HPZ A;  1ZBS A;  3C65 A;  3H3N O;  3ULE A;  1C0M A;  2GBZ A;  1VQ9 N;  3KVG A;  4EHT A;  1D4X A;  4GKJ K;  5E26 A;  2AA4 A;  2IC3 A;  2HHT A;  4DSJ A;  4JYA K;  3GL1 A;  3NGI A;  2J4R A;  4GKK K;  1NJX A;  4K8Z A;  3DXK B;  3JS6 A;  3EE8 A;  1DT9 A;  4JK9 A;  4PKH A;  3L3U A;  1KQS M;  5HBM A;  4CVN E;  3AA4 A;  1NM1 A;  1OH7 A;  2F96 A;  3BEX A;  4IO9 L;  3U4L A;  5HRN A;  4DR1 K;  5HOO A;  4CBX A;  1T7P A;  3OYG A;  5AZI A;  2W42 A;  1T03 A;  1KD1 O;  3NDK A;  3LPU A;  3HT3 A;  1VQ4 N;  3F5T A;  1CZA N;  3Q7B A;  1NBW A;  3P39 A;  4B9L A;  4FZZ A;  1IBL K;  4IXC A;  3RMC A;  4DV0 K;  2DY4 A;  3CFO A;  1JJ2 M;  4B3S K;  3E1Y A;  3AVL A;  3L0Q A;  2NRT A;  4HUF A;  4IJA A;  3L2V A;  3TAR A;  4RW7 A;  4CF8 A;  4CK3 A;  1QS4 A;  3MN9 A;  4KI4 A;  4XH1 A;  1VQ5 N;  1NK9 A;  1IKY A;  3I55 N;  1ASV A;  4LFC K;  3RSE A;  1KAY A;  3A0I X;  1TK0 A;  5I3U A;  5M1F A;  3D2E B;  3ID6 A;  3DWL A;  2D0C A;  4CFB A;  4DWI A;  4BE2 A;  1NKE A;  1SV5 A;  2F9T A;  3I8D A;  4DMN A;  3VN5 A;  3FLC O;  3OYF A;  2CGK A;  3CCJ N;  3SLC A;  2D0B A;  4AQY K;  3KLI A;  2QM1 A;  1S72 N;  4I6M A;  4IJN A;  4IEE A;  2IVO A;  3G10 A;  3AVN A;  2PY5 A;  4IBN A;  1NJY A;  3F2K A;  4PHT X;  4FWR A;  4CHP A;  5IWA K;  1QQO A;  2VYP A;  4HUG A;  2G8K A;  3CCS N;  3SYZ A;  4FJG A;  3EKS A;  1NGG A;  3ZSQ A;  5J2Q A;  4YNQ A;  2E5L K;  3T1H K;  5I9E B;  2O8E A;  4IFE A;  3CCQ N;  3ALY A;  1XNR K;  2YHB A;  4CE9 A;  3QNO A;  4L8R B;  4JI1 K;  3TAQ A;  3SI6 A;  1RBS A;  3HYF A;  1NGI A;  4CIF A;  1T6C A;  4CHQ A;  4FZY A;  2Z1I A;  2XY8 A;  1RT4 A;  1XQS C;  1X9J A;  3WQU A;  3KD1 E;  1TV6 A;  4DFP A;  3L3V A;  2OCE A;  3HP9 A;  4MQ3 A;  4QS9 A;  5LJV A;  4OPK A;  4DR5 K;  4IDH A;  2NUB A;  2QKK A;  3HM8 A;  4FWL A;  1S6P A;  1ZYQ A;  3IS9 A;  4DQR A;  4DV5 K;  2HHU A;  4BRN A;  3TTF A;  3F73 A;  3O4W A;  1V4S A;  2Z1J A;  2RPI A;  3U3Y A;  2PAV A;  3JAM O;  4DTJ A;  1KC8 O;  1QHA A;  4FW2 A;  1QSY A;  3DXM B;  4C1N K;  4EFH A;  4CJ3 A;  2KTQ A;  4JKG B;  4KH5 A;  2HHQ A;  2H3G X;  4ZTF A;  3R6M A;  3RVC A;  1TK5 A;  3I56 N;  3DLL L;  4A57 A;  1LOT B;  1HNX K;  4JI0 K;  4DR3 K;  4CZH A;  3THW A;  5CZ1 A;  3MXI A;  1VQN N;  4M3Y A;  3E9P A;  1J6Z A;  1BOT O;  4J2B A;  1HJR A;  5LL6 Z;  1VSL A;  4B3T K;  1IKX A;  1JLE A;  3VEZ A;  2QW9 A;  4FCY A;  1OH8 A;  2ZGY A;  1VRT A;  3VEN A;  3K58 A;  4FM0 A;  3AVK A;  2HVH A;  1S5J A;  3ISN C;  3CI5 A;  2Q31 A;  5LY3 A;  1EKE A;  1C6V A;  4J2D A;  4NYN A;  4CK1 A;  3B6P A;  4Z4G A;  2ZF5 O;  5GAG P;  3DJC A;  3BP8 A;  1TUU A;  3TPQ A;  1HUX A;  4YY3 K;  3WEE B;  2YV0 X;  3C0B A;  1WSJ A;  4KHW A;  4GW6 A;  3CCL N;  1SKR A;  5AQK A;  3U6F A;  3ZX0 A;  4K42 A;  3KD5 E;  1LW0 A;  1KLM A;  3SNN A;  4LF9 K;  1NOY A;  2PFU A;  2Q3S A;  4W5T A;  3PSF A;  4BVP A;  4CHY A;  1RT1 A;  3MX5 A;  4DTP A;  2YHW A;  4H5T A;  3FE1 A;  2OAN A;  2WOM A;  3T7Z A;  4M7X A;  5BR8 K;  2QWM A;  5BR9 A;  4BRO A;  3AVJ A;  4FL9 A;  3LWM A;  4CF1 A;  2UXD K;  4CEC A;  1RDA A;  4A59 A;  4QS8 A;  4DSL A;  1VQM N;  5TKY A;  4GV9 A;  4LY7 A;  3ZSO A;  4Y1D A;  1LWF A;  3R9P A;  5H1S Q;  3C7N A;  3NFA A;  1ZC6 A;  4JI4 K;  4GVE A;  4F2R A;  2P9S B;  1TKZ A;  4YDU C;  4FJI A;  3ZSX A;  3VOV A;  3QES A;  3RMB A;  2HHH K;  2YKM A;  4Z0U A;  5KGX A;  1BA0 A;  2QWQ A;  3VQ9 A;  3NMU A;  3N4Q A;  4I7F A;  1T3V A;  4M3T A;  3HTV A;  2ZWH A;  1BIU A;  3PSI A;  2W6K A;  4IOC L;  1OVY A;  4E19 A;  2WTU A;  1UWB A;  2JWL A;  3LP0 A;  5K14 A;  1TUY A;  3CCM N;  4BQL A;  3G71 N;  4BY9 C;  3QIP A;  3IFR A;  4H4M A;  3VES A;  2E6L A;  1L5U A;  2G8H A;  4EHU A;  4CHZ A;  1Z26 A;  1I94 K;  3O08 A;  3DLB A;  4OGC A;  1ASU A;  4O4G A;  2UYT A;  4BRA A;  3CMA N;  1ILY A;  4CBW A;  2O8C B;  4FK0 A;  3ZX3 A;  1SZ2 A;  4MO5 A;  4DF8 A;  3VF6 A;  4JI7 K;  2ASO A;  4ID1 A;  4DU4 A;  4Z4H A;  4FJJ A;  3OBY A;  3ZEU B;  5HL7 L;  1U45 A;  4EZ6 A;  4WYB A;  3P38 A;  3Q7C A;  2ASM A;  5AQW A;  3P4I A;  3U9D A;  4WQ4 C;  2E2O A;  4I2Q A;  4JLH A;  4K25 A;  4FJK A;  3EN9 A;  4GMJ B;  1CXQ A;  4DR7 K;  1BCO A;  4JKC A;  1UOC A;  2IS3 A;  3QBW A;  1WNS A;  4MLE A;  1BO5 O;  1NKC A;  3LAN A;  4Z4I A;  1IG8 A;  2VG7 A;  2HB5 A;  2VWJ A;  2DPN A;  4JI3 K;  1Q9X A;  3OBW A;  3KLF A;  3VQ8 A;  5FRM A;  1E4G T;  3NF8 A;  3MAQ A;  4CJ5 A;  3NAE A;  4RCH A;  1TYQ A;  1C0G A;  4JN4 A;  2YNF A;  4H0V B;  1KVA A;  4KBO A;  4C8K A;  3D2F B;  5JMV A;  3M5R A;  1OH5 A;  3NF7 A;  3CC2 N;  2W40 A;  4BRG A;  4OGE A;  4CI6 A;  3KLG A;  2RF2 A;  3EO3 A;  3O9R A;  1IBM K;  3GDQ A;  3GG4 A;  1LAV A;  4CF9 A;  2JWK A;  3RWU A;  1KTQ A;  4DU3 A;  1IKV A;  3T1Y K;  2YJE A;  1BUP A;  3CCU N;  3FZM A;  2OZS A;  3CQ8 A;  1S1T A;  2YI1 A;  3ZT1 A;  5AZJ B;  4B9T A;  1XHX A;  5C15 A;  3OJU A;  3P83 D;  3LAL A;  2P51 A;  3CER A;  3IMX A;  1HNI A;  2V7Z A;  4BRK A;  4OPA A;  1RFQ A;  2YHY A;  4CJV A;  4MO4 A;  1HLU A;  2BDP A;  2UXB K;  1RT3 A;  2IDO A;  4H0T B;  3PO5 A;  2V7Y A;  4LF6 K;  2NRW A;  3SUN A;  3EZ5 A;  4DSI A;  4LSN A;  4BRQ A;  2ZJP L;  1LW2 A;  4DV2 K;  4H0Y B;  4FSV A;  4Y1C A;  4DTM A;  1IJJ A;  3DMJ A;  3VQQ A;  4BR7 A;  1A5W A;  4J8F A;  1NJI O;  4F8R A;  2F8S A;  2ETJ A;  1C1C A;  4OLA A;  2E2Q A;  1EO1 A;  3C94 A;  1W97 L;  3AO3 A;  4B9Q A;  1JXE A;  3AAR A;  4JKH A;  2BH1 A;  4DFK A;  1BQN A;  3ZSR A;  4CEO A;  3GE1 A;  4FJL A;  1JCF A;  4DS5 A;  4ELU A;  3KLE A;  5ADX A;  4WFA L;  3LDS A;  1N34 K;  3QML A;  3KK2 A;  2NRX A;  3L2Q A;  3SAF A;  2CGJ A;  4DR4 K;  5KPZ A;  3WXL A;  5F2R A;  1JLG A;  3FZK A;  3TWH A;  2HHX A;  4CFA A;  5DMR A;  4CGG A;  5BPN A;  1W7A A;  2XO7 A;  3A2F A;  3G6E N;  1CXU A;  4BQZ A;  4JAX A;  3ZSW A;  1T44 A;  3BDP A;  5J1E A;  5FPD A;  2FF3 B;  1ATR A;  1S22 A;  2P9I B;  4R5P A;  3ENH A;  3QET A;  2WFB A;  3ITH A;  4NYF A;  4EZ9 A;  5HLF A;  1VQK N;  4EP5 A;  5AQG A;  3UKR B;  5M1K A;  2Y1I A;  2A1R A;  4KHY A;  4IOA L;  3WNH A;  5C2D A;  2BAN A;  4DTO A;  1DLO A;  4E0D A;  4GNI A;  2CGL A;  2P9L A;  3QBX A;  3SQ0 A;  4EAH D;  5FRN A;  4G1Q A;  1R59 O;  3MN6 A;  2B4J A;  4DUY K;  1JLF A;  1HNZ K;  3CET A;  2ASP A;  1RTH A;  1WSE A;  5SWM A;  1YXQ A;  5GAD P;  3BZC A;  2HMP A;  5EXW A;  5A2Q O;  4A62 A;  4KPY A;  2ZQB A;  4V19 S;  4BRP A;  4GV6 A;  3LPT A;  5AQL A;  3DOL A;  4CIG A;  3VA0 A;  3C6T A;  3K9K A;  1QSL A;  4FJX A;  3QEX A;  3D0P A;  3VQA A;  1GLD G;  4OPH A;  2QI2 A;  4PY5 A;  4FJ5 A;  3CG7 A;  3WXJ A;  2WUS A;  3UKU A;  1WB9 A;  1BIS A;  1OVQ A;  4CJQ A;  2RN2 A;  2P9N A;  2O8F B;  3G0Z A;  4PQU A;  3W0L A;  3ZYY X;  1WAF A;  1QQM A;  4ISE A;  4RWT A;  5M1P A;  2HF3 A;  4E7L A;  2YCH A;  4BC3 A;  3THX A;  3HSC A;  2FBV A;  4OKK A;  1EET A;  1XUP O;  2QWL A;  1ZBH A;  4CJP A;  1T05 A;  3LDP A;  3KZB A;  4QS7 A;  2YNG A;  3VGK A;  4BGA A;  2P1J A;  3IAY A;  3K5N A;  3CC4 N;  2OPP A;  3LDL A;  5M1O A;  3J80 O;  5AQZ A;  4BR4 A;  1OH6 A;  4CZG A;  1N5Y A;  2HHW A;  2NRR A;  1ZXO A;  4O55 A;  4FVU A;  1RIL A;  1SUQ A;  4JS4 A;  4OJR A;  1UA0 A;  3LDQ A;  3MXJ A;  4IFY A;  3A5L C;  3QLH A;  4CZL A;  3O1B A;  2HBL A;  4XH5 A;  3NVK A;  3VMF B;  2OZM A;  2HF4 A;  3KWI A;  5AQM A;  5KRS A;  2F9W A;  1TKD A;  3OYJ A;  1REV A;  3CCE N;  5AQH A;  5BRF A;  3VER A;  4M3Z A;  1JXB A;  2P9P B;  1KSP A;  4CZK A;  1EWR A;  4FW1 A;  5AQV A;  4DS4 A;  1BWF O;  4FJ9 A;  3RRG A;  3MDQ A;  2NZT A;  4FOE A;  3AVM A;  3WNG A;  3EE9 A;  2A5X A;  5GIO A;  2UUB K;  2P9K A;  5BRD A;  2VWK A;  5AQY A;  2QWO A;  2E1Y A;  1VQ6 N;  4JKA A;  3SMS A;  3HST B;  1XMQ K;  4CZE A;  3MK6 A;  1WSH A;  2VGM A;  4B1X B;  4YOV A;  3ZET A;  2QEX N;  3MN5 A;  3FFI A;  4KKO A;  2KKZ A;  3OYA A;  4DV1 K;  2IGI A;  4FWQ A;  3TU5 A;  1H1V A;  3HVT A;  5M1N A;  4CJL A;  4E3S A;  4FJ7 A;  1U04 A;  5LJW A;  5HRP A;  4TSX A;  4LFA K;  3L2R A;  2O8D B;  3V9W A;  3O9T A;  4B1V A;  1HR0 K;  4X62 K;  4FLU A;  4H0X B;  4JEP A;  2FF6 A;  3HBT A;  4MDB A;  1WOQ A;  4LH5 A;  3O4N A;  3MMV A;  3E9O A;  2X74 A;  3IDH A;  1D9D A;  4W5O A;  2FSJ A;  2Z1H A;  1BI4 B;  1SS6 A;  3C6H A;  4KHP K;  1K9M O;  3QIO A;  1FK9 A;  3JYT A;  2ATQ A;  3OYD A;  3WXM B;  2W41 A;  2D0P A;  4DHY A;  1GLF O;  3HI0 A;  4M41 A;  4CZM A;  2HHV A;  3ULE B;  1GLC G;  4EP4 A;  2X6S A;  1GLL O;  3TSP A;  2I5J A;  1YIT N;  1YTU A;  3NH0 A;  4PL8 A;  4N47 A;  5HRO A;  2NRV A;  4HUE A;  3E66 A;  1S9G A;  3LAK A;  3H1Q A;  4KTW A;  5C12 A;  2E88 A;  1KFS A;  4DV4 K;  3ULD A;  5E41 A;  3ASM A;  1B9F A;  4IO8 A;  4O0J A;  4OX9 K;  2FLO A;  1J53 A;  3OVN A;  2P5G A;  3BGR A;  2EWS A;  1TKT A;  2E2P A;  5J2M A;  3DLG A;  2W6L A;  3QEI A;  4OPJ A;  1BL3 A;  1NJW A;  2DFF A;  3FZF A;  3SBT A;  1LCU A;  1YT3 A;  1NK8 A;  4DV3 K;  1ESV A;  4A2A A;  2BGG A;  1DTQ A;  4NB4 A;  1N36 K;  4FXD A;  3SQ4 A;  1QHT A;  3AV9 A;  3K5O A;  3SBG A;  5BRE A;  3OHR A;  1WBD A;  3V1Q A;  2ZGZ A;  5JIC A;  4H0P A;  2HBJ A;  3L2W A;  3H45 C;  3RRH A;  1ITG A;  2G8F A;  3CFP A;  4H4O A;  5F1X A;  2VGN A;  4M42 A;  3BF1 A;  1K8K A;  1WUA A;  4IOX A;  3M8Q A;  3MED A;  3BY5 A;  1SQK A;  1XHZ A;  1Q9Y A;  3THV A;  3NF9 A;  5D3G A;  4YOR A;  4JD2 A;  1NKB A;  4RTF D;  1X3M A;  3HOS A;  1NGH A;  4I6M B;  4JK7 A;  2HVI A;  3CQY A;  2Z1G A;  4BVO A;  3TAE A;  1P90 A;  4M7Y A;  1D8Y A;  4E7K A;  3OS0 A;  3VEV A;  3ZT3 A;  1HNV A;  1E3M A;  4CD1 A;  1ZBI A;  2PYJ A;  3K5M A;  1NK4 A;  3CHW A;  1I39 A;  1SKS A;  3SJH A;  5JVH L;  2EHG A;  4DKW A;  3KIO A;  3T3F A;  1HPM A;  4CJK A;  2FBY A;  3AGK A;  4CBU A;  4I9L A;  4FZX C;  1ATN A;  4BAC A;  3I0S A;  2D5R A;  3I0R A;  3D45 A;  1NU0 A;  3VQP A;  2O8E B;  2F7T A;  4FVM A;  1GLA G;  1C0T A;  4H5W A;  2O4I A;  4C1N I;  2D1K A;  4ICL A;  1L3S A;  1BDG A;  1N32 K;  3SPZ A;  3WT0 A;  1Q81 O;  2RKI A;  3CM5 A;  3M8S A;  2BUP A;  4FM1 A;  1YJN N;  5SZT A;  4AHV A;  1RT6 A;  3HOT A;  4YOU A;  5E84 A;  1CLQ A;  5JS1 A;  4DTX A;  2HOE A;  3J7Y P;  5CY4 A;  3SUO A;  3MCA B;  1UA1 A;  3V81 A;  3ENB A;  3TAF A;  1X3N A;  1QSS A;  5DM7 L;  3OYH A;  4B3M K;  2F4V K;  4FM2 A;  3THY B;  4HHT A;  1Q7Y O;  4X66 K;  4BRH A;  3TAB A;  3S3M A;  2B5J A;  5AZJ A;  2CH6 A;  3NF6 A;  2ZM6 K;  2IAJ A;  1ATS A;  4LC9 B;  3QER A;  4NO7 A;  1Z25 A;  3OYE A;  4RW6 A;  2V52 B;  4BDZ A;  4N41 A;  3THW B;  1QQN A;  1Z6R A;  4N56 A;  1J54 A;  4B8A B;  1KVB A;  3QFU A;  3UB5 A;  2D4W A;  4DQQ A;  1KLN A;  3UIQ A;  4E7J A;  3M8R A;  3TAP A;  3KK7 A;  2P9U A;  5JLF A;  1X9M A;  5AQP A;  3SV3 A;  3OYL A;  1BG3 A;  3OYI A;  3NGZ A;  3PX6 A;  2GTD A;  1YUW A;  2A40 A;  3NVM A;  1NGB A;  2GWJ A;  1RTJ A;  1BIZ A;  2XY6 A;  3D6R A;  1A5V A;  3ATV A;  1YVN A;  5AFU A;  4BE0 A;  1F21 A;  5C10 A;  1QTM A;  4C23 A;  5AQT A;  1C0F A;  2FSN A;  3QEV A;  3M1F A;  4R79 A;  1NK7 A;  1VAZ A;  1MWM A;  4KHU A;  4G9Z A;  1L3T A;  4NCB A;  1P8Z A;  4KRF A;  1M1K O;  1JCG A;  4CZF A;  3S41 A;  4IEI A;  1WSI A;  5AQQ A;  5B8H A;  4CES A;  3VEX A;  4AHR A;  5BRH A;  3MCP A;  1U49 A;  2YNI A;  2PZS A;  3SV4 A;  4CJF A;  3GBT A;  3KWG A;  1MDU B;  4DB3 A;  3LP3 A;  5C42 A;  1L3U A;  5EX5 A;  5FPM A;  4UY8 O;  1RDC A;  1TL3 A;  2LSN A;  4IDK A;  5AQS A;  1EP4 A;  3CIP A;  5JLH A;  3SUQ A;  3C7N B;  4J2A A;  2VG6 A;  4FJH A;  1FJG K;  1X1P A;  1YJW N;  3OS1 A;  5CZ2 A;  3NCI A;  1SL0 A;  3SQ2 A;  3HO1 A;  4ZHR A;  4BE1 A;  1YI2 N;  3E01 A;  2O8B B;  1S9E A;  3IKM A;  4O5F A;  1TK8 A;  3A5M C;  2Q2R A;  4E1M A;  1SL1 A;  4DTU A;  3DRP A;  2G8U A;  3WNE A;  4Z4F A;  3PO4 A;  3I8B A;  2EX3 A;  4FJM A;  2XRI A;  4FLW A;  2ITM A;  1U2V A;  2JGU A;  4WCE L;  2NNW A;  4LF8 K;  1TAQ A;  1S1W A;  3CCV N;  2G8I A;  2KFN A;  4JV5 K;  1CZB A;  1BU6 O;  4B1U B;  5AQI A;  2VCP A;  4A2B A;  4WFN L;  1NMD A;  1QZ6 A;  4OVL A;  4U67 L;  3HL8 A;  4IG0 A;  1N33 K;  3SMP A;  2Q0R A;  3KKS A;  4PKG A;  1U47 A;  4CFD A;  3VQD A;  2Q97 A;  4JS5 A;  3PLA A;  4CJW A;  4XIU A;  1NK6 A;  4AM7 A;  3AVG A;  1VSM A;  3K2P A;  4O8K A;  4M3R A;  3T19 A;  1FW6 A;  4WE1 A;  2AJQ A;  4A5B A;  5CYM A;  4JHD A;  1NJZ A;  4CJ4 A;  4NXM K;  2Q1N A;  1IG9 A;  3OS2 A;  4CJE A;  1K6Y A;  4LF7 K;  4PWD A;  4FO0 A;  2XY7 A;  2E4L A;  1HRH A;  3P1G A;  5C25 A;  4MFB A;  4F9O A;  4BR5 A;  2A3Z A;  1TYQ B;  4DTN A;  1X9S A;  4CJS A;  4C8O A;  4B3O A;  2O4G A;  4Z4C A;  3AY9 A;  1HJO A;  2GUP A;  3O6W A;  2HW3 A;  1RTD A;  2E2N A;  4HCB A;  4CJ7 A;  3AVB A;  4XH4 A;  2OPS A;  1G99 A;  4Q5V A;  4LF4 K;  4B9V A;  2OTL N;  3K59 A;  4BR0 A;  3PIP L;  3HM9 A;  3QIN A;  1VSK A;  3VGL A;  1QE1 A;  3R8E A;  4MLH A;  3T69 A;  5KQD A;  2BE2 A;  1S1X A;  1WSG A;  4NCG A;  3HZ6 A;  3KTQ A;  4OO1 J;  3M3Z A;  4K8X A;  3HXM A;  1UAX A;  5KTQ A;  4UQG A;  4FLT A;  1NNE A;  3DXK A;  2E6M A;  3EEQ A;  3VQ7 A;  2HBK A;  3LDN A;  3TSU A;  1IO2 A;  3ENO A;  3SPY A;  1Y64 A;  1BHL A;  2OYQ A;  3VEW A;  4KTZ A;  3TTD A;  1B92 A;  3H08 A;  3H6E A;  4X65 K;  5C0Y A;  4M3U A;  4JRQ A;  2GX9 A;  4DCH A;  1TVR A;  5CHI A;  5LMU K;  2JLE A;  1ZBU A;  4KAZ A;  3L4Q A;  4FLY A;  1ZBL A;  2QWP A;  4JI2 K;  4IKF A;  4YFU A;  3HPO A;  4KRE A;  2GWK A;  2BTF A;  4J2E A;  3I33 A;  3P31 A;  1ASW A;  2VQF K;  5FPN A;  1JLA A;  4I2P A;  4YDU A;  3AVF A;  1VQ7 N;  3C6U A;  3JXU A;  4GY2 B;  1MWK A;  2I7N A;  2KZM A;  1LWE A;  2QA4 N;  4C8L A;  3D2E A;  4FLX A;  3HK2 A;  4DR6 K;  4BGB A;  3L6Q A;  4B1W B;  3P5J A;  3O5B A;  3PIO L;  3BZK A;  3CJA A;  2E20 A;  4H5R A;  3UE5 A;  4DSE A;  3U9Z A;  1KXP A;  4LFB K;  4DV7 K;  4YOT A;  4AHT A;  5M1Q A;  1NWK A;  2YJF A;  4RG8 A;  3SAG A;  4CJT A;  4DSF A;  2B6A A;  1O13 A;  1BI4 A;  4E1J A;  1VRU A;  1YIJ N;  1HMV A;  4B9S A;  1JL2 A;  3TR8 A;  3OJS A;  3NHG A;  3V9X A;  1NK0 A;  4WQ4 A;  2OPQ A;  5GAE P;  3VQB A;  4M63 C;  1L3V A;  3AO4 A;  3AGR A;  5KGW A;  2P9L B;  1RT5 A;  4F2S A;  2FBT A;  3RR7 A;  3ATU A;  4FK4 A;  3L2U A;  5ADX H;  1S6Q A;  2IIR A;  3MWT A;  4A5A A;  2HNY A;  4CER A;  3LL3 A;  3TAM A;  2HST A;  4E7I A;  1T8E A;  1RDD A;  3D7E O;  4L3Q A;  5AQF A;  3VQE A;  3LZJ A;  4FLZ A;  1VQP N;  3AO1 A;  1D5A A;  1G15 A;  4FPA A;  4CF2 A;  4U7B A;  1YAG A;  3CJ1 A;  5EOY A;  1RT7 A;  1GOB A;  3MEC A;  3QEW A;  5AQX A;  4X64 K;  3QB0 A;  4W5R A;  1RGI A;  3UKU B;  1IBK K;  5DK5 A;  3O3F A;  2P9N B;  3AAQ A;  4RW4 A;  1RBT A;  4N76 A;  4PA1 A;  1KRP A;  2DFH A;  3CF5 L;  3NE6 A;  1QVG M;  3CME N;  3DM2 A;  3DXM A;  1K73 O;  2KZZ A;  4KI6 A;  3J8A A; 
#chains in the Genus database with same CATH homology
 4BRG A;  1HPM A;  4JKG A;  1U2V B;  4FPB A;  4CI6 A;  4B1Z A;  2QXL A;  3AGK A;  4CBU A;  3EO3 A;  3O9R A;  1ATN A;  4BRM A;  3GDQ A;  3GG4 A;  2OTJ N;  2JWK A;  5KPR A;  3FZH A;  3HRG A;  4ISF A;  4BRC A;  2YJE A;  1BUP A;  2F7T A;  3CCU N;  1GLA G;  3FZM A;  4H5W A;  4C1N I;  4WF9 L;  2D1K A;  2YI1 A;  5AZJ B;  4BC4 A;  4FWM A;  5C15 A;  1BDG A;  5GIP A;  4BRF A;  1Q81 O;  3WT0 A;  3CER A;  3IMX A;  4JKE A;  2V7Z A;  4WQ5 A;  2BUP A;  4BRK A;  4OPA A;  2PBD A;  4BG8 A;  2D0O A;  4CZI A;  1RFQ A;  1YJN N;  2YHY A;  4MO4 A;  4H03 B;  3O9S A;  4B1Y B;  4FWO A;  3HOT A;  4JHD B;  4YOU A;  4NLB A;  5E84 A;  1HLU A;  1HKB A;  2HOE A;  4ILG B;  5FPE A;  4H0T B;  2V7Y A;  1Z05 A;  2NRH A;  2NRW A;  1U6Z A;  2ZJQ L;  3MCA B;  4BRQ A;  2ZJP L;  3N4P A;  5CE3 A;  2Q36 A;  2V51 B;  4H5N A;  4H0Y B;  4FSV A;  3WEE A;  3ENB A;  3O9U A;  3H3O B;  1X3N A;  1IJJ A;  4BR7 A;  5DM7 L;  3A5N C;  4J8F A;  1NJI O;  5AQR A;  5BN8 A;  4AM6 A;  4FWS A;  1YHQ N;  3E9L A;  3B8A X;  2E2Q A;  1EO1 A;  5KQ8 A;  1W97 L;  4B9Q A;  1NGJ A;  1Q7Y O;  2WBN A;  3AAR A;  4JKH A;  2BH1 A;  4BRH A;  4FOI A;  3H1V X;  3GE1 A;  5AZI B;  4YOX A;  5AZJ A;  2CH6 A;  1JCF A;  2P9K B;  3ZX2 A;  1ATS A;  4LC9 B;  4NO7 A;  3H3N O;  1ZBS A;  3C65 A;  5ADX A;  3ULE A;  4Z94 A;  4WFA L;  2V52 B;  4BR9 A;  1QQN A;  2I7P A;  1VQ9 N;  1Z6R A;  3KVG A;  3QML A;  4EHT A;  2NRX A;  2GEM A;  3SAF A;  2CGJ A;  2A41 A;  1D4X A;  1K8A O;  5E26 A;  2AA4 A;  3QFU A;  3FGU A;  3WXL A;  3ZET B;  3UB5 A;  5KPZ A;  2D4W A;  5F2R A;  3FZK A;  3A5O C;  3GL1 A;  2J4R A;  3EZW A;  3KK7 A;  2P9U A;  2P9S A;  3L4I A;  3SK3 A;  5JLF A;  3DXK B;  3JS6 A;  4ILJ A;  5AQP A;  3EE8 A;  1BG3 A;  3RSE B;  5BPN A;  1DT9 A;  1DKG D;  4JK9 A;  4PKH A;  3G6E N;  3CCR N;  4YOW A;  4BQZ A;  1KQS M;  4IWV A;  2GTD A;  4JAX A;  1YUW A;  2A40 A;  3CC7 N;  3NVM A;  1GLE G;  1NGB A;  1T44 A;  2GWJ A;  1NM1 A;  3F9M A;  3WXK A;  3D6R A;  3ATV A;  1YVN A;  3BEX A;  4IO9 L;  4K41 A;  5AFU A;  5FPD A;  3U4L A;  2FF3 B;  1ATR A;  1S22 A;  2P9I B;  5C10 A;  3ENH A;  5HOO A;  4CBX A;  4C23 A;  5AQT A;  2WFB A;  2FSN A;  1C0F A;  3CJB A;  3M1F A;  4R79 A;  2E1Z A;  5AZI A;  1VAZ A;  1V4T A;  1VQK N;  1MWM A;  4FWP A;  5AQG A;  3UKR B;  5M1K A;  4G9Z A;  1KD1 O;  4IOA L;  5C2D A;  1VQ4 N;  1KAZ A;  3F5T A;  1CZA N;  3Q7B A;  1NBW A;  3P39 A;  4IXC A;  1P8Z A;  3IUC A;  1JJ2 M;  4GNI A;  3U8X A;  2CGL A;  2P9L A;  3MN7 A;  3E1Y A;  2QWN A;  3QBX A;  1M1K O;  3L0Q A;  4EAH D;  2NRT A;  1JCG A;  2WC9 A;  4CZF A;  3S41 A;  3VEY A;  1SAZ A;  1YF5 L;  1R59 O;  1KAX A;  4IEI A;  4BRD A;  3MN6 A;  4IJA A;  3AAP A;  5AQQ A;  5B8H A;  3MN9 A;  3ZEU A;  3VEX A;  1OKJ A;  4XH1 A;  5BRH A;  3MCP A;  1VQ5 N;  4GV3 A;  3CET A;  5DM6 L;  2ASP A;  3SAH A;  3I55 N;  3RSE A;  1HKG A;  1KAY A;  1YXQ A;  5GAD P;  3A0I X;  1VQL N;  3GBT A;  3KWG A;  1MDU B;  2HMP A;  5EXW A;  4DB3 A;  4A62 A;  5M1F A;  3D2E B;  3ID6 A;  4H0O A;  4BRP A;  5EX5 A;  3DWL A;  4GV6 A;  5FPM A;  5AQL A;  4UY8 O;  5AQS A;  3G4S N;  3K9K A;  3CIP A;  5JLH A;  2F9T A;  3C7N B;  3TTC A;  3J7Z O;  1GLD G;  4OPH A;  2QI2 A;  1DEJ A;  3FLC O;  1YJW N;  2CGK A;  3WXJ A;  4PL7 A;  3W3D A;  2WUS A;  1HX1 A;  3UKU A;  3SLC A;  3CCJ N;  3EL2 A;  1RDU A;  5JVG L;  2QM1 A;  1S72 N;  4I6M A;  4IJN A;  4IEE A;  1YI2 N;  2IVO A;  3IKM A;  2ZJR L;  4O5F A;  2P9N A;  3WQT A;  3FZL A;  4IZ9 A;  3A5M C;  2Q2R A;  4BRL A;  3F2K A;  4PHT X;  3W0L A;  4FWR A;  3ZYY X;  3D2F A;  1QQM A;  3I8B A;  4ISE A;  4RWT A;  5M1P A;  1QQO A;  2HF3 A;  2VYP A;  2YCH A;  2ITM A;  3BF3 A;  3CCS N;  4BC3 A;  1U2V A;  4WCE L;  2NNW A;  3CCV N;  3HSC A;  1XUP O;  2QWL A;  3EKS A;  1NGG A;  1MA9 B;  1BU6 O;  4B1U B;  5AQI A;  2VCP A;  4A2B A;  5I9E B;  4WFN L;  3LDP A;  1NMD A;  3KZB A;  1QZ6 A;  4QS7 A;  1VQO N;  4KH4 A;  3O1W A;  1NLV A;  4IFE A;  3VGK A;  4BGA A;  4U67 L;  4WFB L;  3CCQ N;  3CC4 N;  4BRE A;  3SMP A;  2Q0R A;  3LDL A;  5M1O A;  4PKG A;  5AQZ A;  4BR4 A;  4CZG A;  2NRR A;  1NGI A;  2Q97 A;  1ZXO A;  3PLA A;  4FVU A;  1T6C A;  2NRZ A;  4AM7 A;  5AR0 A;  4BRI A;  1XQS C;  3LDQ A;  1K8K B;  4O8K A;  1X9J A;  3WQU A;  3A5L C;  3A8Y A;  1GLB G;  4A5B A;  4CZL A;  3O1B A;  2HBL A;  4XH5 A;  3NVK A;  4JHD A;  3VMF B;  3CPW M;  2HF4 A;  4JKB A;  5BPM A;  3KWI A;  4QS9 A;  5LJV A;  4YOY A;  2Q1N A;  2FXU A;  5AQM A;  4IDH A;  3HM8 A;  4FWL A;  2F9W A;  4JD2 B;  1S3X A;  1M90 O;  3CCE N;  5AQH A;  4JNE A;  5BRF A;  4FO0 A;  4O8U A;  3VER A;  4BRN A;  3TTF A;  4JKD A;  3VF4 A;  2P9P B;  3O4W A;  1V4S A;  4CZK A;  5AQV A;  4NLC A;  3CJ7 A;  4BR5 A;  4F9O A;  3M6G A;  2A3Z A;  4A61 A;  4CZJ A;  1RDW X;  1TYQ B;  1BWF O;  2PAV A;  4MDA A;  5GIN A;  4BR2 A;  1KC8 O;  1QHA A;  3MDQ A;  2RHK A;  2NZT A;  4FOE A;  3AY9 A;  3DXM B;  3EE9 A;  1HJO A;  4C1N K;  2GUP A;  3O6W A;  4EFH A;  4BC2 A;  2A5X A;  5F0X A;  5GIO A;  3KHY A;  3EKU A;  2E2N A;  4ISG A;  4CJ7 A;  4XH4 A;  3CQX A;  5AQU A;  4CD3 A;  2P9K A;  3WUH A;  5BPL A;  1G99 A;  4JKG B;  4KH5 A;  1T6D A;  2H3G X;  3MWP A;  5JVH L;  5BRD A;  3R6M A;  5AQY A;  2OTL N;  3RVC A;  3I56 N;  3DLL L;  4BR0 A;  4A57 A;  1LOT B;  2QWO A;  3PIP L;  2E1Y A;  1VQ6 N;  4CZH A;  3VGL A;  3DAW A;  4JKA A;  3R8E A;  3SMS A;  1VQN N;  4MLH A;  3T69 A;  5KQD A;  4CZE A;  3MK6 A;  3E9P A;  1J6Z A;  1BOT O;  2VGM A;  4B1X B;  4YOV A;  2A42 A;  3HZ6 A;  3R1X A;  3ZET A;  2QEX N;  3MN5 A;  4OO1 J;  3M3Z A;  2KKZ A;  5AQJ A;  3VEZ A;  2QW9 A;  4ILH A;  2ZGY A;  3VEN A;  1N8R O;  3DXK A;  4FWQ A;  3TU5 A;  1H1V A;  1XC3 A;  2HBK A;  5M1N A;  3LDN A;  3TSU A;  3CI5 A;  2Q31 A;  3ENO A;  4FWK A;  5LY3 A;  1Y64 A;  5LJW A;  1YJ9 N;  4AF1 A;  4JKF A;  3TTD A;  3VEW A;  2YX6 A;  3H6E A;  5C0Y A;  2P9I A;  2ZF5 O;  5GAG P;  3DJC A;  3BP8 A;  3O9T A;  4B1V A;  1TUU A;  3TPQ A;  1HUX A;  2KHO A;  4H0X B;  4JEP A;  3H46 O;  3WEE B;  2FF6 A;  2GX9 A;  3C0B A;  5GAH P;  4DCH A;  4DQ8 A;  3O8M A;  1VQ8 N;  5CHI A;  3QDK A;  1E4F T;  3HBT A;  3UKR A;  4MDB A;  1WOQ A;  3L4Q A;  2QWP A;  3MMV A;  4EIA A;  3CCL N;  3E9O A;  5AQK A;  1DGK N;  3ZX0 A;  3IDH A;  4K42 A;  4H5V A;  2GWK A;  2FSJ A;  5CR4 A;  1QZ5 A;  2BTF A;  5C2F A;  2QWR A;  3MX2 A;  2PFU A;  1SS6 A;  3I33 A;  3P31 A;  3C6H A;  3CXC M;  1K9M O;  1NGD A;  5FPN A;  4BVP A;  3G25 A;  4YDU A;  3MX5 A;  1VQ7 N;  3WXM B;  2W41 A;  2YHW A;  3JXU A;  1EQY A;  4H5T A;  3OW2 M;  3BUZ B;  4GY2 B;  1Q86 O;  2D0P A;  3FE1 A;  1MWK A;  4DHY A;  1GLF O;  3HI0 A;  4CZM A;  2OAN A;  4HTL A;  2I7N A;  3CPE A;  4JK8 A;  1GLC G;  3T7Z A;  3ULE B;  2A6A A;  4PKI A;  4M7X A;  1GLL O;  3TSP A;  2QWM A;  5BR9 A;  4BRO A;  1YIT N;  4FL9 A;  3LDO A;  1NGE A;  2QA4 N;  3D2E A;  3QIC A;  4A59 A;  4QS8 A;  4PL8 A;  1VQM N;  5EVZ A;  5TKY A;  2NRV A;  4GV9 A;  3E66 A;  4K43 A;  3VF2 A;  5C12 A;  3H1Q A;  2E88 A;  2KLA A;  3L6Q A;  4B1W B;  3R9P A;  4BGB A;  5H1S Q;  3O5B A;  3C7N A;  3VTI A;  3PIO L;  1ZC6 A;  4GVE A;  2P9U B;  2P9S B;  4KH6 A;  5TKW A;  3CJA A;  3FFK B;  4YDU C;  1NGF A;  2IVN A;  2E20 A;  3VOV A;  4H5R A;  3UE5 A;  3U9Z A;  5EY4 A;  1KXP A;  2YHX A;  4IO8 A;  2FLO A;  5MLC Q;  4YOT A;  3O9Q A;  4WQ5 C;  3GOI A;  5M1Q A;  1GLJ O;  1BA0 A;  1NWK A;  2YJF A;  2QWQ A;  3CJ9 A;  3SAG A;  3VGM A;  3NMU A;  3N4Q A;  2Q0U A;  1O13 A;  5BN9 A;  1T3V A;  4E1J A;  3HTV A;  2ZWH A;  1YIJ N;  2EWS A;  4IOC L;  1OVY A;  2E2P A;  2JWL A;  1Q18 A;  1NGA A;  5ELZ A;  3OA9 A;  1TUY A;  3CCM N;  4BQL A;  3G71 N;  4BY9 C;  3CD6 N;  3CJC A;  1NGC A;  3IFR A;  5AQN A;  3WXI A;  3VES A;  3FZF A;  4FWN A;  3FR0 A;  4WQ4 A;  3VET A;  3SBT A;  1QVF M;  1LCU A;  4EHU A;  5GAE P;  3O08 A;  4M63 C;  4BRA A;  2UYT A;  3CMA N;  1ILY A;  3AGR A;  4CBW A;  3LM2 A;  3ZX3 A;  1ESV A;  1SZ2 A;  2P9L B;  4A2A A;  4MO5 A;  3ATU A;  4NB4 A;  3VF6 A;  4XEI A;  2AP1 A;  2ASO A;  3SBG A;  5ADX H;  2CH5 A;  3TSQ A;  2IIR A;  5BRE A;  3MWT A;  3OBY A;  3OHR A;  3ZEU B;  4BG9 A;  4A5A A;  5HL7 L;  4WYB A;  3P38 A;  3Q7C A;  2ZGZ A;  5JIC A;  5KPT A;  4H0P A;  2HBJ A;  2ASM A;  5AQW A;  3H45 C;  3LL3 A;  3P4I A;  3U9D A;  3VTH A;  4WQ4 C;  2HST A;  2E2O A;  3D7E O;  5F1X A;  2VGN A;  2RE2 A;  4K25 A;  3BF1 A;  1K8K A;  3QFP A;  1WUA A;  4IOX A;  3EN9 A;  4L3Q A;  5AQF A;  3R3L A;  3ID8 A;  1BA1 A;  4HWI A;  2QTD A;  1VQP N;  4Y0W A;  1SQK A;  4JKC A;  4FPA A;  4U7B A;  1YAG A;  3CJ1 A;  3QBW A;  4MLE A;  1BO5 O;  3O80 A;  5EOY A;  2FSK A;  3LM9 A;  1W2B M;  1IG8 A;  4YOR A;  5AQX A;  5AFU H;  3QB0 A;  4JD2 A;  2HBM A;  2DPN A;  2IVP A;  1RGI A;  2NLX A;  3OBW A;  3UKU B;  4RTF D;  1Q82 O;  5AQO A;  1X3M A;  3HOS A;  1E4G T;  1NGH A;  4I6M B;  1JCE A;  4JK7 A;  3CQY A;  2P9P A;  3VEO A;  4BVO A;  1P90 A;  2E8A A;  4M7Y A;  2P9N B;  3AAQ A;  4RCH A;  2VWB A;  3C6A A;  3K9J A;  1TYQ A;  1C0G A;  4JN4 A;  3CF5 L;  3VEV A;  2GEL A;  4H0V B;  4KBO A;  1QVG M;  3CME N;  1HKC A;  3DXM A;  4CD1 A;  3D2F B;  1K73 O;  5JMV A;  4BC5 A;  3CHW A;  3M5R A;  3VPZ A;  3SJH A;  3J8A A;  3CC2 N;  2W40 A;  4DKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...