3ZX3A

Crystal structure and domain rotation of ntpdase1 cd39
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
406
structure length
399
Chain Sequence
NVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGASTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNNSHCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Evidence for a Domain Motion in Rat Nucleoside Triphosphate Diphosphohydrolase (Ntpdase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
total genus 125
structure length 399
sequence length 406
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx3A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx3A02
4A2AA 2FF6A 5AQTA 4BRLA 4H5NA 5CE3A 2V7YA 3WQUA 3WQTA 2ZGYA 3GOIA 3ID8A 2A41A 1T44A 4Y0WA 3VENA 4IO8A 3O80A 3KZBA 4MO4A 3ATVA 3HSCA 4B1YB 1R59O 3UKUB 4H5TA 4BRIA 4XH1A 3CI5A 3AAQA 3VF2A 3VGKA 1GLLO 4H5RA 1IJJA 1NLVA 4CI6A 5KQDA 1C0FA 1XUPO 2ZF5O 3MN9A 1HJOA 4BC5A 5AZIB 3F9MA 5LJVA 1GLAG 1NGAA 3WXLA 3L6QA 4E1JA 3EL2A 3MN5A 3BF1A 3SMSA 1TYQB 1BA1A 1BWFO 1T6DA 3P4IA 3O1WA 5F2RA 3VEWA 1BDGA 5AZIA 2FF3B 3UKRB 2CGKA 3R9PA 2YHXA 2A42A 4FWPA 4K25A 3LDLA 3M1FA 3WXIA 4O8KA 4M7YA 5AQKA 5BRFA 1Q18A 4BR0A 2E1YA 4FPBA 4K43A 4BRQA 3HM8A 3ENHA 4WQ4C 3GG4A 3FE1A 4F9OA 4M63C 2GEMA 5AQWA 4MLHA 5AQXA 3EKSA 5AQIA 3CQYA 4CZHA 5FPDA 4JD2B 4FWNA 4IZ9A 3ZX0A 3UKUA 4H5WA 1CZAN 3QBWA 1U2VA 4IWVA 5AQMA 2P9PB 1LCUA 3G25A 3RSEB 2GWKA 2IIRA 3CHWA 4H0XB 3A5LC 3CJBA 2GELA 4BR9A 2QWPA 3MN6A 4EFHA 2YHWA 2P9LA 3UB5A 3CJCA 3DXKA 4CD3A 5BPLA 4YDUC 3H45C 4XH5A 5EXWA 5E26A 5B8HA 2QWOA 2FSNA 4DB3A 2P9UA 4CD1A 3GBTA 1OKJA 2A40A 4FWSA 4FWRA 2P9NB 4GY2B 1XC3A 1DGKN 4B1WB 4WQ5A 4BGBA 4FO0A 3TU5A 1NGEA 3DXMB 3R8EA 2D1KA 1HKGA 4BREA 1NM1A 3U9DA 4PKIA 4BC2A 4K42A 2DPNA 3LDNA 3WXKA 4A2BA 1JCFA 3DXKB 5AQHA 4AM6A 3ZX3A 4QS9A 5FPMA 1GLBG 1GLEG 4I6MA 2J4RA 1NGJA 1ZBSA 4H03B 3B8AX 1HKCA 2QWQA 2P9SB 3AAPA 1RGIA 4BRNA 2ASMA 1BU6O 2W41A 2UYTA 3ENOA 5BPMA 3VETA 2Q31A 2QWMA 3M6GA 3FR0A 3QFUA 3SMPA 4B9QA 3VPZA 2AA4A 1GLJO 3A0IX 2FXUA 1YVNA 3O1BA 3WT0A 3O5BA 2PAVA 5E84A 2FSJA 3U8XA 5EOYA 2IVNA 2NRHA 3D7EO 5JMVA 3CETA 1C0GA 2V52B 3OHRA 2FLOA 3J8AA 4AM7A 1ZC6A 3M3ZA 3FZHA 3GDQA 1WUAA 2Q0UA 4WQ5C 4DQ8A 4FWQA 1GLDG 2I7PA 2NLXA 4CBWA 2PBDA 2QM1A 3ULEA 1NGHA 3HZ6A 4M7XA 3LDPA 1DEJA 1SAZA 3DAWA 4C23A 5AQGA 3FGUA 3CJ7A 4H5VA 1HLUA 2IVPA 4BR7A 3D2FB 2ZWHA 1JCGA 4BROA 3CJAA 3JS6A 3WEEA 4ISGA 3VEOA 2P9SA 2I7NA 3C0BA 1NGBA 4PKHA 4QS8A 1T6CA 2WUSA 2E2QA 2HF3A 4B1UB 3EN9A 4CZEA 3BUZB 4PL7A 1D4XA 4LC9B 5AQNA 3QB0A 4Z94A 5AQYA 3CJ9A 1TUYA 3D2FA 4BR5A 5I9EB 2CGJA 4K41A 3ZX2A 4IXCA 3QMLA 5AQVA 4FWKA 3VF6A 3IMXA 1J6ZA 4FWLA 4H0OA 5ADXA 2CH6A 1YXQA 3CERA 2ZGZA 3D2EB 4YDUA 2ITMA 4B1VA 3ZETA 4BQLA 3W0LA 3L4IA 2P9NA 2E2NA 3VEYA 1SZ2A 1MA9B 4CBUA 4KBOA 3VEZA 4J8FA 2D0OA 4MLEA 2CGLA 3HTVA 4HWIA 1BG3A 3S41A 3VERA 4IJAA 4CZKA 1GLCG 1HPMA 3I33A 1KAZA 1V4SA 3WUHA 3O6WA 4FL9A 4BRPA 2KHOA 2EWSA 1K8KA 2AP1A 2HMPA 3O08A 5AQSA 3VF4A 1TYQA 2FSKA 5EY4A 2QXLA 4RWTA 4XEIA 5TKYA 3IFRA 2A6AA 4NO7A 1HUXA 1E4GT 3O8MA 2QWRA 3A5MC 5AZJB 4A61A 3VOVA 4EHTA 3VGMA 3QICA 5AQZA 3LDOA 4BRAA 3BP8A 3A5OC 4CZMA 1QQOA 4BRMA 5BRHA 2E20A 5JICA 3W3DA 3H6EA 4BGAA 4BRHA 2Q0RA 4WQ4A 3MMVA 4FPAA 2BUPA 3BF3A 2E1ZA 5LJWA 1KAYA 1X3NA 1IG8A 2D0PA 3JXUA 3FFKB 5AFUA 3CJ1A 3C7NB 3LM9A 5AQUA 5EX5A 3MDQA 4RTFD 2Q2RA 1DKGD 3FZFA 3QFPA 2ASOA 5FPNA 1E4FT 2CH5A 3VEXA 3FZLA 1Z6RA 4BVPA 4PL8A 4HTLA 4BRCA 3QBXA 3H3NO 5AQFA 3O4WA 1NMDA 5BN8A 5AQQA 4IJNA 3ZETB 1NGGA 1BUPA 5BN9A 3SK3A 5BR9A 2VWBA 3CQXA 1QQNA 1JCEA 4NB4A 4BRDA 4BC3A 1ATRA 2Q97A 1YAGA 3RSEA 1BOTO 4BRFA 1RFQA 5JLFA 2BTFA 4JAXA 1RDWX 3CIPA 4BVOA 5AQRA 4RCHA 1S3XA 4BG9A 3U9ZA 5BPNA 1TUUA 5KPZA 3IUCA 4JN4A 4CZGA 3H1VX 2QW9A 3EZWA 2P9UB 1Z05A 4BRGA 3BEXA 4I6MB 2W40A 3IDHA 1NGIA 1V4TA 1HKBA 5LY3A 3SJHA 4FSVA 1QQMA 4BC4A 3KHYA 3GE1A 5AR0A 4FWMA 4FOEA 5AQJA 2ASPA 3FZKA 1HX1A 4EIAA 1U6ZA 1Y64A 1GLFO 5FPEA 1SQKA 4DCHA 2YJFA 5ELZA 5AQPA 2QWNA 3WEEB 4ISFA 4PKGA 4CZJA 5ADXH 5AQLA 3H3OB 1U2VB 4H0YB 1P8ZA 1QZ5A 1NGCA 3SLCA 1NGDA 4QS7A 4CZIA 3EO3A 3A8YA 3TPQA 4O5FA 1ZXOA 5AZJA 2V7ZA 3EKUA 3MK6A 2OANA 4BR4A 1YUWA 2YHYA 2GWJA 3AARA 1MWKA 2VYPA 2V51B 3LM2A 5BREA 3LDQA 2VCPA 1K8KB 3QDKA 3L0QA 2P9LB 3HI0A 4EAHD 3H46O 3UE5A 5KPRA 4H0PA 2HOEA 4MO5A 5AQOA 1EQYA 1WOQA 4BRKA 3DWLA 2H3GX 1H1VA 1X9JA 3I8BA 2P9IB 2P9KB 3HBTA 1G99A 4JHDB 5F1XA 5F0XA 1NGFA 2A3ZA 4WYBA 1X3MA 4JD2A 3A5NC 2Q1NA 3FLCO 4CZLA 3KVGA 2Q36A 2YCHA 1BA0A 1KAXA 5BRDA 2E88A 2YI1A 2E8AA 4CBXA 1ESVA 1NWKA 4BG8A 1KXPA 3AY9A 5KQ8A 3VEVA 3ZEUA 2GUPA 4H0TB 4H0VB 2D4WA 2GTDA 3ATUA 3VGLA 1QZ6A 4FOIA 2QWLA 3MCPA 4ISEA 1ATNA 1ATSA 4GNIA 3VESA 4B1XB 5AFUH 5KPTA 2E2PA 3H1QA 1MWMA 3ULEB 3ZEUB 4L3QA 2IVOA 4DHYA 3FZMA 3UKRA 4FWOA 3C7NA 3DXMA 5EVZA 4BR2A 1LOTB 3WXJA 2HF4A 1MDUB 3LL3A 3D2EA 4CZFA 1NBWA 3GL1A 5JLHA 3R6MA 1XQSC 4CJ7A 3MN7A 4A62A 2E2OA 4B1ZA 2YJEA 3DJCA 4XH4A 4EHUA 2P9PA 2F9TA 1QHAA 2NZTA 4BQZA 4JHDA 2P9IA 2A5XA 1BO5O 2P9KA 3U4LA 2F9WA 4JNEA 1S22A
chains in the Genus database with same CATH superfamily
3OA9A 3AVFA 1VSMA 4DKWA 4DR1K 3THWA 3KLEA 4FLZA 2V7YA 1I39A 3GOIA 1B92A 3D6RA 1N5YA 4O0JA 4YOYA 1VQMN 4DSFA 4G1QA 4JKDA 4GV3A 4JS4A 3V9UA 4DQQA 3HSCA 3J7AP 3JYTA 4DLEA 4J2BA 4PWDA 3UKUB 3CQ8A 4M3TA 4H5RA 1IJJA 4Z4EA 4OVLA 4B9VA 1HJOA 4BC5A 3EZ5A 4CFBA 3ZSWA 5LJVA 2ZJRL 4BDYA 2HHHK 3L6QA 3SUNA 5C2DA 1BWFO 3O1WA 5AZIA 2FF3B 1Y97A 4CJFA 3R9PA 2OPSA 1KLMA 3HM9A 4O8KA 4ID1A 5AQKA 2ZJPL 1HRHA 1Q18A 1KLNA 5LMUK 2HNDA 3ENHA 3HT3A 4GVEA 1HYZA 4B9NA 4LH4A 2BGGA 1K6YA 1VSEA 2YKMA 4FWNA 4M3XA 3S9HA 3P39A 4JKHA 4JKAA 1TAQA 3LAMA 2HMIA 4FM1A 5GAHP 3RTVA 3UKUA 3F9KA 1X9MA 5D3GA 4LH5A 4OPJA 1FK9A 4FJKA 1WNSA 3CJBA 4KO0A 1BIZA 4BR9A 2VG6A 3AV9A 4LSNA 3UB5A 1WAJA 5B8HA 3CPEA 4DB3A 5C15A 4CD1A 3D0PA 2WOMA 1IV0A 3Q7CA 1BIUA 1GOAA 4GY2B 2NRXA 2A1SA 3CMAN 1JLQA 4FXDA 4JK8A 4WQ5A 4IKFA 3DXMB 4BREA 4DFMA 1ASWA 1WSHA 2YNFA 1KCFA 2WBNA 5DM6L 4K42A 2P51A 3OJSA 3DRPA 5JVHL 4OPKA 3V9WA 1T8EA 1SKRA 4KPYA 3ZX3A 5FPMA 3UIQA 2B5JA 1D9DA 3B8AX 1HKCA 2QWQA 2P9SB 3AAPA 1RGIA 4JK7A 4FZXC 4BRNA 2ASMA 2IC3A 3HL8A 2Q3SA 1RDAA 1K8AO 4EZ6A 2VGMA 5BPMA 3VETA 2Q31A 4CK3A 1M90O 4B3RK 1NOZA 2QWMA 3M6GA 3SPYA 3VPZA 2AA4A 2KKZA 1Q81O 1YVNA 3WT0A 2Z1GA 3SUQA 2FSJA 3M8PA 3U8XA 3SZ2A 2IVNA 2NRHA 4FK4A 1VSIA 2UUCK 2D0CA 4FYDA 4AM7A 1RBVA 4DQ8A 4F2SA 2NLXA 2QM1A 3QINA 4M7XA 5GAEP 2GX9A 2X6SA 3MXJA 5HRRA 3ASMA 2IVPA 4WFBL 3QLHA 3QNOA 3QERA 1KC8O 2W6LA 3WEEA 5FRNA 4BDZA 4ISGA 3VEOA 2I7NA 1NK8A 1T6CA 4CJSA 4CJTA 4CZEA 4B1UB 4DFKA 1ITGA 4ELUA 4FLXA 4JKGA 5AQNA 3U3GA 3PV8A 3C6HA 3D2FA 5I9EB 3ZX2A 3CD6N 2AJQA 4JV5K 1F21A 3L3VA 5AQVA 4CJUA 4FWKA 5C10A 3CCRN 3AO2A 4NCBA 2O8CB 3LANA 1XMOK 3CERA 4EP5A 3FFIA 1VK0A 3D2EB 4BQLA 1CZ9A 3ZETA 4E7LA 3W0LA 4LF5K 2BDPA 3AVGA 1I94K 4KBOA 3VEZA 4MDBA 4J8FA 3MXIA 4DSJA 3CM6A 3VERA 3NDKA 2KTQA 1VQKN 4GKJK 4OX9K 3VQDA 3VQCA 4F3TA 1HPMA 3EE8A 3I33A 4K8ZA 1KAZA 4O8UA 3TSQA 3KJVA 1KSPA 4I9LA 2NNWA 2KHOA 4CGFA 3S3MA 1K8KA 2AP1A 2FBXA 1U48A 5IWAK 5EY4A 2BANA 4NO7A 1HUXA 4IDHA 1TK0A 1NJIO 3CC2N 3A5MC 5AZJB 4A61A 3VOVA 3VGMA 5AQZA 4LFBK 4GV9A 1OVYA 4CZMA 2KFZA 1RTJA 2E20A 5JICA 4IDKA 3KLGA 4X64K 3PLAA 2YNHA 4KI4A 3RMAA 3MMVA 3SUOA 3BF3A 2E1ZA 3T1HK 4DSLA 5LJWA 4CCHA 5AQUA 2Q2RA 1C1BA 3VQ4A 3SUPA 3TAPA 3AVKA 5LL6Z 1KVBA 3QBXA 4OGEA 3OS2A 1TVRA 5M1KA 1A5WA 1Z25A 5AQQA 4IJNA 1NGGA 5BN9A 4CEOA 2VWBA 1XI1A 3RSEA 5CHIA 4CEQA 4CFCA 1GOBA 4JI6K 3CCMN 1RDWX 3VQ9A 3V4IA 1S3XA 4BG9A 1JLFA 3U9ZA 5BPNA 1C1AA 3CCVN 3IUCA 4HUEA 2YHBA 1LW0A 2E6LA 4CZGA 1NJZA 4FJHA 4DTUA 5GINA 3CFPA 4N5SA 3OYHA 1NGIA 1V4TA 3AVAA 3BDPA 5LY3A 3SJHA 1QQMA 2O4GA 4BC4A 4CJRA 5AR0A 3GE1A 2ASPA 1Y64A 1S9EA 1SQKA 4PY5A 5AQPA 2QWNA 2ZJQL 3G10A 1J54A 3HVTA 4A5BA 4O0IA 3I0SA 4QS7A 3ZYYX 4ICLA 3PO5A 4CERA 1ZXOA 2ETJA 3SAGA 2V7ZA 3RWUA 4BR4A 1YUWA 2YHYA 2D5RA 2GWJA 3AARA 4A57A 4M41A 3VQQA 3THYB 1BI4A 3AVCA 1K8KB 3L0QA 4DTNA 1L3TA 4DFJA 4IBNA 3CCSN 3AO3A 4DR3K 3UE5A 1UA1A 1NKCA 4K8XA 2ITGA 3IRXA 1EQYA 3O9QA 2KQ2A 1JLCA 1RDCA 4BWJA 3C94A 4CEBA 2NUBA 2VQFK 4GKKK 4DUYK 1G99A 3SPZA 1BQMA 3I56N 2A3ZA 4WYBA 1X3MA 4DTPA 3G0ZA 4W5TA 1S6PA 3A5NC 1JL1A 3FLCO 3HK2A 3KKRA 1JLAA 3L2QA 3C6AA 4CZLA 1OVQA 2Q36A 3KVGA 4CHPA 4DF4A 4FLVA 3U3YA 2P5GA 5J2QA 2B4JA 3VQEA 4KB0A 4L8RB 3CCEN 1CXQA 2E88A 1WSJA 4IOXA 2YI1A 4DSKA 3KTQA 1NWKA 3ZEUA 3S3OA 4FJ7A 4FJ8A 3VA0A 3ATUA 4AHTA 3MCPA 2G8HA 3LZJA 2E2PA 1MWMA 3P5JA 2IVOA 3UKRA 4DV5K 4FWOA 3C7NA 2IS3A 2E5LK 4CEDA 1VQON 2YX6A 4DR2K 1MDUB 1NBWA 3GL1A 4KB1A 3T1AA 3DM2A 3NMUA 3HP6A 3J80O 3DLLL 5I3UA 3MN7A 1ILYA 2P9PA 2F9TA 1VSJA 4AHSA 3VTHA 2YNIA 2G8IA 4KHWA 4JHDA 3TAGA 1NKEA 2P9KA 2A5XA 1DLOA 3KD1E 2F9WA 5SZTA 3H08A 4M3YA 2FF6A 4BRLA 1JXEA 1NG9A 1VQ7N 3WQUA 4CEZA 3V81A 3WQTA 2D0BA 3ID8A 4OPHA 2P5OA 1YTAA 2Y1IA 1S1WA 1Q7YO 4I7FA 1DTTA 2JGUA 4CE9A 2HHQA 3L2UA 4JKCA 1YITN 3VF2A 3VGKA 1GLLO 1NLVA 3NF6A 4I2QA 3EE9A 5KQDA 1NK7A 1XUPO 3PX4A 4CECA 4HHTA 3ZSRA 1BCMA 5AZIB 3F9MA 1GLAG 1XMQK 2R7YA 1NGAA 4YOWA 3EYZA 4FCYA 3AO4A 4E1JA 1TYQB 1BA1A 1T6DA 4WFNL 3L3UA 2CGKA 3NF7A 2EX3A 1EX4A 4K25A 4CF8A 4NLBA 3ZCMA 3K9KA 5I42A 2YHAA 4M7YA 4E0DA 3WNGA 2ZD1A 5BRFA 3VQAA 1VAZA 2E1YA 4BRQA 5BR8K 5K14A 1LAWA 1YIJN 4ZTFA 3FE1A 1RTHA 4F9OA 3ULDA 3HVRA 4M63C 4IEEA 3CQYA 4DV6K 1KD1O 3JSMA 4H8KA 1TL1A 4AQYK 4IZ9A 4Z0UA 3AVJA 2WONA 4H5WA 1ZYQA 4KAZA 4LF9K 1U2VA 4IWVA 4NYNA 3NFAA 3RSEB 4BY9C 3SAFA 4M3WA 2QA4N 4J2AA 3A5LC 3ZSOA 2P9LA 2HHSA 4YDUC 3H45C 4F4KA 4W5RA 2WTUA 2QWOA 2FSNA 2QK9A 5IT9O 4M45A 3K57A 2VG5A 3QIOA 1XC3A 4JLHA 1JL2A 1XNRK 1TV6A 2D1KA 2JLEA 2XY7A 5LMNK 1BCOA 3C65A 3ISNC 1NK0A 1OH5A 1M1KO 4RW4A 4BDPA 3B6PA 2UUAK 4CJWA 1TKDA 4QS9A 3HPOA 3TWHA 3NAEA 1ZBSA 4H03B 3LALA 3LDSA 3BZCA 1QQCA 3E01A 1BU6O 3OW2M 3CG7A 3QESA 2QKKA 3B6OA 3D45A 3QEIA 2X78A 1YI2N 1CXUA 1IBMK 4B9UA 3FR0A 3SMPA 1NOYA 1FJGK 1NJXA 2HBKA 5MLCQ 3A0IX 4C8MA 3O1BA 1UAXA 4OLAA 4E3SA 3AVNA 1X9WA 1RT6A 4KHPK 3D7EO 5JMVA 3DLEA 2V52B 1RT2A 3J8AA 3NGYA 1ZC6A 3M3ZA 3FZHA 3T3FA 3K58A 2Q0UA 3NH2A 4FWQA 2I7PA 2VWJA 2UXCK 4CBWA 4RG8A 1RBRA 1NGHA 3HZ6A 1DEJA 1SAZA 4K0KK 3SNNA 4C23A 5AQGA 4KFBA 2RKIA 5GAGP 1RDBA 2ZWHA 4CIEA 4KH5A 4NXNK 2HW3A 2WUSA 2HF3A 3DRSA 1HNXK 3G71N 1D4XA 1VRTA 1JLEA 3TAQA 1KTQA 5DK5A 5AQYA 5SWMA 4Z4CA 4AHUA 3LZIA 2CGJA 1SL1A 4IOCL 3J7YP 1WSGA 2RF2A 3OS1A 2RE2A 1N32K 4FWLA 3G6EN 1XNQK 2VQEK 4B1VA 4JI8K 2HVHA 2P9NA 3VEYA 4JKEA 1HNWK 2JWLA 4GW6A 4C8NA 1WAFA 4Y1CA 4CZKA 1N6QA 4UQGA 4RW9A 1S6QA 3O9SA 3IAYA 5KRTA 1KVAA 3WUHA 1MU2A 3O6WA 4CHNA 4FLTA 3ENBA 3CFOA 3VF4A 3O08A 1JXBA 5AQSA 2KW4A 3CCLN 1TGOA 1VSDA 1JJ2M 4LF7K 5J1EA 2ATQA 3T69A 3QEVA 2A6AA 3RR7A 4CEEA 3SQ1A 1E4GT 1C1CA 1NNEA 5KGXA 4BRAA 4C1NK 4U67L 4CHYA 2OA8A 4Z4FA 3BY5A 1QQOA 1VSKA 4M3RA 3NH1A 5J2NA 4DV0K 1NK6A 4DTRA 1RT1A 3H6EA 4CHQA 1J9AA 4CESA 3V1OA 2HB5A 1X3NA 3FFKB 3I8DA 3CJ1A 3C7NB 1IG9A 4RTFD 3QFPA 2O4IA 2ASOA 3AA3A 3KKSA 4Q0BA 1RILA 4M3ZA 2CH5A 3VEXA 1Z6RA 3V1QA 1KQSM 2PFUA 1J5EK 4BRCA 3HSTB 4O55A 2RN2A 1ASUA 4FJGA 5HL7L 3C6TA 3AO5A 4O5BA 4W5QA 2F7TA 1CLQA 3VQ8A 4JI4K 5BR9A 3KK1A 5TKWA 2UXDK 1JCEA 2OZSA 4BC3A 4N76A 1BOTO 5J2MA 4E7JA 1RFQA 2I5JA 3N4QA 3MCAB 1U47A 1TAUA 1NMNA 4BE2A 4CK2A 4W5OA 2Z1HA 4TSXA 2QW9A 4LF6K 2DFEA 4YFUA 4I6MB 1KFSA 2GUIA 3K59A 2PZSA 2OPQA 4CJLA 1LW2A 4FOEA 2QI2A 5AQJA 3QNNA 4AF1A 4EIAA 2F4VK 1GLFO 1BL3A 5ADXH 4CZJA 4ISFA 4PKGA 3MXMA 5AQLA 3V1RA 4FJ9A 4JI2K 1P8ZA 4FZZA 3AGKA 3PX6A 3TSPA 3LAKA 3MK6A 3OBYA 3KK7A 3C6UA 4FVUA 2VYPA 3LM2A 5BREA 3LDQA 2VCPA 4X62K 4QCLA 1IKVA 1S72N 3TSUA 2P9LB 2LSNA 4EAHD 4DR4K 3H46O 1WBDA 2HOEA 4F8RA 5AQOA 3SQ4A 1WOQA 2H3GX 1X9JA 1J53A 5KI6A 3OYJA 1N33K 2P9KB 2G8VA 4FVMA 3HBTA 4JHDB 4NCGA 2VWKA 2B6AA 3THWB 3O3FA 1BA0A 1UA0A 1IH7A 3WXMB 2OTLN 2W6KA 3HJFA 4CBXA 1WB9A 1ESVA 2OPRA 4X66K 3AGRA 4E1MA 5GADP 4CF9A 4CIGA 1HNIA 4H0TB 4H0VB 5JVGL 4FK2A 1NJYA 4YOUA 3VGLA 1QZ6A 4FOIA 1ATNA 4GNIA 3DLGA 4A5AA 5KPTA 3H1QA 4L3QA 1Q82O 3NGIA 5JS2A 3OVNA 3E9OA 4BR2A 4EP4A 2HF4A 3LL3A 3PIOL 3DRRA 4CHOA 5CYQA 4CZFA 5CY4A 4JEPA 1N34K 3BZKA 1QVFM 3R6MA 1RBUA 3LPUA 3QEXA 4DG1A 2IDOA 2YJEA 2GV9A 3DJCA 4PUOA 5HRPA 4EHUA 2OCEA 2E4LA 3QEWA 3AVMA 1QHAA 3ITHA 1FKPA 3KLIA 3CCUN 2P9IA 4CJQA 1C6VA 1R0AA 4NYFA 1S22A 3J81O 4DQIA 5HP1A 5HRNA 1WLJA 2DTUA 4FK0A 2A41A 4B08A 2O8FB 4Y0WA 3O9RA 3F5TA 3O3HA 3O80A 3KZBA 2HHUA 3ZSZA 4MO4A 3ATVA 4Q5VA 1RTIA 4AHRA 3P1GA 4B1YB 2NRWA 4NXMK 1EWQA 2OZMA 1R59O 4H5TA 1VSHA 3ZT2A 4XH1A 3AAQA 2HHXA 2YKNA 4B3OA 1C0FA 2ZF5O 1L5UA 4CIFA 4DQSA 3MN9A 1L3SA 2OYQA 1NKBA 1YTUA 3WXLA 3NF8A 3SMSA 4V19S 3VEWA 3P4IA 4FM0A 4JI1K 4E7HA 3AA4A 3HO1A 3K9JA 2F96A 3Q7BA 2YHXA 5M1NA 2A42A 4DU4A 3WXIA 3LDLA 4KI6A 3ZT4A 3TAFA 4KHNA 1O13A 4IFYA 3O4QA 1IO2A 4WQ4C 4X65K 3GG4A 3RVCA 3MWPA 1IKXA 4DR7K 5AQWA 4MLHA 1HYVA 4NCAA 3EKSA 4CZHA 4RW7A 5C0YA 1Q8IA 4DV3K 1S1XA 3DLKA 3ZX0A 4DS4A 5HLFA 5M1FA 3SAHA 4FJNA 1QSYA 2XY8A 4E19A 2F8SA 4E1NA 1LCUA 2G8FA 1QHTA 5GIPA 3G25A 3TARA 2HBLA 3TTCA 3CHWA 1TKZA 4H0XB 4CGGA 2GELA 3PY8A 4EFHA 1T03A 3JAMO 3CJCA 3DXKA 5BPLA 4XH5A 1IBLK 4C8LA 5E26A 3K2PA 1EWRA 3SQ0A 4BE1A 1OKJA 4CGJA 2A40A 4FWSA 2HHVA 4FWRA 4DSEA 4B1WB 3MEGA 4BGBA 1C0TA 1HKGA 3OYCA 3R1XA 2JWKA 3U9DA 3OYNA 2DPNA 3LDNA 1SKSA 3WXKA 4KTQA 3V9ZA 4PQUA 3VQ6A 5AQHA 3MECA 4CW7B 4F2RA 1GLBG 3TANA 4JKBA 1D8YA 2J4RA 3SQ2A 1YJWN 4LF4K 4YNQA 1VQPN 5EU7A 1VQ8N 2OPPA 4CF2A 2UYTA 4KTWA 3ENOA 2XRIA 1JLGA 3M8QA 3THXA 1IKWA 1SV5A 3QFUA 4B9QA 2NRZA 1TKXA 1GLJO 1N8RO 2HSTA 2PAVA 5E84A 1KVCA 3NVKA 5CR4A 1RDUA 5EOYA 3SJJA 2YV0X 1FKOA 1W2BM 4N47A 3CETA 5CZ1A 1DT9A 3OS0A 1S5JA 3AVLA 4OPAA 4WQ5C 3O4NA 1GLDG 1SL0A 1XHXA 3ULEA 4U7BA 4OO1J 3ZT0A 3DAWA 4KHYA 3TAMA 3OTOK 3FGUA 3EY1A 3CJ7A 4BR7A 1JCGA 4BROA 5KTQA 4FLUA 4DF8A 3CJAA 3JS6A 2EHGA 4ELVA 4O44A 2P9SA 1NGBA 3AVIA 3NGZA 2UUBK 4PL7A 1TK5A 4M42A 3BUZB 2UU9K 4GV6A 1Q9XA 1VQNN 3OYAA 4CJVA 4BR5A 3M5RA 2O8EB 3SI6A 3QMLA 3TAEA 3VF6A 1EO1A 2YNGA 4KREA 3KK2A 4ILGB 5ADXA 4H0OA 1YXQA 1X9SA 3L4QA 3VQ7A 2ZGZA 4YDUA 2ITMA 3V9XA 3L4IA 3HP9A 2E2NA 3OYFA 2F8TA 4CBUA 4MLEA 1UOCA 1LWFA 2CGLA 3HTVA 4HWIA 4F3OA 1GLCG 4YORA 3T19A 5T7BA 1V4SA 2X6NA 4FL9A 4BRPA 2EWSA 1EETA 2HMPA 2VG7A 2HVIA 1P90A 4CJEA 5C24A 3DYAA 5TKYA 4KHUA 4EHTA 1U49A 3K5LA 3LDOA 3BP8A 4Z4IA 4FJ5A 3I0RA 4KH6A 3KLHA 4FM2A 2HBJA 3W3DA 1QTMA 4BGAA 4BRHA 5HOOA 4WQ4A 4FPAA 2BUPA 4FW2A 3HXMA 4BE0A 4Y1DA 1S1UA 1HQUA 3CF5L 1KAYA 1HYSA 2D0PA 5CZ2A 5AFUA 3L2WA 2O8FA 3LM9A 5EX5A 3MDQA 3OJUA 2XY6A 2HHWA 3C95A 3OYMA 3OYGA 5FPNA 3FZLA 3P38A 4BVPA 4PL8A 2GBZA 4HTLA 3A2FA 2QXFA 3O4WA 3L2VA 4DTOA 1NMDA 4PA1A 5BN8A 3DLRA 3ZETB 3K5OA 1BUPA 5M1OA 3DOKA 3SK3A 2DFHA 1QQNA 3CQXA 4BRDA 3NCIA 4IG3A 2Q97A 3VTIA 1YAGA 3LPTA 4CFDA 4JK9A 4BRFA 5C2FA 4DR5K 4DV2K 4G9ZA 2BTFA 1YJ9N 4JAXA 1Q86O 1IKYA 3PO4A 4FJLA 5AQRA 2X74A 1RTDA 4B9LA 4FZYA 2IAJA 5KPZA 5GIOA 1HJRA 4IG0A 3CXCM 3EZWA 3LWLA 1Z05A 1D5AA 4JKFA 4DQPA 4BRGA 3BEXA 4BACA 3RMDA 2RPIA 1HKBA 5KGWA 1U45A 4B9MA 4CGHA 4FSVA 3E9PA 2Z1JA 1HX1A 3TI0A 1U6ZA 1RDDA 4DCHA 5J2PA 2YJFA 1EP4A 1QZ5A 1BGXT 3SLCA 3CMEN 1RT4A 4CZIA 3KLFA 4DFPA 3A8YA 3TPQA 4O5FA 5AZJA 4R79A 3EKUA 2OANA 2DFFA 4CJPA 1W9HA 2NRRA 2V51B 2BE2A 3M8RA 1JKHA 3QDKA 4IFEA 3HI0A 3HRGA 1FW6A 1RT5A 4KHSA 3I55N 2PYJA 4CVNE 4JRQA 2XO7A 4YOVA 4MO5A 4Z4GA 5KRSA 3DWLA 3HOSA 4CEFA 1H1VA 3RR8A 3TTFA 3CCJN 4IFVA 2FBVA 2P9IB 4B3TK 4WCEL 4FJIA 1DTQA 1YHQN 3VN5A 4DLGA 1NGFA 3HPGA 1REVA 2FBTA 4LSLA 1B9DA 1NK9A 1LWCA 3CC4N 1D9FA 3SBGA 5BRDA 3P31A 3HOTA 4CF1A 2E8AA 3L2RA 2G8KA 4CFAA 3TR8A 1KXPA 4HUFA 3AY9A 2P1JA 3THVA 5KQ8A 3QETA 3IS9A 2GUPA 1HNVA 4DTJA 1VQ9N 3RRHA 2D4WA 3MX5A 2QWLA 1ATSA 3F73A 1NU0A 3ULEB 3VQBA 4DHYA 4W5NA 4ELTA 3FZMA 4E7KA 2WC9A 3DXMA 3MX2A 4WFAL 4JYAK 1LOTB 3WXJA 2QTDA 4B8AB 4FJMA 3O3GA 1ZBHA 5H1SQ 4DU3A 4KHQA 5JLHA 1XQSC 3MEEA 3NH0A 2NZTA 1VQ4N 4M3UA 1S1TA 4XIUA 3N4PA 4DR6K 3U4LA 4OKEA 4AHVA 4JNEA 3K5NA 1VRUA 1SS6A 4A2AA 3LP1A 2ZM6K 3NF9A 5AQTA 4H5NA 5CE3A 1FXXA 1QS4A 2ZGYA 2A1RA 4J2EA 1T44A 3VENA 4IO8A 1EKEA 1HR0K 4LFCK 4CHZA 2O8CA 2PY5A 3ZSQA 5FDLA 2HHTA 3DMJA 4BRIA 1S1VA 3CI5A 4CF0A 2FC0A 4DSIA 3QEPA 4CI6A 3P83D 4O4GA 2VGNA 5C25A 3MAQA 1OH8A 1C0MA 4JRPA 1N36K 1UWBA 3EL2A 3MN5A 3BF1A 1W0HA 1VSLA 5F2RA 2O8DA 1C0UA 4MDAA 4E89A 2E6MA 1BDGA 4OJRA 4FLYA 3UKRB 4OLBA 4N41A 4FWPA 3M1FA 1WN7A 2RHKA 1QSLA 4C8OA 4BR0A 4FPBA 4K43A 1OH6A 3AVBA 4MQ3A 4JI3K 1LAVA 3HM8A 2KLAA 4ZHRA 2GEMA 5AQXA 5AQIA 1EXQA 5FPDA 4JD2B 1RCHA 4LD0A 3ZSXA 4YOTA 3WNFA 3RRGA 1CZAN 3QBWA 5AQMA 4B9SA 2P9PB 1VSFA 1QSSA 3BGRA 2GWKA 2IIRA 2QWPA 3PX0A 1OH7A 3MN6A 4LY7A 4YOXA 2YHWA 4H4OA 3OYLA 4CD3A 5M1PA 1VQ5N 4KKOA 5EXWA 3PIPL 4Z4HA 4DMNA 3TABA 2P9UA 5HROA 2O8BB 3E66A 3GBTA 2P9NB 3RMCA 4WF9L 1XHZA 4YY3K 4FO0A 3TU5A 1A5VA 1NGEA 3R8EA 4AH9A 1JLBA 1KFDA 1NM1A 3TTDA 4PKIA 4BC2A 3IKMA 1K73O 4CK1A 3IG1A 4AILC 1K9MO 4A2BA 1JCFA 3DXKB 4DTSA 3LP2A 4AM6A 4DV7K 1BISA 1GLEG 4I6MA 1NGJA 4OGCA 4CJ3A 2XHBA 4HCBA 1VQLN 1B9FA 3AVHA 2ZE2A 3VA3A 4IEIA 2W41A 4QAGA 4DQRA 3OYBA 3LP3A 4ID5A 4GVMA 1BQNA 1E3MA 1YF5L 4B3SK 4IO9L 2FXUA 4DUZK 3O5BA 4CEAA 1S9GA 4DTXA 2FBYA 4BWMA 2HBMA 1HMVA 1XC9A 5HBMA 1C0GA 3OHRA 3M8SA 2G8UA 2FLOA 3ZLJA 1KRPA 3GDQA 1WUAA 1WSIA 4DTMA 4KRFA 3PUFA 5HRSA 4UY8O 4MFBA 4HVJA 4ILJA 1U4BA 2PBDA 3OYIA 3SBTA 4HUGA 1CZBA 3LDPA 5FRMA 3K5MA 3VMFB 2KZMA 1TL3A 4EZ9A 1X1PA 4H5VA 4FLWA 1HLUA 3D2FB 1W97L 4J2DA 3C0BA 4QS8A 4PKHA 1TKTA 2E2QA 3EN9A 1YJNN 2O8DB 4LC9B 3QB0A 2QKBA 4Z94A 3SV4A 3CJ9A 1TUYA 4K41A 2KZZA 3THYA 4IXCA 5C42A 1SKWA 5FROA 4NLCA 3AA5X 3OYDA 3IMXA 1WSEA 1J6ZA 2OTJN 5AJ3K 2CH6A 3ZSVA 4LFAK 2WFBA 1T7PA 1WBBA 1RT7A 4KH4A 1ZBUA 1SZ2A 1MA9B 3VQ5A 2D0OA 5C12A 2QEXN 1BG3A 2IOCA 3EEQA 3S41A 4IJAA 4CJKA 4CJ4A 3ZT1A 2G8WA 3NHGA 2Z1IA 3WNEA 1TYQA 3SV3A 4H4MA 2DY4A 2FSKA 4WE1A 4RWTA 2QXLA 3KWGA 4XEIA 1RBTA 3IFRA 2IGIA 3CC7N 3O8MA 2QWRA 4R5PA 2NRTA 3CM5A 1RT3A 3QICA 1HQEA 5DMRA 3A5OC 4DU1A 4JI7K 4BRMA 4N56A 4OKKA 3V6DA 1BI4B 5BRHA 4E7IA 4C1NI 4KV8A 3AO1A 3E1YA 3MEDA 2Q0RA 3K0SA 2NRVA 3RMBA 4LF8K 4B3MK 1LV5A 1IG8A 3DI6A 3JXUA 3KK3A 4DWIA 3ZSYA 4HTUA 3CYMA 1DKGD 3FZFA 5M1QA 3VQPA 4DV1K 3CFRA 4IOAL 1E4FT 3LP0A 3DLHA 3OYKA 2XY5A 1ZBIA 1GOCA 3QIPA 5FLXO 1NJWA 4JS5A 4B8CA 3H3NO 5AQFA 1Q9YA 3SCXA 1U04A 2HNYA 3O9TA 3OY9A 1VQ6N 3WNHA 4NB4A 2PYLA 1ATRA 3S3NA 4GMJB 5JLFA 1SL2A 4FJXA 3ZT3A 1G15A 3CIPA 4BVOA 4RCHA 1TUUA 3R3LA 3QO9A 3PSIA 4JN4A 4HCCA 3H1VX 2P9UB 2O8BA 4ILHA 3NBPA 4OKJA 2O8EA 2W40A 3IDHA 4JKGB 1HPZA 5JS1A 3KHYA 1XWLA 4FWMA 3FZKA 5FPEA 1NK5A 2HNZA 5ELZA 1HNZK 3WEEB 3HYFA 1VHXA 3H3OB 1U2VB 4H0YB 2D0AA 1NGCA 1A5XA 5DM7L 4B9TA 3KD5E 1NGDA 3EO3A 4I9QA 1NK4A 3E9LA 1L3VA 3CCQN 3MWTA 1MWKA 4AHCA 3KWIA 3ALYA 1YVUA 3HPHA 4YHHK 3T7ZA 5E41A 1LWEA 5KPRA 4H0PA 1TK8A 1T3VA 4BRKA 3I8BA 2KFNA 2UXBK 3KIOA 4I2PA 1QVGM 3V9SA 5CYMA 5F1XA 5F0XA 4DS5A 4FW1A 3O9UA 3J7ZO 4JD2A 4CGIA 2Q1NA 3U6FA 4CGDA 2ZQBA 3DOLA 2YCHA 1BHLA 3OYEA 1Z26A 1KAXA 1RNHA 2BH1A 4RW6A 3ID6A 3NE6A 1IBKK 4RW8A 4A59A 1SUQA 2Y1JA 4CJ5A 3OBWA 3PSFA 1J5OA 4BG8A 1ZBLA 1ASVA 4ZTJA 3VEVA 3G4SN 1W7AA 5A2QO 1RBSA 3DLBA 2GTDA 4FJJA 3THXB 4ISEA 3VESA 4B1XB 5AFUH 3L8BA 3AA2A 3F2KA 1I3AA 1L3UA 3ZEUB 3NVMA 4JI0K 5EVZA 1T05A 4PHTX 1WSFA 4KTZA 3D2EA 2W42A 3CPWM 4CJ7A 4A62A 4C8KA 2E2OA 4B1ZA 3LWMA 4XH4A 4JI5K 1YT3A 3SYZA 1ZBFA 1O1WA 4BQZA 1QE1A 3T1YK 4DV4K 4QOZB 1BO5O 1DGKN
chains in the Genus database with same CATH topology
1SS6A 3OA9A 4A2AA 2FF6A 4DKWA 5AQTA 4BRLA 4H5NA 5CE3A 2V7YA 1VQ7N 3WQUA 3WQTA 2ZGYA 3GOIA 3ID8A 3D6RA 2A41A 4OPHA 1T44A 4Y0WA 3VENA 3O9RA 3F5TA 4IO8A 4YOYA 1VQMN 1Q7YO 3O80A 3KZBA 4JKDA 4MO4A 3ATVA 4GV3A 3HSCA 4B1YB 2NRWA 1R59O 3UKUB 4H5TA 4JKCA 1YITN 4BRIA 4XH1A 3CI5A 3AAQA 3VF2A 3VGKA 1GLLO 4H5RA 1IJJA 1NLVA 4CI6A 3EE9A 5KQDA 1C0FA 1XUPO 2ZF5O 3MN9A 2VGNA 1HJOA 4BC5A 5AZIB 3F9MA 5LJVA 1GLAG 2ZJRL 1NGAA 3WXLA 4YOWA 3L6QA 4E1JA 3EL2A 3MN5A 3BF1A 3SMSA 5C2DA 1TYQB 1BA1A 1BWFO 1T6DA 3P4IA 3O1WA 4MDAA 5F2RA 3VEWA 4WFNL 1BDGA 5AZIA 2FF3B 3K9JA 3Q7BA 3UKRB 2CGKA 3R9PA 2YHXA 5M1NA 2A42A 4FWPA 4K25A 3LDLA 3M1FA 3WXIA 2RHKA 4NLBA 3K9KA 4O8KA 4M7YA 5AQKA 1O13A 5BRFA 2ZJPL 1Q18A 1VAZA 4BR0A 2E1YA 4FPBA 4K43A 4BRQA 1YIJN 3HM8A 3ENHA 4WQ4C 3GG4A 2KLAA 3FE1A 4F9OA 4GVEA 4M63C 2GEMA 3MWPA 3RVCA 4IEEA 5AQWA 4MLHA 5AQXA 3EKSA 5AQIA 3CQYA 4CZHA 5FPDA 5C0YA 4JD2B 4FWNA 1KD1O 3P39A 4JKHA 4JKAA 4IZ9A 3ZX0A 5GAHP 5M1FA 4YOTA 3SAHA 3UKUA 4H5WA 1CZAN 3QBWA 1U2VA 4IWVA 5AQMA 2P9PB 1LCUA 5GIPA 3G25A 3RSEB 4BY9C 3SAFA 2HBLA 2QA4N 2GWKA 2IIRA 3TTCA 3CHWA 4H0XB 3A5LC 3CJBA 2GELA 4BR9A 2QWPA 3MN6A 4EFHA 4YOXA 2YHWA 2P9LA 3UB5A 3CJCA 3DXKA 5M1PA 4CD3A 4YDUC 3H45C 5BPLA 1VQ5N 4XH5A 5EXWA 5E26A 5B8HA 3PIPL 2QWOA 2FSNA 3CPEA 4DB3A 5C15A 2P9UA 4CD1A 3E66A 3GBTA 1OKJA 2A40A 4FWSA 3Q7CA 4FWRA 2P9NB 2NRXA 4GY2B 3CMAN 1XC3A 1DGKN 4JK8A 4B1WB 4WF9L 4WQ5A 4BGBA 4FO0A 3TU5A 1NGEA 3DXMB 3R8EA 2D1KA 1HKGA 4BREA 3C65A 3R1XA 1NM1A 2JWKA 3TTDA 4PKIA 3U9DA 2WBNA 4BC2A 3IKMA 4K42A 5DM6L 2DPNA 3LDNA 1K73O 1M1KO 1K9MO 3WXKA 5JVHL 4A2BA 1JCFA 3DXKB 5AQHA 4AM6A 3ZX3A 4QS9A 5FPMA 1GLBG 4JKBA 1GLEG 4I6MA 2J4RA 1NGJA 1ZBSA 4H03B 3B8AX 1HKCA 2QWQA 1YJWN 2P9SB 3AAPA 1RGIA 4JK7A 1VQPN 1VQLN 4BRNA 2ASMA 4IEIA 1VQ8N 1BU6O 3OW2M 2W41A 2UYTA 3ENOA 1K8AO 2VGMA 5BPMA 3VETA 2Q31A 1M90O 1YI2N 2QWMA 3M6GA 3FR0A 3QFUA 3SMPA 1YF5L 4B9QA 2HBKA 3VPZA 2AA4A 5MLCQ 2KKZA 2NRZA 1GLJO 4IO9L 3A0IX 2FXUA 1Q81O 1YVNA 3O1BA 3WT0A 2HSTA 3O5BA 1N8RO 2PAVA 5E84A 3NVKA 2FSJA 5CR4A 1RDUA 3U8XA 2HBMA 5EOYA 2IVNA 2NRHA 3D7EO 5JMVA 1W2BM 3CETA 1C0GA 2V52B 3OHRA 1DT9A 2FLOA 3J8AA 4AM7A 1ZC6A 3M3ZA 3FZHA 3GDQA 1WUAA 2Q0UA 4OPAA 4WQ5C 4DQ8A 4FWQA 1GLDG 2I7PA 4UY8O 2NLXA 4ILJA 4CBWA 2PBDA 2QM1A 3ULEA 1NGHA 3HZ6A 4M7XA 3SBTA 3LDPA 2GX9A 5GAEP 4U7BA 4OO1J 1DEJA 1SAZA 3DAWA 3VMFB 4C23A 5AQGA 3FGUA 3CJ7A 4H5VA 1HLUA 2IVPA 4BR7A 4WFBL 3D2FB 5GAGP 2ZWHA 1JCGA 4BROA 1KC8O 3CJAA 3JS6A 4KH5A 3WEEA 1W97L 4ISGA 3VEOA 2P9SA 2I7NA 3C0BA 1NGBA 4PKHA 4QS8A 1T6CA 2WUSA 2E2QA 2HF3A 4B1UB 3EN9A 4CZEA 3BUZB 4PL7A 1YJNN 4GV6A 3G71N 1D4XA 4LC9B 1VQNN 4JKGA 3QB0A 5AQNA 4Z94A 5AQYA 3CJ9A 1TUYA 3C6HA 3D2FA 4BR5A 5I9EB 2CGJA 3M5RA 4K41A 3ZX2A 3CD6N 4IXCA 4IOCL 3QMLA 5AQVA 3CCRN 4FWKA 4NLCA 3VF6A 5C10A 1EO1A 2RE2A 3IMXA 4ILGB 1J6ZA 2OTJN 4FWLA 4H0OA 5ADXA 2CH6A 1YXQA 3G6EN 3CERA 3L4QA 2WFBA 2ZGZA 3D2EB 4YDUA 2ITMA 4B1VA 3ZETA 4KH4A 4BQLA 3W0LA 3L4IA 2P9NA 2E2NA 3VEYA 1SZ2A 1MA9B 4JKEA 4CBUA 4KBOA 3VEZA 4MDBA 4J8FA 2D0OA 4MLEA 5C12A 2QEXN 2CGLA 2JWLA 3HTVA 4HWIA 1BG3A 3S41A 3VERA 4IJAA 4CZKA 1GLCG 4YORA 1VQKN 3O9SA 1HPMA 3EE8A 3I33A 1KAZA 1V4SA 4O8UA 3TSQA 3WUHA 3O6WA 4FL9A 2NNWA 2KHOA 3ENBA 4BRPA 2EWSA 1K8KA 2AP1A 2HMPA 3O08A 5AQSA 3VF4A 1TYQA 1P90A 3CCLN 1JJ2M 2FSKA 5EY4A 2QXLA 4RWTA 3KWGA 4XEIA 5TKYA 3IFRA 3T69A 2A6AA 4NO7A 1HUXA 4IDHA 1NJIO 3CC2N 1E4GT 3CC7N 3O8MA 2QWRA 3A5MC 5AZJB 4A61A 3VOVA 4EHTA 3VGMA 2NRTA 3QICA 5AQZA 3LDOA 4BRAA 4C1NK 3BP8A 4U67L 4GV9A 1OVYA 3A5OC 4CZMA 1QQOA 4BRMA 4KH6A 5BRHA 2HBJA 2E20A 4C1NI 5JICA 3W3DA 3PLAA 3H6EA 3E1YA 4BGAA 4BRHA 2Q0RA 5HOOA 4WQ4A 3MMVA 4FPAA 2BUPA 2NRVA 3BF3A 2E1ZA 3CF5L 5LJWA 1KAYA 1X3NA 1IG8A 2D0PA 3JXUA 3FFKB 5AFUA 3CJ1A 3C7NB 3LM9A 5AQUA 5EX5A 3MDQA 4RTFD 2Q2RA 1DKGD 3FZFA 3QFPA 5M1QA 2ASOA 5FPNA 4IOAL 1E4FT 2CH5A 3VEXA 3FZLA 1Z6RA 3P38A 1KQSM 4BVPA 4PL8A 2PFUA 4HTLA 4BRCA 3QBXA 3H3NO 5AQFA 5M1KA 3O4WA 1NMDA 5BN8A 5AQQA 5HL7L 3O9TA 4IJNA 3ZETB 1NGGA 2F7TA 1BUPA 5BN9A 5M1OA 1VQ6N 3SK3A 5BR9A 2VWBA 3CQXA 1QQNA 5TKWA 1JCEA 4NB4A 4BRDA 4BC3A 1ATRA 2Q97A 3VTIA 1YAGA 3RSEA 5CHIA 1BOTO 4JK9A 4BRFA 1RFQA 5C2FA 3N4QA 5JLFA 4G9ZA 2BTFA 3MCAB 4JAXA 3CCMN 1YJ9N 1Q86O 1RDWX 3CIPA 4BVOA 5AQRA 4RCHA 1S3XA 4BG9A 3U9ZA 5BPNA 3CCVN 1TUUA 5KPZA 3IUCA 3R3LA 4JN4A 5GIOA 3CXCM 4CZGA 3H1VX 2QW9A 3EZWA 2P9UB 1Z05A 4JKFA 5GINA 4ILHA 4BRGA 3BEXA 4I6MB 2W40A 3IDHA 1NGIA 1V4TA 1HKBA 5LY3A 3SJHA 4FSVA 1QQMA 4JKGB 4BC4A 3KHYA 3GE1A 5AR0A 3E9PA 2QI2A 4FWMA 4FOEA 5AQJA 2ASPA 3FZKA 1HX1A 4AF1A 1U6ZA 4EIAA 1Y64A 1GLFO 5FPEA 1SQKA 4DCHA 2YJFA 5ELZA 5AQPA 2QWNA 3WEEB 4ISFA 4PKGA 4CZJA 5ADXH 5AQLA 2ZJQL 3H3OB 1U2VB 4H0YB 1P8ZA 1QZ5A 1NGCA 4A5BA 5DM7L 3SLCA 1NGDA 4QS7A 3CMEN 3ZYYX 3AGKA 4CZIA 3EO3A 3A8YA 3TPQA 4O5FA 1ZXOA 3E9LA 3TSPA 5AZJA 4R79A 2V7ZA 3EKUA 3SAGA 3MK6A 2OANA 4BR4A 3OBYA 1YUWA 3CCQN 2YHYA 2GWJA 3MWTA 3AARA 3KK7A 2NRRA 4FVUA 1MWKA 2VYPA 4A57A 2V51B 3LM2A 3KWIA 5BREA 3LDQA 2VCPA 1S72N 3TSUA 1K8KB 3QDKA 3L0QA 2P9LB 3HI0A 3HRGA 4IFEA 4EAHD 3T7ZA 3H46O 3CCSN 3UE5A 5KPRA 4H0PA 2HOEA 3I55N 1T3VA 4MO5A 5AQOA 1EQYA 4YOVA 1WOQA 3O9QA 4BRKA 3DWLA 3HOSA 2H3GX 1H1VA 1X9JA 3I8BA 3TTFA 3CCJN 2P9IB 2P9KB 3HBTA 1G99A 4JHDB 4WCEL 1QVGM 5F1XA 1YHQN 5F0XA 1NGFA 2A3ZA 3I56N 4WYBA 1X3MA 3O9UA 3J7ZO 4JD2A 3A5NC 2Q1NA 3FLCO 3C6AA 4CZLA 3KVGA 2Q36A 2YCHA 1BA0A 1KAXA 2BH1A 3CC4N 3CCEN 3ID6A 3SBGA 2E88A 5BRDA 3P31A 3HOTA 4IOXA 2YI1A 3WXMB 2E8AA 4A59A 2OTLN 4CBXA 1ESVA 3OBWA 1NWKA 4BG8A 3AGRA 1KXPA 3AY9A 5GADP 5KQ8A 3VEVA 3G4SN 3ZEUA 2GUPA 4H0TB 4H0VB 5JVGL 1VQ9N 2D4WA 2GTDA 3ATUA 3MX5A 4YOUA 1QZ6A 4FOIA 2QWLA 3MCPA 4ISEA 3VGLA 1ATNA 1ATSA 4GNIA 3VESA 4B1XB 5AFUH 3F2KA 4A5AA 5KPTA 2E2PA 3H1QA 1MWMA 3ULEB 3ZEUB 4L3QA 2IVOA 4DHYA 1Q82O 3NVMA 3FZMA 3UKRA 4FWOA 3C7NA 2WC9A 3DXMA 5EVZA 3MX2A 4WFAL 4PHTX 3E9OA 1LOTB 4BR2A 1VQON 2YX6A 3WXJA 2QTDA 2HF4A 1MDUB 3LL3A 3PIOL 3D2EA 4CZFA 1NBWA 4JEPA 1QVFM 3GL1A 5H1SQ 3CPWM 3NMUA 5JLHA 3R6MA 3DLLL 1XQSC 4CJ7A 3MN7A 4A62A 1ILYA 2E2OA 4B1ZA 2YJEA 3DJCA 4XH4A 4EHUA 2P9PA 2F9TA 1QHAA 3VTHA 2NZTA 4BQZA 1VQ4N 4JHDA 3CCUN 3N4PA 2P9IA 2A5XA 1BO5O 2P9KA 3U4LA 2F9WA 4JNEA 1S22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2A A;  2FF6 A;  5AQT A;  4BRL A;  4H5N A;  5CE3 A;  2V7Y A;  3WQU A;  3WQT A;  2ZGY A;  3GOI A;  3ID8 A;  2A41 A;  1T44 A;  4Y0W A;  3VEN A;  4IO8 A;  3O80 A;  3KZB A;  4MO4 A;  3ATV A;  3HSC A;  4B1Y B;  1R59 O;  3UKU B;  4H5T A;  4BRI A;  4XH1 A;  3CI5 A;  3AAQ A;  3VF2 A;  3VGK A;  1GLL O;  4H5R A;  1IJJ A;  1NLV A;  4CI6 A;  5KQD A;  1C0F A;  1XUP O;  2ZF5 O;  3MN9 A;  1HJO A;  4BC5 A;  5AZI B;  3F9M A;  5LJV A;  1GLA G;  1NGA A;  3WXL A;  3L6Q A;  4E1J A;  3EL2 A;  3MN5 A;  3BF1 A;  3SMS A;  1TYQ B;  1BA1 A;  1BWF O;  1T6D A;  3P4I A;  3O1W A;  5F2R A;  3VEW A;  1BDG A;  5AZI A;  2FF3 B;  3UKR B;  2CGK A;  3R9P A;  2YHX A;  2A42 A;  4FWP A;  4K25 A;  3LDL A;  3M1F A;  3WXI A;  4O8K A;  4M7Y A;  5AQK A;  5BRF A;  1Q18 A;  4BR0 A;  2E1Y A;  4FPB A;  4K43 A;  4BRQ A;  3HM8 A;  3ENH A;  4WQ4 C;  3GG4 A;  3FE1 A;  4F9O A;  4M63 C;  2GEM A;  5AQW A;  4MLH A;  5AQX A;  3EKS A;  5AQI A;  3CQY A;  4CZH A;  5FPD A;  4JD2 B;  4FWN A;  4IZ9 A;  3ZX0 A;  3UKU A;  4H5W A;  1CZA N;  3QBW A;  1U2V A;  4IWV A;  5AQM A;  2P9P B;  1LCU A;  3G25 A;  3RSE B;  2GWK A;  2IIR A;  3CHW A;  4H0X B;  3A5L C;  3CJB A;  2GEL A;  4BR9 A;  2QWP A;  3MN6 A;  4EFH A;  2YHW A;  2P9L A;  3UB5 A;  3CJC A;  3DXK A;  4CD3 A;  5BPL A;  4YDU C;  3H45 C;  4XH5 A;  5EXW A;  5E26 A;  5B8H A;  2QWO A;  2FSN A;  4DB3 A;  2P9U A;  4CD1 A;  3GBT A;  1OKJ A;  2A40 A;  4FWS A;  4FWR A;  2P9N B;  4GY2 B;  1XC3 A;  1DGK N;  4B1W B;  4WQ5 A;  4BGB A;  4FO0 A;  3TU5 A;  1NGE A;  3DXM B;  3R8E A;  2D1K A;  1HKG A;  4BRE A;  1NM1 A;  3U9D A;  4PKI A;  4BC2 A;  4K42 A;  2DPN A;  3LDN A;  3WXK A;  4A2B A;  1JCF A;  3DXK B;  5AQH A;  4AM6 A;  3ZX3 A;  4QS9 A;  5FPM A;  1GLB G;  1GLE G;  4I6M A;  2J4R A;  1NGJ A;  1ZBS A;  4H03 B;  3B8A X;  1HKC A;  2QWQ A;  2P9S B;  3AAP A;  1RGI A;  4BRN A;  2ASM A;  1BU6 O;  2W41 A;  2UYT A;  3ENO A;  5BPM A;  3VET A;  2Q31 A;  2QWM A;  3M6G A;  3FR0 A;  3QFU A;  3SMP A;  4B9Q A;  3VPZ A;  2AA4 A;  1GLJ O;  3A0I X;  2FXU A;  1YVN A;  3O1B A;  3WT0 A;  3O5B A;  2PAV A;  5E84 A;  2FSJ A;  3U8X A;  5EOY A;  2IVN A;  2NRH A;  3D7E O;  5JMV A;  3CET A;  1C0G A;  2V52 B;  3OHR A;  2FLO A;  3J8A A;  4AM7 A;  1ZC6 A;  3M3Z A;  3FZH A;  3GDQ A;  1WUA A;  2Q0U A;  4WQ5 C;  4DQ8 A;  4FWQ A;  1GLD G;  2I7P A;  2NLX A;  4CBW A;  2PBD A;  2QM1 A;  3ULE A;  1NGH A;  3HZ6 A;  4M7X A;  3LDP A;  1DEJ A;  1SAZ A;  3DAW A;  4C23 A;  5AQG A;  3FGU A;  3CJ7 A;  4H5V A;  1HLU A;  2IVP A;  4BR7 A;  3D2F B;  2ZWH A;  1JCG A;  4BRO A;  3CJA A;  3JS6 A;  3WEE A;  4ISG A;  3VEO A;  2P9S A;  2I7N A;  3C0B A;  1NGB A;  4PKH A;  4QS8 A;  1T6C A;  2WUS A;  2E2Q A;  2HF3 A;  4B1U B;  3EN9 A;  4CZE A;  3BUZ B;  4PL7 A;  1D4X A;  4LC9 B;  5AQN A;  3QB0 A;  4Z94 A;  5AQY A;  3CJ9 A;  1TUY A;  3D2F A;  4BR5 A;  5I9E B;  2CGJ A;  4K41 A;  3ZX2 A;  4IXC A;  3QML A;  5AQV A;  4FWK A;  3VF6 A;  3IMX A;  1J6Z A;  4FWL A;  4H0O A;  5ADX A;  2CH6 A;  1YXQ A;  3CER A;  2ZGZ A;  3D2E B;  4YDU A;  2ITM A;  4B1V A;  3ZET A;  4BQL A;  3W0L A;  3L4I A;  2P9N A;  2E2N A;  3VEY A;  1SZ2 A;  1MA9 B;  4CBU A;  4KBO A;  3VEZ A;  4J8F A;  2D0O A;  4MLE A;  2CGL A;  3HTV A;  4HWI A;  1BG3 A;  3S41 A;  3VER A;  4IJA A;  4CZK A;  1GLC G;  1HPM A;  3I33 A;  1KAZ A;  1V4S A;  3WUH A;  3O6W A;  4FL9 A;  4BRP A;  2KHO A;  2EWS A;  1K8K A;  2AP1 A;  2HMP A;  3O08 A;  5AQS A;  3VF4 A;  1TYQ A;  2FSK A;  5EY4 A;  2QXL A;  4RWT A;  4XEI A;  5TKY A;  3IFR A;  2A6A A;  4NO7 A;  1HUX A;  1E4G T;  3O8M A;  2QWR A;  3A5M C;  5AZJ B;  4A61 A;  3VOV A;  4EHT A;  3VGM A;  3QIC A;  5AQZ A;  3LDO A;  4BRA A;  3BP8 A;  3A5O C;  4CZM A;  1QQO A;  4BRM A;  5BRH A;  2E20 A;  5JIC A;  3W3D A;  3H6E A;  4BGA A;  4BRH A;  2Q0R A;  4WQ4 A;  3MMV A;  4FPA A;  2BUP A;  3BF3 A;  2E1Z A;  5LJW A;  1KAY A;  1X3N A;  1IG8 A;  2D0P A;  3JXU A;  3FFK B;  5AFU A;  3CJ1 A;  3C7N B;  3LM9 A;  5AQU A;  5EX5 A;  3MDQ A;  4RTF D;  2Q2R A;  1DKG D;  3FZF A;  3QFP A;  2ASO A;  5FPN A;  1E4F T;  2CH5 A;  3VEX A;  3FZL A;  1Z6R A;  4BVP A;  4PL8 A;  4HTL A;  4BRC A;  3QBX A;  3H3N O;  5AQF A;  3O4W A;  1NMD A;  5BN8 A;  5AQQ A;  4IJN A;  3ZET B;  1NGG A;  1BUP A;  5BN9 A;  3SK3 A;  5BR9 A;  2VWB A;  3CQX A;  1QQN A;  1JCE A;  4NB4 A;  4BRD A;  4BC3 A;  1ATR A;  2Q97 A;  1YAG A;  3RSE A;  1BOT O;  4BRF A;  1RFQ A;  5JLF A;  2BTF A;  4JAX A;  1RDW X;  3CIP A;  4BVO A;  5AQR A;  4RCH A;  1S3X A;  4BG9 A;  3U9Z A;  5BPN A;  1TUU A;  5KPZ A;  3IUC A;  4JN4 A;  4CZG A;  3H1V X;  2QW9 A;  3EZW A;  2P9U B;  1Z05 A;  4BRG A;  3BEX A;  4I6M B;  2W40 A;  3IDH A;  1NGI A;  1V4T A;  1HKB A;  5LY3 A;  3SJH A;  4FSV A;  1QQM A;  4BC4 A;  3KHY A;  3GE1 A;  5AR0 A;  4FWM A;  4FOE A;  5AQJ A;  2ASP A;  3FZK A;  1HX1 A;  4EIA A;  1U6Z A;  1Y64 A;  1GLF O;  5FPE A;  1SQK A;  4DCH A;  2YJF A;  5ELZ A;  5AQP A;  2QWN A;  3WEE B;  4ISF A;  4PKG A;  4CZJ A;  5ADX H;  5AQL A;  3H3O B;  1U2V B;  4H0Y B;  1P8Z A;  1QZ5 A;  1NGC A;  3SLC A;  1NGD A;  4QS7 A;  4CZI A;  3EO3 A;  3A8Y A;  3TPQ A;  4O5F A;  1ZXO A;  5AZJ A;  2V7Z A;  3EKU A;  3MK6 A;  2OAN A;  4BR4 A;  1YUW A;  2YHY A;  2GWJ A;  3AAR A;  1MWK A;  2VYP A;  2V51 B;  3LM2 A;  5BRE A;  3LDQ A;  2VCP A;  1K8K B;  3QDK A;  3L0Q A;  2P9L B;  3HI0 A;  4EAH D;  3H46 O;  3UE5 A;  5KPR A;  4H0P A;  2HOE A;  4MO5 A;  5AQO A;  1EQY A;  1WOQ A;  4BRK A;  3DWL A;  2H3G X;  1H1V A;  1X9J A;  3I8B A;  2P9I B;  2P9K B;  3HBT A;  1G99 A;  4JHD B;  5F1X A;  5F0X A;  1NGF A;  2A3Z A;  4WYB A;  1X3M A;  4JD2 A;  3A5N C;  2Q1N A;  3FLC O;  4CZL A;  3KVG A;  2Q36 A;  2YCH A;  1BA0 A;  1KAX A;  5BRD A;  2E88 A;  2YI1 A;  2E8A A;  4CBX A;  1ESV A;  1NWK A;  4BG8 A;  1KXP A;  3AY9 A;  5KQ8 A;  3VEV A;  3ZEU A;  2GUP A;  4H0T B;  4H0V B;  2D4W A;  2GTD A;  3ATU A;  3VGL A;  1QZ6 A;  4FOI A;  2QWL A;  3MCP A;  4ISE A;  1ATN A;  1ATS A;  4GNI A;  3VES A;  4B1X B;  5AFU H;  5KPT A;  2E2P A;  3H1Q A;  1MWM A;  3ULE B;  3ZEU B;  4L3Q A;  2IVO A;  4DHY A;  3FZM A;  3UKR A;  4FWO A;  3C7N A;  3DXM A;  5EVZ A;  4BR2 A;  1LOT B;  3WXJ A;  2HF4 A;  1MDU B;  3LL3 A;  3D2E A;  4CZF A;  1NBW A;  3GL1 A;  5JLH A;  3R6M A;  1XQS C;  4CJ7 A;  3MN7 A;  4A62 A;  2E2O A;  4B1Z A;  2YJE A;  3DJC A;  4XH4 A;  4EHU A;  2P9P A;  2F9T A;  1QHA A;  2NZT A;  4BQZ A;  4JHD A;  2P9I A;  2A5X A;  1BO5 O;  2P9K A;  3U4L A;  2F9W A;  4JNE A;  1S22 A; 
#chains in the Genus database with same CATH topology
 3OA9 A;  3AVF A;  1VSM A;  4DKW A;  4DR1 K;  3THW A;  3KLE A;  4FLZ A;  2V7Y A;  1I39 A;  3GOI A;  1B92 A;  3D6R A;  1N5Y A;  4O0J A;  4YOY A;  1VQM N;  4DSF A;  4G1Q A;  4JKD A;  4GV3 A;  4JS4 A;  3V9U A;  4DQQ A;  3HSC A;  3J7A P;  3JYT A;  4DLE A;  4J2B A;  4PWD A;  3UKU B;  3CQ8 A;  4M3T A;  4H5R A;  1IJJ A;  4Z4E A;  4OVL A;  4B9V A;  1HJO A;  4BC5 A;  3EZ5 A;  4CFB A;  3ZSW A;  5LJV A;  2ZJR L;  4BDY A;  2HHH K;  3L6Q A;  3SUN A;  5C2D A;  1BWF O;  3O1W A;  5AZI A;  2FF3 B;  1Y97 A;  4CJF A;  3R9P A;  2OPS A;  1KLM A;  3HM9 A;  4O8K A;  4ID1 A;  5AQK A;  2ZJP L;  1HRH A;  1Q18 A;  1KLN A;  5LMU K;  2HND A;  3ENH A;  3HT3 A;  4GVE A;  1HYZ A;  4B9N A;  4LH4 A;  2BGG A;  1K6Y A;  1VSE A;  2YKM A;  4FWN A;  4M3X A;  3S9H A;  3P39 A;  4JKH A;  4JKA A;  1TAQ A;  3LAM A;  2HMI A;  4FM1 A;  5GAH P;  3RTV A;  3UKU A;  3F9K A;  1X9M A;  5D3G A;  4LH5 A;  4OPJ A;  1FK9 A;  4FJK A;  1WNS A;  3CJB A;  4KO0 A;  1BIZ A;  4BR9 A;  2VG6 A;  3AV9 A;  4LSN A;  3UB5 A;  1WAJ A;  5B8H A;  3CPE A;  4DB3 A;  5C15 A;  4CD1 A;  3D0P A;  2WOM A;  1IV0 A;  3Q7C A;  1BIU A;  1GOA A;  4GY2 B;  2NRX A;  2A1S A;  3CMA N;  1JLQ A;  4FXD A;  4JK8 A;  4WQ5 A;  4IKF A;  3DXM B;  4BRE A;  4DFM A;  1ASW A;  1WSH A;  2YNF A;  1KCF A;  2WBN A;  5DM6 L;  4K42 A;  2P51 A;  3OJS A;  3DRP A;  5JVH L;  4OPK A;  3V9W A;  1T8E A;  1SKR A;  4KPY A;  3ZX3 A;  5FPM A;  3UIQ A;  2B5J A;  1D9D A;  3B8A X;  1HKC A;  2QWQ A;  2P9S B;  3AAP A;  1RGI A;  4JK7 A;  4FZX C;  4BRN A;  2ASM A;  2IC3 A;  3HL8 A;  2Q3S A;  1RDA A;  1K8A O;  4EZ6 A;  2VGM A;  5BPM A;  3VET A;  2Q31 A;  4CK3 A;  1M90 O;  4B3R K;  1NOZ A;  2QWM A;  3M6G A;  3SPY A;  3VPZ A;  2AA4 A;  2KKZ A;  1Q81 O;  1YVN A;  3WT0 A;  2Z1G A;  3SUQ A;  2FSJ A;  3M8P A;  3U8X A;  3SZ2 A;  2IVN A;  2NRH A;  4FK4 A;  1VSI A;  2UUC K;  2D0C A;  4FYD A;  4AM7 A;  1RBV A;  4DQ8 A;  4F2S A;  2NLX A;  2QM1 A;  3QIN A;  4M7X A;  5GAE P;  2GX9 A;  2X6S A;  3MXJ A;  5HRR A;  3ASM A;  2IVP A;  4WFB L;  3QLH A;  3QNO A;  3QER A;  1KC8 O;  2W6L A;  3WEE A;  5FRN A;  4BDZ A;  4ISG A;  3VEO A;  2I7N A;  1NK8 A;  1T6C A;  4CJS A;  4CJT A;  4CZE A;  4B1U B;  4DFK A;  1ITG A;  4ELU A;  4FLX A;  4JKG A;  5AQN A;  3U3G A;  3PV8 A;  3C6H A;  3D2F A;  5I9E B;  3ZX2 A;  3CD6 N;  2AJQ A;  4JV5 K;  1F21 A;  3L3V A;  5AQV A;  4CJU A;  4FWK A;  5C10 A;  3CCR N;  3AO2 A;  4NCB A;  2O8C B;  3LAN A;  1XMO K;  3CER A;  4EP5 A;  3FFI A;  1VK0 A;  3D2E B;  4BQL A;  1CZ9 A;  3ZET A;  4E7L A;  3W0L A;  4LF5 K;  2BDP A;  3AVG A;  1I94 K;  4KBO A;  3VEZ A;  4MDB A;  4J8F A;  3MXI A;  4DSJ A;  3CM6 A;  3VER A;  3NDK A;  2KTQ A;  1VQK N;  4GKJ K;  4OX9 K;  3VQD A;  3VQC A;  4F3T A;  1HPM A;  3EE8 A;  3I33 A;  4K8Z A;  1KAZ A;  4O8U A;  3TSQ A;  3KJV A;  1KSP A;  4I9L A;  2NNW A;  2KHO A;  4CGF A;  3S3M A;  1K8K A;  2AP1 A;  2FBX A;  1U48 A;  5IWA K;  5EY4 A;  2BAN A;  4NO7 A;  1HUX A;  4IDH A;  1TK0 A;  1NJI O;  3CC2 N;  3A5M C;  5AZJ B;  4A61 A;  3VOV A;  3VGM A;  5AQZ A;  4LFB K;  4GV9 A;  1OVY A;  4CZM A;  2KFZ A;  1RTJ A;  2E20 A;  5JIC A;  4IDK A;  3KLG A;  4X64 K;  3PLA A;  2YNH A;  4KI4 A;  3RMA A;  3MMV A;  3SUO A;  3BF3 A;  2E1Z A;  3T1H K;  4DSL A;  5LJW A;  4CCH A;  5AQU A;  2Q2R A;  1C1B A;  3VQ4 A;  3SUP A;  3TAP A;  3AVK A;  5LL6 Z;  1KVB A;  3QBX A;  4OGE A;  3OS2 A;  1TVR A;  5M1K A;  1A5W A;  1Z25 A;  5AQQ A;  4IJN A;  1NGG A;  5BN9 A;  4CEO A;  2VWB A;  1XI1 A;  3RSE A;  5CHI A;  4CEQ A;  4CFC A;  1GOB A;  4JI6 K;  3CCM N;  1RDW X;  3VQ9 A;  3V4I A;  1S3X A;  4BG9 A;  1JLF A;  3U9Z A;  5BPN A;  1C1A A;  3CCV N;  3IUC A;  4HUE A;  2YHB A;  1LW0 A;  2E6L A;  4CZG A;  1NJZ A;  4FJH A;  4DTU A;  5GIN A;  3CFP A;  4N5S A;  3OYH A;  1NGI A;  1V4T A;  3AVA A;  3BDP A;  5LY3 A;  3SJH A;  1QQM A;  2O4G A;  4BC4 A;  4CJR A;  5AR0 A;  3GE1 A;  2ASP A;  1Y64 A;  1S9E A;  1SQK A;  4PY5 A;  5AQP A;  2QWN A;  2ZJQ L;  3G10 A;  1J54 A;  3HVT A;  4A5B A;  4O0I A;  3I0S A;  4QS7 A;  3ZYY X;  4ICL A;  3PO5 A;  4CER A;  1ZXO A;  2ETJ A;  3SAG A;  2V7Z A;  3RWU A;  4BR4 A;  1YUW A;  2YHY A;  2D5R A;  2GWJ A;  3AAR A;  4A57 A;  4M41 A;  3VQQ A;  3THY B;  1BI4 A;  3AVC A;  1K8K B;  3L0Q A;  4DTN A;  1L3T A;  4DFJ A;  4IBN A;  3CCS N;  3AO3 A;  4DR3 K;  3UE5 A;  1UA1 A;  1NKC A;  4K8X A;  2ITG A;  3IRX A;  1EQY A;  3O9Q A;  2KQ2 A;  1JLC A;  1RDC A;  4BWJ A;  3C94 A;  4CEB A;  2NUB A;  2VQF K;  4GKK K;  4DUY K;  1G99 A;  3SPZ A;  1BQM A;  3I56 N;  2A3Z A;  4WYB A;  1X3M A;  4DTP A;  3G0Z A;  4W5T A;  1S6P A;  3A5N C;  1JL1 A;  3FLC O;  3HK2 A;  3KKR A;  1JLA A;  3L2Q A;  3C6A A;  4CZL A;  1OVQ A;  2Q36 A;  3KVG A;  4CHP A;  4DF4 A;  4FLV A;  3U3Y A;  2P5G A;  5J2Q A;  2B4J A;  3VQE A;  4KB0 A;  4L8R B;  3CCE N;  1CXQ A;  2E88 A;  1WSJ A;  4IOX A;  2YI1 A;  4DSK A;  3KTQ A;  1NWK A;  3ZEU A;  3S3O A;  4FJ7 A;  4FJ8 A;  3VA0 A;  3ATU A;  4AHT A;  3MCP A;  2G8H A;  3LZJ A;  2E2P A;  1MWM A;  3P5J A;  2IVO A;  3UKR A;  4DV5 K;  4FWO A;  3C7N A;  2IS3 A;  2E5L K;  4CED A;  1VQO N;  2YX6 A;  4DR2 K;  1MDU B;  1NBW A;  3GL1 A;  4KB1 A;  3T1A A;  3DM2 A;  3NMU A;  3HP6 A;  3J80 O;  3DLL L;  5I3U A;  3MN7 A;  1ILY A;  2P9P A;  2F9T A;  1VSJ A;  4AHS A;  3VTH A;  2YNI A;  2G8I A;  4KHW A;  4JHD A;  3TAG A;  1NKE A;  2P9K A;  2A5X A;  1DLO A;  3KD1 E;  2F9W A;  5SZT A;  3H08 A;  4M3Y A;  2FF6 A;  4BRL A;  1JXE A;  1NG9 A;  1VQ7 N;  3WQU A;  4CEZ A;  3V81 A;  3WQT A;  2D0B A;  3ID8 A;  4OPH A;  2P5O A;  1YTA A;  2Y1I A;  1S1W A;  1Q7Y O;  4I7F A;  1DTT A;  2JGU A;  4CE9 A;  2HHQ A;  3L2U A;  4JKC A;  1YIT N;  3VF2 A;  3VGK A;  1GLL O;  1NLV A;  3NF6 A;  4I2Q A;  3EE9 A;  5KQD A;  1NK7 A;  1XUP O;  3PX4 A;  4CEC A;  4HHT A;  3ZSR A;  1BCM A;  5AZI B;  3F9M A;  1GLA G;  1XMQ K;  2R7Y A;  1NGA A;  4YOW A;  3EYZ A;  4FCY A;  3AO4 A;  4E1J A;  1TYQ B;  1BA1 A;  1T6D A;  4WFN L;  3L3U A;  2CGK A;  3NF7 A;  2EX3 A;  1EX4 A;  4K25 A;  4CF8 A;  4NLB A;  3ZCM A;  3K9K A;  5I42 A;  2YHA A;  4M7Y A;  4E0D A;  3WNG A;  2ZD1 A;  5BRF A;  3VQA A;  1VAZ A;  2E1Y A;  4BRQ A;  5BR8 K;  5K14 A;  1LAW A;  1YIJ N;  4ZTF A;  3FE1 A;  1RTH A;  4F9O A;  3ULD A;  3HVR A;  4M63 C;  4IEE A;  3CQY A;  4DV6 K;  1KD1 O;  3JSM A;  4H8K A;  1TL1 A;  4AQY K;  4IZ9 A;  4Z0U A;  3AVJ A;  2WON A;  4H5W A;  1ZYQ A;  4KAZ A;  4LF9 K;  1U2V A;  4IWV A;  4NYN A;  3NFA A;  3RSE B;  4BY9 C;  3SAF A;  4M3W A;  2QA4 N;  4J2A A;  3A5L C;  3ZSO A;  2P9L A;  2HHS A;  4YDU C;  3H45 C;  4F4K A;  4W5R A;  2WTU A;  2QWO A;  2FSN A;  2QK9 A;  5IT9 O;  4M45 A;  3K57 A;  2VG5 A;  3QIO A;  1XC3 A;  4JLH A;  1JL2 A;  1XNR K;  1TV6 A;  2D1K A;  2JLE A;  2XY7 A;  5LMN K;  1BCO A;  3C65 A;  3ISN C;  1NK0 A;  1OH5 A;  1M1K O;  4RW4 A;  4BDP A;  3B6P A;  2UUA K;  4CJW A;  1TKD A;  4QS9 A;  3HPO A;  3TWH A;  3NAE A;  1ZBS A;  4H03 B;  3LAL A;  3LDS A;  3BZC A;  1QQC A;  3E01 A;  1BU6 O;  3OW2 M;  3CG7 A;  3QES A;  2QKK A;  3B6O A;  3D45 A;  3QEI A;  2X78 A;  1YI2 N;  1CXU A;  1IBM K;  4B9U A;  3FR0 A;  3SMP A;  1NOY A;  1FJG K;  1NJX A;  2HBK A;  5MLC Q;  3A0I X;  4C8M A;  3O1B A;  1UAX A;  4OLA A;  4E3S A;  3AVN A;  1X9W A;  1RT6 A;  4KHP K;  3D7E O;  5JMV A;  3DLE A;  2V52 B;  1RT2 A;  3J8A A;  3NGY A;  1ZC6 A;  3M3Z A;  3FZH A;  3T3F A;  3K58 A;  2Q0U A;  3NH2 A;  4FWQ A;  2I7P A;  2VWJ A;  2UXC K;  4CBW A;  4RG8 A;  1RBR A;  1NGH A;  3HZ6 A;  1DEJ A;  1SAZ A;  4K0K K;  3SNN A;  4C23 A;  5AQG A;  4KFB A;  2RKI A;  5GAG P;  1RDB A;  2ZWH A;  4CIE A;  4KH5 A;  4NXN K;  2HW3 A;  2WUS A;  2HF3 A;  3DRS A;  1HNX K;  3G71 N;  1D4X A;  1VRT A;  1JLE A;  3TAQ A;  1KTQ A;  5DK5 A;  5AQY A;  5SWM A;  4Z4C A;  4AHU A;  3LZI A;  2CGJ A;  1SL1 A;  4IOC L;  3J7Y P;  1WSG A;  2RF2 A;  3OS1 A;  2RE2 A;  1N32 K;  4FWL A;  3G6E N;  1XNQ K;  2VQE K;  4B1V A;  4JI8 K;  2HVH A;  2P9N A;  3VEY A;  4JKE A;  1HNW K;  2JWL A;  4GW6 A;  4C8N A;  1WAF A;  4Y1C A;  4CZK A;  1N6Q A;  4UQG A;  4RW9 A;  1S6Q A;  3O9S A;  3IAY A;  5KRT A;  1KVA A;  3WUH A;  1MU2 A;  3O6W A;  4CHN A;  4FLT A;  3ENB A;  3CFO A;  3VF4 A;  3O08 A;  1JXB A;  5AQS A;  2KW4 A;  3CCL N;  1TGO A;  1VSD A;  1JJ2 M;  4LF7 K;  5J1E A;  2ATQ A;  3T69 A;  3QEV A;  2A6A A;  3RR7 A;  4CEE A;  3SQ1 A;  1E4G T;  1C1C A;  1NNE A;  5KGX A;  4BRA A;  4C1N K;  4U67 L;  4CHY A;  2OA8 A;  4Z4F A;  3BY5 A;  1QQO A;  1VSK A;  4M3R A;  3NH1 A;  5J2N A;  4DV0 K;  1NK6 A;  4DTR A;  1RT1 A;  3H6E A;  4CHQ A;  1J9A A;  4CES A;  3V1O A;  2HB5 A;  1X3N A;  3FFK B;  3I8D A;  3CJ1 A;  3C7N B;  1IG9 A;  4RTF D;  3QFP A;  2O4I A;  2ASO A;  3AA3 A;  3KKS A;  4Q0B A;  1RIL A;  4M3Z A;  2CH5 A;  3VEX A;  1Z6R A;  3V1Q A;  1KQS M;  2PFU A;  1J5E K;  4BRC A;  3HST B;  4O55 A;  2RN2 A;  1ASU A;  4FJG A;  5HL7 L;  3C6T A;  3AO5 A;  4O5B A;  4W5Q A;  2F7T A;  1CLQ A;  3VQ8 A;  4JI4 K;  5BR9 A;  3KK1 A;  5TKW A;  2UXD K;  1JCE A;  2OZS A;  4BC3 A;  4N76 A;  1BOT O;  5J2M A;  4E7J A;  1RFQ A;  2I5J A;  3N4Q A;  3MCA B;  1U47 A;  1TAU A;  1NMN A;  4BE2 A;  4CK2 A;  4W5O A;  2Z1H A;  4TSX A;  2QW9 A;  4LF6 K;  2DFE A;  4YFU A;  4I6M B;  1KFS A;  2GUI A;  3K59 A;  2PZS A;  2OPQ A;  4CJL A;  1LW2 A;  4FOE A;  2QI2 A;  5AQJ A;  3QNN A;  4AF1 A;  4EIA A;  2F4V K;  1GLF O;  1BL3 A;  5ADX H;  4CZJ A;  4ISF A;  4PKG A;  3MXM A;  5AQL A;  3V1R A;  4FJ9 A;  4JI2 K;  1P8Z A;  4FZZ A;  3AGK A;  3PX6 A;  3TSP A;  3LAK A;  3MK6 A;  3OBY A;  3KK7 A;  3C6U A;  4FVU A;  2VYP A;  3LM2 A;  5BRE A;  3LDQ A;  2VCP A;  4X62 K;  4QCL A;  1IKV A;  1S72 N;  3TSU A;  2P9L B;  2LSN A;  4EAH D;  4DR4 K;  3H46 O;  1WBD A;  2HOE A;  4F8R A;  5AQO A;  3SQ4 A;  1WOQ A;  2H3G X;  1X9J A;  1J53 A;  5KI6 A;  3OYJ A;  1N33 K;  2P9K B;  2G8V A;  4FVM A;  3HBT A;  4JHD B;  4NCG A;  2VWK A;  2B6A A;  3THW B;  3O3F A;  1BA0 A;  1UA0 A;  1IH7 A;  3WXM B;  2OTL N;  2W6K A;  3HJF A;  4CBX A;  1WB9 A;  1ESV A;  2OPR A;  4X66 K;  3AGR A;  4E1M A;  5GAD P;  4CF9 A;  4CIG A;  1HNI A;  4H0T B;  4H0V B;  5JVG L;  4FK2 A;  1NJY A;  4YOU A;  3VGL A;  1QZ6 A;  4FOI A;  1ATN A;  4GNI A;  3DLG A;  4A5A A;  5KPT A;  3H1Q A;  4L3Q A;  1Q82 O;  3NGI A;  5JS2 A;  3OVN A;  3E9O A;  4BR2 A;  4EP4 A;  2HF4 A;  3LL3 A;  3PIO L;  3DRR A;  4CHO A;  5CYQ A;  4CZF A;  5CY4 A;  4JEP A;  1N34 K;  3BZK A;  1QVF M;  3R6M A;  1RBU A;  3LPU A;  3QEX A;  4DG1 A;  2IDO A;  2YJE A;  2GV9 A;  3DJC A;  4PUO A;  5HRP A;  4EHU A;  2OCE A;  2E4L A;  3QEW A;  3AVM A;  1QHA A;  3ITH A;  1FKP A;  3KLI A;  3CCU N;  2P9I A;  4CJQ A;  1C6V A;  1R0A A;  4NYF A;  1S22 A;  3J81 O;  4DQI A;  5HP1 A;  5HRN A;  1WLJ A;  2DTU A;  4FK0 A;  2A41 A;  4B08 A;  2O8F B;  4Y0W A;  3O9R A;  3F5T A;  3O3H A;  3O80 A;  3KZB A;  2HHU A;  3ZSZ A;  4MO4 A;  3ATV A;  4Q5V A;  1RTI A;  4AHR A;  3P1G A;  4B1Y B;  2NRW A;  4NXM K;  1EWQ A;  2OZM A;  1R59 O;  4H5T A;  1VSH A;  3ZT2 A;  4XH1 A;  3AAQ A;  2HHX A;  2YKN A;  4B3O A;  1C0F A;  2ZF5 O;  1L5U A;  4CIF A;  4DQS A;  3MN9 A;  1L3S A;  2OYQ A;  1NKB A;  1YTU A;  3WXL A;  3NF8 A;  3SMS A;  4V19 S;  3VEW A;  3P4I A;  4FM0 A;  4JI1 K;  4E7H A;  3AA4 A;  3HO1 A;  3K9J A;  2F96 A;  3Q7B A;  2YHX A;  5M1N A;  2A42 A;  4DU4 A;  3WXI A;  3LDL A;  4KI6 A;  3ZT4 A;  3TAF A;  4KHN A;  1O13 A;  4IFY A;  3O4Q A;  1IO2 A;  4WQ4 C;  4X65 K;  3GG4 A;  3RVC A;  3MWP A;  1IKX A;  4DR7 K;  5AQW A;  4MLH A;  1HYV A;  4NCA A;  3EKS A;  4CZH A;  4RW7 A;  5C0Y A;  1Q8I A;  4DV3 K;  1S1X A;  3DLK A;  3ZX0 A;  4DS4 A;  5HLF A;  5M1F A;  3SAH A;  4FJN A;  1QSY A;  2XY8 A;  4E19 A;  2F8S A;  4E1N A;  1LCU A;  2G8F A;  1QHT A;  5GIP A;  3G25 A;  3TAR A;  2HBL A;  3TTC A;  3CHW A;  1TKZ A;  4H0X B;  4CGG A;  2GEL A;  3PY8 A;  4EFH A;  1T03 A;  3JAM O;  3CJC A;  3DXK A;  5BPL A;  4XH5 A;  1IBL K;  4C8L A;  5E26 A;  3K2P A;  1EWR A;  3SQ0 A;  4BE1 A;  1OKJ A;  4CGJ A;  2A40 A;  4FWS A;  2HHV A;  4FWR A;  4DSE A;  4B1W B;  3MEG A;  4BGB A;  1C0T A;  1HKG A;  3OYC A;  3R1X A;  2JWK A;  3U9D A;  3OYN A;  2DPN A;  3LDN A;  1SKS A;  3WXK A;  4KTQ A;  3V9Z A;  4PQU A;  3VQ6 A;  5AQH A;  3MEC A;  4CW7 B;  4F2R A;  1GLB G;  3TAN A;  4JKB A;  1D8Y A;  2J4R A;  3SQ2 A;  1YJW N;  4LF4 K;  4YNQ A;  1VQP N;  5EU7 A;  1VQ8 N;  2OPP A;  4CF2 A;  2UYT A;  4KTW A;  3ENO A;  2XRI A;  1JLG A;  3M8Q A;  3THX A;  1IKW A;  1SV5 A;  3QFU A;  4B9Q A;  2NRZ A;  1TKX A;  1GLJ O;  1N8R O;  2HST A;  2PAV A;  5E84 A;  1KVC A;  3NVK A;  5CR4 A;  1RDU A;  5EOY A;  3SJJ A;  2YV0 X;  1FKO A;  1W2B M;  4N47 A;  3CET A;  5CZ1 A;  1DT9 A;  3OS0 A;  1S5J A;  3AVL A;  4OPA A;  4WQ5 C;  3O4N A;  1GLD G;  1SL0 A;  1XHX A;  3ULE A;  4U7B A;  4OO1 J;  3ZT0 A;  3DAW A;  4KHY A;  3TAM A;  3OTO K;  3FGU A;  3EY1 A;  3CJ7 A;  4BR7 A;  1JCG A;  4BRO A;  5KTQ A;  4FLU A;  4DF8 A;  3CJA A;  3JS6 A;  2EHG A;  4ELV A;  4O44 A;  2P9S A;  1NGB A;  3AVI A;  3NGZ A;  2UUB K;  4PL7 A;  1TK5 A;  4M42 A;  3BUZ B;  2UU9 K;  4GV6 A;  1Q9X A;  1VQN N;  3OYA A;  4CJV A;  4BR5 A;  3M5R A;  2O8E B;  3SI6 A;  3QML A;  3TAE A;  3VF6 A;  1EO1 A;  2YNG A;  4KRE A;  3KK2 A;  4ILG B;  5ADX A;  4H0O A;  1YXQ A;  1X9S A;  3L4Q A;  3VQ7 A;  2ZGZ A;  4YDU A;  2ITM A;  3V9X A;  3L4I A;  3HP9 A;  2E2N A;  3OYF A;  2F8T A;  4CBU A;  4MLE A;  1UOC A;  1LWF A;  2CGL A;  3HTV A;  4HWI A;  4F3O A;  1GLC G;  4YOR A;  3T19 A;  5T7B A;  1V4S A;  2X6N A;  4FL9 A;  4BRP A;  2EWS A;  1EET A;  2HMP A;  2VG7 A;  2HVI A;  1P90 A;  4CJE A;  5C24 A;  3DYA A;  5TKY A;  4KHU A;  4EHT A;  1U49 A;  3K5L A;  3LDO A;  3BP8 A;  4Z4I A;  4FJ5 A;  3I0R A;  4KH6 A;  3KLH A;  4FM2 A;  2HBJ A;  3W3D A;  1QTM A;  4BGA A;  4BRH A;  5HOO A;  4WQ4 A;  4FPA A;  2BUP A;  4FW2 A;  3HXM A;  4BE0 A;  4Y1D A;  1S1U A;  1HQU A;  3CF5 L;  1KAY A;  1HYS A;  2D0P A;  5CZ2 A;  5AFU A;  3L2W A;  2O8F A;  3LM9 A;  5EX5 A;  3MDQ A;  3OJU A;  2XY6 A;  2HHW A;  3C95 A;  3OYM A;  3OYG A;  5FPN A;  3FZL A;  3P38 A;  4BVP A;  4PL8 A;  2GBZ A;  4HTL A;  3A2F A;  2QXF A;  3O4W A;  3L2V A;  4DTO A;  1NMD A;  4PA1 A;  5BN8 A;  3DLR A;  3ZET B;  3K5O A;  1BUP A;  5M1O A;  3DOK A;  3SK3 A;  2DFH A;  1QQN A;  3CQX A;  4BRD A;  3NCI A;  4IG3 A;  2Q97 A;  3VTI A;  1YAG A;  3LPT A;  4CFD A;  4JK9 A;  4BRF A;  5C2F A;  4DR5 K;  4DV2 K;  4G9Z A;  2BTF A;  1YJ9 N;  4JAX A;  1Q86 O;  1IKY A;  3PO4 A;  4FJL A;  5AQR A;  2X74 A;  1RTD A;  4B9L A;  4FZY A;  2IAJ A;  5KPZ A;  5GIO A;  1HJR A;  4IG0 A;  3CXC M;  3EZW A;  3LWL A;  1Z05 A;  1D5A A;  4JKF A;  4DQP A;  4BRG A;  3BEX A;  4BAC A;  3RMD A;  2RPI A;  1HKB A;  5KGW A;  1U45 A;  4B9M A;  4CGH A;  4FSV A;  3E9P A;  2Z1J A;  1HX1 A;  3TI0 A;  1U6Z A;  1RDD A;  4DCH A;  5J2P A;  2YJF A;  1EP4 A;  1QZ5 A;  1BGX T;  3SLC A;  3CME N;  1RT4 A;  4CZI A;  3KLF A;  4DFP A;  3A8Y A;  3TPQ A;  4O5F A;  5AZJ A;  4R79 A;  3EKU A;  2OAN A;  2DFF A;  4CJP A;  1W9H A;  2NRR A;  2V51 B;  2BE2 A;  3M8R A;  1JKH A;  3QDK A;  4IFE A;  3HI0 A;  3HRG A;  1FW6 A;  1RT5 A;  4KHS A;  3I55 N;  2PYJ A;  4CVN E;  4JRQ A;  2XO7 A;  4YOV A;  4MO5 A;  4Z4G A;  5KRS A;  3DWL A;  3HOS A;  4CEF A;  1H1V A;  3RR8 A;  3TTF A;  3CCJ N;  4IFV A;  2FBV A;  2P9I B;  4B3T K;  4WCE L;  4FJI A;  1DTQ A;  1YHQ N;  3VN5 A;  4DLG A;  1NGF A;  3HPG A;  1REV A;  2FBT A;  4LSL A;  1B9D A;  1NK9 A;  1LWC A;  3CC4 N;  1D9F A;  3SBG A;  5BRD A;  3P31 A;  3HOT A;  4CF1 A;  2E8A A;  3L2R A;  2G8K A;  4CFA A;  3TR8 A;  1KXP A;  4HUF A;  3AY9 A;  2P1J A;  3THV A;  5KQ8 A;  3QET A;  3IS9 A;  2GUP A;  1HNV A;  4DTJ A;  1VQ9 N;  3RRH A;  2D4W A;  3MX5 A;  2QWL A;  1ATS A;  3F73 A;  1NU0 A;  3ULE B;  3VQB A;  4DHY A;  4W5N A;  4ELT A;  3FZM A;  4E7K A;  2WC9 A;  3DXM A;  3MX2 A;  4WFA L;  4JYA K;  1LOT B;  3WXJ A;  2QTD A;  4B8A B;  4FJM A;  3O3G A;  1ZBH A;  5H1S Q;  4DU3 A;  4KHQ A;  5JLH A;  1XQS C;  3MEE A;  3NH0 A;  2NZT A;  1VQ4 N;  4M3U A;  1S1T A;  4XIU A;  3N4P A;  4DR6 K;  3U4L A;  4OKE A;  4AHV A;  4JNE A;  3K5N A;  1VRU A;  1SS6 A;  4A2A A;  3LP1 A;  2ZM6 K;  3NF9 A;  5AQT A;  4H5N A;  5CE3 A;  1FXX A;  1QS4 A;  2ZGY A;  2A1R A;  4J2E A;  1T44 A;  3VEN A;  4IO8 A;  1EKE A;  1HR0 K;  4LFC K;  4CHZ A;  2O8C A;  2PY5 A;  3ZSQ A;  5FDL A;  2HHT A;  3DMJ A;  4BRI A;  1S1V A;  3CI5 A;  4CF0 A;  2FC0 A;  4DSI A;  3QEP A;  4CI6 A;  3P83 D;  4O4G A;  2VGN A;  5C25 A;  3MAQ A;  1OH8 A;  1C0M A;  4JRP A;  1N36 K;  1UWB A;  3EL2 A;  3MN5 A;  3BF1 A;  1W0H A;  1VSL A;  5F2R A;  2O8D A;  1C0U A;  4MDA A;  4E89 A;  2E6M A;  1BDG A;  4OJR A;  4FLY A;  3UKR B;  4OLB A;  4N41 A;  4FWP A;  3M1F A;  1WN7 A;  2RHK A;  1QSL A;  4C8O A;  4BR0 A;  4FPB A;  4K43 A;  1OH6 A;  3AVB A;  4MQ3 A;  4JI3 K;  1LAV A;  3HM8 A;  2KLA A;  4ZHR A;  2GEM A;  5AQX A;  5AQI A;  1EXQ A;  5FPD A;  4JD2 B;  1RCH A;  4LD0 A;  3ZSX A;  4YOT A;  3WNF A;  3RRG A;  1CZA N;  3QBW A;  5AQM A;  4B9S A;  2P9P B;  1VSF A;  1QSS A;  3BGR A;  2GWK A;  2IIR A;  2QWP A;  3PX0 A;  1OH7 A;  3MN6 A;  4LY7 A;  4YOX A;  2YHW A;  4H4O A;  3OYL A;  4CD3 A;  5M1P A;  1VQ5 N;  4KKO A;  5EXW A;  3PIP L;  4Z4H A;  4DMN A;  3TAB A;  2P9U A;  5HRO A;  2O8B B;  3E66 A;  3GBT A;  2P9N B;  3RMC A;  4WF9 L;  1XHZ A;  4YY3 K;  4FO0 A;  3TU5 A;  1A5V A;  1NGE A;  3R8E A;  4AH9 A;  1JLB A;  1KFD A;  1NM1 A;  3TTD A;  4PKI A;  4BC2 A;  3IKM A;  1K73 O;  4CK1 A;  3IG1 A;  4AIL C;  1K9M O;  4A2B A;  1JCF A;  3DXK B;  4DTS A;  3LP2 A;  4AM6 A;  4DV7 K;  1BIS A;  1GLE G;  4I6M A;  1NGJ A;  4OGC A;  4CJ3 A;  2XHB A;  4HCB A;  1VQL N;  1B9F A;  3AVH A;  2ZE2 A;  3VA3 A;  4IEI A;  2W41 A;  4QAG A;  4DQR A;  3OYB A;  3LP3 A;  4ID5 A;  4GVM A;  1BQN A;  1E3M A;  1YF5 L;  4B3S K;  4IO9 L;  2FXU A;  4DUZ K;  3O5B A;  4CEA A;  1S9G A;  4DTX A;  2FBY A;  4BWM A;  2HBM A;  1HMV A;  1XC9 A;  5HBM A;  1C0G A;  3OHR A;  3M8S A;  2G8U A;  2FLO A;  3ZLJ A;  1KRP A;  3GDQ A;  1WUA A;  1WSI A;  4DTM A;  4KRF A;  3PUF A;  5HRS A;  4UY8 O;  4MFB A;  4HVJ A;  4ILJ A;  1U4B A;  2PBD A;  3OYI A;  3SBT A;  4HUG A;  1CZB A;  3LDP A;  5FRM A;  3K5M A;  3VMF B;  2KZM A;  1TL3 A;  4EZ9 A;  1X1P A;  4H5V A;  4FLW A;  1HLU A;  3D2F B;  1W97 L;  4J2D A;  3C0B A;  4QS8 A;  4PKH A;  1TKT A;  2E2Q A;  3EN9 A;  1YJN N;  2O8D B;  4LC9 B;  3QB0 A;  2QKB A;  4Z94 A;  3SV4 A;  3CJ9 A;  1TUY A;  4K41 A;  2KZZ A;  3THY A;  4IXC A;  5C42 A;  1SKW A;  5FRO A;  4NLC A;  3AA5 X;  3OYD A;  3IMX A;  1WSE A;  1J6Z A;  2OTJ N;  5AJ3 K;  2CH6 A;  3ZSV A;  4LFA K;  2WFB A;  1T7P A;  1WBB A;  1RT7 A;  4KH4 A;  1ZBU A;  1SZ2 A;  1MA9 B;  3VQ5 A;  2D0O A;  5C12 A;  2QEX N;  1BG3 A;  2IOC A;  3EEQ A;  3S41 A;  4IJA A;  4CJK A;  4CJ4 A;  3ZT1 A;  2G8W A;  3NHG A;  2Z1I A;  3WNE A;  1TYQ A;  3SV3 A;  4H4M A;  2DY4 A;  2FSK A;  4WE1 A;  4RWT A;  2QXL A;  3KWG A;  4XEI A;  1RBT A;  3IFR A;  2IGI A;  3CC7 N;  3O8M A;  2QWR A;  4R5P A;  2NRT A;  3CM5 A;  1RT3 A;  3QIC A;  1HQE A;  5DMR A;  3A5O C;  4DU1 A;  4JI7 K;  4BRM A;  4N56 A;  4OKK A;  3V6D A;  1BI4 B;  5BRH A;  4E7I A;  4C1N I;  4KV8 A;  3AO1 A;  3E1Y A;  3MED A;  2Q0R A;  3K0S A;  2NRV A;  3RMB A;  4LF8 K;  4B3M K;  1LV5 A;  1IG8 A;  3DI6 A;  3JXU A;  3KK3 A;  4DWI A;  3ZSY A;  4HTU A;  3CYM A;  1DKG D;  3FZF A;  5M1Q A;  3VQP A;  4DV1 K;  3CFR A;  4IOA L;  1E4F T;  3LP0 A;  3DLH A;  3OYK A;  2XY5 A;  1ZBI A;  1GOC A;  3QIP A;  5FLX O;  1NJW A;  4JS5 A;  4B8C A;  3H3N O;  5AQF A;  1Q9Y A;  3SCX A;  1U04 A;  2HNY A;  3O9T A;  3OY9 A;  1VQ6 N;  3WNH A;  4NB4 A;  2PYL A;  1ATR A;  3S3N A;  4GMJ B;  5JLF A;  1SL2 A;  4FJX A;  3ZT3 A;  1G15 A;  3CIP A;  4BVO A;  4RCH A;  1TUU A;  3R3L A;  3QO9 A;  3PSI A;  4JN4 A;  4HCC A;  3H1V X;  2P9U B;  2O8B A;  4ILH A;  3NBP A;  4OKJ A;  2O8E A;  2W40 A;  3IDH A;  4JKG B;  1HPZ A;  5JS1 A;  3KHY A;  1XWL A;  4FWM A;  3FZK A;  5FPE A;  1NK5 A;  2HNZ A;  5ELZ A;  1HNZ K;  3WEE B;  3HYF A;  1VHX A;  3H3O B;  1U2V B;  4H0Y B;  2D0A A;  1NGC A;  1A5X A;  5DM7 L;  4B9T A;  3KD5 E;  1NGD A;  3EO3 A;  4I9Q A;  1NK4 A;  3E9L A;  1L3V A;  3CCQ N;  3MWT A;  1MWK A;  4AHC A;  3KWI A;  3ALY A;  1YVU A;  3HPH A;  4YHH K;  3T7Z A;  5E41 A;  1LWE A;  5KPR A;  4H0P A;  1TK8 A;  1T3V A;  4BRK A;  3I8B A;  2KFN A;  2UXB K;  3KIO A;  4I2P A;  1QVG M;  3V9S A;  5CYM A;  5F1X A;  5F0X A;  4DS5 A;  4FW1 A;  3O9U A;  3J7Z O;  4JD2 A;  4CGI A;  2Q1N A;  3U6F A;  4CGD A;  2ZQB A;  3DOL A;  2YCH A;  1BHL A;  3OYE A;  1Z26 A;  1KAX A;  1RNH A;  2BH1 A;  4RW6 A;  3ID6 A;  3NE6 A;  1IBK K;  4RW8 A;  4A59 A;  1SUQ A;  2Y1J A;  4CJ5 A;  3OBW A;  3PSF A;  1J5O A;  4BG8 A;  1ZBL A;  1ASV A;  4ZTJ A;  3VEV A;  3G4S N;  1W7A A;  5A2Q O;  1RBS A;  3DLB A;  2GTD A;  4FJJ A;  3THX B;  4ISE A;  3VES A;  4B1X B;  5AFU H;  3L8B A;  3AA2 A;  3F2K A;  1I3A A;  1L3U A;  3ZEU B;  3NVM A;  4JI0 K;  5EVZ A;  1T05 A;  4PHT X;  1WSF A;  4KTZ A;  3D2E A;  2W42 A;  3CPW M;  4CJ7 A;  4A62 A;  4C8K A;  2E2O A;  4B1Z A;  3LWM A;  4XH4 A;  4JI5 K;  1YT3 A;  3SYZ A;  1ZBF A;  1O1W A;  4BQZ A;  1QE1 A;  3T1Y K;  4DV4 K;  4QOZ B;  1BO5 O;  1DGK N; 
#chains in the Genus database with same CATH homology
 1SS6 A;  3OA9 A;  4A2A A;  2FF6 A;  4DKW A;  5AQT A;  4BRL A;  4H5N A;  5CE3 A;  2V7Y A;  1VQ7 N;  3WQU A;  3WQT A;  2ZGY A;  3GOI A;  3ID8 A;  3D6R A;  2A41 A;  4OPH A;  1T44 A;  4Y0W A;  3VEN A;  3O9R A;  3F5T A;  4IO8 A;  4YOY A;  1VQM N;  1Q7Y O;  3O80 A;  3KZB A;  4JKD A;  4MO4 A;  3ATV A;  4GV3 A;  3HSC A;  4B1Y B;  2NRW A;  1R59 O;  3UKU B;  4H5T A;  4JKC A;  1YIT N;  4BRI A;  4XH1 A;  3CI5 A;  3AAQ A;  3VF2 A;  3VGK A;  1GLL O;  4H5R A;  1IJJ A;  1NLV A;  4CI6 A;  3EE9 A;  5KQD A;  1C0F A;  1XUP O;  2ZF5 O;  3MN9 A;  2VGN A;  1HJO A;  4BC5 A;  5AZI B;  3F9M A;  5LJV A;  1GLA G;  2ZJR L;  1NGA A;  3WXL A;  4YOW A;  3L6Q A;  4E1J A;  3EL2 A;  3MN5 A;  3BF1 A;  3SMS A;  5C2D A;  1TYQ B;  1BA1 A;  1BWF O;  1T6D A;  3P4I A;  3O1W A;  4MDA A;  5F2R A;  3VEW A;  4WFN L;  1BDG A;  5AZI A;  2FF3 B;  3K9J A;  3Q7B A;  3UKR B;  2CGK A;  3R9P A;  2YHX A;  5M1N A;  2A42 A;  4FWP A;  4K25 A;  3LDL A;  3M1F A;  3WXI A;  2RHK A;  4NLB A;  3K9K A;  4O8K A;  4M7Y A;  5AQK A;  1O13 A;  5BRF A;  2ZJP L;  1Q18 A;  1VAZ A;  4BR0 A;  2E1Y A;  4FPB A;  4K43 A;  4BRQ A;  1YIJ N;  3HM8 A;  3ENH A;  4WQ4 C;  3GG4 A;  2KLA A;  3FE1 A;  4F9O A;  4GVE A;  4M63 C;  2GEM A;  3MWP A;  3RVC A;  4IEE A;  5AQW A;  4MLH A;  5AQX A;  3EKS A;  5AQI A;  3CQY A;  4CZH A;  5FPD A;  5C0Y A;  4JD2 B;  4FWN A;  1KD1 O;  3P39 A;  4JKH A;  4JKA A;  4IZ9 A;  3ZX0 A;  5GAH P;  5M1F A;  4YOT A;  3SAH A;  3UKU A;  4H5W A;  1CZA N;  3QBW A;  1U2V A;  4IWV A;  5AQM A;  2P9P B;  1LCU A;  5GIP A;  3G25 A;  3RSE B;  4BY9 C;  3SAF A;  2HBL A;  2QA4 N;  2GWK A;  2IIR A;  3TTC A;  3CHW A;  4H0X B;  3A5L C;  3CJB A;  2GEL A;  4BR9 A;  2QWP A;  3MN6 A;  4EFH A;  4YOX A;  2YHW A;  2P9L A;  3UB5 A;  3CJC A;  3DXK A;  5M1P A;  4CD3 A;  4YDU C;  3H45 C;  5BPL A;  1VQ5 N;  4XH5 A;  5EXW A;  5E26 A;  5B8H A;  3PIP L;  2QWO A;  2FSN A;  3CPE A;  4DB3 A;  5C15 A;  2P9U A;  4CD1 A;  3E66 A;  3GBT A;  1OKJ A;  2A40 A;  4FWS A;  3Q7C A;  4FWR A;  2P9N B;  2NRX A;  4GY2 B;  3CMA N;  1XC3 A;  1DGK N;  4JK8 A;  4B1W B;  4WF9 L;  4WQ5 A;  4BGB A;  4FO0 A;  3TU5 A;  1NGE A;  3DXM B;  3R8E A;  2D1K A;  1HKG A;  4BRE A;  3C65 A;  3R1X A;  1NM1 A;  2JWK A;  3TTD A;  4PKI A;  3U9D A;  2WBN A;  4BC2 A;  3IKM A;  4K42 A;  5DM6 L;  2DPN A;  3LDN A;  1K73 O;  1M1K O;  1K9M O;  3WXK A;  5JVH L;  4A2B A;  1JCF A;  3DXK B;  5AQH A;  4AM6 A;  3ZX3 A;  4QS9 A;  5FPM A;  1GLB G;  4JKB A;  1GLE G;  4I6M A;  2J4R A;  1NGJ A;  1ZBS A;  4H03 B;  3B8A X;  1HKC A;  2QWQ A;  1YJW N;  2P9S B;  3AAP A;  1RGI A;  4JK7 A;  1VQP N;  1VQL N;  4BRN A;  2ASM A;  4IEI A;  1VQ8 N;  1BU6 O;  3OW2 M;  2W41 A;  2UYT A;  3ENO A;  1K8A O;  2VGM A;  5BPM A;  3VET A;  2Q31 A;  1M90 O;  1YI2 N;  2QWM A;  3M6G A;  3FR0 A;  3QFU A;  3SMP A;  1YF5 L;  4B9Q A;  2HBK A;  3VPZ A;  2AA4 A;  5MLC Q;  2KKZ A;  2NRZ A;  1GLJ O;  4IO9 L;  3A0I X;  2FXU A;  1Q81 O;  1YVN A;  3O1B A;  3WT0 A;  2HST A;  3O5B A;  1N8R O;  2PAV A;  5E84 A;  3NVK A;  2FSJ A;  5CR4 A;  1RDU A;  3U8X A;  2HBM A;  5EOY A;  2IVN A;  2NRH A;  3D7E O;  5JMV A;  1W2B M;  3CET A;  1C0G A;  2V52 B;  3OHR A;  1DT9 A;  2FLO A;  3J8A A;  4AM7 A;  1ZC6 A;  3M3Z A;  3FZH A;  3GDQ A;  1WUA A;  2Q0U A;  4OPA A;  4WQ5 C;  4DQ8 A;  4FWQ A;  1GLD G;  2I7P A;  4UY8 O;  2NLX A;  4ILJ A;  4CBW A;  2PBD A;  2QM1 A;  3ULE A;  1NGH A;  3HZ6 A;  4M7X A;  3SBT A;  3LDP A;  2GX9 A;  5GAE P;  4U7B A;  4OO1 J;  1DEJ A;  1SAZ A;  3DAW A;  3VMF B;  4C23 A;  5AQG A;  3FGU A;  3CJ7 A;  4H5V A;  1HLU A;  2IVP A;  4BR7 A;  4WFB L;  3D2F B;  5GAG P;  2ZWH A;  1JCG A;  4BRO A;  1KC8 O;  3CJA A;  3JS6 A;  4KH5 A;  3WEE A;  1W97 L;  4ISG A;  3VEO A;  2P9S A;  2I7N A;  3C0B A;  1NGB A;  4PKH A;  4QS8 A;  1T6C A;  2WUS A;  2E2Q A;  2HF3 A;  4B1U B;  3EN9 A;  4CZE A;  3BUZ B;  4PL7 A;  1YJN N;  4GV6 A;  3G71 N;  1D4X A;  4LC9 B;  1VQN N;  4JKG A;  3QB0 A;  5AQN A;  4Z94 A;  5AQY A;  3CJ9 A;  1TUY A;  3C6H A;  3D2F A;  4BR5 A;  5I9E B;  2CGJ A;  3M5R A;  4K41 A;  3ZX2 A;  3CD6 N;  4IXC A;  4IOC L;  3QML A;  5AQV A;  3CCR N;  4FWK A;  4NLC A;  3VF6 A;  5C10 A;  1EO1 A;  2RE2 A;  3IMX A;  4ILG B;  1J6Z A;  2OTJ N;  4FWL A;  4H0O A;  5ADX A;  2CH6 A;  1YXQ A;  3G6E N;  3CER A;  3L4Q A;  2WFB A;  2ZGZ A;  3D2E B;  4YDU A;  2ITM A;  4B1V A;  3ZET A;  4KH4 A;  4BQL A;  3W0L A;  3L4I A;  2P9N A;  2E2N A;  3VEY A;  1SZ2 A;  1MA9 B;  4JKE A;  4CBU A;  4KBO A;  3VEZ A;  4MDB A;  4J8F A;  2D0O A;  4MLE A;  5C12 A;  2QEX N;  2CGL A;  2JWL A;  3HTV A;  4HWI A;  1BG3 A;  3S41 A;  3VER A;  4IJA A;  4CZK A;  1GLC G;  4YOR A;  1VQK N;  3O9S A;  1HPM A;  3EE8 A;  3I33 A;  1KAZ A;  1V4S A;  4O8U A;  3TSQ A;  3WUH A;  3O6W A;  4FL9 A;  2NNW A;  2KHO A;  3ENB A;  4BRP A;  2EWS A;  1K8K A;  2AP1 A;  2HMP A;  3O08 A;  5AQS A;  3VF4 A;  1TYQ A;  1P90 A;  3CCL N;  1JJ2 M;  2FSK A;  5EY4 A;  2QXL A;  4RWT A;  3KWG A;  4XEI A;  5TKY A;  3IFR A;  3T69 A;  2A6A A;  4NO7 A;  1HUX A;  4IDH A;  1NJI O;  3CC2 N;  1E4G T;  3CC7 N;  3O8M A;  2QWR A;  3A5M C;  5AZJ B;  4A61 A;  3VOV A;  4EHT A;  3VGM A;  2NRT A;  3QIC A;  5AQZ A;  3LDO A;  4BRA A;  4C1N K;  3BP8 A;  4U67 L;  4GV9 A;  1OVY A;  3A5O C;  4CZM A;  1QQO A;  4BRM A;  4KH6 A;  5BRH A;  2HBJ A;  2E20 A;  4C1N I;  5JIC A;  3W3D A;  3PLA A;  3H6E A;  3E1Y A;  4BGA A;  4BRH A;  2Q0R A;  5HOO A;  4WQ4 A;  3MMV A;  4FPA A;  2BUP A;  2NRV A;  3BF3 A;  2E1Z A;  3CF5 L;  5LJW A;  1KAY A;  1X3N A;  1IG8 A;  2D0P A;  3JXU A;  3FFK B;  5AFU A;  3CJ1 A;  3C7N B;  3LM9 A;  5AQU A;  5EX5 A;  3MDQ A;  4RTF D;  2Q2R A;  1DKG D;  3FZF A;  3QFP A;  5M1Q A;  2ASO A;  5FPN A;  4IOA L;  1E4F T;  2CH5 A;  3VEX A;  3FZL A;  1Z6R A;  3P38 A;  1KQS M;  4BVP A;  4PL8 A;  2PFU A;  4HTL A;  4BRC A;  3QBX A;  3H3N O;  5AQF A;  5M1K A;  3O4W A;  1NMD A;  5BN8 A;  5AQQ A;  5HL7 L;  3O9T A;  4IJN A;  3ZET B;  1NGG A;  2F7T A;  1BUP A;  5BN9 A;  5M1O A;  1VQ6 N;  3SK3 A;  5BR9 A;  2VWB A;  3CQX A;  1QQN A;  5TKW A;  1JCE A;  4NB4 A;  4BRD A;  4BC3 A;  1ATR A;  2Q97 A;  3VTI A;  1YAG A;  3RSE A;  5CHI A;  1BOT O;  4JK9 A;  4BRF A;  1RFQ A;  5C2F A;  3N4Q A;  5JLF A;  4G9Z A;  2BTF A;  3MCA B;  4JAX A;  3CCM N;  1YJ9 N;  1Q86 O;  1RDW X;  3CIP A;  4BVO A;  5AQR A;  4RCH A;  1S3X A;  4BG9 A;  3U9Z A;  5BPN A;  3CCV N;  1TUU A;  5KPZ A;  3IUC A;  3R3L A;  4JN4 A;  5GIO A;  3CXC M;  4CZG A;  3H1V X;  2QW9 A;  3EZW A;  2P9U B;  1Z05 A;  4JKF A;  5GIN A;  4ILH A;  4BRG A;  3BEX A;  4I6M B;  2W40 A;  3IDH A;  1NGI A;  1V4T A;  1HKB A;  5LY3 A;  3SJH A;  4FSV A;  1QQM A;  4JKG B;  4BC4 A;  3KHY A;  3GE1 A;  5AR0 A;  3E9P A;  2QI2 A;  4FWM A;  4FOE A;  5AQJ A;  2ASP A;  3FZK A;  1HX1 A;  4AF1 A;  1U6Z A;  4EIA A;  1Y64 A;  1GLF O;  5FPE A;  1SQK A;  4DCH A;  2YJF A;  5ELZ A;  5AQP A;  2QWN A;  3WEE B;  4ISF A;  4PKG A;  4CZJ A;  5ADX H;  5AQL A;  2ZJQ L;  3H3O B;  1U2V B;  4H0Y B;  1P8Z A;  1QZ5 A;  1NGC A;  4A5B A;  5DM7 L;  3SLC A;  1NGD A;  4QS7 A;  3CME N;  3ZYY X;  3AGK A;  4CZI A;  3EO3 A;  3A8Y A;  3TPQ A;  4O5F A;  1ZXO A;  3E9L A;  3TSP A;  5AZJ A;  4R79 A;  2V7Z A;  3EKU A;  3SAG A;  3MK6 A;  2OAN A;  4BR4 A;  3OBY A;  1YUW A;  3CCQ N;  2YHY A;  2GWJ A;  3MWT A;  3AAR A;  3KK7 A;  2NRR A;  4FVU A;  1MWK A;  2VYP A;  4A57 A;  2V51 B;  3LM2 A;  3KWI A;  5BRE A;  3LDQ A;  2VCP A;  1S72 N;  3TSU A;  1K8K B;  3QDK A;  3L0Q A;  2P9L B;  3HI0 A;  3HRG A;  4IFE A;  4EAH D;  3T7Z A;  3H46 O;  3CCS N;  3UE5 A;  5KPR A;  4H0P A;  2HOE A;  3I55 N;  1T3V A;  4MO5 A;  5AQO A;  1EQY A;  4YOV A;  1WOQ A;  3O9Q A;  4BRK A;  3DWL A;  3HOS A;  2H3G X;  1H1V A;  1X9J A;  3I8B A;  3TTF A;  3CCJ N;  2P9I B;  2P9K B;  3HBT A;  1G99 A;  4JHD B;  4WCE L;  1QVG M;  5F1X A;  1YHQ N;  5F0X A;  1NGF A;  2A3Z A;  3I56 N;  4WYB A;  1X3M A;  3O9U A;  3J7Z O;  4JD2 A;  3A5N C;  2Q1N A;  3FLC O;  3C6A A;  4CZL A;  3KVG A;  2Q36 A;  2YCH A;  1BA0 A;  1KAX A;  2BH1 A;  3CC4 N;  3CCE N;  3ID6 A;  3SBG A;  2E88 A;  5BRD A;  3P31 A;  3HOT A;  4IOX A;  2YI1 A;  3WXM B;  2E8A A;  4A59 A;  2OTL N;  4CBX A;  1ESV A;  3OBW A;  1NWK A;  4BG8 A;  3AGR A;  1KXP A;  3AY9 A;  5GAD P;  5KQ8 A;  3VEV A;  3G4S N;  3ZEU A;  2GUP A;  4H0T B;  4H0V B;  5JVG L;  1VQ9 N;  2D4W A;  2GTD A;  3ATU A;  3MX5 A;  4YOU A;  1QZ6 A;  4FOI A;  2QWL A;  3MCP A;  4ISE A;  3VGL A;  1ATN A;  1ATS A;  4GNI A;  3VES A;  4B1X B;  5AFU H;  3F2K A;  4A5A A;  5KPT A;  2E2P A;  3H1Q A;  1MWM A;  3ULE B;  3ZEU B;  4L3Q A;  2IVO A;  4DHY A;  1Q82 O;  3NVM A;  3FZM A;  3UKR A;  4FWO A;  3C7N A;  2WC9 A;  3DXM A;  5EVZ A;  3MX2 A;  4WFA L;  4PHT X;  3E9O A;  1LOT B;  4BR2 A;  1VQO N;  2YX6 A;  3WXJ A;  2QTD A;  2HF4 A;  1MDU B;  3LL3 A;  3PIO L;  3D2E A;  4CZF A;  1NBW A;  4JEP A;  1QVF M;  3GL1 A;  5H1S Q;  3CPW M;  3NMU A;  5JLH A;  3R6M A;  3DLL L;  1XQS C;  4CJ7 A;  3MN7 A;  4A62 A;  1ILY A;  2E2O A;  4B1Z A;  2YJE A;  3DJC A;  4XH4 A;  4EHU A;  2P9P A;  2F9T A;  1QHA A;  3VTH A;  2NZT A;  4BQZ A;  1VQ4 N;  4JHD A;  3CCU N;  3N4P A;  2P9I A;  2A5X A;  1BO5 O;  2P9K A;  3U4L A;  2F9W A;  4JNE A;  1S22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...