3ZX3A

Crystal structure and domain rotation of ntpdase1 cd39
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
406
structure length
399
Chain Sequence
NVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGASTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNNSHCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
publication title Crystallographic Evidence for a Domain Motion in Rat Nucleoside Triphosphate Diphosphohydrolase (Ntpdase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 125
structure length 399
sequence length 406
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx3A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx3A02
5AQHA 4BRNA 2E2QA 3A5OC 5EX5A 1JCFA 4B1UB 5AQIA 4BRIA 2CH5A 3RSEB 3VENA 3QFPA 4B1YB 3MN6A 2YJFA 2HMPA 3DJCA 2QW9A 2W40A 3QDKA 2CGJA 3A5NC 4BVOA 3WEEA 4FWMA 3FZMA 5AQXA 5AFUH 3CERA 4JHDB 3IDHA 1GLFO 3KVGA 2Q0RA 1LOTB 3QB0A 3ID8A 4BRGA 5BR9A 2I7PA 1JCGA 4E1JA 5ADXH 3QMLA 4K41A 4PL8A 3W0LA 1DEJA 3M3ZA 5FPDA 5JLFA 2W41A 1NGCA 5EY4A 3D2EA 5AQWA 4IJAA 4F9OA 2P9PB 3HTVA 1BA1A 5FPEA 3EKUA 1YUWA 3CJ7A 1HUXA 5ELZA 2QWOA 5BREA 2QWQA 3FLCO 5BRHA 3A5LC 1TUUA 4EHUA 1J6ZA 3TPQA 5AQKA 3BF1A 1C0GA 1YXQA 3VEYA 2GELA 4Y0WA 2H3GX 1MDUB 1BWFO 2D1KA 1DGKN 4BRMA 4BR5A 5AZIB 3UKUA 5AQLA 3CJAA 3H6EA 5F1XA 5AR0A 4Z94A 4BGAA 1ESVA 4A62A 1NLVA 1K8KA 3MN7A 2UYTA 3ULEA 3IMXA 4FO0A 4EFHA 3L4IA 3GL1A 3ZEUB 1BA0A 4BRQA 4BC5A 1KAZA 4IZ9A 4CBWA 4MO4A 1WOQA 4O5FA 4FWLA 4H5WA 4CZGA 1Q18A 4IXCA 2V7YA 4XH1A 3SMPA 3WXLA 1NBWA 2QWMA 1V4SA 2KHOA 3EN9A 2YI1A 4BVPA 4BREA 2QWLA 1QHAA 3VERA 3VF4A 5AQOA 3WQTA 4YDUC 2FXUA 2QWNA 2BTFA 4B1WB 5BRDA 1BOTO 1QQNA 5AQNA 1GLAG 4H0OA 4BROA 1T6DA 2P9UA 2ZWHA 4WQ4A 3QFUA 4JNEA 4B1ZA 5KQDA 1SZ2A 5LJVA 3UKRA 3MN5A 2DPNA 2P9LB 3VOVA 1Y64A 4K43A 5E84A 4B9QA 3FZHA 3O4WA 5AFUA 3C7NB 4H0PA 3JS6A 4DCHA 3DXMA 4QS8A 5AQPA 4EIAA 4K25A 3SK3A 2IVNA 3VGLA 4PKHA 3B8AX 2E20A 5ADXA 3LM2A 1U2VB 4FWNA 1NGHA 5BPMA 1S22A 1RGIA 1TYQA 2ASMA 4BRAA 4WQ4C 4QS9A 3A0IX 3VESA 3R8EA 4C23A 3VEZA 3BUZB 2HOEA 5KPZA 1QQOA 3O5BA 2P9NB 2A40A 3D2FB 1ZXOA 3LDQA 3ZX3A 5I9EB 1GLEG 2P9IA 3O1BA 5BRFA 2PAVA 4FSVA 3QBWA 2D0OA 2FSNA 2QWRA 1HJOA 4FWPA 4WYBA 2D4WA 3AY9A 4A2AA 3ZETB 2P9SB 5F0XA 3WUHA 3S41A 2ZF5O 5AQQA 1X9JA 4JD2B 4H0XB 4LC9B 3DXKB 4BQLA 2A5XA 3FGUA 3BF3A 3QBXA 1DKGD 4BRDA 4I6MA 1U6ZA 3VEOA 2ZGYA 2NRHA 3GDQA 4FPBA 1KXPA 2IVOA 4MO5A 3IUCA 3CQXA 3VEVA 2I7NA 5KPTA 3WT0A 2F9WA 3WXKA 2Q1NA 3O80A 2YHXA 5B8HA 1HX1A 3ZX0A 3DAWA 3HI0A 1GLBG 5EOYA 3GOIA 3BP8A 4KBOA 2Q31A 5AQVA 5AQYA 2PBDA 1XQSC 3VGMA 2P9KA 5LY3A 5AZJA 1YAGA 5AQJA 2FLOA 4FWKA 4BGBA 1KAYA 5FPMA 3UB5A 2FSKA 3W3DA 3FZKA 3HBTA 3LDOA 3WEEB 4ISFA 4QS7A 1XC3A 1YVNA 2GUPA 2IIRA 3A5MC 3H1VX 1NGJA 4B1XB 4MLEA 3DWLA 4WQ5A 4CBXA 2OANA 3GG4A 4ISEA 2Q2RA 4XH4A 3WXJA 4EAHD 5AQFA 4XH5A 4A61A 2AP1A 5JLHA 3D2EB 3MN9A 1Z6RA 1T6CA 1NGBA 3D7EO 1GLJO 3VGKA 3VEXA 3UE5A 3CHWA 3U8XA 3ENHA 4CZMA 2Q0UA 1X3NA 2VWBA 1Z05A 4EHTA 3FZFA 3LDNA 4FWOA 4PKGA 2ITMA 1R59O 4BC3A 4BRKA 4RCHA 1BO5O 2FF3B 3GBTA 2Q97A 3AAPA 4BR2A 1RDWX 4WQ5C 1WUAA 3SJHA 2QWPA 4FWQA 1CZAN 2HF3A 3O8MA 3C0BA 4BRHA 3UKUB 4CZKA 3TU5A 2A42A 2A6AA 4FL9A 4RWTA 4CD3A 2CGKA 3RSEA 1G99A 2D0PA 3H1QA 5LJWA 2E2NA 1IG8A 1K8KB 4H03B 2QXLA 3L6QA 3ULEB 3VF6A 3MDQA 3VEWA 4JHDA 4BRCA 2CH6A 5BN8A 3WXIA 3H3OB 4FOEA 1NGAA 2GWKA 1NMDA 1LCUA 3KZBA 5KQ8A 2YHWA 4FOIA 3MCPA 4M63C 2GTDA 2YJEA 1HKCA 3CIPA 4JN4A 4M7YA 2E1YA 2P9PA 2A3ZA 2E88A 3MK6A 1P8ZA 2VYPA 3FR0A 2NLXA 2WUSA 4CZIA 1EQYA 4IO8A 1HPMA 2BUPA 4DHYA 5TKYA 1SAZA 2QM1A 2P9UB 3CJCA 5BPNA 4BRFA 2NZTA 2V7ZA 4GNIA 4J8FA 4FWRA 5AQTA 3M6GA 2ASPA 3UKRB 4GY2B 1ATSA 5FPNA 5JMVA 4H0TB 3SMSA 4RTFD 1ATNA 2IVPA 3U4LA 5AZIA 2F9TA 5JICA 2VCPA 3DXMB 3FFKB 3KHYA 4IJNA 4H5TA 4CZLA 4CZEA 4B1VA 4CZFA 4CI6A 4CBUA 2YCHA 1BDGA 2EWSA 5AQRA 2CGLA 3ZEUA 4NO7A 2A41A 1TYQB 1HLUA 3F9MA 3O1WA 3AAQA 1BG3A 3LDLA 3R6MA 1NGEA 3R9PA 5AQZA 5AQMA 3JXUA 3H3NO 3H46O 2ZGZA 4M7XA 3H45C 4A2BA 1ZBSA 1KAXA 2ASOA 2P9IB 4XEIA 3VF2A 3WQUA 4H5RA 3M1FA 1RFQA 1V4TA 3VETA 2E2OA 3J8AA 3O08A 3U9DA 1BUPA 3I8BA 4JAXA 1MWMA 4BG9A 4HTLA 4PL7A 2FSJA 1SQKA 3LDPA 4IWVA 2GEMA 2P9LA 1S3XA 1NGDA 4BRPA 1T44A 3C7NA 4YDUA 2AA4A 1JCEA 2HF4A 3CETA 4HWIA 1QZ6A 3HSCA 4I6MB 3LM9A 4H0VB 3O6WA 4BR4A 3ATVA 5AQUA 4CZHA 3U9ZA 1U2VA 3L0QA 2J4RA 3EO3A 1MA9B 3BEXA 2GWJA 3EZWA 1GLDG 4CZJA 4BQZA 2V51B 3CJ9A 3HZ6A 3IFRA 3CJ1A 4BC2A 4BRLA 2E8AA 5AQSA 1GLCG 1MWKA 4DQ8A 5F2RA 4L3QA 3FZLA 4BR9A 2P9NA 2Q36A 3D2FA 2P9KB 1QQMA 1ATRA 5CE3A 4BR0A 3CI5A 1XUPO 5AZJB 1H1VA 3VPZA 4DB3A 2E2PA 2V52B 4AM7A 5E26A 4BR7A 4MLHA 5KPRA 3OHRA 1HKBA 3SLCA 3G25A 4BG8A 3HM8A 3AARA 2E1ZA 4FPAA 1NM1A 1X3MA 3I33A 3P4IA 5AQGA 4K42A 1BU6O 4PKIA 5BPLA 3CQYA 4CJ7A 4NB4A 3ZETA 1NGGA 2P9SA 1C0FA 1NGFA 4H5VA 5EXWA 1E4GT 2FF6A 1D4XA 1OKJA 3ZX2A 4JD2A 4FWSA 1QZ5A 1HKGA 1NWKA 4O8KA 3FE1A 1E4FT 3ATUA 3DXKA 4BC4A 5BN9A 3A8YA 1GLLO 3LL3A 1IJJA 4H5NA 3CJBA 4AM6A 3ENOA 3EKSA 3QICA 5EVZA 4H0YB 2YHYA 4CD1A 4ISGA 3MMVA 3EL2A 1ZC6A 1TUYA 3GE1A 1NGIA
chains in the Genus database with same CATH superfamily
5AQHA 4AH9A 4CJLA 5HP1A 1C6VA 1U48A 3ID6A 3TSQA 5AQIA 1EXQA 1HR0K 3VENA 4DTRA 1HNIA 2YV0X 3QFPA 1NOZA 3MN6A 3T69A 3CMEN 3LWMA 1VSKA 2IS3A 2G8UA 2QW9A 2W40A 2CGJA 4FK4A 4E7LA 3K9KA 3CFOA 1GLFO 4KI6A 3QB0A 4DF8A 4DMNA 4BRGA 1X9MA 3VQQA 4PL8A 4BDPA 5FPDA 1NGCA 2W41A 1N33K 3D2EA 5AQWA 3HJFA 2P9PB 3HTVA 1RBTA 5GAHP 1IV0A 3RRGA 2F96A 3KKSA 1VQON 2Z1GA 3AGRA 5HRRA 4EHUA 3DLHA 1SKRA 1J6ZA 3HYFA 1NOYA 5AQKA 3BF1A 4O8UA 1C0GA 3TAQA 1ITGA 3C6HA 3K5LA 2H3GX 1MDUB 2D1KA 1DGKN 3OYHA 4MDBA 3S3OA 2OPPA 4BDYA 1ZBHA 5AR0A 4Z94A 4BGAA 4F4KA 3SI6A 1NLVA 1K8KA 3ENBA 2QK9A 3V6DA 3ULEA 4FO0A 3ZT0A 3GL1A 4BRQA 4IZ9A 3ALYA 1BL3A 4BACA 4O5FA 4FWLA 1NBWA 4CGIA 3ZSVA 2RN2A 4N5SA 3C6UA 4N56A 4E7KA 1XNRK 3OA9A 4G1QA 4QOZB 1RBUA 1W0HA 1IKWA 1QVFM 3KK7A 5E41A 1LV5A 1RT4A 1SUQA 4KHQA 2O8BB 1IBKK 1QQNA 3BZKA 5AQNA 4DTXA 3DLBA 4BROA 1T6DA 3QFUA 2X6SA 1YJ9N 4DSEA 2B5JA 2D0CA 1C1CA 3MN5A 1SKWA 3J7YP 4HCCA 2VGNA 3C6AA 3FZHA 3O4WA 5AFUA 3C7NB 4H0PA 4DCHA 1SL1A 4FJLA 4CEDA 4K25A 3SK3A 3NVMA 1S9EA 1SV5A 4CIGA 5FLXO 4C8NA 4QCLA 1CXQA 5BPMA 2JLEA 1RGIA 2D0AA 1KQSM 4KH6A 1TYQA 4BRAA 3VESA 3SPZA 1WSFA 3VEZA 4I7FA 1QQOA 4WF9L 3OYLA 4ILJA 2P9NB 2DFEA 3D2FB 3KK1A 2OYQA 1L3VA 4OPAA 1GOAA 3A2FA 1VHXA 4YOWA 2Z1IA 5HOOA 3CCVN 4B3TK 5JS2A 3RR8A 2FSNA 3MWTA 2RF2A 4LY7A 4WYBA 4CF9A 2A1SA 2P9SB 4DSFA 4DR7K 3L2RA 3WUHA 3V9ZA 4AHUA 4DQRA 4B3MK 2ZF5O 3AO2A 1QQCA 1Q86O 4LC9B 3ZSWA 1IBLK 3SV4A 4JK9A 4DFJA 4GV3A 3QBXA 1DKGD 1U6ZA 3VEOA 3GDQA 5KGXA 2O8FA 1KXPA 2NRWA 3C65A 1VQPN 3IS9A 1DTTA 2Q1NA 5KGWA 4RW6A 1HX1A 4DR1K 1RT6A 3SZ2A 3GOIA 3OW2M 5J2MA 4ELTA 1ZBIA 2Q31A 5LY3A 4DV7K 3L2QA 4DR3K 1QHTA 5AQJA 3ZYYX 4DSLA 5FPMA 3VQ7A 2FSKA 3WEEB 3B6PA 1YVNA 2IIRA 1FW6A 2OPQA 4CJSA 1X9WA 4CBXA 1S1TA 4CJUA 1YT3A 3WXJA 1EKEA 4IBNA 3CMAN 5AQFA 4XH5A 4CGDA 3VQPA 1T6CA 3OYJA 4OJRA 1NMNA 3VGKA 4CW7B 1Q9XA 4E1NA 4CZMA 1X3NA 4KHUA 1Z05A 4CK3A 1R59O 3L4QA 3WNGA 4RCHA 2IDOA 3G71N 2QWPA 4RG8A 1CZAN 4JEPA 2HF3A 4ZHRA 3BY5A 5IWAK 2FBTA 1SS6A 4CD3A 4DTSA 2CGKA 1G99A 3F5TA 1S1VA 4DTNA 4IFVA 4DS4A 4H03B 4IDKA 4HUGA 3VF6A 3OTOK 4KHYA 4AQYK 1KVBA 4NCGA 5SWMA 3K9JA 3TSPA 1NGAA 3E9OA 3QINA 3THXB 2W6LA 4DS5A 3K2PA 3SPYA 4W5OA 3ZT3A 4YY3K 2NNWA 1HMVA 2YJEA 3VQ8A 1Q9YA 4KREA 4JN4A 2P9PA 2E88A 1VQ7N 3TTDA 1D8YA 2YHBA 1N8RO 1JL2A 2BUPA 4UQGA 1VQMN 3CPWM 3SCXA 2P9UB 3CJCA 3RMDA 4X66K 1HRHA 3F73A 1RT2A 2PZSA 3M6GA 4LF8K 3OYIA 3SMSA 2IVPA 2UU9K 3QERA 4TSXA 2VCPA 4I9LA 3ITHA 4H5TA 1XHXA 1NKEA 1J9AA 4OVLA 3DLEA 2YCHA 5FROA 4CJTA 3OYBA 4FJ9A 2CGLA 4NO7A 2YHAA 3NCIA 4ILHA 1HLUA 4KTQA 5M1OA 1VSEA 2RPIA 3O1WA 4KV8A 3R9PA 5AQZA 4DTMA 4YFUA 3HPHA 4YORA 4KO0A 3HT3A 3OYNA 4OLAA 3H46O 2ZGZA 1B9FA 3H45C 4CK2A 3D0PA 2ZJPL 2NRVA 4FLWA 3VF2A 3SQ0A 2F8TA 2O8BA 3VETA 1MU2A 3O9TA 4EZ9A 4M3YA 1A5VA 1DLOA 1MWMA 3C94A 1RDBA 1XWLA 4OGEA 2E6LA 4IWVA 2O8DB 2GEMA 4N76A 4KB1A 5FRNA 3THVA 1T44A 3C7NA 4C1NK 1NJYA 1QZ6A 2E4LA 4I6MB 4H0VB 3O6WA 5AQUA 3V4IA 4FK0A 3TI0A 1Q7YO 4B9VA 2ETJA 1MA9B 4I2PA 4K8ZA 4CZJA 4BC2A 3EY1A 2E8AA 4FM0A 3M8PA 3SUPA 1K9MO 4OLBA 2X6NA 1WSHA 2D5RA 4DQ8A 3TANA 4F3TA 2ZQBA 4L3QA 2P9NA 3D2FA 2P9KB 1TV6A 3LWLA 3CI5A 1XUPO 5AZJB 1X9SA 3VPZA 1H1VA 1LWEA 3SUOA 1YVUA 4MLHA 1RILA 1HKBA 2FC0A 4CJKA 1T05A 3AVGA 2XY7A 4XIUA 3O3GA 3I33A 5AQGA 3J7ZO 1BU6O 2EHGA 2B4JA 4NB4A 4WFAL 4DV0K 4DWIA 3MXIA 2P9SA 1SL2A 1C1AA 3ULDA 4CCHA 2NRRA 5EXWA 1TL1A 3ZX2A 1NWKA 1TAQA 3D45A 2KLAA 4KRFA 3A8YA 5C25A 2AJQA 3CJBA 1RDUA 3VQ9A 5EVZA 1K6YA 4OX9K 1T03A 1HYZA 2OPSA 2G8HA 3GE1A 2KW4A 1UWBA 3CFPA 2ITGA 3VQEA 4O55A 3BGRA 3AO4A 4W5QA 2YNHA 3DJCA 3QDKA 3LZJA 4OKKA 3WEEA 2XY5A 3SUNA 1VSMA 5AQXA 1BIZA 1TVRA 5AFUH 3OYCA 5I42A 1KFSA 2QKKA 3O4QA 3AO5A 4JKBA 5BR9A 1I39A 2GV9A 4E1JA 3T3FA 3M8QA 4K41A 3W0LA 2QTDA 1NKBA 3LAKA 4J2DA 5JLFA 3JYTA 3SAGA 1RTJA 2HHUA 1BA1A 5ELZA 3AO1A 3AVAA 5BRHA 3DMJA 3CCJN 3NDKA 3QIOA 4CIEA 4X62K 5HRNA 4E89A 2E6MA 1YXQA 3NGZA 1TAUA 4DF4A 4FXDA 1HNXK 1LW0A 1RT3A 4Y0WA 1BWFO 4BRMA 5AZIB 3CF5L 5EU7A 5AQLA 1C0MA 3CJAA 4YHHK 1QTMA 2UXCK 1ESVA 4FJGA 3RTVA 2WC9A 2OZSA 2UYTA 1D9DA 3IMXA 4IKFA 4GVEA 5KTQA 4A5BA 2FBYA 3DLKA 3O4NA 1YI2N 5JS1A 4MO4A 3QEWA 2BANA 4H5WA 1VQLN 1OH7A 3SMPA 3THXA 1OVQA 2LSNA 4IFYA 2HHXA 2VWJA 3VERA 4GKJK 3ZT4A 2OCEA 1LWCA 3ZT1A 1BOTO 4FM1A 3RVCA 4ISGA 2QI2A 3AVNA 4H0OA 2P9UA 4WQ4A 1T7PA 3S3NA 5KQDA 1CXUA 5LJVA 1HJRA 4RW4A 4CGJA 3C95A 2B6AA 2DPNA 1Y64A 4K43A 3T19A 2VQFK 3JS6A 4RW8A 1KVCA 4QS8A 4DTUA 3HVRA 2W42A 1EP4A 2IVNA 3MXJA 4V19S 3LM2A 4KH4A 3TAPA 4FJIA 3LP1A 3VQCA 4FLYA 4KHNA 4QS9A 3T1HK 3R8EA 3BUZB 3HL8A 4IDHA 3S3MA 1TKZA 5KPZA 3O5BA 5C15A 3ZLJA 3L8BA 3ZX3A 5I9EB 1QSYA 1S9GA 1NJWA 5CZ2A 1W9HA 4X64K 3L2UA 4FSVA 1BI4B 3AA5X 2YNFA 2I5JA 1HNVA 5J2QA 1WSIA 4N47A 2PY5A 3UIQA 3S41A 2VG6A 3MX2A 2O8DA 1X9JA 4BE2A 4H0XB 3DRSA 1L3SA 2A5XA 2KFZA 4JLHA 3QETA 4I6MA 4LFBK 4W5RA 2IVOA 4MO5A 4CHNA 3CQXA 4DUZK 2NRTA 3G4SN 2I7NA 4CHYA 2F9WA 3O80A 1A5XA 1W97L 3V1QA 3ZX0A 3VA3A 2WONA 3HI0A 1B92A 2PYJA 3AV9A 4OKEA 5A2QO 1HPZA 3Q7BA 5AQVA 5HRPA 5DM7L 2P9KA 1WB9A 4ILGB 5AZJA 4KHPK 1YAGA 4FWKA 1KD1O 1KAYA 3HVTA 3IRXA 4KB0A 3UB5A 4FJJA 4O0IA 1BQMA 3OVNA 1JLCA 1NU0A 4ELUA 4U7BA 3OYMA 1NNEA 4KPYA 4MLEA 4WQ5A 3VTHA 3NVKA 3CCSN 3KWIA 2YKMA 1FKOA 4I9QA 1N32K 3PV8A 3HRGA 4NLCA 2Y1IA 2AP1A 4CEQA 1A5WA 1Z6RA 3MN9A 4A57A 1NGBA 2XO7A 3VEXA 1XHZA 4DR5K 3UE5A 4YOTA 4LSNA 3U8XA 1G15A 3ENHA 2HHHK 2VWBA 3V81A 4DR4K 3FZFA 3DM2A 5JVGL 1YHQN 3PSFA 4OKJA 2ITMA 3G0ZA 4ID1A 3G10A 1WUAA 1RTDA 3MAQA 3CPEA 3C0BA 3UKUB 4CJ4A 4FL9A 4RWTA 5C2DA 5LJWA 3VTIA 4FLXA 4DV1K 3CCEN 4GKKK 2W6KA 3QNOA 3MDQA 4FVMA 5D3GA 4CEAA 3J7AP 3L2VA 2WTUA 1GOCA 1LAVA 2CH6A 2Y1JA 1WSJA 1S1XA 4FOEA 5LL6Z 3N4QA 1NJXA 1FJGK 1QS4A 4BWJA 3PY8A 1P8ZA 2VYPA 2NLXA 2WUSA 4CJWA 3JAMO 4BE1A 4CJQA 3E9PA 1RNHA 1YTUA 3MEGA 4CHQA 2QM1A 2NZTA 4FWRA 4NCBA 4C8LA 2FBVA 3LP2A 5AZIA 2F9TA 3PO4A 4OPKA 3FFKB 3KHYA 4IJNA 1NK5A 2P1JA 1WBBA 4CZEA 4CBUA 2WBNA 3HSTB 2ZD1A 4DTJA 4M3TA 2HB5A 1BG3A 4DQSA 5CYMA 5J2PA 4G9ZA 4CHZA 4CESA 4B8CA 3O9SA 2R7YA 4A2BA 1VSLA 2IOCA 1ZBSA 1JLQA 1KAXA 3DYAA 2P9IB 3P1GA 1S1UA 4XEIA 4YOUA 4M41A 1EO1A 4H5RA 3LP0A 3ZSQA 4JYAK 3AVKA 3J8AA 1BUPA 3OYGA 3TAFA 4JAXA 3TSUA 2KTQA 4HTLA 3HXMA 5M1KA 1U04A 3CCMN 2FSJA 1W2BM 4A5AA 4CGHA 1NGDA 1U4BA 2AA4A 2HF4A 3CETA 3NGYA 2Q3SA 4HCBA 4B9LA 3TR8A 3FFIA 4B8AB 4CZHA 5HBMA 4FYDA 4E7IA 2YNGA 1NK0A 2GBZA 2J4RA 3BEXA 3WNFA 3EZWA 4WE1A 1GLDG 1WNSA 4DFPA 1VQ5N 2XHBA 4BWMA 3CJ9A 2KQ2A 3IFRA 4O4GA 1JLEA 2PFUA 3C6TA 3EYZA 3U6FA 1O1WA 3FZLA 1BQNA 5C10A 4NXNK 2UUCK 1NG9A 4W5NA 2OPRA 4RW7A 2V52B 4DQQA 5KPRA 4FZXC 1IKVA 1RDAA 2HNYA 1F21A 3EEQA 4FJMA 1BI4A 1NM1A 4K42A 1CLQA 1N36K 4WCEL 4F8RA 4CJ7A 4DR6K 3VQ6A 3OS0A 3ZSOA 1VK0A 3G6EN 3DOLA 4YOYA 1RTHA 3KIOA 1DTQA 4FWSA 1E4FT 3ATUA 4BC4A 5BN9A 2HNDA 3WNHA 2IAJA 3LP3A 2HBJA 1IH7A 4B3SK 4NYFA 3CYMA 3CCLN 3S9HA 3ENOA 3EKSA 3N4PA 3QICA 2HHQA 4DKWA 4H0YB 2YHYA 4FZYA 4CD1A 4LF6K 4DUYK 1TUYA 1NGIA 4BRNA 1IKXA 3A5OC 3VQAA 5EX5A 4FLZA 1JCFA 3PUFA 3B6OA 4B1UB 3RSEB 1KCFA 4Z4HA 4CJ3A 4LF4K 4JI6K 2DTUA 2YJFA 4F2RA 4CF2A 1JKHA 3MXMA 3A5NC 4FZZA 4BVOA 4PY5A 4E1MA 5C2FA 3MWPA 3CERA 3TWHA 4JHDB 3IDHA 1X1PA 1J54A 2Q0RA 1LOTB 1QE1A 3ID8A 1NK7A 1TK5A 5FRMA 3AVFA 3QO9A 2I7PA 1JCGA 4CFDA 3QEXA 3DI6A 5DM6L 4CK1A 2WOMA 3AO3A 4CF8A 1TGOA 4ZTFA 1VQNN 1JLGA 4IJAA 4FK2A 3LAMA 2XY8A 3EKUA 1YUWA 1OH6A 3AVHA 1ILYA 3K5NA 4GVMA 2ZJQL 3O9UA 2QWQA 2HNZA 1FKPA 3K58A 3PX6A 3TABA 3A5LC 1TUUA 4J2BA 4CGGA 1Q81O 3O9QA 4DV3K 1C0TA 4CGFA 3TPQA 3L3UA 3PX4A 4DG1A 3AGKA 5FDLA 5KRSA 3VEYA 4JKHA 4X65K 1NK4A 3IAYA 1K8AO 1CZ9A 1YTAA 4CEEA 3AA2A 4R5PA 3UKUA 3LZIA 4JK7A 4LFCK 4JRQA 4A62A 3V9UA 3K5OA 4DV2K 4FLTA 4Y1DA 3T7ZA 3ZEUB 2X78A 1KAZA 1U45A 4BE0A 4CBWA 4J2AA 2HHVA 1WOQA 2WFBA 1HQEA 1Q18A 4IXCA 2V7YA 4IO9L 2HVIA 1ASWA 2QWMA 1RDCA 4KFBA 4L8RB 2YI1A 2QWLA 3THYB 1QHAA 2HBMA 4KI4A 5AQOA 2A1RA 3VA0A 3O9RA 2FXUA 4B1WB 3CC7N 4B9NA 3KD1E 5BRDA 3TAGA 2IGIA 1LAWA 3TTFA 4YOVA 1SL0A 4B1ZA 2BGGA 1KSPA 4KTZA 3MEEA 3EZ5A 2PYLA 3KLFA 1JLAA 3OS1A 3ZT2A 2P9LB 5E84A 1NK9A 4HVJA 2HSTA 4DFMA 4EP5A 5AQPA 3VGLA 3B8AX 3WNEA 5ADXA 1TL3A 4O0JA 3OJUA 2ASMA 4KH5A 1YIJN 1REVA 4BY9C 3A0IX 4CEBA 4CEOA 5C24A 4CEZA 4HUEA 2HOEA 2NRZA 3J81O 4JKGB 2A40A 5AJ3K 1Y97A 2F4VK 1GOBA 2G8VA 2P9IA 4B9UA 1RBVA 1OH8A 3KKRA 4OPHA 3O1BA 2O4IA 2O8CB 1ZYQA 1P90A 2D0OA 3E9LA 2QWRA 3KK2A 1JXBA 4FWPA 2QXFA 2D4WA 3HOTA 4CERA 3AY9A 1N6QA 4CFBA 3LALA 3ZETB 4HUFA 4DV4K 3KLEA 1KLNA 3PLAA 1YJNN 4DV5K 4KHWA 5AQQA 4JD2B 4PHTX 5LMUK 3NH1A 3DXKB 4BQLA 1VSHA 4K8XA 3BF3A 4JI0K 4AHTA 4BRDA 4CIFA 4W5TA 2FBXA 4FPBA 3VEVA 3WT0A 2YHXA 1RTIA 4NXMK 3DAWA 1D5AA 1GLBG 4DFKA 5EOYA 1XMQK 2BH1A 3QNNA 1S6QA 3BP8A 3AVIA 2G8WA 1TK0A 1XQSC 2X74A 4IEIA 4IFEA 2ZM6K 4AHCA 4FJNA 2FLOA 3NFAA 1ASVA 3PX0A 3FZKA 4JI8K 4QS7A 4HTUA 2UUAK 3A5MC 4FW2A 3H1VX 1NGJA 4B1XB 4JKFA 4JKDA 4DV6K 3GG4A 4ISEA 4I2QA 5CY4A 3DLRA 4XH4A 4EAHD 1TKTA 3P31A 4IG3A 3HPOA 2O4GA 3DLGA 3EE8A 2KKZA 3CHWA 3RMAA 4B9TA 3QESA 2Q0UA 4GW6A 4IOCL 4JI7K 5KRTA 5GIOA 4PKGA 3OYDA 3OYAA 4BRKA 1N5YA 3CC4N 1RBRA 1L5UA 3GBTA 5JVHL 3AAPA 4BR2A 1RDWX 4JI3K 3SJHA 1VQ4N 4FWQA 4M3ZA 2GUIA 3O8MA 4BRHA 5C12A 4CZKA 2UXDK 1YITN 4B08A 3RSEA 3KWGA 2D0PA 3MECA 1IG8A 2VWKA 3HO1A 2BE2A 2QXLA 3L6QA 4IOAL 1QSSA 3NH0A 3VEWA 1HYSA 1BCMA 4JHDA 4BRCA 2YNIA 4JRPA 2E5LK 3H3OB 4B3OA 1EETA 1LCUA 5KQ8A 3KZBA 3CC2N 4LSLA 1JJ2M 1N34K 2YHWA 3LANA 3NF6A 4M63C 4JKCA 2GTDA 1VSJA 1HKCA 3ZSRA 4M7YA 2E1YA 4CJVA 3MK6A 1I3AA 5M1QA 1EQYA 3R3LA 1HPMA 1ASUA 4DHYA 2ATQA 4JI2K 4DU4A 1SAZA 5BPNA 4GNIA 4NCAA 3M8RA 2ASPA 3UKRB 4M3RA 4E19A 4GY2B 4AHRA 4RTFD 1ATNA 4CJPA 4Z4CA 2YKNA 4CECA 3OYEA 3DRRA 3E66A 5JICA 3DXMB 1S1WA 1WSEA 4Z4IA 4CZLA 3T1YK 3RMBA 4DSJA 3AVMA 3VQBA 4B1VA 4CI6A 5M1NA 1VSDA 4O5BA 3OJSA 1CZBA 1EX4A 2DFFA 3ZEUA 1T8EA 1DT9A 2HBLA 4LFAK 1SKSA 1UAXA 2D0BA 3AAQA 3LDLA 3AA4A 1JLBA 1KC8O 1VAZA 3H3NO 3THYA 4CEFA 2F8SA 2HHWA 1Z25A 2ASOA 1VRTA 3WQUA 4B3RK 2GX9A 4LF5K 3M1FA 3K5MA 2E2OA 1XC9A 4Q5VA 3U9DA 3I8BA 4F2SA 4CJRA 1NK8A 4J2EA 4BG9A 4PL7A 1SQKA 4DLEA 3ISNC 5C42A 2RE2A 2P9LA 2ZE2A 4RW9A 4BRPA 3MX5A 3CCQN 1UA0A 3LM9A 4FLVA 4BR4A 3NHGA 4JKAA 4AHSA 2KZZA 1ZBLA 3EO3A 3OY9A 3I0SA 3NE6A 3K0SA 2GWJA 3SUQA 4BQZA 3SAHA 2V51B 4BRLA 3CJ1A 3NF9A 3P83D 3OYFA 5AQSA 1GLCG 4N41A 2JWKA 1JL1A 4JKGA 4Q0BA 4BR9A 5J2NA 1QQMA 1ATRA 4CVNE 4BR0A 3CXCM 4DB3A 2E2PA 3SAFA 5E26A 4M3WA 4BR7A 4FCYA 1QVGM 3OHRA 5CR4A 2KZMA 2OTLN 4C8KA 2O8CA 3G25A 3HM8A 4FPAA 4JV5K 3P4IA 5BPLA 4CFCA 1FK9A 5T7BA 4PUOA 3ASMA 1WSGA 1B9DA 3ZETA 1NGGA 4H5VA 1J5EK 4LF9K 3OBYA 4WFNL 1E4GT 3IG1A 4JD2A 4O8KA 3FE1A 3DXKA 4CE9A 4F3OA 4OPJA 4KKOA 4AM6A 3RWUA 4FM2A 1KRPA 3TAMA 4CF0A 4DSIA 1WN7A 3T1AA 3EL2A 4M3XA 3AA3A 3DOKA 4DLGA 4E0DA 2E2QA 4CHOA 4JK8A 4EZ6A 4BRIA 2CH5A 1BISA 4B1YB 4HHTA 4DTPA 3OYKA 1JXEA 2HMPA 1RT7A 2YX6A 3V9SA 3QIPA 4FWMA 3DRPA 5GADP 3FZMA 1TK8A 3KVGA 4BDZA 3F2KA 3F9KA 2VG5A 5GAGP 2VGMA 1XI1A 5ADXH 3QMLA 1DEJA 3M3ZA 4YOXA 5EY4A 4F9OA 1RDDA 2XY6A 1VSIA 3ZSXA 5FPEA 3CJ7A 4IOXA 3CG7A 1HUXA 4FVUA 2QWOA 5BREA 4FJ8A 3FLCO 3PSIA 3ZSYA 3AVLA 1J53A 2HBKA 1L3UA 5M1PA 4GV6A 2GELA 4PA1A 2BDPA 4CFAA 3NBPA 1YJWN 1LW2A 4BR5A 3CM5A 3CFRA 4A59A 3SBTA 5KI6A 3H6EA 5F1XA 4Z0UA 3U3GA 2O8EB 2RHKA 3MN7A 2NRXA 3MCAB 4EFHA 2DY4A 3E1YA 3L4IA 1BA0A 4KTWA 1EWRA 4BC5A 5CZ1A 2XRIA 4CZGA 4XH1A 3WXLA 1M1KO 4DU3A 1TKDA 5SZTA 1V4SA 2KHOA 3EN9A 3V1OA 4BVPA 4BREA 2VQEK 5MLCQ 2HHSA 3VF4A 1BIUA 3AVCA 1Q82O 1D9FA 4JI5K 3WQTA 4K0KK 4YDUC 2QWNA 2BTFA 1WBDA 2IC3A 3I55N 5J1EA 4DQPA 3VQ5A 3SBGA 1LWFA 1GLAG 4M3UA 2ZWHA 4DTOA 4JNEA 1SZ2A 3MEDA 3UKRA 4M42A 2RKIA 2QEXN 4KAZA 3QEVA 3VOVA 4B9QA 1BHLA 3QLHA 1IO2A 4OGCA 3DXMA 3I0RA 4EIAA 4PKHA 2E20A 2P5OA 3Q7CA 1U2VB 4FWNA 3VQDA 2P51A 4CJ5A 1NGHA 1S22A 1S72N 1HYVA 4Y1CA 4WQ4C 4C23A 1ZBUA 3KTQA 3HM9A 1XNQK 1RT5A 3DLLL 3THWB 3LDQA 1M90O 1ZXOA 5DMRA 1T3VA 1GLEG 3KLGA 3NH2A 4OO1J 3P5JA 3V1RA 4CHPA 3CM6A 5BRFA 3RMCA 2PAVA 2G8KA 3O3HA 3QBWA 2HVHA 4R79A 3SV3A 4Z4FA 4AF1A 1HJOA 1L3TA 1VQKN 1RCHA 4A2AA 1WAJA 4H4OA 1VQ9N 3E01A 1HNZK 5F0XA 1HQUA 1KTQA 1QSLA 4FJHA 2DFHA 3IKMA 3FGUA 2UUBK 1OH5A 1RBSA 3WXMB 3KK3A 2ZGYA 2NRHA 4JS5A 3IUCA 3VN5A 5CYQA 3NMUA 5KPTA 3WXKA 5C0YA 5B8HA 2Z1HA 5H1SQ 3CQ8A 4YNQA 3EE9A 3PIPL 3HPGA 4CJEA 4EP4A 4KBOA 5AQYA 2PBDA 3VGMA 3LDSA 3KLIA 4BGBA 3RRHA 3HBTA 3LDOA 3JSMA 4ISFA 1XC3A 2GUPA 5HLFA 3D6RA 2P5GA 4WFBL 4JKEA 3O3FA 5GINA 3SQ1A 3DWLA 4C8OA 2OANA 3VQ4A 2HHTA 2Q2RA 1U49A 4MFBA 3BDPA 1VSFA 3TARA 4A61A 5JLHA 3D2EB 3LPUA 4LH5A 5K14A 2OZMA 2JGUA 3KLHA 5GIPA 3D7EO 1GLJO 3M5RA 4JI4K 4NYNA 4DSKA 1VRUA 1UOCA 4EHTA 3PO5A 3LDNA 4FWOA 4BC3A 1O13A 4C1NI 1BO5O 2FF3B 2Q97A 3QEIA 4WQ5C 2EX3A 4O44A 1W7AA 4E7HA 1E3MA 1S6PA 2VG7A 5HL7L 3CCUN 3TU5A 2A42A 2A6AA 1NK6A 1C0UA 4FJXA 3NF7A 3H1QA 2HMIA 2E2NA 2NUBA 1K8KB 3NGIA 2ZJRL 2KFNA 1ZBFA 3ULEB 4CJFA 1Z26A 1WAFA 3SNNA 3QEPA 3BZCA 3HP9A 4AILC 5BN8A 3WXIA 3KJVA 2GWKA 4E3SA 1NMDA 3VMFB 3U3YA 2F7TA 3OBWA 4FOIA 3MCPA 3SJJA 3PIOL 2QA4N 1IKYA 3CIPA 2Z1JA 2A3ZA 3KD5E 1U47A 4DQIA 4IG0A 3FR0A 1J5OA 4CZIA 3AVJA 5M1FA 4IO8A 1YF5L 5CHIA 5TKYA 5GAEP 4LF7K 4BRFA 2V7ZA 1JLFA 4J8FA 5AQTA 3HK2A 3AVBA 1BCOA 4ZTJA 4H8KA 2JWLA 4LD0A 3TAEA 1ATSA 5FPNA 5JMVA 4H0TB 1S5JA 3U4LA 4FW1A 3P39A 4AHVA 4ID5A 1I94K 4DR2K 4Z4EA 2O8EA 3ZSZA 4FJKA 4CZFA 1BDGA 2EWSA 2OA8A 5AQRA 4IEEA 5HRSA 2A41A 1TYQB 3NAEA 3F9MA 5TKWA 5DK5A 1TKXA 4ICLA 3R6MA 1NGEA 5AQMA 3JXUA 3CD6N 3L2WA 1EWQA 4M45A 4FJ5A 4M7XA 3CCRN 2G8FA 3LPTA 4KHSA 1KLMA 1NKCA 1VQ6N 5BR8K 3SQ4A 3HOSA 1OVYA 1RFQA 1V4TA 4C8MA 4FJ7A 1R0AA 3O08A 3K59A 1FXXA 4PQUA 4DU1A 4H4MA 2QKBA 3L3VA 4NLBA 3LDPA 1S3XA 3J80O 3OS2A 4YDUA 3RR7A 1JCEA 4LH4A 4HWIA 3HSCA 2O8FB 1XMOK 3ATVA 3U9ZA 1U2VA 2UXBK 2OTJN 3L0QA 1KVAA 4JS4A 3M8SA 3I8DA 4FLUA 4PWDA 3I56N 5I3UA 3HZ6A 1MWKA 5F2RA 4CF1A 3THWA 1NJZA 2Q36A 1KFDA 3SYZA 1UA1A 5CE3A 4UY8O 3H08A 4MDAA 3R1XA 4AM7A 1WLJA 1K73O 1C1BA 5IT9O 4GMJB 4QAGA 3SLCA 4BG8A 4MQ3A 3AARA 2E1ZA 1X3MA 3ZCMA 4PKIA 3CQYA 3P38A 1BGXT 5LMNK 3SQ2A 3V9XA 4B9MA 3TTCA 4E7JA 4GV9A 2G8IA 1C0FA 1NGFA 4U67L 3K57A 4ELVA 4B9SA 2FF6A 1NJIO 1IG9A 1D4XA 1OKJA 3NF8A 4Z4GA 2HW3A 1QZ5A 1HKGA 1VQ8N 5HROA 1RT1A 3V9WA 1GLLO 3LL3A 1IJJA 4JI1K 1IBMK 4H5NA 1Q8IA 3HP6A 3W3DA 3MMVA 1HNWK 1ZC6A
chains in the Genus database with same CATH topology
5AQHA 4BRNA 2E2QA 3A5OC 5EX5A 1JCFA 4B1UB 3ID6A 4JK8A 5AQIA 3TSQA 4BRIA 2CH5A 3RSEB 3VENA 3QFPA 4B1YB 3MN6A 3T69A 2YJFA 3CMEN 2HMPA 3DJCA 2QW9A 2W40A 3QDKA 2CGJA 2YX6A 3A5NC 4BVOA 3WEEA 4FWMA 5C2FA 5GADP 3FZMA 3K9KA 5AQXA 5AFUH 3MWPA 3CERA 4JHDB 3IDHA 4JKBA 1GLFO 3KVGA 2Q0RA 1LOTB 3QB0A 3F2KA 3ID8A 5GAGP 4BRGA 2VGMA 5BR9A 2I7PA 1JCGA 4E1JA 5ADXH 3QMLA 4K41A 4PL8A 3W0LA 1DEJA 2QTDA 5DM6L 3M3ZA 4YOXA 5FPDA 5JLFA 2W41A 1NGCA 5EY4A 3SAGA 3D2EA 5AQWA 4IJAA 4F9OA 1VQNN 2P9PB 3HTVA 1BA1A 5FPEA 3EKUA 5GAHP 1YUWA 3CJ7A 4IOXA 1ILYA 2ZJQL 4FVUA 1HUXA 5ELZA 2QWOA 3O9UA 2QWQA 5BREA 3FLCO 1VQON 5BRHA 3A5LC 1TUUA 3AGRA 4EHUA 3CCJN 1Q81O 1J6ZA 3O9QA 3TPQA 5AQKA 3BF1A 5HL7L 2HBKA 3AGKA 4O8UA 1C0GA 1YXQA 5M1PA 4GV6A 3VEYA 2GELA 3C6HA 4Y0WA 2H3GX 4JKHA 1MDUB 1BWFO 2D1KA 1YJWN 1K8AO 1DGKN 4BRMA 4BR5A 4MDBA 5AZIB 3CF5L 3UKUA 4A59A 5AQLA 3SBTA 3CJAA 3H6EA 5F1XA 5AR0A 4JK7A 4Z94A 4BGAA 1ESVA 4A62A 1NLVA 2WC9A 1K8KA 3ENBA 2RHKA 3MN7A 2NRXA 2UYTA 3MCAB 3ULEA 3IMXA 4FO0A 4EFHA 3T7ZA 3E1YA 3L4IA 4GVEA 3GL1A 3ZEUB 4A5BA 1BA0A 4BRQA 4BC5A 1KAZA 4IZ9A 1YI2N 4CBWA 4MO4A 1WOQA 4O5FA 4FWLA 2WFBA 4H5WA 4CZGA 1Q18A 4IXCA 1VQLN 2V7YA 4IO9L 4XH1A 3SMPA 3WXLA 1M1KO 1NBWA 2QWMA 1V4SA 2KHOA 3EN9A 2YI1A 4BVPA 3OA9A 2QWLA 4BREA 5MLCQ 1QHAA 3VERA 3VF4A 2HBMA 1Q82O 1QVFM 3KK7A 5AQOA 3WQTA 3O9RA 4YDUC 2FXUA 2QWNA 2BTFA 4B1WB 3CC7N 5BRDA 1BOTO 3RVCA 3I55N 2QI2A 1QQNA 3SBGA 5AQNA 1GLAG 4H0OA 3TTFA 4YOVA 4BROA 1T6DA 2P9UA 2ZWHA 4WQ4A 3QFUA 4JNEA 4B1ZA 5KQDA 1SZ2A 5LJVA 1YJ9N 3UKRA 2QEXN 3MN5A 2DPNA 2P9LB 2VGNA 1Y64A 4K43A 5E84A 3VOVA 3C6AA 3FZHA 3O4WA 4B9QA 3C7NB 5AFUA 4H0PA 3JS6A 4DCHA 2HSTA 3DXMA 4QS8A 5AQPA 4EIAA 4K25A 3SK3A 2IVNA 3VGLA 3NVMA 3B8AX 2E20A 4PKHA 3Q7CA 5ADXA 3LM2A 4KH4A 1U2VB 4FWNA 1NGHA 5BPMA 1S22A 1RGIA 1S72N 1KQSM 4KH6A 1TYQA 2ASMA 4KH5A 4BRAA 1YIJN 4WQ4C 4QS9A 3A0IX 3VESA 4BY9C 3R8EA 4C23A 3VEZA 3BUZB 4IDHA 2HOEA 5KPZA 1QQOA 2NRZA 3O5BA 5C15A 4WF9L 4JKGB 4ILJA 3DLLL 2P9NB 2A40A 3D2FB 1ZXOA 3LDQA 1T3VA 3ZX3A 1GLEG 5I9EB 1M90O 4OPAA 4OO1J 4YOWA 2P9IA 4OPHA 3O1BA 5BRFA 2PAVA 5HOOA 3CCVN 4FSVA 1P90A 3QBWA 2D0OA 3E9LA 2FSNA 2QWRA 3MWTA 4R79A 4AF1A 1HJOA 4FWPA 4WYBA 2D4WA 3HOTA 3AY9A 1VQKN 4A2AA 1VQ9N 3ZETB 2P9SB 5F0XA 3WUHA 3PLAA 1YJNN 3S41A 3MX2A 2ZF5O 5AQQA 1X9JA 4JD2B 3IKMA 1Q86O 4PHTX 4H0XB 4LC9B 3DXKB 4JK9A 4BQLA 2A5XA 3FGUA 3BF3A 3QBXA 4GV3A 1DKGD 3WXMB 4I6MA 4BRDA 1U6ZA 3VEOA 2ZGYA 2NRHA 3GDQA 4FPBA 1KXPA 2IVOA 4MO5A 3IUCA 3CQXA 2NRWA 2NRTA 3C65A 1VQPN 3G4SN 3VEVA 3NMUA 2I7NA 5KPTA 3WT0A 2F9WA 3WXKA 5C0YA 2Q1NA 3O80A 2YHXA 5B8HA 1W97L 1HX1A 3ZX0A 5H1SQ 3DAWA 3HI0A 1GLBG 3EE9A 3PIPL 5EOYA 2BH1A 3GOIA 3OW2M 3BP8A 4KBOA 2Q31A 3Q7BA 5AQVA 5AQYA 2PBDA 1XQSC 3VGMA 2P9KA 5LY3A 5DM7L 4ILGB 4IEIA 4IFEA 5AZJA 1YAGA 5AQJA 2FLOA 3ZYYX 4FWKA 4BGBA 1KD1O 1KAYA 5FPMA 3UB5A 2FSKA 3W3DA 3FZKA 3HBTA 3LDOA 3WEEB 4ISFA 4QS7A 1XC3A 1YVNA 2GUPA 2IIRA 3D6RA 3A5MC 4U7BA 3H1VX 4WFBL 1NGJA 4JKEA 4B1XB 4JKFA 5GINA 4JKDA 4MLEA 3DWLA 4WQ5A 3VTHA 4CBXA 3NVKA 2OANA 3GG4A 4ISEA 3CCSN 3KWIA 2Q2RA 4XH4A 3WXJA 3CMAN 4EAHD 3HRGA 3P31A 4NLCA 4XH5A 5AQFA 4A61A 2AP1A 5JLHA 3D2EB 3MN9A 1Z6RA 4A57A 1T6CA 5GIPA 1NGBA 3D7EO 1GLJO 3EE8A 3M5RA 3VEXA 3VGKA 3UE5A 2KKZA 3CHWA 4YOTA 3U8XA 3ENHA 4CZMA 2Q0UA 1X3NA 2VWBA 4IOCL 1Z05A 4EHTA 3FZFA 3LDNA 5GIOA 4FWOA 5JVGL 4PKGA 1YHQN 2ITMA 1R59O 4BC3A 4BRKA 1O13A 3L4QA 4C1NI 3CC4N 4RCHA 1BO5O 2FF3B 3GBTA 5JVHL 2Q97A 3AAPA 4BR2A 3G71N 1RDWX 4WQ5C 1WUAA 3SJHA 1VQ4N 2QWPA 4FWQA 3CPEA 1CZAN 4JEPA 2HF3A 3O8MA 3C0BA 4BRHA 3UKUB 4CZKA 3TU5A 2A42A 2A6AA 5C12A 4FL9A 3CCUN 4RWTA 1SS6A 4CD3A 1YITN 2CGKA 3KWGA 3RSEA 1G99A 2D0PA 3H1QA 3F5TA 5C2DA 3VTIA 5LJWA 2E2NA 1IG8A 1K8KB 2ZJRL 3CCEN 4H03B 2QXLA 3L6QA 3ULEB 4IOAL 3VF6A 3MDQA 3VEWA 4JHDA 4BRCA 2CH6A 5BN8A 3WXIA 3K9JA 3TSPA 3H3OB 4FOEA 1NGAA 2GWKA 3N4QA 3E9OA 1NMDA 1LCUA 3KZBA 3VMFB 5KQ8A 3CC2N 1JJ2M 2F7TA 3OBWA 2YHWA 4FOIA 3MCPA 4JKCA 4M63C 3PIOL 2QA4N 2GTDA 2NNWA 2YJEA 1HKCA 3CIPA 4JN4A 4M7YA 2E1YA 2P9PA 2A3ZA 2E88A 3MK6A 1P8ZA 2VYPA 3FR0A 2NLXA 5M1QA 2WUSA 4CZIA 1VQ7N 3TTDA 1EQYA 3R3LA 5M1FA 1N8RO 4IO8A 1HPMA 1YF5L 2BUPA 3E9PA 4DHYA 5CHIA 1VQMN 3CPWM 5TKYA 1SAZA 2QM1A 2P9UB 3CJCA 5GAEP 5BPNA 4BRFA 2NZTA 2V7ZA 4GNIA 4J8FA 4FWRA 5AQTA 3M6GA 2ASPA 3UKRB 2JWLA 4GY2B 1ATSA 5FPNA 5JMVA 4H0TB 3SMSA 4RTFD 1ATNA 2IVPA 3U4LA 5AZIA 2F9TA 3P39A 3E66A 5JICA 2VCPA 3DXMB 3FFKB 3KHYA 4IJNA 4H5TA 4CZLA 4CZEA 4B1VA 4CZFA 4CI6A 4CBUA 2YCHA 5M1NA 2WBNA 1BDGA 2EWSA 5AQRA 2CGLA 3ZEUA 4IEEA 4NO7A 1DT9A 2HBLA 4ILHA 2A41A 1TYQB 1HLUA 3F9MA 5M1OA 5TKWA 3O1WA 3AAQA 1BG3A 3LDLA 3R6MA 1NGEA 3R9PA 5AQZA 5AQMA 3JXUA 3CD6N 4G9ZA 1KC8O 4YORA 1VAZA 3H3NO 3H46O 2ZGZA 3O9SA 4M7XA 3CCRN 3H45C 4A2BA 1ZBSA 2ZJPL 1VQ6N 1KAXA 2ASOA 2P9IB 4XEIA 2NRVA 4YOUA 3VF2A 3WQUA 3HOSA 1EO1A 1OVYA 2GX9A 4H5RA 3M1FA 1RFQA 1V4TA 3VETA 2E2OA 3J8AA 3O08A 3O9TA 3U9DA 1BUPA 3I8BA 4JAXA 1MWMA 3TSUA 4BG9A 4HTLA 5M1KA 3CCMN 4NLBA 4PL7A 2FSJA 1SQKA 3LDPA 1W2BM 4IWVA 4A5AA 2GEMA 2RE2A 2P9LA 1S3XA 1NGDA 4BRPA 1T44A 3C7NA 3MX5A 4C1NK 4YDUA 3CCQN 2AA4A 1JCEA 2HF4A 3CETA 4HWIA 1QZ6A 3HSCA 4I6MB 3LM9A 4H0VB 3O6WA 4BR4A 4JKAA 3ATVA 5AQUA 4CZHA 3U9ZA 1U2VA 1Q7YO 2OTJN 3L0QA 2J4RA 3EO3A 1MA9B 3BEXA 2GWJA 3EZWA 1GLDG 1VQ5N 3I56N 4CZJA 4BQZA 3SAHA 2V51B 3CJ9A 3HZ6A 3IFRA 3CJ1A 4BC2A 4BRLA 2E8AA 1K9MO 5AQSA 2PFUA 1GLCG 1MWKA 4DQ8A 2JWKA 5F2RA 4L3QA 4JKGA 3FZLA 4BR9A 2P9NA 2Q36A 3D2FA 2P9KB 5C10A 1QQMA 1ATRA 4UY8O 5CE3A 4BR0A 3CI5A 1XUPO 5AZJB 1H1VA 3VPZA 4DB3A 2E2PA 3CXCM 2V52B 3R1XA 4MDAA 4AM7A 5E26A 3SAFA 4BR7A 1QVGM 4MLHA 5KPRA 1K73O 3OHRA 5CR4A 1HKBA 2OTLN 3SLCA 3G25A 4BG8A 3HM8A 3AARA 2E1ZA 4FPAA 1NM1A 1X3MA 3I33A 3P4IA 5AQGA 4K42A 1BU6O 4PKIA 5BPLA 3J7ZO 3CQYA 3P38A 4WCEL 3TTCA 4CJ7A 4NB4A 4WFAL 4GV9A 3ZETA 1NGGA 2P9SA 1C0FA 1NGFA 4H5VA 4U67L 3G6EN 3OBYA 2NRRA 5EXWA 4WFNL 4YOYA 1E4GT 2FF6A 1NJIO 1D4XA 1OKJA 3ZX2A 4JD2A 4FWSA 1QZ5A 1HKGA 1NWKA 4O8KA 3FE1A 1E4FT 3ATUA 1VQ8N 3DXKA 4BC4A 5BN9A 2KLAA 3A8YA 1GLLO 3LL3A 1IJJA 2HBJA 4H5NA 3CJBA 4AM6A 1RDUA 3CCLN 3ENOA 3EKSA 3N4PA 3QICA 5EVZA 4DKWA 4H0YB 2YHYA 4CD1A 4ISGA 3MMVA 3EL2A 1ZC6A 1TUYA 3GE1A 1NGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQH A;  4BRN A;  2E2Q A;  3A5O C;  5EX5 A;  1JCF A;  4B1U B;  5AQI A;  4BRI A;  2CH5 A;  3RSE B;  3VEN A;  3QFP A;  4B1Y B;  3MN6 A;  2YJF A;  2HMP A;  3DJC A;  2QW9 A;  2W40 A;  3QDK A;  2CGJ A;  3A5N C;  4BVO A;  3WEE A;  4FWM A;  3FZM A;  5AQX A;  5AFU H;  3CER A;  4JHD B;  3IDH A;  1GLF O;  3KVG A;  2Q0R A;  1LOT B;  3QB0 A;  3ID8 A;  4BRG A;  5BR9 A;  2I7P A;  1JCG A;  4E1J A;  5ADX H;  3QML A;  4K41 A;  4PL8 A;  3W0L A;  1DEJ A;  3M3Z A;  5FPD A;  5JLF A;  2W41 A;  1NGC A;  5EY4 A;  3D2E A;  5AQW A;  4IJA A;  4F9O A;  2P9P B;  3HTV A;  1BA1 A;  5FPE A;  3EKU A;  1YUW A;  3CJ7 A;  1HUX A;  5ELZ A;  2QWO A;  5BRE A;  2QWQ A;  3FLC O;  5BRH A;  3A5L C;  1TUU A;  4EHU A;  1J6Z A;  3TPQ A;  5AQK A;  3BF1 A;  1C0G A;  1YXQ A;  3VEY A;  2GEL A;  4Y0W A;  2H3G X;  1MDU B;  1BWF O;  2D1K A;  1DGK N;  4BRM A;  4BR5 A;  5AZI B;  3UKU A;  5AQL A;  3CJA A;  3H6E A;  5F1X A;  5AR0 A;  4Z94 A;  4BGA A;  1ESV A;  4A62 A;  1NLV A;  1K8K A;  3MN7 A;  2UYT A;  3ULE A;  3IMX A;  4FO0 A;  4EFH A;  3L4I A;  3GL1 A;  3ZEU B;  1BA0 A;  4BRQ A;  4BC5 A;  1KAZ A;  4IZ9 A;  4CBW A;  4MO4 A;  1WOQ A;  4O5F A;  4FWL A;  4H5W A;  4CZG A;  1Q18 A;  4IXC A;  2V7Y A;  4XH1 A;  3SMP A;  3WXL A;  1NBW A;  2QWM A;  1V4S A;  2KHO A;  3EN9 A;  2YI1 A;  4BVP A;  4BRE A;  2QWL A;  1QHA A;  3VER A;  3VF4 A;  5AQO A;  3WQT A;  4YDU C;  2FXU A;  2QWN A;  2BTF A;  4B1W B;  5BRD A;  1BOT O;  1QQN A;  5AQN A;  1GLA G;  4H0O A;  4BRO A;  1T6D A;  2P9U A;  2ZWH A;  4WQ4 A;  3QFU A;  4JNE A;  4B1Z A;  5KQD A;  1SZ2 A;  5LJV A;  3UKR A;  3MN5 A;  2DPN A;  2P9L B;  3VOV A;  1Y64 A;  4K43 A;  5E84 A;  4B9Q A;  3FZH A;  3O4W A;  5AFU A;  3C7N B;  4H0P A;  3JS6 A;  4DCH A;  3DXM A;  4QS8 A;  5AQP A;  4EIA A;  4K25 A;  3SK3 A;  2IVN A;  3VGL A;  4PKH A;  3B8A X;  2E20 A;  5ADX A;  3LM2 A;  1U2V B;  4FWN A;  1NGH A;  5BPM A;  1S22 A;  1RGI A;  1TYQ A;  2ASM A;  4BRA A;  4WQ4 C;  4QS9 A;  3A0I X;  3VES A;  3R8E A;  4C23 A;  3VEZ A;  3BUZ B;  2HOE A;  5KPZ A;  1QQO A;  3O5B A;  2P9N B;  2A40 A;  3D2F B;  1ZXO A;  3LDQ A;  3ZX3 A;  5I9E B;  1GLE G;  2P9I A;  3O1B A;  5BRF A;  2PAV A;  4FSV A;  3QBW A;  2D0O A;  2FSN A;  2QWR A;  1HJO A;  4FWP A;  4WYB A;  2D4W A;  3AY9 A;  4A2A A;  3ZET B;  2P9S B;  5F0X A;  3WUH A;  3S41 A;  2ZF5 O;  5AQQ A;  1X9J A;  4JD2 B;  4H0X B;  4LC9 B;  3DXK B;  4BQL A;  2A5X A;  3FGU A;  3BF3 A;  3QBX A;  1DKG D;  4BRD A;  4I6M A;  1U6Z A;  3VEO A;  2ZGY A;  2NRH A;  3GDQ A;  4FPB A;  1KXP A;  2IVO A;  4MO5 A;  3IUC A;  3CQX A;  3VEV A;  2I7N A;  5KPT A;  3WT0 A;  2F9W A;  3WXK A;  2Q1N A;  3O80 A;  2YHX A;  5B8H A;  1HX1 A;  3ZX0 A;  3DAW A;  3HI0 A;  1GLB G;  5EOY A;  3GOI A;  3BP8 A;  4KBO A;  2Q31 A;  5AQV A;  5AQY A;  2PBD A;  1XQS C;  3VGM A;  2P9K A;  5LY3 A;  5AZJ A;  1YAG A;  5AQJ A;  2FLO A;  4FWK A;  4BGB A;  1KAY A;  5FPM A;  3UB5 A;  2FSK A;  3W3D A;  3FZK A;  3HBT A;  3LDO A;  3WEE B;  4ISF A;  4QS7 A;  1XC3 A;  1YVN A;  2GUP A;  2IIR A;  3A5M C;  3H1V X;  1NGJ A;  4B1X B;  4MLE A;  3DWL A;  4WQ5 A;  4CBX A;  2OAN A;  3GG4 A;  4ISE A;  2Q2R A;  4XH4 A;  3WXJ A;  4EAH D;  5AQF A;  4XH5 A;  4A61 A;  2AP1 A;  5JLH A;  3D2E B;  3MN9 A;  1Z6R A;  1T6C A;  1NGB A;  3D7E O;  1GLJ O;  3VGK A;  3VEX A;  3UE5 A;  3CHW A;  3U8X A;  3ENH A;  4CZM A;  2Q0U A;  1X3N A;  2VWB A;  1Z05 A;  4EHT A;  3FZF A;  3LDN A;  4FWO A;  4PKG A;  2ITM A;  1R59 O;  4BC3 A;  4BRK A;  4RCH A;  1BO5 O;  2FF3 B;  3GBT A;  2Q97 A;  3AAP A;  4BR2 A;  1RDW X;  4WQ5 C;  1WUA A;  3SJH A;  2QWP A;  4FWQ A;  1CZA N;  2HF3 A;  3O8M A;  3C0B A;  4BRH A;  3UKU B;  4CZK A;  3TU5 A;  2A42 A;  2A6A A;  4FL9 A;  4RWT A;  4CD3 A;  2CGK A;  3RSE A;  1G99 A;  2D0P A;  3H1Q A;  5LJW A;  2E2N A;  1IG8 A;  1K8K B;  4H03 B;  2QXL A;  3L6Q A;  3ULE B;  3VF6 A;  3MDQ A;  3VEW A;  4JHD A;  4BRC A;  2CH6 A;  5BN8 A;  3WXI A;  3H3O B;  4FOE A;  1NGA A;  2GWK A;  1NMD A;  1LCU A;  3KZB A;  5KQ8 A;  2YHW A;  4FOI A;  3MCP A;  4M63 C;  2GTD A;  2YJE A;  1HKC A;  3CIP A;  4JN4 A;  4M7Y A;  2E1Y A;  2P9P A;  2A3Z A;  2E88 A;  3MK6 A;  1P8Z A;  2VYP A;  3FR0 A;  2NLX A;  2WUS A;  4CZI A;  1EQY A;  4IO8 A;  1HPM A;  2BUP A;  4DHY A;  5TKY A;  1SAZ A;  2QM1 A;  2P9U B;  3CJC A;  5BPN A;  4BRF A;  2NZT A;  2V7Z A;  4GNI A;  4J8F A;  4FWR A;  5AQT A;  3M6G A;  2ASP A;  3UKR B;  4GY2 B;  1ATS A;  5FPN A;  5JMV A;  4H0T B;  3SMS A;  4RTF D;  1ATN A;  2IVP A;  3U4L A;  5AZI A;  2F9T A;  5JIC A;  2VCP A;  3DXM B;  3FFK B;  3KHY A;  4IJN A;  4H5T A;  4CZL A;  4CZE A;  4B1V A;  4CZF A;  4CI6 A;  4CBU A;  2YCH A;  1BDG A;  2EWS A;  5AQR A;  2CGL A;  3ZEU A;  4NO7 A;  2A41 A;  1TYQ B;  1HLU A;  3F9M A;  3O1W A;  3AAQ A;  1BG3 A;  3LDL A;  3R6M A;  1NGE A;  3R9P A;  5AQZ A;  5AQM A;  3JXU A;  3H3N O;  3H46 O;  2ZGZ A;  4M7X A;  3H45 C;  4A2B A;  1ZBS A;  1KAX A;  2ASO A;  2P9I B;  4XEI A;  3VF2 A;  3WQU A;  4H5R A;  3M1F A;  1RFQ A;  1V4T A;  3VET A;  2E2O A;  3J8A A;  3O08 A;  3U9D A;  1BUP A;  3I8B A;  4JAX A;  1MWM A;  4BG9 A;  4HTL A;  4PL7 A;  2FSJ A;  1SQK A;  3LDP A;  4IWV A;  2GEM A;  2P9L A;  1S3X A;  1NGD A;  4BRP A;  1T44 A;  3C7N A;  4YDU A;  2AA4 A;  1JCE A;  2HF4 A;  3CET A;  4HWI A;  1QZ6 A;  3HSC A;  4I6M B;  3LM9 A;  4H0V B;  3O6W A;  4BR4 A;  3ATV A;  5AQU A;  4CZH A;  3U9Z A;  1U2V A;  3L0Q A;  2J4R A;  3EO3 A;  1MA9 B;  3BEX A;  2GWJ A;  3EZW A;  1GLD G;  4CZJ A;  4BQZ A;  2V51 B;  3CJ9 A;  3HZ6 A;  3IFR A;  3CJ1 A;  4BC2 A;  4BRL A;  2E8A A;  5AQS A;  1GLC G;  1MWK A;  4DQ8 A;  5F2R A;  4L3Q A;  3FZL A;  4BR9 A;  2P9N A;  2Q36 A;  3D2F A;  2P9K B;  1QQM A;  1ATR A;  5CE3 A;  4BR0 A;  3CI5 A;  1XUP O;  5AZJ B;  1H1V A;  3VPZ A;  4DB3 A;  2E2P A;  2V52 B;  4AM7 A;  5E26 A;  4BR7 A;  4MLH A;  5KPR A;  3OHR A;  1HKB A;  3SLC A;  3G25 A;  4BG8 A;  3HM8 A;  3AAR A;  2E1Z A;  4FPA A;  1NM1 A;  1X3M A;  3I33 A;  3P4I A;  5AQG A;  4K42 A;  1BU6 O;  4PKI A;  5BPL A;  3CQY A;  4CJ7 A;  4NB4 A;  3ZET A;  1NGG A;  2P9S A;  1C0F A;  1NGF A;  4H5V A;  5EXW A;  1E4G T;  2FF6 A;  1D4X A;  1OKJ A;  3ZX2 A;  4JD2 A;  4FWS A;  1QZ5 A;  1HKG A;  1NWK A;  4O8K A;  3FE1 A;  1E4F T;  3ATU A;  3DXK A;  4BC4 A;  5BN9 A;  3A8Y A;  1GLL O;  3LL3 A;  1IJJ A;  4H5N A;  3CJB A;  4AM6 A;  3ENO A;  3EKS A;  3QIC A;  5EVZ A;  4H0Y B;  2YHY A;  4CD1 A;  4ISG A;  3MMV A;  3EL2 A;  1ZC6 A;  1TUY A;  3GE1 A;  1NGI A; 
#chains in the Genus database with same CATH topology
 5AQH A;  4AH9 A;  4CJL A;  5HP1 A;  1C6V A;  1U48 A;  3ID6 A;  3TSQ A;  5AQI A;  1EXQ A;  1HR0 K;  3VEN A;  4DTR A;  1HNI A;  2YV0 X;  3QFP A;  1NOZ A;  3MN6 A;  3T69 A;  3CME N;  3LWM A;  1VSK A;  2IS3 A;  2G8U A;  2QW9 A;  2W40 A;  2CGJ A;  4FK4 A;  4E7L A;  3K9K A;  3CFO A;  1GLF O;  4KI6 A;  3QB0 A;  4DF8 A;  4DMN A;  4BRG A;  1X9M A;  3VQQ A;  4PL8 A;  4BDP A;  5FPD A;  1NGC A;  2W41 A;  1N33 K;  3D2E A;  5AQW A;  3HJF A;  2P9P B;  3HTV A;  1RBT A;  5GAH P;  1IV0 A;  3RRG A;  2F96 A;  3KKS A;  1VQO N;  2Z1G A;  3AGR A;  5HRR A;  4EHU A;  3DLH A;  1SKR A;  1J6Z A;  3HYF A;  1NOY A;  5AQK A;  3BF1 A;  4O8U A;  1C0G A;  3TAQ A;  1ITG A;  3C6H A;  3K5L A;  2H3G X;  1MDU B;  2D1K A;  1DGK N;  3OYH A;  4MDB A;  3S3O A;  2OPP A;  4BDY A;  1ZBH A;  5AR0 A;  4Z94 A;  4BGA A;  4F4K A;  3SI6 A;  1NLV A;  1K8K A;  3ENB A;  2QK9 A;  3V6D A;  3ULE A;  4FO0 A;  3ZT0 A;  3GL1 A;  4BRQ A;  4IZ9 A;  3ALY A;  1BL3 A;  4BAC A;  4O5F A;  4FWL A;  1NBW A;  4CGI A;  3ZSV A;  2RN2 A;  4N5S A;  3C6U A;  4N56 A;  4E7K A;  1XNR K;  3OA9 A;  4G1Q A;  4QOZ B;  1RBU A;  1W0H A;  1IKW A;  1QVF M;  3KK7 A;  5E41 A;  1LV5 A;  1RT4 A;  1SUQ A;  4KHQ A;  2O8B B;  1IBK K;  1QQN A;  3BZK A;  5AQN A;  4DTX A;  3DLB A;  4BRO A;  1T6D A;  3QFU A;  2X6S A;  1YJ9 N;  4DSE A;  2B5J A;  2D0C A;  1C1C A;  3MN5 A;  1SKW A;  3J7Y P;  4HCC A;  2VGN A;  3C6A A;  3FZH A;  3O4W A;  5AFU A;  3C7N B;  4H0P A;  4DCH A;  1SL1 A;  4FJL A;  4CED A;  4K25 A;  3SK3 A;  3NVM A;  1S9E A;  1SV5 A;  4CIG A;  5FLX O;  4C8N A;  4QCL A;  1CXQ A;  5BPM A;  2JLE A;  1RGI A;  2D0A A;  1KQS M;  4KH6 A;  1TYQ A;  4BRA A;  3VES A;  3SPZ A;  1WSF A;  3VEZ A;  4I7F A;  1QQO A;  4WF9 L;  3OYL A;  4ILJ A;  2P9N B;  2DFE A;  3D2F B;  3KK1 A;  2OYQ A;  1L3V A;  4OPA A;  1GOA A;  3A2F A;  1VHX A;  4YOW A;  2Z1I A;  5HOO A;  3CCV N;  4B3T K;  5JS2 A;  3RR8 A;  2FSN A;  3MWT A;  2RF2 A;  4LY7 A;  4WYB A;  4CF9 A;  2A1S A;  2P9S B;  4DSF A;  4DR7 K;  3L2R A;  3WUH A;  3V9Z A;  4AHU A;  4DQR A;  4B3M K;  2ZF5 O;  3AO2 A;  1QQC A;  1Q86 O;  4LC9 B;  3ZSW A;  1IBL K;  3SV4 A;  4JK9 A;  4DFJ A;  4GV3 A;  3QBX A;  1DKG D;  1U6Z A;  3VEO A;  3GDQ A;  5KGX A;  2O8F A;  1KXP A;  2NRW A;  3C65 A;  1VQP N;  3IS9 A;  1DTT A;  2Q1N A;  5KGW A;  4RW6 A;  1HX1 A;  4DR1 K;  1RT6 A;  3SZ2 A;  3GOI A;  3OW2 M;  5J2M A;  4ELT A;  1ZBI A;  2Q31 A;  5LY3 A;  4DV7 K;  3L2Q A;  4DR3 K;  1QHT A;  5AQJ A;  3ZYY X;  4DSL A;  5FPM A;  3VQ7 A;  2FSK A;  3WEE B;  3B6P A;  1YVN A;  2IIR A;  1FW6 A;  2OPQ A;  4CJS A;  1X9W A;  4CBX A;  1S1T A;  4CJU A;  1YT3 A;  3WXJ A;  1EKE A;  4IBN A;  3CMA N;  5AQF A;  4XH5 A;  4CGD A;  3VQP A;  1T6C A;  3OYJ A;  4OJR A;  1NMN A;  3VGK A;  4CW7 B;  1Q9X A;  4E1N A;  4CZM A;  1X3N A;  4KHU A;  1Z05 A;  4CK3 A;  1R59 O;  3L4Q A;  3WNG A;  4RCH A;  2IDO A;  3G71 N;  2QWP A;  4RG8 A;  1CZA N;  4JEP A;  2HF3 A;  4ZHR A;  3BY5 A;  5IWA K;  2FBT A;  1SS6 A;  4CD3 A;  4DTS A;  2CGK A;  1G99 A;  3F5T A;  1S1V A;  4DTN A;  4IFV A;  4DS4 A;  4H03 B;  4IDK A;  4HUG A;  3VF6 A;  3OTO K;  4KHY A;  4AQY K;  1KVB A;  4NCG A;  5SWM A;  3K9J A;  3TSP A;  1NGA A;  3E9O A;  3QIN A;  3THX B;  2W6L A;  4DS5 A;  3K2P A;  3SPY A;  4W5O A;  3ZT3 A;  4YY3 K;  2NNW A;  1HMV A;  2YJE A;  3VQ8 A;  1Q9Y A;  4KRE A;  4JN4 A;  2P9P A;  2E88 A;  1VQ7 N;  3TTD A;  1D8Y A;  2YHB A;  1N8R O;  1JL2 A;  2BUP A;  4UQG A;  1VQM N;  3CPW M;  3SCX A;  2P9U B;  3CJC A;  3RMD A;  4X66 K;  1HRH A;  3F73 A;  1RT2 A;  2PZS A;  3M6G A;  4LF8 K;  3OYI A;  3SMS A;  2IVP A;  2UU9 K;  3QER A;  4TSX A;  2VCP A;  4I9L A;  3ITH A;  4H5T A;  1XHX A;  1NKE A;  1J9A A;  4OVL A;  3DLE A;  2YCH A;  5FRO A;  4CJT A;  3OYB A;  4FJ9 A;  2CGL A;  4NO7 A;  2YHA A;  3NCI A;  4ILH A;  1HLU A;  4KTQ A;  5M1O A;  1VSE A;  2RPI A;  3O1W A;  4KV8 A;  3R9P A;  5AQZ A;  4DTM A;  4YFU A;  3HPH A;  4YOR A;  4KO0 A;  3HT3 A;  3OYN A;  4OLA A;  3H46 O;  2ZGZ A;  1B9F A;  3H45 C;  4CK2 A;  3D0P A;  2ZJP L;  2NRV A;  4FLW A;  3VF2 A;  3SQ0 A;  2F8T A;  2O8B A;  3VET A;  1MU2 A;  3O9T A;  4EZ9 A;  4M3Y A;  1A5V A;  1DLO A;  1MWM A;  3C94 A;  1RDB A;  1XWL A;  4OGE A;  2E6L A;  4IWV A;  2O8D B;  2GEM A;  4N76 A;  4KB1 A;  5FRN A;  3THV A;  1T44 A;  3C7N A;  4C1N K;  1NJY A;  1QZ6 A;  2E4L A;  4I6M B;  4H0V B;  3O6W A;  5AQU A;  3V4I A;  4FK0 A;  3TI0 A;  1Q7Y O;  4B9V A;  2ETJ A;  1MA9 B;  4I2P A;  4K8Z A;  4CZJ A;  4BC2 A;  3EY1 A;  2E8A A;  4FM0 A;  3M8P A;  3SUP A;  1K9M O;  4OLB A;  2X6N A;  1WSH A;  2D5R A;  4DQ8 A;  3TAN A;  4F3T A;  2ZQB A;  4L3Q A;  2P9N A;  3D2F A;  2P9K B;  1TV6 A;  3LWL A;  3CI5 A;  1XUP O;  5AZJ B;  1X9S A;  3VPZ A;  1H1V A;  1LWE A;  3SUO A;  1YVU A;  4MLH A;  1RIL A;  1HKB A;  2FC0 A;  4CJK A;  1T05 A;  3AVG A;  2XY7 A;  4XIU A;  3O3G A;  3I33 A;  5AQG A;  3J7Z O;  1BU6 O;  2EHG A;  2B4J A;  4NB4 A;  4WFA L;  4DV0 K;  4DWI A;  3MXI A;  2P9S A;  1SL2 A;  1C1A A;  3ULD A;  4CCH A;  2NRR A;  5EXW A;  1TL1 A;  3ZX2 A;  1NWK A;  1TAQ A;  3D45 A;  2KLA A;  4KRF A;  3A8Y A;  5C25 A;  2AJQ A;  3CJB A;  1RDU A;  3VQ9 A;  5EVZ A;  1K6Y A;  4OX9 K;  1T03 A;  1HYZ A;  2OPS A;  2G8H A;  3GE1 A;  2KW4 A;  1UWB A;  3CFP A;  2ITG A;  3VQE A;  4O55 A;  3BGR A;  3AO4 A;  4W5Q A;  2YNH A;  3DJC A;  3QDK A;  3LZJ A;  4OKK A;  3WEE A;  2XY5 A;  3SUN A;  1VSM A;  5AQX A;  1BIZ A;  1TVR A;  5AFU H;  3OYC A;  5I42 A;  1KFS A;  2QKK A;  3O4Q A;  3AO5 A;  4JKB A;  5BR9 A;  1I39 A;  2GV9 A;  4E1J A;  3T3F A;  3M8Q A;  4K41 A;  3W0L A;  2QTD A;  1NKB A;  3LAK A;  4J2D A;  5JLF A;  3JYT A;  3SAG A;  1RTJ A;  2HHU A;  1BA1 A;  5ELZ A;  3AO1 A;  3AVA A;  5BRH A;  3DMJ A;  3CCJ N;  3NDK A;  3QIO A;  4CIE A;  4X62 K;  5HRN A;  4E89 A;  2E6M A;  1YXQ A;  3NGZ A;  1TAU A;  4DF4 A;  4FXD A;  1HNX K;  1LW0 A;  1RT3 A;  4Y0W A;  1BWF O;  4BRM A;  5AZI B;  3CF5 L;  5EU7 A;  5AQL A;  1C0M A;  3CJA A;  4YHH K;  1QTM A;  2UXC K;  1ESV A;  4FJG A;  3RTV A;  2WC9 A;  2OZS A;  2UYT A;  1D9D A;  3IMX A;  4IKF A;  4GVE A;  5KTQ A;  4A5B A;  2FBY A;  3DLK A;  3O4N A;  1YI2 N;  5JS1 A;  4MO4 A;  3QEW A;  2BAN A;  4H5W A;  1VQL N;  1OH7 A;  3SMP A;  3THX A;  1OVQ A;  2LSN A;  4IFY A;  2HHX A;  2VWJ A;  3VER A;  4GKJ K;  3ZT4 A;  2OCE A;  1LWC A;  3ZT1 A;  1BOT O;  4FM1 A;  3RVC A;  4ISG A;  2QI2 A;  3AVN A;  4H0O A;  2P9U A;  4WQ4 A;  1T7P A;  3S3N A;  5KQD A;  1CXU A;  5LJV A;  1HJR A;  4RW4 A;  4CGJ A;  3C95 A;  2B6A A;  2DPN A;  1Y64 A;  4K43 A;  3T19 A;  2VQF K;  3JS6 A;  4RW8 A;  1KVC A;  4QS8 A;  4DTU A;  3HVR A;  2W42 A;  1EP4 A;  2IVN A;  3MXJ A;  4V19 S;  3LM2 A;  4KH4 A;  3TAP A;  4FJI A;  3LP1 A;  3VQC A;  4FLY A;  4KHN A;  4QS9 A;  3T1H K;  3R8E A;  3BUZ B;  3HL8 A;  4IDH A;  3S3M A;  1TKZ A;  5KPZ A;  3O5B A;  5C15 A;  3ZLJ A;  3L8B A;  3ZX3 A;  5I9E B;  1QSY A;  1S9G A;  1NJW A;  5CZ2 A;  1W9H A;  4X64 K;  3L2U A;  4FSV A;  1BI4 B;  3AA5 X;  2YNF A;  2I5J A;  1HNV A;  5J2Q A;  1WSI A;  4N47 A;  2PY5 A;  3UIQ A;  3S41 A;  2VG6 A;  3MX2 A;  2O8D A;  1X9J A;  4BE2 A;  4H0X B;  3DRS A;  1L3S A;  2A5X A;  2KFZ A;  4JLH A;  3QET A;  4I6M A;  4LFB K;  4W5R A;  2IVO A;  4MO5 A;  4CHN A;  3CQX A;  4DUZ K;  2NRT A;  3G4S N;  2I7N A;  4CHY A;  2F9W A;  3O80 A;  1A5X A;  1W97 L;  3V1Q A;  3ZX0 A;  3VA3 A;  2WON A;  3HI0 A;  1B92 A;  2PYJ A;  3AV9 A;  4OKE A;  5A2Q O;  1HPZ A;  3Q7B A;  5AQV A;  5HRP A;  5DM7 L;  2P9K A;  1WB9 A;  4ILG B;  5AZJ A;  4KHP K;  1YAG A;  4FWK A;  1KD1 O;  1KAY A;  3HVT A;  3IRX A;  4KB0 A;  3UB5 A;  4FJJ A;  4O0I A;  1BQM A;  3OVN A;  1JLC A;  1NU0 A;  4ELU A;  4U7B A;  3OYM A;  1NNE A;  4KPY A;  4MLE A;  4WQ5 A;  3VTH A;  3NVK A;  3CCS N;  3KWI A;  2YKM A;  1FKO A;  4I9Q A;  1N32 K;  3PV8 A;  3HRG A;  4NLC A;  2Y1I A;  2AP1 A;  4CEQ A;  1A5W A;  1Z6R A;  3MN9 A;  4A57 A;  1NGB A;  2XO7 A;  3VEX A;  1XHZ A;  4DR5 K;  3UE5 A;  4YOT A;  4LSN A;  3U8X A;  1G15 A;  3ENH A;  2HHH K;  2VWB A;  3V81 A;  4DR4 K;  3FZF A;  3DM2 A;  5JVG L;  1YHQ N;  3PSF A;  4OKJ A;  2ITM A;  3G0Z A;  4ID1 A;  3G10 A;  1WUA A;  1RTD A;  3MAQ A;  3CPE A;  3C0B A;  3UKU B;  4CJ4 A;  4FL9 A;  4RWT A;  5C2D A;  5LJW A;  3VTI A;  4FLX A;  4DV1 K;  3CCE N;  4GKK K;  2W6K A;  3QNO A;  3MDQ A;  4FVM A;  5D3G A;  4CEA A;  3J7A P;  3L2V A;  2WTU A;  1GOC A;  1LAV A;  2CH6 A;  2Y1J A;  1WSJ A;  1S1X A;  4FOE A;  5LL6 Z;  3N4Q A;  1NJX A;  1FJG K;  1QS4 A;  4BWJ A;  3PY8 A;  1P8Z A;  2VYP A;  2NLX A;  2WUS A;  4CJW A;  3JAM O;  4BE1 A;  4CJQ A;  3E9P A;  1RNH A;  1YTU A;  3MEG A;  4CHQ A;  2QM1 A;  2NZT A;  4FWR A;  4NCB A;  4C8L A;  2FBV A;  3LP2 A;  5AZI A;  2F9T A;  3PO4 A;  4OPK A;  3FFK B;  3KHY A;  4IJN A;  1NK5 A;  2P1J A;  1WBB A;  4CZE A;  4CBU A;  2WBN A;  3HST B;  2ZD1 A;  4DTJ A;  4M3T A;  2HB5 A;  1BG3 A;  4DQS A;  5CYM A;  5J2P A;  4G9Z A;  4CHZ A;  4CES A;  4B8C A;  3O9S A;  2R7Y A;  4A2B A;  1VSL A;  2IOC A;  1ZBS A;  1JLQ A;  1KAX A;  3DYA A;  2P9I B;  3P1G A;  1S1U A;  4XEI A;  4YOU A;  4M41 A;  1EO1 A;  4H5R A;  3LP0 A;  3ZSQ A;  4JYA K;  3AVK A;  3J8A A;  1BUP A;  3OYG A;  3TAF A;  4JAX A;  3TSU A;  2KTQ A;  4HTL A;  3HXM A;  5M1K A;  1U04 A;  3CCM N;  2FSJ A;  1W2B M;  4A5A A;  4CGH A;  1NGD A;  1U4B A;  2AA4 A;  2HF4 A;  3CET A;  3NGY A;  2Q3S A;  4HCB A;  4B9L A;  3TR8 A;  3FFI A;  4B8A B;  4CZH A;  5HBM A;  4FYD A;  4E7I A;  2YNG A;  1NK0 A;  2GBZ A;  2J4R A;  3BEX A;  3WNF A;  3EZW A;  4WE1 A;  1GLD G;  1WNS A;  4DFP A;  1VQ5 N;  2XHB A;  4BWM A;  3CJ9 A;  2KQ2 A;  3IFR A;  4O4G A;  1JLE A;  2PFU A;  3C6T A;  3EYZ A;  3U6F A;  1O1W A;  3FZL A;  1BQN A;  5C10 A;  4NXN K;  2UUC K;  1NG9 A;  4W5N A;  2OPR A;  4RW7 A;  2V52 B;  4DQQ A;  5KPR A;  4FZX C;  1IKV A;  1RDA A;  2HNY A;  1F21 A;  3EEQ A;  4FJM A;  1BI4 A;  1NM1 A;  4K42 A;  1CLQ A;  1N36 K;  4WCE L;  4F8R A;  4CJ7 A;  4DR6 K;  3VQ6 A;  3OS0 A;  3ZSO A;  1VK0 A;  3G6E N;  3DOL A;  4YOY A;  1RTH A;  3KIO A;  1DTQ A;  4FWS A;  1E4F T;  3ATU A;  4BC4 A;  5BN9 A;  2HND A;  3WNH A;  2IAJ A;  3LP3 A;  2HBJ A;  1IH7 A;  4B3S K;  4NYF A;  3CYM A;  3CCL N;  3S9H A;  3ENO A;  3EKS A;  3N4P A;  3QIC A;  2HHQ A;  4DKW A;  4H0Y B;  2YHY A;  4FZY A;  4CD1 A;  4LF6 K;  4DUY K;  1TUY A;  1NGI A;  4BRN A;  1IKX A;  3A5O C;  3VQA A;  5EX5 A;  4FLZ A;  1JCF A;  3PUF A;  3B6O A;  4B1U B;  3RSE B;  1KCF A;  4Z4H A;  4CJ3 A;  4LF4 K;  4JI6 K;  2DTU A;  2YJF A;  4F2R A;  4CF2 A;  1JKH A;  3MXM A;  3A5N C;  4FZZ A;  4BVO A;  4PY5 A;  4E1M A;  5C2F A;  3MWP A;  3CER A;  3TWH A;  4JHD B;  3IDH A;  1X1P A;  1J54 A;  2Q0R A;  1LOT B;  1QE1 A;  3ID8 A;  1NK7 A;  1TK5 A;  5FRM A;  3AVF A;  3QO9 A;  2I7P A;  1JCG A;  4CFD A;  3QEX A;  3DI6 A;  5DM6 L;  4CK1 A;  2WOM A;  3AO3 A;  4CF8 A;  1TGO A;  4ZTF A;  1VQN N;  1JLG A;  4IJA A;  4FK2 A;  3LAM A;  2XY8 A;  3EKU A;  1YUW A;  1OH6 A;  3AVH A;  1ILY A;  3K5N A;  4GVM A;  2ZJQ L;  3O9U A;  2QWQ A;  2HNZ A;  1FKP A;  3K58 A;  3PX6 A;  3TAB A;  3A5L C;  1TUU A;  4J2B A;  4CGG A;  1Q81 O;  3O9Q A;  4DV3 K;  1C0T A;  4CGF A;  3TPQ A;  3L3U A;  3PX4 A;  4DG1 A;  3AGK A;  5FDL A;  5KRS A;  3VEY A;  4JKH A;  4X65 K;  1NK4 A;  3IAY A;  1K8A O;  1CZ9 A;  1YTA A;  4CEE A;  3AA2 A;  4R5P A;  3UKU A;  3LZI A;  4JK7 A;  4LFC K;  4JRQ A;  4A62 A;  3V9U A;  3K5O A;  4DV2 K;  4FLT A;  4Y1D A;  3T7Z A;  3ZEU B;  2X78 A;  1KAZ A;  1U45 A;  4BE0 A;  4CBW A;  4J2A A;  2HHV A;  1WOQ A;  2WFB A;  1HQE A;  1Q18 A;  4IXC A;  2V7Y A;  4IO9 L;  2HVI A;  1ASW A;  2QWM A;  1RDC A;  4KFB A;  4L8R B;  2YI1 A;  2QWL A;  3THY B;  1QHA A;  2HBM A;  4KI4 A;  5AQO A;  2A1R A;  3VA0 A;  3O9R A;  2FXU A;  4B1W B;  3CC7 N;  4B9N A;  3KD1 E;  5BRD A;  3TAG A;  2IGI A;  1LAW A;  3TTF A;  4YOV A;  1SL0 A;  4B1Z A;  2BGG A;  1KSP A;  4KTZ A;  3MEE A;  3EZ5 A;  2PYL A;  3KLF A;  1JLA A;  3OS1 A;  3ZT2 A;  2P9L B;  5E84 A;  1NK9 A;  4HVJ A;  2HST A;  4DFM A;  4EP5 A;  5AQP A;  3VGL A;  3B8A X;  3WNE A;  5ADX A;  1TL3 A;  4O0J A;  3OJU A;  2ASM A;  4KH5 A;  1YIJ N;  1REV A;  4BY9 C;  3A0I X;  4CEB A;  4CEO A;  5C24 A;  4CEZ A;  4HUE A;  2HOE A;  2NRZ A;  3J81 O;  4JKG B;  2A40 A;  5AJ3 K;  1Y97 A;  2F4V K;  1GOB A;  2G8V A;  2P9I A;  4B9U A;  1RBV A;  1OH8 A;  3KKR A;  4OPH A;  3O1B A;  2O4I A;  2O8C B;  1ZYQ A;  1P90 A;  2D0O A;  3E9L A;  2QWR A;  3KK2 A;  1JXB A;  4FWP A;  2QXF A;  2D4W A;  3HOT A;  4CER A;  3AY9 A;  1N6Q A;  4CFB A;  3LAL A;  3ZET B;  4HUF A;  4DV4 K;  3KLE A;  1KLN A;  3PLA A;  1YJN N;  4DV5 K;  4KHW A;  5AQQ A;  4JD2 B;  4PHT X;  5LMU K;  3NH1 A;  3DXK B;  4BQL A;  1VSH A;  4K8X A;  3BF3 A;  4JI0 K;  4AHT A;  4BRD A;  4CIF A;  4W5T A;  2FBX A;  4FPB A;  3VEV A;  3WT0 A;  2YHX A;  1RTI A;  4NXM K;  3DAW A;  1D5A A;  1GLB G;  4DFK A;  5EOY A;  1XMQ K;  2BH1 A;  3QNN A;  1S6Q A;  3BP8 A;  3AVI A;  2G8W A;  1TK0 A;  1XQS C;  2X74 A;  4IEI A;  4IFE A;  2ZM6 K;  4AHC A;  4FJN A;  2FLO A;  3NFA A;  1ASV A;  3PX0 A;  3FZK A;  4JI8 K;  4QS7 A;  4HTU A;  2UUA K;  3A5M C;  4FW2 A;  3H1V X;  1NGJ A;  4B1X B;  4JKF A;  4JKD A;  4DV6 K;  3GG4 A;  4ISE A;  4I2Q A;  5CY4 A;  3DLR A;  4XH4 A;  4EAH D;  1TKT A;  3P31 A;  4IG3 A;  3HPO A;  2O4G A;  3DLG A;  3EE8 A;  2KKZ A;  3CHW A;  3RMA A;  4B9T A;  3QES A;  2Q0U A;  4GW6 A;  4IOC L;  4JI7 K;  5KRT A;  5GIO A;  4PKG A;  3OYD A;  3OYA A;  4BRK A;  1N5Y A;  3CC4 N;  1RBR A;  1L5U A;  3GBT A;  5JVH L;  3AAP A;  4BR2 A;  1RDW X;  4JI3 K;  3SJH A;  1VQ4 N;  4FWQ A;  4M3Z A;  2GUI A;  3O8M A;  4BRH A;  5C12 A;  4CZK A;  2UXD K;  1YIT N;  4B08 A;  3RSE A;  3KWG A;  2D0P A;  3MEC A;  1IG8 A;  2VWK A;  3HO1 A;  2BE2 A;  2QXL A;  3L6Q A;  4IOA L;  1QSS A;  3NH0 A;  3VEW A;  1HYS A;  1BCM A;  4JHD A;  4BRC A;  2YNI A;  4JRP A;  2E5L K;  3H3O B;  4B3O A;  1EET A;  1LCU A;  5KQ8 A;  3KZB A;  3CC2 N;  4LSL A;  1JJ2 M;  1N34 K;  2YHW A;  3LAN A;  3NF6 A;  4M63 C;  4JKC A;  2GTD A;  1VSJ A;  1HKC A;  3ZSR A;  4M7Y A;  2E1Y A;  4CJV A;  3MK6 A;  1I3A A;  5M1Q A;  1EQY A;  3R3L A;  1HPM A;  1ASU A;  4DHY A;  2ATQ A;  4JI2 K;  4DU4 A;  1SAZ A;  5BPN A;  4GNI A;  4NCA A;  3M8R A;  2ASP A;  3UKR B;  4M3R A;  4E19 A;  4GY2 B;  4AHR A;  4RTF D;  1ATN A;  4CJP A;  4Z4C A;  2YKN A;  4CEC A;  3OYE A;  3DRR A;  3E66 A;  5JIC A;  3DXM B;  1S1W A;  1WSE A;  4Z4I A;  4CZL A;  3T1Y K;  3RMB A;  4DSJ A;  3AVM A;  3VQB A;  4B1V A;  4CI6 A;  5M1N A;  1VSD A;  4O5B A;  3OJS A;  1CZB A;  1EX4 A;  2DFF A;  3ZEU A;  1T8E A;  1DT9 A;  2HBL A;  4LFA K;  1SKS A;  1UAX A;  2D0B A;  3AAQ A;  3LDL A;  3AA4 A;  1JLB A;  1KC8 O;  1VAZ A;  3H3N O;  3THY A;  4CEF A;  2F8S A;  2HHW A;  1Z25 A;  2ASO A;  1VRT A;  3WQU A;  4B3R K;  2GX9 A;  4LF5 K;  3M1F A;  3K5M A;  2E2O A;  1XC9 A;  4Q5V A;  3U9D A;  3I8B A;  4F2S A;  4CJR A;  1NK8 A;  4J2E A;  4BG9 A;  4PL7 A;  1SQK A;  4DLE A;  3ISN C;  5C42 A;  2RE2 A;  2P9L A;  2ZE2 A;  4RW9 A;  4BRP A;  3MX5 A;  3CCQ N;  1UA0 A;  3LM9 A;  4FLV A;  4BR4 A;  3NHG A;  4JKA A;  4AHS A;  2KZZ A;  1ZBL A;  3EO3 A;  3OY9 A;  3I0S A;  3NE6 A;  3K0S A;  2GWJ A;  3SUQ A;  4BQZ A;  3SAH A;  2V51 B;  4BRL A;  3CJ1 A;  3NF9 A;  3P83 D;  3OYF A;  5AQS A;  1GLC G;  4N41 A;  2JWK A;  1JL1 A;  4JKG A;  4Q0B A;  4BR9 A;  5J2N A;  1QQM A;  1ATR A;  4CVN E;  4BR0 A;  3CXC M;  4DB3 A;  2E2P A;  3SAF A;  5E26 A;  4M3W A;  4BR7 A;  4FCY A;  1QVG M;  3OHR A;  5CR4 A;  2KZM A;  2OTL N;  4C8K A;  2O8C A;  3G25 A;  3HM8 A;  4FPA A;  4JV5 K;  3P4I A;  5BPL A;  4CFC A;  1FK9 A;  5T7B A;  4PUO A;  3ASM A;  1WSG A;  1B9D A;  3ZET A;  1NGG A;  4H5V A;  1J5E K;  4LF9 K;  3OBY A;  4WFN L;  1E4G T;  3IG1 A;  4JD2 A;  4O8K A;  3FE1 A;  3DXK A;  4CE9 A;  4F3O A;  4OPJ A;  4KKO A;  4AM6 A;  3RWU A;  4FM2 A;  1KRP A;  3TAM A;  4CF0 A;  4DSI A;  1WN7 A;  3T1A A;  3EL2 A;  4M3X A;  3AA3 A;  3DOK A;  4DLG A;  4E0D A;  2E2Q A;  4CHO A;  4JK8 A;  4EZ6 A;  4BRI A;  2CH5 A;  1BIS A;  4B1Y B;  4HHT A;  4DTP A;  3OYK A;  1JXE A;  2HMP A;  1RT7 A;  2YX6 A;  3V9S A;  3QIP A;  4FWM A;  3DRP A;  5GAD P;  3FZM A;  1TK8 A;  3KVG A;  4BDZ A;  3F2K A;  3F9K A;  2VG5 A;  5GAG P;  2VGM A;  1XI1 A;  5ADX H;  3QML A;  1DEJ A;  3M3Z A;  4YOX A;  5EY4 A;  4F9O A;  1RDD A;  2XY6 A;  1VSI A;  3ZSX A;  5FPE A;  3CJ7 A;  4IOX A;  3CG7 A;  1HUX A;  4FVU A;  2QWO A;  5BRE A;  4FJ8 A;  3FLC O;  3PSI A;  3ZSY A;  3AVL A;  1J53 A;  2HBK A;  1L3U A;  5M1P A;  4GV6 A;  2GEL A;  4PA1 A;  2BDP A;  4CFA A;  3NBP A;  1YJW N;  1LW2 A;  4BR5 A;  3CM5 A;  3CFR A;  4A59 A;  3SBT A;  5KI6 A;  3H6E A;  5F1X A;  4Z0U A;  3U3G A;  2O8E B;  2RHK A;  3MN7 A;  2NRX A;  3MCA B;  4EFH A;  2DY4 A;  3E1Y A;  3L4I A;  1BA0 A;  4KTW A;  1EWR A;  4BC5 A;  5CZ1 A;  2XRI A;  4CZG A;  4XH1 A;  3WXL A;  1M1K O;  4DU3 A;  1TKD A;  5SZT A;  1V4S A;  2KHO A;  3EN9 A;  3V1O A;  4BVP A;  4BRE A;  2VQE K;  5MLC Q;  2HHS A;  3VF4 A;  1BIU A;  3AVC A;  1Q82 O;  1D9F A;  4JI5 K;  3WQT A;  4K0K K;  4YDU C;  2QWN A;  2BTF A;  1WBD A;  2IC3 A;  3I55 N;  5J1E A;  4DQP A;  3VQ5 A;  3SBG A;  1LWF A;  1GLA G;  4M3U A;  2ZWH A;  4DTO A;  4JNE A;  1SZ2 A;  3MED A;  3UKR A;  4M42 A;  2RKI A;  2QEX N;  4KAZ A;  3QEV A;  3VOV A;  4B9Q A;  1BHL A;  3QLH A;  1IO2 A;  4OGC A;  3DXM A;  3I0R A;  4EIA A;  4PKH A;  2E20 A;  2P5O A;  3Q7C A;  1U2V B;  4FWN A;  3VQD A;  2P51 A;  4CJ5 A;  1NGH A;  1S22 A;  1S72 N;  1HYV A;  4Y1C A;  4WQ4 C;  4C23 A;  1ZBU A;  3KTQ A;  3HM9 A;  1XNQ K;  1RT5 A;  3DLL L;  3THW B;  3LDQ A;  1M90 O;  1ZXO A;  5DMR A;  1T3V A;  1GLE G;  3KLG A;  3NH2 A;  4OO1 J;  3P5J A;  3V1R A;  4CHP A;  3CM6 A;  5BRF A;  3RMC A;  2PAV A;  2G8K A;  3O3H A;  3QBW A;  2HVH A;  4R79 A;  3SV3 A;  4Z4F A;  4AF1 A;  1HJO A;  1L3T A;  1VQK N;  1RCH A;  4A2A A;  1WAJ A;  4H4O A;  1VQ9 N;  3E01 A;  1HNZ K;  5F0X A;  1HQU A;  1KTQ A;  1QSL A;  4FJH A;  2DFH A;  3IKM A;  3FGU A;  2UUB K;  1OH5 A;  1RBS A;  3WXM B;  3KK3 A;  2ZGY A;  2NRH A;  4JS5 A;  3IUC A;  3VN5 A;  5CYQ A;  3NMU A;  5KPT A;  3WXK A;  5C0Y A;  5B8H A;  2Z1H A;  5H1S Q;  3CQ8 A;  4YNQ A;  3EE9 A;  3PIP L;  3HPG A;  4CJE A;  4EP4 A;  4KBO A;  5AQY A;  2PBD A;  3VGM A;  3LDS A;  3KLI A;  4BGB A;  3RRH A;  3HBT A;  3LDO A;  3JSM A;  4ISF A;  1XC3 A;  2GUP A;  5HLF A;  3D6R A;  2P5G A;  4WFB L;  4JKE A;  3O3F A;  5GIN A;  3SQ1 A;  3DWL A;  4C8O A;  2OAN A;  3VQ4 A;  2HHT A;  2Q2R A;  1U49 A;  4MFB A;  3BDP A;  1VSF A;  3TAR A;  4A61 A;  5JLH A;  3D2E B;  3LPU A;  4LH5 A;  5K14 A;  2OZM A;  2JGU A;  3KLH A;  5GIP A;  3D7E O;  1GLJ O;  3M5R A;  4JI4 K;  4NYN A;  4DSK A;  1VRU A;  1UOC A;  4EHT A;  3PO5 A;  3LDN A;  4FWO A;  4BC3 A;  1O13 A;  4C1N I;  1BO5 O;  2FF3 B;  2Q97 A;  3QEI A;  4WQ5 C;  2EX3 A;  4O44 A;  1W7A A;  4E7H A;  1E3M A;  1S6P A;  2VG7 A;  5HL7 L;  3CCU N;  3TU5 A;  2A42 A;  2A6A A;  1NK6 A;  1C0U A;  4FJX A;  3NF7 A;  3H1Q A;  2HMI A;  2E2N A;  2NUB A;  1K8K B;  3NGI A;  2ZJR L;  2KFN A;  1ZBF A;  3ULE B;  4CJF A;  1Z26 A;  1WAF A;  3SNN A;  3QEP A;  3BZC A;  3HP9 A;  4AIL C;  5BN8 A;  3WXI A;  3KJV A;  2GWK A;  4E3S A;  1NMD A;  3VMF B;  3U3Y A;  2F7T A;  3OBW A;  4FOI A;  3MCP A;  3SJJ A;  3PIO L;  2QA4 N;  1IKY A;  3CIP A;  2Z1J A;  2A3Z A;  3KD5 E;  1U47 A;  4DQI A;  4IG0 A;  3FR0 A;  1J5O A;  4CZI A;  3AVJ A;  5M1F A;  4IO8 A;  1YF5 L;  5CHI A;  5TKY A;  5GAE P;  4LF7 K;  4BRF A;  2V7Z A;  1JLF A;  4J8F A;  5AQT A;  3HK2 A;  3AVB A;  1BCO A;  4ZTJ A;  4H8K A;  2JWL A;  4LD0 A;  3TAE A;  1ATS A;  5FPN A;  5JMV A;  4H0T B;  1S5J A;  3U4L A;  4FW1 A;  3P39 A;  4AHV A;  4ID5 A;  1I94 K;  4DR2 K;  4Z4E A;  2O8E A;  3ZSZ A;  4FJK A;  4CZF A;  1BDG A;  2EWS A;  2OA8 A;  5AQR A;  4IEE A;  5HRS A;  2A41 A;  1TYQ B;  3NAE A;  3F9M A;  5TKW A;  5DK5 A;  1TKX A;  4ICL A;  3R6M A;  1NGE A;  5AQM A;  3JXU A;  3CD6 N;  3L2W A;  1EWQ A;  4M45 A;  4FJ5 A;  4M7X A;  3CCR N;  2G8F A;  3LPT A;  4KHS A;  1KLM A;  1NKC A;  1VQ6 N;  5BR8 K;  3SQ4 A;  3HOS A;  1OVY A;  1RFQ A;  1V4T A;  4C8M A;  4FJ7 A;  1R0A A;  3O08 A;  3K59 A;  1FXX A;  4PQU A;  4DU1 A;  4H4M A;  2QKB A;  3L3V A;  4NLB A;  3LDP A;  1S3X A;  3J80 O;  3OS2 A;  4YDU A;  3RR7 A;  1JCE A;  4LH4 A;  4HWI A;  3HSC A;  2O8F B;  1XMO K;  3ATV A;  3U9Z A;  1U2V A;  2UXB K;  2OTJ N;  3L0Q A;  1KVA A;  4JS4 A;  3M8S A;  3I8D A;  4FLU A;  4PWD A;  3I56 N;  5I3U A;  3HZ6 A;  1MWK A;  5F2R A;  4CF1 A;  3THW A;  1NJZ A;  2Q36 A;  1KFD A;  3SYZ A;  1UA1 A;  5CE3 A;  4UY8 O;  3H08 A;  4MDA A;  3R1X A;  4AM7 A;  1WLJ A;  1K73 O;  1C1B A;  5IT9 O;  4GMJ B;  4QAG A;  3SLC A;  4BG8 A;  4MQ3 A;  3AAR A;  2E1Z A;  1X3M A;  3ZCM A;  4PKI A;  3CQY A;  3P38 A;  1BGX T;  5LMN K;  3SQ2 A;  3V9X A;  4B9M A;  3TTC A;  4E7J A;  4GV9 A;  2G8I A;  1C0F A;  1NGF A;  4U67 L;  3K57 A;  4ELV A;  4B9S A;  2FF6 A;  1NJI O;  1IG9 A;  1D4X A;  1OKJ A;  3NF8 A;  4Z4G A;  2HW3 A;  1QZ5 A;  1HKG A;  1VQ8 N;  5HRO A;  1RT1 A;  3V9W A;  1GLL O;  3LL3 A;  1IJJ A;  4JI1 K;  1IBM K;  4H5N A;  1Q8I A;  3HP6 A;  3W3D A;  3MMV A;  1HNW K;  1ZC6 A; 
#chains in the Genus database with same CATH homology
 5AQH A;  4BRN A;  2E2Q A;  3A5O C;  5EX5 A;  1JCF A;  4B1U B;  3ID6 A;  4JK8 A;  5AQI A;  3TSQ A;  4BRI A;  2CH5 A;  3RSE B;  3VEN A;  3QFP A;  4B1Y B;  3MN6 A;  3T69 A;  2YJF A;  3CME N;  2HMP A;  3DJC A;  2QW9 A;  2W40 A;  3QDK A;  2CGJ A;  2YX6 A;  3A5N C;  4BVO A;  3WEE A;  4FWM A;  5C2F A;  5GAD P;  3FZM A;  3K9K A;  5AQX A;  5AFU H;  3MWP A;  3CER A;  4JHD B;  3IDH A;  4JKB A;  1GLF O;  3KVG A;  2Q0R A;  1LOT B;  3QB0 A;  3F2K A;  3ID8 A;  5GAG P;  4BRG A;  2VGM A;  5BR9 A;  2I7P A;  1JCG A;  4E1J A;  5ADX H;  3QML A;  4K41 A;  4PL8 A;  3W0L A;  1DEJ A;  2QTD A;  5DM6 L;  3M3Z A;  4YOX A;  5FPD A;  5JLF A;  2W41 A;  1NGC A;  5EY4 A;  3SAG A;  3D2E A;  5AQW A;  4IJA A;  4F9O A;  1VQN N;  2P9P B;  3HTV A;  1BA1 A;  5FPE A;  3EKU A;  5GAH P;  1YUW A;  3CJ7 A;  4IOX A;  1ILY A;  2ZJQ L;  4FVU A;  1HUX A;  5ELZ A;  2QWO A;  3O9U A;  2QWQ A;  5BRE A;  3FLC O;  1VQO N;  5BRH A;  3A5L C;  1TUU A;  3AGR A;  4EHU A;  3CCJ N;  1Q81 O;  1J6Z A;  3O9Q A;  3TPQ A;  5AQK A;  3BF1 A;  5HL7 L;  2HBK A;  3AGK A;  4O8U A;  1C0G A;  1YXQ A;  5M1P A;  4GV6 A;  3VEY A;  2GEL A;  3C6H A;  4Y0W A;  2H3G X;  4JKH A;  1MDU B;  1BWF O;  2D1K A;  1YJW N;  1K8A O;  1DGK N;  4BRM A;  4BR5 A;  4MDB A;  5AZI B;  3CF5 L;  3UKU A;  4A59 A;  5AQL A;  3SBT A;  3CJA A;  3H6E A;  5F1X A;  5AR0 A;  4JK7 A;  4Z94 A;  4BGA A;  1ESV A;  4A62 A;  1NLV A;  2WC9 A;  1K8K A;  3ENB A;  2RHK A;  3MN7 A;  2NRX A;  2UYT A;  3MCA B;  3ULE A;  3IMX A;  4FO0 A;  4EFH A;  3T7Z A;  3E1Y A;  3L4I A;  4GVE A;  3GL1 A;  3ZEU B;  4A5B A;  1BA0 A;  4BRQ A;  4BC5 A;  1KAZ A;  4IZ9 A;  1YI2 N;  4CBW A;  4MO4 A;  1WOQ A;  4O5F A;  4FWL A;  2WFB A;  4H5W A;  4CZG A;  1Q18 A;  4IXC A;  1VQL N;  2V7Y A;  4IO9 L;  4XH1 A;  3SMP A;  3WXL A;  1M1K O;  1NBW A;  2QWM A;  1V4S A;  2KHO A;  3EN9 A;  2YI1 A;  4BVP A;  3OA9 A;  2QWL A;  4BRE A;  5MLC Q;  1QHA A;  3VER A;  3VF4 A;  2HBM A;  1Q82 O;  1QVF M;  3KK7 A;  5AQO A;  3WQT A;  3O9R A;  4YDU C;  2FXU A;  2QWN A;  2BTF A;  4B1W B;  3CC7 N;  5BRD A;  1BOT O;  3RVC A;  3I55 N;  2QI2 A;  1QQN A;  3SBG A;  5AQN A;  1GLA G;  4H0O A;  3TTF A;  4YOV A;  4BRO A;  1T6D A;  2P9U A;  2ZWH A;  4WQ4 A;  3QFU A;  4JNE A;  4B1Z A;  5KQD A;  1SZ2 A;  5LJV A;  1YJ9 N;  3UKR A;  2QEX N;  3MN5 A;  2DPN A;  2P9L B;  2VGN A;  1Y64 A;  4K43 A;  5E84 A;  3VOV A;  3C6A A;  3FZH A;  3O4W A;  4B9Q A;  3C7N B;  5AFU A;  4H0P A;  3JS6 A;  4DCH A;  2HST A;  3DXM A;  4QS8 A;  5AQP A;  4EIA A;  4K25 A;  3SK3 A;  2IVN A;  3VGL A;  3NVM A;  3B8A X;  2E20 A;  4PKH A;  3Q7C A;  5ADX A;  3LM2 A;  4KH4 A;  1U2V B;  4FWN A;  1NGH A;  5BPM A;  1S22 A;  1RGI A;  1S72 N;  1KQS M;  4KH6 A;  1TYQ A;  2ASM A;  4KH5 A;  4BRA A;  1YIJ N;  4WQ4 C;  4QS9 A;  3A0I X;  3VES A;  4BY9 C;  3R8E A;  4C23 A;  3VEZ A;  3BUZ B;  4IDH A;  2HOE A;  5KPZ A;  1QQO A;  2NRZ A;  3O5B A;  5C15 A;  4WF9 L;  4JKG B;  4ILJ A;  3DLL L;  2P9N B;  2A40 A;  3D2F B;  1ZXO A;  3LDQ A;  1T3V A;  3ZX3 A;  1GLE G;  5I9E B;  1M90 O;  4OPA A;  4OO1 J;  4YOW A;  2P9I A;  4OPH A;  3O1B A;  5BRF A;  2PAV A;  5HOO A;  3CCV N;  4FSV A;  1P90 A;  3QBW A;  2D0O A;  3E9L A;  2FSN A;  2QWR A;  3MWT A;  4R79 A;  4AF1 A;  1HJO A;  4FWP A;  4WYB A;  2D4W A;  3HOT A;  3AY9 A;  1VQK N;  4A2A A;  1VQ9 N;  3ZET B;  2P9S B;  5F0X A;  3WUH A;  3PLA A;  1YJN N;  3S41 A;  3MX2 A;  2ZF5 O;  5AQQ A;  1X9J A;  4JD2 B;  3IKM A;  1Q86 O;  4PHT X;  4H0X B;  4LC9 B;  3DXK B;  4JK9 A;  4BQL A;  2A5X A;  3FGU A;  3BF3 A;  3QBX A;  4GV3 A;  1DKG D;  3WXM B;  4I6M A;  4BRD A;  1U6Z A;  3VEO A;  2ZGY A;  2NRH A;  3GDQ A;  4FPB A;  1KXP A;  2IVO A;  4MO5 A;  3IUC A;  3CQX A;  2NRW A;  2NRT A;  3C65 A;  1VQP N;  3G4S N;  3VEV A;  3NMU A;  2I7N A;  5KPT A;  3WT0 A;  2F9W A;  3WXK A;  5C0Y A;  2Q1N A;  3O80 A;  2YHX A;  5B8H A;  1W97 L;  1HX1 A;  3ZX0 A;  5H1S Q;  3DAW A;  3HI0 A;  1GLB G;  3EE9 A;  3PIP L;  5EOY A;  2BH1 A;  3GOI A;  3OW2 M;  3BP8 A;  4KBO A;  2Q31 A;  3Q7B A;  5AQV A;  5AQY A;  2PBD A;  1XQS C;  3VGM A;  2P9K A;  5LY3 A;  5DM7 L;  4ILG B;  4IEI A;  4IFE A;  5AZJ A;  1YAG A;  5AQJ A;  2FLO A;  3ZYY X;  4FWK A;  4BGB A;  1KD1 O;  1KAY A;  5FPM A;  3UB5 A;  2FSK A;  3W3D A;  3FZK A;  3HBT A;  3LDO A;  3WEE B;  4ISF A;  4QS7 A;  1XC3 A;  1YVN A;  2GUP A;  2IIR A;  3D6R A;  3A5M C;  4U7B A;  3H1V X;  4WFB L;  1NGJ A;  4JKE A;  4B1X B;  4JKF A;  5GIN A;  4JKD A;  4MLE A;  3DWL A;  4WQ5 A;  3VTH A;  4CBX A;  3NVK A;  2OAN A;  3GG4 A;  4ISE A;  3CCS N;  3KWI A;  2Q2R A;  4XH4 A;  3WXJ A;  3CMA N;  4EAH D;  3HRG A;  3P31 A;  4NLC A;  4XH5 A;  5AQF A;  4A61 A;  2AP1 A;  5JLH A;  3D2E B;  3MN9 A;  1Z6R A;  4A57 A;  1T6C A;  5GIP A;  1NGB A;  3D7E O;  1GLJ O;  3EE8 A;  3M5R A;  3VEX A;  3VGK A;  3UE5 A;  2KKZ A;  3CHW A;  4YOT A;  3U8X A;  3ENH A;  4CZM A;  2Q0U A;  1X3N A;  2VWB A;  4IOC L;  1Z05 A;  4EHT A;  3FZF A;  3LDN A;  5GIO A;  4FWO A;  5JVG L;  4PKG A;  1YHQ N;  2ITM A;  1R59 O;  4BC3 A;  4BRK A;  1O13 A;  3L4Q A;  4C1N I;  3CC4 N;  4RCH A;  1BO5 O;  2FF3 B;  3GBT A;  5JVH L;  2Q97 A;  3AAP A;  4BR2 A;  3G71 N;  1RDW X;  4WQ5 C;  1WUA A;  3SJH A;  1VQ4 N;  2QWP A;  4FWQ A;  3CPE A;  1CZA N;  4JEP A;  2HF3 A;  3O8M A;  3C0B A;  4BRH A;  3UKU B;  4CZK A;  3TU5 A;  2A42 A;  2A6A A;  5C12 A;  4FL9 A;  3CCU N;  4RWT A;  1SS6 A;  4CD3 A;  1YIT N;  2CGK A;  3KWG A;  3RSE A;  1G99 A;  2D0P A;  3H1Q A;  3F5T A;  5C2D A;  3VTI A;  5LJW A;  2E2N A;  1IG8 A;  1K8K B;  2ZJR L;  3CCE N;  4H03 B;  2QXL A;  3L6Q A;  3ULE B;  4IOA L;  3VF6 A;  3MDQ A;  3VEW A;  4JHD A;  4BRC A;  2CH6 A;  5BN8 A;  3WXI A;  3K9J A;  3TSP A;  3H3O B;  4FOE A;  1NGA A;  2GWK A;  3N4Q A;  3E9O A;  1NMD A;  1LCU A;  3KZB A;  3VMF B;  5KQ8 A;  3CC2 N;  1JJ2 M;  2F7T A;  3OBW A;  2YHW A;  4FOI A;  3MCP A;  4JKC A;  4M63 C;  3PIO L;  2QA4 N;  2GTD A;  2NNW A;  2YJE A;  1HKC A;  3CIP A;  4JN4 A;  4M7Y A;  2E1Y A;  2P9P A;  2A3Z A;  2E88 A;  3MK6 A;  1P8Z A;  2VYP A;  3FR0 A;  2NLX A;  5M1Q A;  2WUS A;  4CZI A;  1VQ7 N;  3TTD A;  1EQY A;  3R3L A;  5M1F A;  1N8R O;  4IO8 A;  1HPM A;  1YF5 L;  2BUP A;  3E9P A;  4DHY A;  5CHI A;  1VQM N;  3CPW M;  5TKY A;  1SAZ A;  2QM1 A;  2P9U B;  3CJC A;  5GAE P;  5BPN A;  4BRF A;  2NZT A;  2V7Z A;  4GNI A;  4J8F A;  4FWR A;  5AQT A;  3M6G A;  2ASP A;  3UKR B;  2JWL A;  4GY2 B;  1ATS A;  5FPN A;  5JMV A;  4H0T B;  3SMS A;  4RTF D;  1ATN A;  2IVP A;  3U4L A;  5AZI A;  2F9T A;  3P39 A;  3E66 A;  5JIC A;  2VCP A;  3DXM B;  3FFK B;  3KHY A;  4IJN A;  4H5T A;  4CZL A;  4CZE A;  4B1V A;  4CZF A;  4CI6 A;  4CBU A;  2YCH A;  5M1N A;  2WBN A;  1BDG A;  2EWS A;  5AQR A;  2CGL A;  3ZEU A;  4IEE A;  4NO7 A;  1DT9 A;  2HBL A;  4ILH A;  2A41 A;  1TYQ B;  1HLU A;  3F9M A;  5M1O A;  5TKW A;  3O1W A;  3AAQ A;  1BG3 A;  3LDL A;  3R6M A;  1NGE A;  3R9P A;  5AQZ A;  5AQM A;  3JXU A;  3CD6 N;  4G9Z A;  1KC8 O;  4YOR A;  1VAZ A;  3H3N O;  3H46 O;  2ZGZ A;  3O9S A;  4M7X A;  3CCR N;  3H45 C;  4A2B A;  1ZBS A;  2ZJP L;  1VQ6 N;  1KAX A;  2ASO A;  2P9I B;  4XEI A;  2NRV A;  4YOU A;  3VF2 A;  3WQU A;  3HOS A;  1EO1 A;  1OVY A;  2GX9 A;  4H5R A;  3M1F A;  1RFQ A;  1V4T A;  3VET A;  2E2O A;  3J8A A;  3O08 A;  3O9T A;  3U9D A;  1BUP A;  3I8B A;  4JAX A;  1MWM A;  3TSU A;  4BG9 A;  4HTL A;  5M1K A;  3CCM N;  4NLB A;  4PL7 A;  2FSJ A;  1SQK A;  3LDP A;  1W2B M;  4IWV A;  4A5A A;  2GEM A;  2RE2 A;  2P9L A;  1S3X A;  1NGD A;  4BRP A;  1T44 A;  3C7N A;  3MX5 A;  4C1N K;  4YDU A;  3CCQ N;  2AA4 A;  1JCE A;  2HF4 A;  3CET A;  4HWI A;  1QZ6 A;  3HSC A;  4I6M B;  3LM9 A;  4H0V B;  3O6W A;  4BR4 A;  4JKA A;  3ATV A;  5AQU A;  4CZH A;  3U9Z A;  1U2V A;  1Q7Y O;  2OTJ N;  3L0Q A;  2J4R A;  3EO3 A;  1MA9 B;  3BEX A;  2GWJ A;  3EZW A;  1GLD G;  1VQ5 N;  3I56 N;  4CZJ A;  4BQZ A;  3SAH A;  2V51 B;  3CJ9 A;  3HZ6 A;  3IFR A;  3CJ1 A;  4BC2 A;  4BRL A;  2E8A A;  1K9M O;  5AQS A;  2PFU A;  1GLC G;  1MWK A;  4DQ8 A;  2JWK A;  5F2R A;  4L3Q A;  4JKG A;  3FZL A;  4BR9 A;  2P9N A;  2Q36 A;  3D2F A;  2P9K B;  5C10 A;  1QQM A;  1ATR A;  4UY8 O;  5CE3 A;  4BR0 A;  3CI5 A;  1XUP O;  5AZJ B;  1H1V A;  3VPZ A;  4DB3 A;  2E2P A;  3CXC M;  2V52 B;  3R1X A;  4MDA A;  4AM7 A;  5E26 A;  3SAF A;  4BR7 A;  1QVG M;  4MLH A;  5KPR A;  1K73 O;  3OHR A;  5CR4 A;  1HKB A;  2OTL N;  3SLC A;  3G25 A;  4BG8 A;  3HM8 A;  3AAR A;  2E1Z A;  4FPA A;  1NM1 A;  1X3M A;  3I33 A;  3P4I A;  5AQG A;  4K42 A;  1BU6 O;  4PKI A;  5BPL A;  3J7Z O;  3CQY A;  3P38 A;  4WCE L;  3TTC A;  4CJ7 A;  4NB4 A;  4WFA L;  4GV9 A;  3ZET A;  1NGG A;  2P9S A;  1C0F A;  1NGF A;  4H5V A;  4U67 L;  3G6E N;  3OBY A;  2NRR A;  5EXW A;  4WFN L;  4YOY A;  1E4G T;  2FF6 A;  1NJI O;  1D4X A;  1OKJ A;  3ZX2 A;  4JD2 A;  4FWS A;  1QZ5 A;  1HKG A;  1NWK A;  4O8K A;  3FE1 A;  1E4F T;  3ATU A;  1VQ8 N;  3DXK A;  4BC4 A;  5BN9 A;  2KLA A;  3A8Y A;  1GLL O;  3LL3 A;  1IJJ A;  2HBJ A;  4H5N A;  3CJB A;  4AM6 A;  1RDU A;  3CCL N;  3ENO A;  3EKS A;  3N4P A;  3QIC A;  5EVZ A;  4DKW A;  4H0Y B;  2YHY A;  4CD1 A;  4ISG A;  3MMV A;  3EL2 A;  1ZC6 A;  1TUY A;  3GE1 A;  1NGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...