3ZX3A

Crystal structure and domain rotation of ntpdase1 cd39
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
406
structure length
399
Chain Sequence
NVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGASTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNNSHCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Evidence for a Domain Motion in Rat Nucleoside Triphosphate Diphosphohydrolase (Ntpdase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
total genus 125
structure length 399
sequence length 406
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx3A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx3A02
3SK3A 4CZMA 1ZC6A 2YCHA 3H45C 1T6CA 1TUYA 2I7PA 3ULEA 1RGIA 4B1XB 2P9PA 1IJJA 4FWNA 2P9IA 3ZEUB 2A40A 2QXLA 2HMPA 2FSNA 1G99A 3WXKA 3FFKB 2E8AA 2A6AA 4IJNA 3C7NA 3CJCA 1BUPA 3R6MA 4M7XA 4ISFA 2GWJA 4BC2A 3VEYA 1J6ZA 4IZ9A 5EXWA 2NZTA 5AQVA 3O4WA 3IMXA 4I6MA 3B8AX 3O1BA 3CI5A 4H5RA 4MO4A 4CZFA 5I9EB 2A42A 3RSEA 3H3NO 4BC4A 4FL9A 3UE5A 4DQ8A 5BRHA 3VERA 4H0TB 4HTLA 3D2FB 1V4TA 1BDGA 2P9IB 4H0YB 3UB5A 3CETA 5BRDA 1ESVA 2YJEA 2QWOA 2P9KB 1GLDG 1JCFA 4BR5A 3CERA 3QMLA 3MCPA 1NGBA 4AM6A 4H5VA 2V7YA 5KQ8A 4LC9B 4K43A 3U4LA 3OHRA 1TUUA 2D1KA 2FF6A 5FPEA 5BR9A 3R9PA 3L4IA 2IVNA 3VPZA 3BP8A 3U9DA 3WXLA 4XH1A 4H0VB 2VCPA 3ATUA 3MN6A 3DXMB 3HBTA 4BREA 1T44A 1C0FA 1V4SA 1Z6RA 2BUPA 4J8FA 3DXMA 1RFQA 4Z94A 3ENHA 3VF6A 2E2NA 4CZIA 4QS9A 3CJ7A 3U9ZA 4K42A 3W3DA 1QQNA 4ISGA 3A5NC 3G25A 4FWQA 3FZHA 5E26A 5EX5A 4IXCA 4JHDA 1NGIA 3QBXA 2P9KA 2BTFA 1X3MA 3ATVA 4IO8A 3KVGA 4JD2B 4FPBA 3VEXA 5AQFA 5FPDA 5AQGA 3ZETB 5BPMA 4YDUC 3VETA 4PL8A 5JLHA 3ENOA 3LM9A 1QHAA 2D4WA 1KAXA 3VOVA 1KAZA 4A2BA 3U8XA 2Q1NA 3R8EA 2HOEA 4B1YB 3FE1A 3C0BA 3QICA 3EL2A 4B1UB 2FF3B 1S22A 1NGDA 4DB3A 3CQXA 5AQYA 4CZJA 4A61A 3FLCO 3BUZB 5AQZA 4BR9A 3VENA 2P9PB 4H03B 2W41A 3ULEB 1GLAG 4CD1A 5FPNA 3UKRA 4WQ5A 4C23A 1DKGD 3D7EO 5AQLA 1NBWA 1NGCA 3M6GA 5JICA 3HTVA 3CJBA 2ASPA 3S41A 4FOIA 5AZJA 2ASMA 2DPNA 4MO5A 2KHOA 5EY4A 4PKGA 4BGAA 2Q36A 4BG9A 3WXIA 3A5LC 2F9TA 3MMVA 3CJ9A 4FOEA 2IIRA 3FZLA 3FZFA 3O5BA 1BA0A 3AAPA 1T6DA 3SMPA 2GTDA 2EWSA 5BPLA 3H1VX 1X3NA 5E84A 3A5OC 1OKJA 2ZGZA 3O6WA 2ZF5O 3FZMA 4FWSA 2P9SB 3VEWA 1MDUB 2P9UA 2QM1A 1MWKA 4H5TA 4JN4A 3WT0A 4BG8A 1Y64A 3O80A 4H5NA 3VGMA 3J8AA 3UKUB 3VESA 4BGBA 4BQLA 3VEZA 4BRAA 4RCHA 1GLCG 3IDHA 3CQYA 4BRGA 1YXQA 1HLUA 2P9LA 3HM8A 1NLVA 2J4RA 1HKCA 2OANA 1S3XA 3HSCA 3VGLA 4FWMA 1XC3A 4BRCA 5EOYA 5AQRA 3FZKA 2VWBA 4CZEA 5AQXA 1ZBSA 3DXKA 4F9OA 4WQ5C 1HPMA 3KHYA 2ASOA 1HKGA 3DAWA 3ZETA 1C0GA 1NGGA 2IVPA 4RTFD 4Y0WA 3TU5A 3D2EB 2QW9A 4FPAA 1HX1A 2Q2RA 1NM1A 5KQDA 3I33A 5B8HA 3UKRB 5AQSA 4BRQA 3CJ1A 5AQQA 3ID8A 1E4GT 4CJ7A 4BC5A 2HF4A 4E1JA 1U2VA 3GG4A 3MN5A 3MK6A 3GOIA 4WQ4C 4BR2A 4DCHA 2P9NB 5F1XA 4BC3A 1D4XA 4FO0A 5BN9A 4GY2B 3BEXA 4ISEA 4NO7A 5AQIA 2D0OA 4DHYA 1LOTB 1SQKA 1ATRA 2A3ZA 2GUPA 1HUXA 3KZBA 3ZX0A 2D0PA 3M1FA 5F0XA 1GLBG 1NGEA 4B9QA 4L3QA 4EFHA 4K25A 1ATSA 3CIPA 4JD2A 5LJWA 3O1WA 4CZGA 4PL7A 2AP1A 4JNEA 3H3OB 2F9WA 5ELZA 3SJHA 2FXUA 4PKIA 3WEEA 4EHUA 1CZAN 3GBTA 5TKYA 3WEEB 2CH6A 3LDQA 3SMSA 4WYBA 3LDPA 5KPZA 4O8KA 3WQUA 3CJAA 1ATNA 5JLFA 3D2FA 4FSVA 5CE3A 2YI1A 1MA9B 1ZXOA 5AQWA 5AQOA 5AFUH 2GWKA 4B1WB 1P8ZA 3WQTA 3A5MC 4XH5A 2P9NA 2WUSA 1GLFO 2YHXA 1YUWA 5AQTA 3LL3A 2Q0RA 5LJVA 1BWFO 1WOQA 3FR0A 3JS6A 4CBWA 2NRHA 2Q0UA 3HZ6A 3ZEUA 4KBOA 2UYTA 4B1VA 4XEIA 5AQMA 4CBUA 2PBDA 1SAZA 1BU6O 3QDKA 3CHWA 3TPQA 1YVNA 2QWPA 2Q31A 3H46O 3QB0A 1LCUA 3D2EA 3EKSA 4BROA 4EHTA 5BREA 2Q97A 3MDQA 3RSEB 4IJAA 1Q18A 3DXKB 3O8MA 4I6MB 2AA4A 5AQHA 4FWOA 2A41A 2YJFA 3W0LA 1QZ5A 4FWPA 1NGFA 3LDOA 2ITMA 4CBXA 5KPRA 5KPTA 3C7NB 2E2PA 3AY9A 1KXPA 4BRPA 4BRKA 2QWLA 3EKUA 3AAQA 2P9LB 4FWLA 4QS7A 1E4FT 3A8YA 1JCEA 1RDWX 2PAVA 4PKHA 1QQMA 4RWTA 2GEMA 1NMDA 1WUAA 3M3ZA 2GELA 4BR0A 3ZX2A 3I8BA 2QWMA 4CZKA 3QFUA 3MN9A 2NLXA 2P9UB 5ADXA 5LY3A 3A0IX 4CD3A 3BF1A 3AARA 2V7ZA 3VF4A 2CGKA 3HI0A 3O08A 2V52B 4B1ZA 4BRDA 5AZIA 2E2QA 3EZWA 3L6QA 4M7YA 2QWNA 4BRMA 3ZX3A 3JXUA 5EVZA 3P4IA 4CZHA 1K8KA 2E20A 4GNIA 3VGKA 1U2VB 3GDQA 4K41A 3L0QA 4AM7A 3GE1A 4YDUA 2CGLA 2ZGYA 5AR0A 4A62A 3VF2A 2IVOA 3DWLA 4O5FA 5FPMA 3VEVA 5ADXH 1YAGA 4MLHA 4EAHD 3EN9A 4CI6A 2E1ZA 4WQ4A 1NWKA 4H0XB 3H6EA 4BVPA 3VEOA 1TYQA 5BN8A 1JCGA 3LM2A 5AQPA 5AQNA 1QQOA 1GLEG 1XQSC 4BRIA 1BOTO 5AQKA 4XH4A 3FGUA 2FLOA 4MLEA 3H1QA 3LDNA 1HKBA 5AFUA 2E2OA 2W40A 4EIAA 1NGHA 4BRFA 1DGKN 1IG8A 1BG3A 3UKUA 1TYQB 2VYPA 3GL1A 4BRNA 3WUHA 1HJOA 2FSKA 1XUPO 4FWKA 4BR4A 5JMVA 2P9SA 1R59O 1SZ2A 2HF3A 4BVOA 3SLCA 2E1YA 4CZLA 4JHDB 1X9JA 4BQZA 3LDLA 1NGAA 3F9MA 5F2RA 1Z05A 1KAYA 4H5WA 4NB4A 4JAXA 5BPNA 2A5XA 3MN7A 2ZWHA 1H1VA 1BA1A 4A2AA 2I7NA 4M63C 1K8KB 2CGJA 2QWQA 3BF3A 2CH5A 2E88A 1QZ6A 3WXJA 5AZIB 1GLJO 4QS8A 1DEJA 3EO3A 3QBWA 5AZJB 2YHYA 3IFRA 1NGJA 2V51B 4BRLA 1MWMA 1GLLO 4HWIA 2FSJA 4BR7A 2YHWA 4H0PA 1BO5O 2QWRA 3IUCA 5BRFA 4IWVA 1EQYA 5AQJA 3DJCA 4BRHA 1U6ZA 2H3GX 3QFPA 5AQUA 4H0OA 4FWRA
chains in the Genus database with same CATH superfamily
3SK3A 2YCHA 1T6CA 2I7PA 4Z0UA 1RGIA 4B1XB 1TKDA 3ZEUB 2HMPA 4LFCK 3AVGA 3WXKA 3CC4N 3C7NA 3CJCA 2ZJQL 1XNQK 4ISFA 1HNZK 3LZJA 4E89A 1J6ZA 4IZ9A 5EXWA 2PYJA 3O1BA 3E9OA 5I9EB 1YJ9N 4B3MK 3RSEA 4JI2K 4BC4A 4FL9A 4DQ8A 3ZT3A 1Q81O 4E7JA 4H0TB 1VSMA 3UB5A 5HL7L 2UUBK 1K9MO 2ZD1A 3AVMA 4BR5A 3CYMA 4H5VA 5M1OA 5KQ8A 3CCJN 3U4LA 4JEPA 1OH8A 3AVJA 3OHRA 4MDAA 1TVRA 2FF6A 3VQ4A 3THWA 1YTAA 3U9DA 4CFAA 3V9ZA 3ATUA 3OYEA 4WFNL 3HBTA 3RRGA 4BREA 2D5RA 4CIGA 5C42A 4I9QA 3T69A 5A2QO 3K59A 3ZSXA 4BDYA 4E7LA 2A1SA 1EKEA 5M1KA 3E01A 4DV4K 4W5TA 1IV0A 3CJ7A 3THWB 3CD6N 3U9ZA 3W3DA 1TKZA 2D0AA 4AILC 4CHZA 1EX4A 2Z1HA 5EX5A 4IXCA 4KTZA 4YOXA 3ATVA 1U49A 1N36K 3SCXA 4DTNA 3NAEA 1LV5A 1U04A 4DFKA 5AQGA 3ZETB 4FLWA 5BPMA 4DQQA 4YDUC 4DLEA 4DG1A 1TK8A 4PL8A 3ENOA 3VOVA 3LM9A 2D4WA 1S1VA 1QE1A 4A2BA 3FE1A 1LWCA 4FK0A 2Y1IA 1CXQA 1NGDA 3V9UA 4A61A 3VA0A 3BUZB 1NK4A 4X62K 1KLNA 3T1HK 3ULEB 4GV3A 4WQ5A 1VSLA 2I5JA 4JKGA 2HHQA 1XMOK 4KHYA 4AHVA 4TSXA 1FXXA 3I56N 3Q7BA 1NGCA 2PFUA 5JICA 1BCOA 3ZSOA 1Q9YA 3VQ8A 1RDBA 3HTVA 2ASPA 3P83D 1TKXA 4KB0A 3MAQA 4MO5A 1BIZA 1LWFA 2F9TA 3MMVA 3O5BA 3AO3A 4NCBA 4ELUA 4B08A 3AO2A 3A5OC 3AA3A 1OKJA 2ZGZA 4Z4EA 4CHOA 3LALA 1LAVA 1MDUB 1MWKA 4JKGB 4CJWA 4JN4A 3WT0A 4CF8A 3OYNA 3NVMA 3I55N 4GKKK 3J8AA 3CG7A 1YVUA 3KKSA 3CQYA 1QTMA 3QIPA 1UA0A 1RDAA 4CIFA 1K73O 4IOCL 2J4RA 4DV5K 4JS4A 3HSCA 1NKCA 3VGLA 1XC3A 4BRCA 1YF5L 2F4VK 3PX4A 1JXBA 5AQXA 1YT3A 4YNQA 4YOUA 4JV5K 3KHYA 3ZETA 4FK2A 4ELTA 3L3VA 3LAMA 3D2EB 4FPAA 1I3AA 4CCHA 1XNRK 3I33A 4FJHA 4DTUA 3TTCA 5AQQA 4FM2A 2HHSA 3ID8A 3PIOL 1RTJA 3N4QA 4FCYA 2OPSA 4CVNE 3KKRA 3HO1A 2RF2A 4A57A 4BC5A 4FM1A 5KRTA 3OW2M 3DRRA 3GG4A 3CMEN 4BR2A 4N47A 3TAPA 5H1SQ 2OTLN 3VTHA 1D4XA 4NO7A 5AQIA 1GOAA 5GINA 4JKEA 1NGEA 4RG8A 2KFNA 4L3QA 4EFHA 4CGHA 1O13A 3T7ZA 1ATSA 4CF1A 4DFJA 4DR1K 5LJWA 2ITGA 4PL7A 5HP1A 2AP1A 4JNEA 2F9WA 4KB1A 3KK3A 3SJHA 4OPHA 1CZAN 3GBTA 1F21A 5HRSA 3SMSA 4WYBA 3LDPA 4OO1J 3WQUA 4JI3K 3ZSWA 3VQEA 3CJAA 1M90O 5JLFA 1YHQN 4FSVA 5M1FA 3PO4A 4DWIA 3T1YK 5AQOA 4CHPA 1YJNN 4ID1A 1HYSA 4LFAK 3WQTA 3L3UA 3MEDA 4DR3K 4DTPA 4EP4A 4DUZK 1A5WA 3JS6A 4PHTX 4OGEA 5JS2A 1YIJN 5M1QA 3ZEUA 4KBOA 3LP1A 2AJQA 4OVLA 3SPYA 4B1VA 3H08A 5AQMA 3QDKA 3CPEA 3THYB 1HNWK 4YORA 2QWPA 1RT3A 4B3SK 2Q31A 4LF5K 3D2EA 4H8KA 1C0TA 4HCCA 2Q97A 3HM9A 3DOLA 3RSEB 1WNSA 3DXKB 4CESA 4DTSA 3DYAA 4AQYK 4JRPA 4FWPA 4YOWA 5MLCQ 5KPTA 2VG6A 4BRKA 3DRSA 1NU0A 1VQ9N 3A8YA 4E3SA 1IKYA 1XWLA 2HB5A 2UXDK 1WUAA 2GELA 1NJWA 3T19A 1Q8IA 5HLFA 5C2DA 1SL0A 1KVCA 2YNHA 5CZ1A 4FJXA 3MN9A 4CEEA 2VG5A 2P9UB 4JKDA 1T8EA 4ZTFA 5C25A 4CJ5A 4BE2A 3PX6A 3HI0A 3V9SA 3LAKA 2V52B 3DI6A 3THXA 2E2QA 2RN2A 3E9PA 4LSLA 3KK2A 2F8SA 5EVZA 3P4IA 4CZHA 2E20A 3RVCA 4GNIA 1U2VB 5M1PA 2HBLA 4BE1A 3P5JA 4IOXA 4A62A 3VF2A 2ZQBA 2VWJA 2P1JA 4ILJA 1BIUA 5FPMA 3MXJA 4BDZA 4EAHD 2Q3SA 1UOCA 4H0XB 4B9NA 4C8LA 1WAJA 4FK4A 5AQPA 4RW8A 3HP9A 4O5BA 5AQKA 4LF4K 3FGUA 4GW6A 3OJUA 3ZSVA 3P39A 3H1QA 4ZTJA 1HKBA 2OPPA 3O9SA 3L2RA 1QVGM 2W40A 3L4QA 4IOAL 4EIAA 3CCUN 1WSGA 2DFHA 1W0HA 1ZBFA 4BRFA 1IG8A 3J7ZO 3UKUA 2VYPA 3CFPA 1HJOA 3O9QA 1XUPO 3F73A 4HUFA 3P1GA 3SPZA 2YKNA 1SL1A 3L2UA 3TWHA 3SLCA 4X66K 5HRPA 4BQZA 4JKCA 5KRSA 1N32K 3MEEA 1KAYA 2A5XA 3MN7A 3VTIA 2HHHK 3M8RA 4M3XA 4A2AA 3AO5A 4M63C 5CY4A 4LD0A 1B9FA 3ZLJA 3QBWA 5AZJB 2O8FA 4OPAA 1B92A 3IFRA 1NGJA 1MWMA 4FJJA 2FSJA 2QWRA 1EQYA 4DV6K 2PYLA 1S1WA 2H3GX 3QFPA 3CF5L 1HNIA 5AQUA 1LW0A 4H0OA 1IH7A 3QERA 4CZMA 3H45C 1TUYA 2P9PA 3J80O 2P9IA 2A40A 3K9JA 2QK9A 1C1CA 4CK3A 4NLBA 1N34K 3LWLA 4BC2A 3VEYA 3LP2A 2XY6A 4WE1A 2NZTA 2WFBA 4F4KA 3IMXA 1X9MA 3HL8A 1VQMN 1VRTA 2LSNA 3K0SA 1V4TA 1BDGA 4H0YB 3OYLA 5KTQA 1ESVA 2YJEA 2P9KB 2PY5A 3SUOA 3QMLA 1JL1A 3AVCA 4CFCA 2V7YA 1VSHA 1QVFM 3VQBA 4FYDA 5BR8K 3M8PA 1JKHA 1ZBUA 2JGUA 4GV9A 5BR9A 3HOSA 3VPZA 3NCIA 4DQPA 4H0VB 3RMAA 4LFBK 2VCPA 2VQEK 2HHVA 2GX9A 1FKOA 4M3ZA 1HYZA 4QAGA 3PX0A 1T44A 2BUPA 1V4SA 3CCRN 4DSFA 4Z94A 4G1QA 1TK0A 1NOZA 4EZ9A 4K42A 1GOCA 4DR7K 3ISNC 4FWQA 4GVMA 5E26A 3V9XA 4B3RK 1E3MA 4JHDA 1NGIA 1X3MA 4IDKA 1ASUA 2F8TA 4IO8A 3JSMA 3VEXA 1JL2A 5J2MA 4C8NA 4YHHK 1HQUA 5JLHA 3S3MA 1QHAA 1KAXA 4NXMK 1KAZA 2XRIA 2Q1NA 3EE9A 2PZSA 2XHBA 3C6UA 3C0BA 3ZT2A 3EL2A 4B9SA 3L8BA 2FF3B 3O3GA 1NNEA 3CQXA 5AQYA 4E7HA 4CZJA 4BR9A 1RILA 4CJEA 1HR0K 4KTWA 3SBGA 1IG9A 4NYNA 5CZ2A 4C23A 1BHLA 2ZE2A 3ZYYX 3QETA 3M6GA 2RKIA 3KJVA 3CJBA 4DR6K 4FJ8A 4FOIA 3NH0A 5AZJA 2DPNA 1TK5A 2KHOA 5EY4A 3WXIA 3A5LC 4FLVA 4JK8A 1WB9A 2B6AA 4L8RB 2YHBA 4DTMA 4LF6K 5BPLA 3NH2A 1EP4A 3WNGA 5E84A 1U4BA 2ZF5O 3OJSA 2P9SB 2QM1A 4O0IA 3D45A 4H5TA 3KTQA 2RE2A 4BG8A 1OVQA 3RTVA 3SNNA 4JI7K 3VESA 4BQLA 4RCHA 3IDHA 4BRGA 2FBYA 1OH6A 3SYZA 2P9LA 2OANA 3MXIA 3FZKA 2VWBA 1IBMK 4OLAA 4NLCA 4EZ6A 1FKPA 3DAWA 1C0GA 1NGGA 2IVPA 3NF7A 4Y0WA 5GAGP 2OTJN 1WBDA 3NVKA 3F5TA 2HHUA 3PSFA 2X6SA 1NM1A 4J2DA 5B8HA 3UKRB 4JI6K 4BRQA 3E9LA 1RTIA 1TAUA 1NJYA 5LMUK 4FXDA 3MX2A 4CJ7A 2HF4A 2O8EA 2DFEA 4E1JA 3VQPA 3MN5A 3MK6A 3GOIA 2YNGA 4DCHA 1LAWA 4FVMA 3TARA 3DMJA 4BC3A 4FO0A 4GY2B 2D0OA 4O0JA 1SQKA 3IG1A 3KLHA 4IG0A 1HUXA 4KI4A 3ZX0A 5KGWA 5F0XA 3L2VA 1GLBG 5GADP 4DTRA 4JD2A 3OYKA 4KHSA 4CGFA 3H3OB 3EEQA 4AH9A 3OYDA 3A2FA 4X64K 4O4GA 4DV0K 3V9WA 3OVNA 2CH6A 3LDQA 4A5AA 4CJPA 3SAFA 4KAZA 4IFVA 3OYCA 1XMQK 3M8SA 4Q5VA 3SQ4A 4DU1A 4FJKA 2QXFA 5DK5A 4JK7A 1ZXOA 4DTXA 5AFUH 1P8ZA 1W7AA 1QHTA 3BGRA 1Q9XA 2YHAA 2YHXA 1O1WA 3LP0A 1J5OA 4A5BA 1TKTA 5HOOA 1JLBA 1RTHA 1BWFO 2O8EB 3OS2A 4JI0K 3K2PA 3J7AP 2UYTA 1YTUA 4CBUA 3MWPA 4DR2K 1BQMA 3OYAA 3DLEA 4JI5K 3TPQA 3S3NA 1YVNA 4CF2A 3H46O 3CQ8A 3QB0A 1LCUA 3EKSA 4BROA 5BREA 3HVRA 4CEFA 3HP6A 3MDQA 4B9MA 2BGGA 3NGZA 1VHXA 4FJGA 2NRTA 1Q18A 4M3YA 4FWOA 2YJFA 1QZ5A 4DMNA 3PY8A 1S5JA 3SZ2A 5KPRA 1KXPA 4BRPA 4C1NK 4DLGA 4HVJA 3AAQA 3AA4A 1JCEA 1RDWX 3BY5A 2GEMA 2HBMA 3M3ZA 3OS1A 4BR0A 4JRQA 3I8BA 3U3YA 2QWMA 3DLKA 3OYBA 4CZKA 3KLEA 4BACA 3K5OA 3U3GA 2EHGA 2NLXA 2XY7A 4C8MA 5LY3A 2ATQA 4DF4A 3CM5A 3CCVN 2V7ZA 2CGKA 2R7YA 4Y1DA 3O08A 4Z4CA 4BRDA 3HPGA 3HRGA 3ZX3A 3SUQA 1BI4A 1RBSA 1Z26A 4FZYA 2RPIA 1ZBIA 1J53A 3VGKA 1S6QA 3GDQA 5LL6Z 4K41A 2W6LA 3L0QA 3GE1A 1J54A 4YDUA 3ZCMA 2CGLA 3L2WA 1T05A 4JI4K 3OYHA 1IBKK 2IVOA 4JI8K 3DWLA 4O5FA 4K8XA 4J2AA 1X1PA 2VQFK 1VQ7N 4CHNA 1WSFA 1YAGA 1L3TA 2OPQA 4AHSA 1W2BM 3SBTA 4CE9A 1TGOA 2KZZA 4IBNA 3VEOA 5BN8A 1P90A 5C15A 3ALYA 1BOTO 2O8CB 1Z25A 4MLEA 1NK9A 3LDNA 1YITN 3NDKA 1S1XA 2FBTA 3TI0A 5J2NA 3AVBA 1HJRA 3DLGA 1NJIO 4NCGA 1BG3A 1TYQB 1D9FA 4BRNA 4AHUA 5GAEP 1VRUA 4JKFA 1SV5A 3SAGA 4YOYA 1RNHA 4FLYA 3TABA 2WBNA 2DFFA 3CCQN 3WNFA 3TAQA 1I39A 4F3TA 2E1YA 4GKJK 1GOBA 1X9JA 3KWGA 3BDPA 3F9MA 5F2RA 4JAXA 5BPNA 4NCAA 2ZWHA 1YI2N 4E0DA 1BA1A 4M45A 4F2RA 2BDPA 1W97L 3SQ0A 4CF9A 1WSJA 3BF3A 3MWTA 3CPWM 1QZ6A 2NRZA 4QS8A 1DEJA 3ZT4A 4XIUA 2YHYA 4LH4A 2V51B 4BRLA 4AHCA 4BR7A 4W5QA 3PLAA 3LPUA 3NH1A 1HQEA 5AQJA 1U6ZA 3I8DA 1NKEA 4DTJA 1KVAA 3ULEA 1ILYA 4FVUA 4FWNA 3EYZA 3MEGA 1KSPA 2DY4A 1VQ8N 5DMRA 2NRWA 3PV8A 1G99A 3FFKB 2E8AA 4IJNA 4JK9A 3R6MA 4O44A 3ZSZA 4CJQA 4E7KA 4I6MA 4NXNK 3B8AX 4MO4A 4OPJA 2A42A 2IOCA 4HUEA 3QEXA 3H3NO 1VQON 4K8ZA 4CK2A 5BRHA 3LWMA 4HTLA 3D2FB 2KLAA 3TAFA 2P9IB 3CETA 2UUAK 4WFBL 1JCFA 3CERA 3MCPA 4AM6A 3R1XA 2O8DB 4LC9B 2RHKA 4KREA 2YX6A 4DV7K 5J1EA 4K43A 1TUUA 2D1KA 2E6MA 4KHUA 4OKEA 3R9PA 3TAMA 4ELVA 3BP8A 3WXLA 4OX9K 3O9RA 4AHTA 3MN6A 1EXQA 1DTQA 2O8FB 2D0BA 3AGRA 1A5XA 1Z6RA 1IO2A 1VQKN 1D8YA 1NK6A 3QEVA 2VGMA 2E6LA 3ENHA 3AVAA 3VF6A 3THVA 2E2NA 2NRXA 4CZIA 4B9LA 3OYJA 1WN7A 3AA5X 3OS0A 1NJZA 3EE8A 5IT9O 4ISGA 4KTQA 4QCLA 3G25A 2O8DA 2X74A 1RBRA 3C65A 3LDSA 3TAEA 2BTFA 4I9LA 4FW2A 3KVGA 3AVLA 1TL3A 4E1MA 2P5GA 1FK9A 3ID6A 4U67L 4CJVA 4FJLA 5FPDA 3QEWA 4ICLA 1NG9A 4J2BA 3I0RA 5T7BA 3G71N 2FBXA 3V1RA 4PQUA 2QKKA 4M3RA 2WOMA 5AJ3K 4B1YB 4BWMA 2HNYA 4CEZA 1B9DA 3QICA 3O9UA 1T03A 2UXBK 2XY8A 3G10A 2O4IA 3VENA 4BE0A 3V1QA 2W41A 4B8CA 3B6OA 4Z4IA 1GLAG 4WFAL 3NF6A 2HW3A 4MFBA 2HVHA 1IKVA 1VQPN 1JLEA 1DKGD 3ITHA 2JWLA 4IG3A 4LSNA 4OPKA 4E7IA 2QKBA 4ILGB 2QTDA 3DLBA 4B3TK 4J2EA 3M8QA 3DOKA 4PKGA 1VSEA 2Q36A 2GV9A 3RR8A 2IIRA 3G6EN 1S1UA 2KQ2A 4KH4A 3TAGA 1BA0A 3AAPA 4UQGA 4N76A 3SMPA 2GTDA 3K5LA 3H1VX 2OZMA 1VSIA 3KLFA 3O6WA 3E66A 3SI6A 3LANA 5KI6A 3FZMA 4FWSA 2B5JA 3AVHA 2P9UA 2VWKA 1RTDA 3NHGA 4WCEL 1BL3A 4CEOA 4KKOA 1Y64A 3O80A 1IBLK 3VGMA 2OCEA 4BGBA 5C2FA 3RMCA 5JS1A 3VEZA 1GLCG 4R5PA 4CIEA 4OKKA 1YXQA 3M5RA 4O55A 3HXMA 3HM8A 3AO1A 3QINA 4CERA 1NLVA 3J81O 1HKCA 3AA2A 3CM6A 1EWQA 4FWMA 1D5AA 3SQ2A 4AF1A 2HBJA 5DM7L 3DXKA 1HPMA 2ASOA 3TR8A 3ZT1A 3O3HA 2QW9A 5CHIA 4FJIA 4M3TA 1S9GA 3NF9A 3SQ1A 4C1NI 2ZJRL 1CZBA 1TV6A 4M3WA 3AVNA 3K9KA 3D6RA 5F1XA 1NMNA 3NF8A 3O9TA 5BN9A 3BEXA 3PUFA 4PY5A 4DU4A 4DHYA 1LOTB 2GUPA 2A3ZA 2D0PA 3M1FA 4DSEA 1K8AO 3MECA 2W6KA 4B9QA 4K25A 3CIPA 1JLFA 3G0ZA 4GV6A 3LP3A 5CYMA 5ELZA 1RT4A 1RBVA 2FXUA 3WEEA 3T3FA 2VGNA 2HBKA 5I3UA 4KHPK 1Q86O 3WEEB 2KFZA 1VSDA 3Q7CA 4BY9C 4GMJB 1ATNA 1KLMA 2X78A 3D2FA 1KQSM 1RT7A 4FJ7A 5CE3A 2YI1A 1MA9B 1QSYA 5AQWA 1SKRA 3VQQA 5CR4A 1C0UA 3A5MC 2O8BA 3CC2N 2WUSA 3RRHA 3NGYA 1GLFO 1YUWA 5AQTA 2Q0RA 3K5MA 3C95A 1NK0A 5GIOA 3WNEA 4DU3A 1UA1A 3UIQA 4CBWA 2NRHA 2Q0UA 2BE2A 2IDOA 1U48A 1VQ4N 2PBDA 3VQ9A 2FC0A 4RW6A 1SAZA 4FLTA 4YY3K 4KHNA 4EHTA 3VQCA 4LF9K 1RT1A 5C0YA 4IJAA 3O8MA 4I6MB 2A41A 3HYFA 3W0LA 3IRXA 5HRRA 3VQ5A 2ITMA 3C7NB 1RDCA 1NKBA 2QWLA 3LZIA 4F8RA 3EKUA 4QS7A 2KTQA 1E4FT 4DKWA 4IFYA 1R0AA 1RBUA 1NMDA 3KIOA 3ZX2A 3RMBA 3SAHA 2HVIA 4FM0A 3J7YP 4C8KA 1KFSA 1DTTA 2NNWA 4JS5A 3NGIA 3CC7N 1T7PA 1VQ6N 3BF1A 3AARA 2A1RA 2NRRA 1J5EK 4CECA 2YNFA 1WBBA 1ASWA 2EX3A 4B9VA 3L6QA 4RW9A 4BRMA 4CJTA 2DTUA 1HNVA 3KLIA 3V6DA 4CGIA 3PO5A 4Q0BA 1WSIA 1G15A 4DV2K 4AM7A 3KWIA 2OA8A 3DRPA 2O8CA 1ZBLA 3KD5E 4IDHA 3VEVA 3CCSN 4OGCA 4MLHA 4NYFA 1N6QA 4W5NA 2E1ZA 1KRPA 4G9ZA 1JXEA 1FJGK 3H6EA 4BVPA 1TYQA 4KH5A 4FZZA 5HROA 1L3SA 1JCGA 1XI1A 2WTUA 3K57A 3LM2A 4DR4K 1QQOA 1GLEG 1OH5A 1DT9A 2GUIA 5KGXA 1RDDA 1VSFA 5JVHL 1BQNA 1WSEA 1BI4B 1EETA 3VQ6A 2WC9A 4KFBA 4JKBA 4CEBA 3CXCM 1DGKN 3GL1A 3V81A 3IAYA 4FWKA 1NK7A 4BR4A 3VMFB 2F96A 5JMVA 2P9SA 3ZT0A 3K58A 1SZ2A 4BVOA 3CCMN 3SV3A 3QIOA 4Z4GA 3LDLA 1NGAA 1NJXA 3PIPL 4B9TA 4H5WA 4NB4A 2IC3A 1N33K 4FJ9A 1REVA 1HYVA 3V1OA 4DQRA 3NMUA 3OA9A 1Q82O 2I7NA 3O3FA 1K8KB 2CGJA 2Z1JA 2QWQA 2E88A 3WXJA 5AZIB 1GLJO 3OY9A 3CCEN 1KCFA 4IKFA 4H4OA 3C94A 3PSIA 1GLLO 4K0KK 2QA4N 3AVFA 2IAJA 1OVYA 3DJCA 4A59A 1JLAA 4N56A 4DF8A 1WLJA 1ZC6A 1ASVA 2BANA 3ENBA 4JKAA 4YFUA 1IJJA 2IS3A 3SJJA 2QXLA 2FSNA 2A6AA 3HPOA 1BUPA 3AV9A 3O4QA 4M7XA 4KH6A 1HRHA 2GWJA 4IFEA 1RBTA 3S3OA 4I2QA 4Y1CA 5AQVA 3O4WA 3RMDA 4YOTA 1QQCA 3CI5A 4H5RA 4CZFA 4U7BA 1SKSA 4DSKA 5J2QA 3ULDA 5DM6L 3UE5A 2UXCK 3VERA 4I2PA 2Z1IA 1FW6A 2YV0X 3AVKA 5BRDA 2QWOA 1GLDG 3OTOK 1NGBA 3NBPA 1JLCA 5C24A 2G8FA 5FPEA 3L4IA 4CEAA 5I42A 2IVNA 2F7TA 4W5OA 1BCMA 4XH1A 3QEPA 2ETJA 3DXMB 1Y97A 5SWMA 1HMVA 3ZSQA 5FRNA 1C0FA 4J8FA 2XY5A 3DXMA 1RFQA 1XHZA 4DUYK 5HBMA 4KHQA 5C10A 3E1YA 1XC9A 4QS9A 1ZYQA 1QSSA 1D9DA 1QQNA 3ZSRA 4M41A 3F2KA 1S6PA 3A5NC 4PUOA 3WNHA 4KRFA 3RWUA 4MQ3A 3WXMB 4DQIA 3QNNA 3BZCA 3FZHA 1NK8A 5FRMA 3I0SA 3KLGA 1L3UA 3K5NA 3QBXA 2P9KA 4JD2B 1X9SA 1VSKA 4FPBA 5AQFA 3DLHA 5FDLA 2NUBA 4CGGA 2ZM6K 3OYMA 4HUGA 3VETA 4DFMA 3TSUA 3OBYA 1A5VA 2KKZA 3U8XA 3R8EA 4EP5A 2HOEA 3TSPA 3HK2A 2KZMA 2OZSA 4B1UB 4FW1A 1S22A 4DB3A 4I7FA 4E19A 4CK1A 3FLCO 5AQZA 1EO1A 4ZHRA 2P9PB 4H03B 4Z4FA 1HPZA 4B8AB 1W9HA 4LY7A 1C6VA 4CD1A 5FPNA 3UKRA 2GBZA 4DTOA 3CFRA 3QLHA 1RDUA 3CCLN 4DS4A 2NRVA 3D7EO 4RW4A 5AQLA 1NBWA 4CHYA 4FJNA 3TTDA 2YNIA 3S41A 4CGJA 4DQSA 3AGKA 5TKWA 2ASMA 1JJ2M 1TAQA 1WSHA 1KFDA 4BGAA 3NE6A 4BG9A 1QSLA 3CJ9A 4FOEA 3SUNA 3DM2A 3FZLA 3TSQA 3FZFA 5K14A 1T6DA 2W42A 1HNXK 2EWSA 3IKMA 1X3NA 3B6PA 4CF0A 4CJRA 3IS9A 3VEWA 4GVEA 3VA3A 3U6FA 2HHTA 4F3OA 4OLBA 4H5NA 3UKUB 4DV1K 4BRAA 4LF8K 4Z4HA 3QO9A 1K6YA 3JYTA 1KC8O 1C0MA 1HLUA 2JLEA 3QNOA 5CYQA 1YJWN 2HHWA 1S3XA 4CJ4A 3AVIA 4AHRA 5FLXO 2G8IA 1ITGA 3ASMA 5EOYA 1Q7YO 5AQRA 3L2QA 3ZSYA 4H4MA 1S72N 4CZEA 1SUQA 1ZBSA 3FFIA 4F9OA 4WQ5C 2QI2A 1JLGA 1HKGA 3SV4A 4RTFD 3TU5A 2QEXN 1HX1A 2Q2RA 2WONA 3EY1A 5KQDA 4W5RA 2G8VA 3KD1E 5AQSA 4UY8O 1BISA 3CJ1A 3G4SN 3OBWA 1VQ5N 4FJMA 1VK0A 3C6HA 1E4GT 4RW7A 1T3VA 1DLOA 3HT3A 4DSJA 1QS4A 2HSTA 1WAFA 1U2VA 4CJUA 2IGIA 4ILHA 4B9UA 1VQNN 4WQ4C 1U45A 2HMIA 2P9NB 3LPTA 2B4JA 2JWKA 4ISEA 1ZBHA 1XHXA 1ATRA 3KZBA 3VN5A 4DFPA 3O1WA 4CZGA 4WF9L 4JYAK 4M42A 4CHQA 4PKIA 4EHUA 4DSLA 3HSTB 5TKYA 1CZ9A 2VG7A 4KI6A 3C6AA 4MDBA 3BZKA 5KPZA 1U47A 4O8KA 4IEEA 1LWEA 3N4PA 5FROA 4HHTA 3P38A 4IEIA 3JAMO 2P5OA 3HPHA 3OYFA 3HOTA 1RCHA 1S9EA 1OH7A 2GWKA 2OPRA 4B1WB 4F2SA 2HNDA 4XH5A 2P9NA 4JKHA 2UUCK 3CMAN 1RT5A 5SZTA 3TTFA 4KPYA 4C8OA 4KV8A 3LL3A 4BDPA 3KK7A 3NFAA 3O4NA 5LJVA 1VQLN 1WOQA 3FR0A 3D0PA 5LMNK 3HZ6A 2Z1GA 3MX5A 1SKWA 4FLXA 4XEIA 1L3VA 1KTQA 1N5YA 1CXUA 1BU6O 4DV3K 3CHWA 5HRNA 1VAZA 2E5LK 2ZJPL 3R3LA 4V19S 4JLHA 4LH5A 1I94K 5D3GA 1J9AA 1S1TA 3V4IA 1UAXA 2FBVA 4N5SA 5JVGL 2G8HA 4CJKA 2AA4A 5AQHA 2O8BB 4CEQA 3HVTA 4O8UA 1NGFA 3LDOA 4CBXA 2E2PA 3AY9A 4CJLA 1NK5A 2P9LB 4FWLA 2E4LA 3C6TA 2HNZA 2PAVA 4PKHA 1QQMA 4RWTA 3KK1A 4DR5K 3F9KA 1VSJA 1M1KO 3SUPA 1BGXT 3VQDA 3QFUA 3TANA 1KD1O 5ADXA 3A0IX 4HCBA 4CD3A 3VF4A 3DLLL 4IO9L 4E1NA 2OYQA 4B1ZA 3QEIA 3T1AA 2G8UA 1LW2A 5AZIA 3EZWA 4M7YA 2UU9K 2QWNA 1X9WA 3JXUA 4X65K 1SL2A 1K8KA 4CFBA 2P51A 3OYIA 1L5UA 4CJ3A 2Y1JA 1EWRA 1RT2A 4M3UA 4ID5A 2KW4A 1N8RO 1TL1A 2ZGYA 5AR0A 4HTUA 4KHWA 4CGDA 4CW7B 1SS6A 5ADXH 4KO0A 4R79A 5J2PA 3EN9A 5GIPA 4CI6A 3VQAA 4WQ4A 1NWKA 1NOYA 2G8KA 3QESA 1C1BA 2X6NA 5AQNA 1XQSC 1RT6A 4OKJA 4BRIA 4OJRA 2XO7A 4CJFA 4XH4A 2FLOA 2BH1A 3P31A 5AFUA 2E2OA 4DS5A 1MU2A 1NGHA 2O4GA 2G8WA 4FLZA 3WUHA 1JLQA 4N41A 2FSKA 3HJFA 4CFDA 3S9HA 4JI1K 3DLRA 1R59O 1CLQA 2HF3A 4CZLA 4JHDB 4YOVA 4BWJA 1Z05A 4B3OA 1IKWA 5M1NA 3MXMA 1H1VA 3CFOA 3VQ7A 4CEDA 4FLUA 4FJ5A 4PA1A 5GAHP 3OYGA 3RR7A 5E41A 3MCAB 2CH5A 4FZXC 2HHXA 2D0CA 3THXB 4DSIA 3EO3A 1KVBA 4PWDA 4HWIA 1UWBA 2YHWA 4H0PA 4QOZB 1C1AA 1BO5O 5IWAK 3IUCA 4CJSA 4IWVA 5BRFA 3EZ5A 4LF7K 1IKXA 4BRHA 5C12A 3THYA 3AO4A 2YKMA 5EU7A 4FWRA
chains in the Genus database with same CATH topology
3SK3A 4CZMA 1ZC6A 2YCHA 3H45C 1T6CA 1TUYA 2I7PA 3ENBA 1RGIA 4JKAA 2P9PA 3ULEA 4B1XB 4FVUA 1IJJA 4FWNA 2P9IA 3ZEUB 2A40A 2QXLA 1VQ8N 2HMPA 2NRWA 2FSNA 3K9JA 1G99A 3WXKA 3FFKB 2E8AA 2A6AA 4IJNA 4JK9A 3CC4N 3C7NA 3CJCA 4NLBA 2ZJQL 1BUPA 3R6MA 4M7XA 4ISFA 2GWJA 4IFEA 4KH6A 3VEYA 4BC2A 1J6ZA 4IZ9A 5EXWA 2NZTA 2WFBA 5AQVA 3O4WA 3IMXA 4I6MA 1VQMN 3B8AX 3O1BA 3E9OA 4YOTA 3CI5A 4H5RA 4MO4A 4CZFA 4U7BA 5I9EB 2A42A 1YJ9N 3RSEA 3H3NO 1VQON 5DM6L 4BC4A 4FL9A 3UE5A 4DQ8A 5BRHA 3VERA 1Q81O 4H0TB 4HTLA 3D2FB 1V4TA 2KLAA 1BDGA 2P9IB 4H0YB 3UB5A 5HL7L 3CETA 5BRDA 1ESVA 2YJEA 2QWOA 2P9KB 1K9MO 1GLDG 1JCFA 4BR5A 4WFBL 3CERA 3QMLA 3MCPA 1NGBA 4AM6A 3R1XA 2V7YA 4H5VA 5M1OA 1QVFM 5KQ8A 3CCJN 4LC9B 2RHKA 2YX6A 4K43A 3U4LA 4JEPA 3OHRA 1TUUA 2D1KA 2FF6A 4MDAA 5FPEA 4GV9A 5BR9A 3HOSA 3R9PA 3L4IA 2IVNA 3VPZA 2F7TA 3BP8A 3U9DA 3WXLA 4XH1A 4H0VB 3O9RA 2VCPA 3ATUA 3MN6A 4WFNL 2GX9A 3DXMB 3HBTA 4BREA 3AGRA 1T44A 1C0FA 1V4SA 1Z6RA 2BUPA 4J8FA 3T69A 3CCRN 3DXMA 1VQKN 1RFQA 4Z94A 2VGMA 3ENHA 5M1KA 3VF6A 5C10A 2E2NA 2NRXA 3E1YA 4CZIA 4QS9A 3CJ7A 3CD6N 3EE8A 3U9ZA 4K42A 3W3DA 1QQNA 4ISGA 3F2KA 3A5NC 3G25A 3WXMB 4FWQA 3FZHA 5E26A 3C65A 5EX5A 4IXCA 4JHDA 1NGIA 3QBXA 2P9KA 2BTFA 1X3MA 4YOXA 3ATVA 4IO8A 3KVGA 4JD2B 4FPBA 3VEXA 5AQFA 4U67L 3ID6A 5FPDA 5AQGA 3ZETB 5BPMA 4YDUC 3G71N 3VETA 4PL8A 5JLHA 3TSUA 3ENOA 3LM9A 1QHAA 2D4WA 1KAXA 3OBYA 2KKZA 1KAZA 3VOVA 4A2BA 3U8XA 2Q1NA 3EE9A 3R8EA 2HOEA 4B1YB 3FE1A 3TSPA 3C0BA 3QICA 3EL2A 4B1UB 2FF3B 1S22A 1NGDA 4DB3A 3CQXA 3O9UA 5AQYA 4CZJA 4A61A 3FLCO 3BUZB 5AQZA 1EO1A 4BR9A 3VENA 2P9PB 4H03B 2W41A 3ULEB 1GLAG 4GV3A 3SBGA 4CD1A 5FPNA 3UKRA 4WFAL 4WQ5A 4JKGA 1VQPN 4C23A 1DKGD 1RDUA 3CCLN 2JWLA 3ZYYX 2NRVA 3D7EO 5AQLA 1NBWA 3Q7BA 3I56N 1NGCA 2PFUA 3M6GA 5JICA 3TTDA 3HTVA 4ILGB 3CJBA 2QTDA 2ASPA 3S41A 3AGKA 4FOIA 5TKWA 5AZJA 2ASMA 2DPNA 4MO5A 1JJ2M 2KHOA 5EY4A 4PKGA 4BGAA 2Q36A 4BG9A 3WXIA 3A5LC 2F9TA 3MMVA 3CJ9A 4FOEA 4JK8A 2IIRA 3FZLA 3TSQA 3G6EN 3FZFA 4KH4A 3O5BA 1BA0A 3AAPA 1T6DA 3SMPA 2GTDA 2EWSA 3IKMA 5BPLA 3H1VX 1X3NA 5E84A 3A5OC 1OKJA 2ZGZA 3E66A 3O6WA 2ZF5O 3FZMA 4FWSA 2P9SB 3VEWA 1MDUB 2P9UA 2QM1A 4GVEA 1MWKA 4JKGB 4H5TA 4JN4A 3WT0A 4WCEL 2RE2A 4BG8A 1Y64A 3O80A 4H5NA 3NVMA 3VGMA 3I55N 3J8AA 3UKUB 3VESA 4BGBA 4BQLA 5C2FA 3VEZA 4BRAA 4RCHA 1GLCG 3IDHA 3CQYA 4BRGA 1YXQA 3M5RA 1KC8O 1HLUA 2P9LA 3HM8A 1YJWN 4IOCL 1NLVA 2J4RA 1HKCA 2OANA 1K73O 1S3XA 3HSCA 3VGLA 4FWMA 1XC3A 4BRCA 4AF1A 1YF5L 5EOYA 1Q7YO 2HBJA 5AQRA 3FZKA 2VWBA 1S72N 4CZEA 5AQXA 1ZBSA 5DM7L 3DXKA 4NLCA 4F9OA 4WQ5C 4YOUA 2QI2A 1HPMA 2ASOA 3KHYA 1HKGA 3DAWA 3ZETA 1C0GA 1NGGA 2IVPA 4RTFD 2OTJN 4Y0WA 5GAGP 3TU5A 3D2EB 2QW9A 3NVKA 2QEXN 3F5TA 4FPAA 1HX1A 2Q2RA 1NM1A 5KQDA 3I33A 5B8HA 3UKRB 5AQSA 3E9LA 4BRQA 3CJ1A 5CHIA 3G4SN 3OBWA 3TTCA 1VQ5N 5AQQA 3C6HA 3ID8A 3PIOL 1E4GT 3N4QA 3MX2A 4C1NI 4CJ7A 1T3VA 4A57A 4BC5A 2ZJRL 2HF4A 3OW2M 2HSTA 4E1JA 1U2VA 4ILHA 3GG4A 3MN5A 3CMEN 3MK6A 1VQNN 3GOIA 4WQ4C 4BR2A 4DCHA 3K9KA 4UY8O 3D6RA 5H1SQ 2P9NB 5F1XA 4BC3A 3VTHA 1D4XA 3O9TA 4FO0A 2OTLN 5BN9A 2JWKA 3BEXA 4GY2B 4ISEA 4NO7A 5AQIA 2D0OA 4DHYA 1LOTB 1SQKA 1ATRA 2A3ZA 2GUPA 1HUXA 3KZBA 3ZX0A 5GINA 2D0PA 3M1FA 4JKEA 1GLBG 1NGEA 4B9QA 4L3QA 4EFHA 4K25A 5F0XA 5GADP 1K8AO 1O13A 3T7ZA 1ATSA 3CIPA 4JD2A 5LJWA 3O1WA 4CZGA 4PL7A 4GV6A 2AP1A 4JNEA 3H3OB 2F9WA 5ELZA 4WF9L 3SJHA 2FXUA 4PKIA 3WEEA 4EHUA 2VGNA 4OPHA 1CZAN 3GBTA 5TKYA 2HBKA 1Q86O 3WEEB 3C6AA 2CH6A 3LDQA 4MDBA 4WYBA 3LDPA 3SMSA 4A5AA 3SAFA 5KPZA 4OO1J 4O8KA 4IEEA 3WQUA 3Q7CA 4BY9C 3CJAA 1ATNA 1M90O 5JLFA 3D2FA 1YHQN 1KQSM 4FSVA 3N4PA 5M1FA 5CE3A 2YI1A 3P38A 4IEIA 1MA9B 4JK7A 1ZXOA 5AQWA 5AQOA 5AFUH 3HOTA 1YJNN 5CR4A 2GWKA 4B1WB 1P8ZA 1ILYA 3WQTA 3A5MC 4XH5A 2P9NA 4JKHA 3CC2N 2WUSA 3CMAN 1GLFO 2YHXA 3TTFA 1YUWA 5AQTA 3LL3A 4A5BA 2Q0RA 3KK7A 5LJVA 5HOOA 1BWFO 1VQLN 1WOQA 3FR0A 5GIOA 3JS6A 4PHTX 1YIJN 5M1QA 4CBWA 2NRHA 2Q0UA 3HZ6A 3ZEUA 4KBOA 3MX5A 2UYTA 4B1VA 4XEIA 1VQ4N 5AQMA 4CBUA 3MWPA 2PBDA 1SAZA 1BU6O 3QDKA 3CHWA 3CPEA 1VAZA 1YVNA 3TPQA 2ZJPL 3R3LA 4YORA 2QWPA 2Q31A 3H46O 3QB0A 1LCUA 3D2EA 3EKSA 4BROA 4EHTA 5BREA 2Q97A 3MDQA 3RSEB 5JVGL 5C0YA 2NRTA 4IJAA 1Q18A 3DXKB 3O8MA 4I6MB 2AA4A 5AQHA 4FWOA 2A41A 2YJFA 3W0LA 1QZ5A 4FWPA 4O8UA 4YOWA 1NGFA 3LDOA 2ITMA 4CBXA 5KPRA 5KPTA 5MLCQ 3C7NB 2E2PA 3AY9A 1KXPA 4BRPA 4BRKA 2QWLA 4C1NK 3EKUA 3AAQA 2P9LB 4FWLA 4QS7A 1VQ9N 1E4FT 3A8YA 4DKWA 1JCEA 1RDWX 2PAVA 4PKHA 1QQMA 4RWTA 2GEMA 2HBMA 1NMDA 1WUAA 3M3ZA 2GELA 4BR0A 3ZX2A 3I8BA 1M1KO 2QWMA 3SAHA 4CZKA 5C2DA 3QFUA 3MN9A 1KD1O 2NLXA 2P9UB 5ADXA 5LY3A 3A0IX 4JKDA 4CD3A 3CCVN 2NNWA 3CC7N 1VQ6N 3BF1A 3AARA 2V7ZA 3VF4A 3DLLL 2CGKA 4IO9L 3HI0A 3O08A 2NRRA 2V52B 4B1ZA 4BRDA 5AZIA 2E2QA 3EZWA 3L6QA 4M7YA 3E9PA 3HRGA 2QWNA 4BRMA 3ZX3A 3JXUA 5EVZA 3P4IA 4CZHA 1K8KA 2E20A 3RVCA 4GNIA 3VGKA 1U2VB 5M1PA 3GDQA 2HBLA 4K41A 3L0QA 4AM7A 3KWIA 3GE1A 4YDUA 2CGLA 1N8RO 2ZGYA 4IOXA 5AR0A 4A62A 3VF2A 2IVOA 4ILJA 3DWLA 4O5FA 4IDHA 5FPMA 3VEVA 1SS6A 5ADXH 3CCSN 1VQ7N 1YAGA 4MLHA 4EAHD 4R79A 3EN9A 5GIPA 4CI6A 2E1ZA 1W2BM 4WQ4A 1NWKA 4H0XB 3SBTA 4G9ZA 3H6EA 4BVPA 3VEOA 1TYQA 4KH5A 5BN8A 1JCGA 3LM2A 1P90A 5C15A 5AQPA 5AQNA 1QQOA 1GLEG 1XQSC 4BRIA 1BOTO 5AQKA 4XH4A 1DT9A 2FLOA 3FGUA 2BH1A 4MLEA 3P39A 3H1QA 3P31A 3LDNA 1HKBA 3O9SA 5AFUA 2E2OA 1YITN 1QVGM 2W40A 3L4QA 5JVHL 4IOAL 4EIAA 1NGHA 2WC9A 3CCUN 1NJIO 4JKBA 3CXCM 4BRFA 1DGKN 1IG8A 3J7ZO 1BG3A 3UKUA 1TYQB 2VYPA 3GL1A 4BRNA 5GAEP 3WUHA 1HJOA 4JKFA 3SAGA 4YOYA 3O9QA 2FSKA 1XUPO 4FWKA 4BR4A 3VMFB 2WBNA 5JMVA 3CCQN 2P9SA 1R59O 1SZ2A 2HF3A 4BVOA 3SLCA 2E1YA 4CZLA 4JHDB 3CCMN 1X9JA 4YOVA 3KWGA 4BQZA 4JKCA 3LDLA 1NGAA 3F9MA 5F2RA 3PIPL 1Z05A 1KAYA 4H5WA 4NB4A 4JAXA 5BPNA 5M1NA 2A5XA 3MN7A 3VTIA 2ZWHA 1YI2N 1H1VA 1BA1A 3NMUA 3OA9A 4A2AA 1Q82O 2I7NA 4M63C 1K8KB 2CGJA 1W97L 5GAHP 2QWQA 3BF3A 3MCAB 3MWTA 2CH5A 3CPWM 2E88A 1QZ6A 3WXJA 5AZIB 1GLJO 2NRZA 1DEJA 3EO3A 3QBWA 4QS8A 5AZJB 3CCEN 2YHYA 4OPAA 3IFRA 1NGJA 2V51B 4BRLA 1MWMA 1GLLO 4HWIA 2FSJA 4BR7A 2YHWA 4H0PA 3PLAA 1BO5O 2QWRA 3IUCA 5BRFA 4IWVA 2QA4N 1EQYA 5AQJA 1OVYA 3DJCA 4BRHA 1U6ZA 2H3GX 3QFPA 4A59A 5C12A 5AQUA 3CF5L 4H0OA 4FWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SK3 A;  4CZM A;  1ZC6 A;  2YCH A;  3H45 C;  1T6C A;  1TUY A;  2I7P A;  3ULE A;  1RGI A;  4B1X B;  2P9P A;  1IJJ A;  4FWN A;  2P9I A;  3ZEU B;  2A40 A;  2QXL A;  2HMP A;  2FSN A;  1G99 A;  3WXK A;  3FFK B;  2E8A A;  2A6A A;  4IJN A;  3C7N A;  3CJC A;  1BUP A;  3R6M A;  4M7X A;  4ISF A;  2GWJ A;  4BC2 A;  3VEY A;  1J6Z A;  4IZ9 A;  5EXW A;  2NZT A;  5AQV A;  3O4W A;  3IMX A;  4I6M A;  3B8A X;  3O1B A;  3CI5 A;  4H5R A;  4MO4 A;  4CZF A;  5I9E B;  2A42 A;  3RSE A;  3H3N O;  4BC4 A;  4FL9 A;  3UE5 A;  4DQ8 A;  5BRH A;  3VER A;  4H0T B;  4HTL A;  3D2F B;  1V4T A;  1BDG A;  2P9I B;  4H0Y B;  3UB5 A;  3CET A;  5BRD A;  1ESV A;  2YJE A;  2QWO A;  2P9K B;  1GLD G;  1JCF A;  4BR5 A;  3CER A;  3QML A;  3MCP A;  1NGB A;  4AM6 A;  4H5V A;  2V7Y A;  5KQ8 A;  4LC9 B;  4K43 A;  3U4L A;  3OHR A;  1TUU A;  2D1K A;  2FF6 A;  5FPE A;  5BR9 A;  3R9P A;  3L4I A;  2IVN A;  3VPZ A;  3BP8 A;  3U9D A;  3WXL A;  4XH1 A;  4H0V B;  2VCP A;  3ATU A;  3MN6 A;  3DXM B;  3HBT A;  4BRE A;  1T44 A;  1C0F A;  1V4S A;  1Z6R A;  2BUP A;  4J8F A;  3DXM A;  1RFQ A;  4Z94 A;  3ENH A;  3VF6 A;  2E2N A;  4CZI A;  4QS9 A;  3CJ7 A;  3U9Z A;  4K42 A;  3W3D A;  1QQN A;  4ISG A;  3A5N C;  3G25 A;  4FWQ A;  3FZH A;  5E26 A;  5EX5 A;  4IXC A;  4JHD A;  1NGI A;  3QBX A;  2P9K A;  2BTF A;  1X3M A;  3ATV A;  4IO8 A;  3KVG A;  4JD2 B;  4FPB A;  3VEX A;  5AQF A;  5FPD A;  5AQG A;  3ZET B;  5BPM A;  4YDU C;  3VET A;  4PL8 A;  5JLH A;  3ENO A;  3LM9 A;  1QHA A;  2D4W A;  1KAX A;  3VOV A;  1KAZ A;  4A2B A;  3U8X A;  2Q1N A;  3R8E A;  2HOE A;  4B1Y B;  3FE1 A;  3C0B A;  3QIC A;  3EL2 A;  4B1U B;  2FF3 B;  1S22 A;  1NGD A;  4DB3 A;  3CQX A;  5AQY A;  4CZJ A;  4A61 A;  3FLC O;  3BUZ B;  5AQZ A;  4BR9 A;  3VEN A;  2P9P B;  4H03 B;  2W41 A;  3ULE B;  1GLA G;  4CD1 A;  5FPN A;  3UKR A;  4WQ5 A;  4C23 A;  1DKG D;  3D7E O;  5AQL A;  1NBW A;  1NGC A;  3M6G A;  5JIC A;  3HTV A;  3CJB A;  2ASP A;  3S41 A;  4FOI A;  5AZJ A;  2ASM A;  2DPN A;  4MO5 A;  2KHO A;  5EY4 A;  4PKG A;  4BGA A;  2Q36 A;  4BG9 A;  3WXI A;  3A5L C;  2F9T A;  3MMV A;  3CJ9 A;  4FOE A;  2IIR A;  3FZL A;  3FZF A;  3O5B A;  1BA0 A;  3AAP A;  1T6D A;  3SMP A;  2GTD A;  2EWS A;  5BPL A;  3H1V X;  1X3N A;  5E84 A;  3A5O C;  1OKJ A;  2ZGZ A;  3O6W A;  2ZF5 O;  3FZM A;  4FWS A;  2P9S B;  3VEW A;  1MDU B;  2P9U A;  2QM1 A;  1MWK A;  4H5T A;  4JN4 A;  3WT0 A;  4BG8 A;  1Y64 A;  3O80 A;  4H5N A;  3VGM A;  3J8A A;  3UKU B;  3VES A;  4BGB A;  4BQL A;  3VEZ A;  4BRA A;  4RCH A;  1GLC G;  3IDH A;  3CQY A;  4BRG A;  1YXQ A;  1HLU A;  2P9L A;  3HM8 A;  1NLV A;  2J4R A;  1HKC A;  2OAN A;  1S3X A;  3HSC A;  3VGL A;  4FWM A;  1XC3 A;  4BRC A;  5EOY A;  5AQR A;  3FZK A;  2VWB A;  4CZE A;  5AQX A;  1ZBS A;  3DXK A;  4F9O A;  4WQ5 C;  1HPM A;  3KHY A;  2ASO A;  1HKG A;  3DAW A;  3ZET A;  1C0G A;  1NGG A;  2IVP A;  4RTF D;  4Y0W A;  3TU5 A;  3D2E B;  2QW9 A;  4FPA A;  1HX1 A;  2Q2R A;  1NM1 A;  5KQD A;  3I33 A;  5B8H A;  3UKR B;  5AQS A;  4BRQ A;  3CJ1 A;  5AQQ A;  3ID8 A;  1E4G T;  4CJ7 A;  4BC5 A;  2HF4 A;  4E1J A;  1U2V A;  3GG4 A;  3MN5 A;  3MK6 A;  3GOI A;  4WQ4 C;  4BR2 A;  4DCH A;  2P9N B;  5F1X A;  4BC3 A;  1D4X A;  4FO0 A;  5BN9 A;  4GY2 B;  3BEX A;  4ISE A;  4NO7 A;  5AQI A;  2D0O A;  4DHY A;  1LOT B;  1SQK A;  1ATR A;  2A3Z A;  2GUP A;  1HUX A;  3KZB A;  3ZX0 A;  2D0P A;  3M1F A;  5F0X A;  1GLB G;  1NGE A;  4B9Q A;  4L3Q A;  4EFH A;  4K25 A;  1ATS A;  3CIP A;  4JD2 A;  5LJW A;  3O1W A;  4CZG A;  4PL7 A;  2AP1 A;  4JNE A;  3H3O B;  2F9W A;  5ELZ A;  3SJH A;  2FXU A;  4PKI A;  3WEE A;  4EHU A;  1CZA N;  3GBT A;  5TKY A;  3WEE B;  2CH6 A;  3LDQ A;  3SMS A;  4WYB A;  3LDP A;  5KPZ A;  4O8K A;  3WQU A;  3CJA A;  1ATN A;  5JLF A;  3D2F A;  4FSV A;  5CE3 A;  2YI1 A;  1MA9 B;  1ZXO A;  5AQW A;  5AQO A;  5AFU H;  2GWK A;  4B1W B;  1P8Z A;  3WQT A;  3A5M C;  4XH5 A;  2P9N A;  2WUS A;  1GLF O;  2YHX A;  1YUW A;  5AQT A;  3LL3 A;  2Q0R A;  5LJV A;  1BWF O;  1WOQ A;  3FR0 A;  3JS6 A;  4CBW A;  2NRH A;  2Q0U A;  3HZ6 A;  3ZEU A;  4KBO A;  2UYT A;  4B1V A;  4XEI A;  5AQM A;  4CBU A;  2PBD A;  1SAZ A;  1BU6 O;  3QDK A;  3CHW A;  3TPQ A;  1YVN A;  2QWP A;  2Q31 A;  3H46 O;  3QB0 A;  1LCU A;  3D2E A;  3EKS A;  4BRO A;  4EHT A;  5BRE A;  2Q97 A;  3MDQ A;  3RSE B;  4IJA A;  1Q18 A;  3DXK B;  3O8M A;  4I6M B;  2AA4 A;  5AQH A;  4FWO A;  2A41 A;  2YJF A;  3W0L A;  1QZ5 A;  4FWP A;  1NGF A;  3LDO A;  2ITM A;  4CBX A;  5KPR A;  5KPT A;  3C7N B;  2E2P A;  3AY9 A;  1KXP A;  4BRP A;  4BRK A;  2QWL A;  3EKU A;  3AAQ A;  2P9L B;  4FWL A;  4QS7 A;  1E4F T;  3A8Y A;  1JCE A;  1RDW X;  2PAV A;  4PKH A;  1QQM A;  4RWT A;  2GEM A;  1NMD A;  1WUA A;  3M3Z A;  2GEL A;  4BR0 A;  3ZX2 A;  3I8B A;  2QWM A;  4CZK A;  3QFU A;  3MN9 A;  2NLX A;  2P9U B;  5ADX A;  5LY3 A;  3A0I X;  4CD3 A;  3BF1 A;  3AAR A;  2V7Z A;  3VF4 A;  2CGK A;  3HI0 A;  3O08 A;  2V52 B;  4B1Z A;  4BRD A;  5AZI A;  2E2Q A;  3EZW A;  3L6Q A;  4M7Y A;  2QWN A;  4BRM A;  3ZX3 A;  3JXU A;  5EVZ A;  3P4I A;  4CZH A;  1K8K A;  2E20 A;  4GNI A;  3VGK A;  1U2V B;  3GDQ A;  4K41 A;  3L0Q A;  4AM7 A;  3GE1 A;  4YDU A;  2CGL A;  2ZGY A;  5AR0 A;  4A62 A;  3VF2 A;  2IVO A;  3DWL A;  4O5F A;  5FPM A;  3VEV A;  5ADX H;  1YAG A;  4MLH A;  4EAH D;  3EN9 A;  4CI6 A;  2E1Z A;  4WQ4 A;  1NWK A;  4H0X B;  3H6E A;  4BVP A;  3VEO A;  1TYQ A;  5BN8 A;  1JCG A;  3LM2 A;  5AQP A;  5AQN A;  1QQO A;  1GLE G;  1XQS C;  4BRI A;  1BOT O;  5AQK A;  4XH4 A;  3FGU A;  2FLO A;  4MLE A;  3H1Q A;  3LDN A;  1HKB A;  5AFU A;  2E2O A;  2W40 A;  4EIA A;  1NGH A;  4BRF A;  1DGK N;  1IG8 A;  1BG3 A;  3UKU A;  1TYQ B;  2VYP A;  3GL1 A;  4BRN A;  3WUH A;  1HJO A;  2FSK A;  1XUP O;  4FWK A;  4BR4 A;  5JMV A;  2P9S A;  1R59 O;  1SZ2 A;  2HF3 A;  4BVO A;  3SLC A;  2E1Y A;  4CZL A;  4JHD B;  1X9J A;  4BQZ A;  3LDL A;  1NGA A;  3F9M A;  5F2R A;  1Z05 A;  1KAY A;  4H5W A;  4NB4 A;  4JAX A;  5BPN A;  2A5X A;  3MN7 A;  2ZWH A;  1H1V A;  1BA1 A;  4A2A A;  2I7N A;  4M63 C;  1K8K B;  2CGJ A;  2QWQ A;  3BF3 A;  2CH5 A;  2E88 A;  1QZ6 A;  3WXJ A;  5AZI B;  1GLJ O;  4QS8 A;  1DEJ A;  3EO3 A;  3QBW A;  5AZJ B;  2YHY A;  3IFR A;  1NGJ A;  2V51 B;  4BRL A;  1MWM A;  1GLL O;  4HWI A;  2FSJ A;  4BR7 A;  2YHW A;  4H0P A;  1BO5 O;  2QWR A;  3IUC A;  5BRF A;  4IWV A;  1EQY A;  5AQJ A;  3DJC A;  4BRH A;  1U6Z A;  2H3G X;  3QFP A;  5AQU A;  4H0O A;  4FWR A; 
#chains in the Genus database with same CATH topology
 3SK3 A;  2YCH A;  1T6C A;  2I7P A;  4Z0U A;  1RGI A;  4B1X B;  1TKD A;  3ZEU B;  2HMP A;  4LFC K;  3AVG A;  3WXK A;  3CC4 N;  3C7N A;  3CJC A;  2ZJQ L;  1XNQ K;  4ISF A;  1HNZ K;  3LZJ A;  4E89 A;  1J6Z A;  4IZ9 A;  5EXW A;  2PYJ A;  3O1B A;  3E9O A;  5I9E B;  1YJ9 N;  4B3M K;  3RSE A;  4JI2 K;  4BC4 A;  4FL9 A;  4DQ8 A;  3ZT3 A;  1Q81 O;  4E7J A;  4H0T B;  1VSM A;  3UB5 A;  5HL7 L;  2UUB K;  1K9M O;  2ZD1 A;  3AVM A;  4BR5 A;  3CYM A;  4H5V A;  5M1O A;  5KQ8 A;  3CCJ N;  3U4L A;  4JEP A;  1OH8 A;  3AVJ A;  3OHR A;  4MDA A;  1TVR A;  2FF6 A;  3VQ4 A;  3THW A;  1YTA A;  3U9D A;  4CFA A;  3V9Z A;  3ATU A;  3OYE A;  4WFN L;  3HBT A;  3RRG A;  4BRE A;  2D5R A;  4CIG A;  5C42 A;  4I9Q A;  3T69 A;  5A2Q O;  3K59 A;  3ZSX A;  4BDY A;  4E7L A;  2A1S A;  1EKE A;  5M1K A;  3E01 A;  4DV4 K;  4W5T A;  1IV0 A;  3CJ7 A;  3THW B;  3CD6 N;  3U9Z A;  3W3D A;  1TKZ A;  2D0A A;  4AIL C;  4CHZ A;  1EX4 A;  2Z1H A;  5EX5 A;  4IXC A;  4KTZ A;  4YOX A;  3ATV A;  1U49 A;  1N36 K;  3SCX A;  4DTN A;  3NAE A;  1LV5 A;  1U04 A;  4DFK A;  5AQG A;  3ZET B;  4FLW A;  5BPM A;  4DQQ A;  4YDU C;  4DLE A;  4DG1 A;  1TK8 A;  4PL8 A;  3ENO A;  3VOV A;  3LM9 A;  2D4W A;  1S1V A;  1QE1 A;  4A2B A;  3FE1 A;  1LWC A;  4FK0 A;  2Y1I A;  1CXQ A;  1NGD A;  3V9U A;  4A61 A;  3VA0 A;  3BUZ B;  1NK4 A;  4X62 K;  1KLN A;  3T1H K;  3ULE B;  4GV3 A;  4WQ5 A;  1VSL A;  2I5J A;  4JKG A;  2HHQ A;  1XMO K;  4KHY A;  4AHV A;  4TSX A;  1FXX A;  3I56 N;  3Q7B A;  1NGC A;  2PFU A;  5JIC A;  1BCO A;  3ZSO A;  1Q9Y A;  3VQ8 A;  1RDB A;  3HTV A;  2ASP A;  3P83 D;  1TKX A;  4KB0 A;  3MAQ A;  4MO5 A;  1BIZ A;  1LWF A;  2F9T A;  3MMV A;  3O5B A;  3AO3 A;  4NCB A;  4ELU A;  4B08 A;  3AO2 A;  3A5O C;  3AA3 A;  1OKJ A;  2ZGZ A;  4Z4E A;  4CHO A;  3LAL A;  1LAV A;  1MDU B;  1MWK A;  4JKG B;  4CJW A;  4JN4 A;  3WT0 A;  4CF8 A;  3OYN A;  3NVM A;  3I55 N;  4GKK K;  3J8A A;  3CG7 A;  1YVU A;  3KKS A;  3CQY A;  1QTM A;  3QIP A;  1UA0 A;  1RDA A;  4CIF A;  1K73 O;  4IOC L;  2J4R A;  4DV5 K;  4JS4 A;  3HSC A;  1NKC A;  3VGL A;  1XC3 A;  4BRC A;  1YF5 L;  2F4V K;  3PX4 A;  1JXB A;  5AQX A;  1YT3 A;  4YNQ A;  4YOU A;  4JV5 K;  3KHY A;  3ZET A;  4FK2 A;  4ELT A;  3L3V A;  3LAM A;  3D2E B;  4FPA A;  1I3A A;  4CCH A;  1XNR K;  3I33 A;  4FJH A;  4DTU A;  3TTC A;  5AQQ A;  4FM2 A;  2HHS A;  3ID8 A;  3PIO L;  1RTJ A;  3N4Q A;  4FCY A;  2OPS A;  4CVN E;  3KKR A;  3HO1 A;  2RF2 A;  4A57 A;  4BC5 A;  4FM1 A;  5KRT A;  3OW2 M;  3DRR A;  3GG4 A;  3CME N;  4BR2 A;  4N47 A;  3TAP A;  5H1S Q;  2OTL N;  3VTH A;  1D4X A;  4NO7 A;  5AQI A;  1GOA A;  5GIN A;  4JKE A;  1NGE A;  4RG8 A;  2KFN A;  4L3Q A;  4EFH A;  4CGH A;  1O13 A;  3T7Z A;  1ATS A;  4CF1 A;  4DFJ A;  4DR1 K;  5LJW A;  2ITG A;  4PL7 A;  5HP1 A;  2AP1 A;  4JNE A;  2F9W A;  4KB1 A;  3KK3 A;  3SJH A;  4OPH A;  1CZA N;  3GBT A;  1F21 A;  5HRS A;  3SMS A;  4WYB A;  3LDP A;  4OO1 J;  3WQU A;  4JI3 K;  3ZSW A;  3VQE A;  3CJA A;  1M90 O;  5JLF A;  1YHQ N;  4FSV A;  5M1F A;  3PO4 A;  4DWI A;  3T1Y K;  5AQO A;  4CHP A;  1YJN N;  4ID1 A;  1HYS A;  4LFA K;  3WQT A;  3L3U A;  3MED A;  4DR3 K;  4DTP A;  4EP4 A;  4DUZ K;  1A5W A;  3JS6 A;  4PHT X;  4OGE A;  5JS2 A;  1YIJ N;  5M1Q A;  3ZEU A;  4KBO A;  3LP1 A;  2AJQ A;  4OVL A;  3SPY A;  4B1V A;  3H08 A;  5AQM A;  3QDK A;  3CPE A;  3THY B;  1HNW K;  4YOR A;  2QWP A;  1RT3 A;  4B3S K;  2Q31 A;  4LF5 K;  3D2E A;  4H8K A;  1C0T A;  4HCC A;  2Q97 A;  3HM9 A;  3DOL A;  3RSE B;  1WNS A;  3DXK B;  4CES A;  4DTS A;  3DYA A;  4AQY K;  4JRP A;  4FWP A;  4YOW A;  5MLC Q;  5KPT A;  2VG6 A;  4BRK A;  3DRS A;  1NU0 A;  1VQ9 N;  3A8Y A;  4E3S A;  1IKY A;  1XWL A;  2HB5 A;  2UXD K;  1WUA A;  2GEL A;  1NJW A;  3T19 A;  1Q8I A;  5HLF A;  5C2D A;  1SL0 A;  1KVC A;  2YNH A;  5CZ1 A;  4FJX A;  3MN9 A;  4CEE A;  2VG5 A;  2P9U B;  4JKD A;  1T8E A;  4ZTF A;  5C25 A;  4CJ5 A;  4BE2 A;  3PX6 A;  3HI0 A;  3V9S A;  3LAK A;  2V52 B;  3DI6 A;  3THX A;  2E2Q A;  2RN2 A;  3E9P A;  4LSL A;  3KK2 A;  2F8S A;  5EVZ A;  3P4I A;  4CZH A;  2E20 A;  3RVC A;  4GNI A;  1U2V B;  5M1P A;  2HBL A;  4BE1 A;  3P5J A;  4IOX A;  4A62 A;  3VF2 A;  2ZQB A;  2VWJ A;  2P1J A;  4ILJ A;  1BIU A;  5FPM A;  3MXJ A;  4BDZ A;  4EAH D;  2Q3S A;  1UOC A;  4H0X B;  4B9N A;  4C8L A;  1WAJ A;  4FK4 A;  5AQP A;  4RW8 A;  3HP9 A;  4O5B A;  5AQK A;  4LF4 K;  3FGU A;  4GW6 A;  3OJU A;  3ZSV A;  3P39 A;  3H1Q A;  4ZTJ A;  1HKB A;  2OPP A;  3O9S A;  3L2R A;  1QVG M;  2W40 A;  3L4Q A;  4IOA L;  4EIA A;  3CCU N;  1WSG A;  2DFH A;  1W0H A;  1ZBF A;  4BRF A;  1IG8 A;  3J7Z O;  3UKU A;  2VYP A;  3CFP A;  1HJO A;  3O9Q A;  1XUP O;  3F73 A;  4HUF A;  3P1G A;  3SPZ A;  2YKN A;  1SL1 A;  3L2U A;  3TWH A;  3SLC A;  4X66 K;  5HRP A;  4BQZ A;  4JKC A;  5KRS A;  1N32 K;  3MEE A;  1KAY A;  2A5X A;  3MN7 A;  3VTI A;  2HHH K;  3M8R A;  4M3X A;  4A2A A;  3AO5 A;  4M63 C;  5CY4 A;  4LD0 A;  1B9F A;  3ZLJ A;  3QBW A;  5AZJ B;  2O8F A;  4OPA A;  1B92 A;  3IFR A;  1NGJ A;  1MWM A;  4FJJ A;  2FSJ A;  2QWR A;  1EQY A;  4DV6 K;  2PYL A;  1S1W A;  2H3G X;  3QFP A;  3CF5 L;  1HNI A;  5AQU A;  1LW0 A;  4H0O A;  1IH7 A;  3QER A;  4CZM A;  3H45 C;  1TUY A;  2P9P A;  3J80 O;  2P9I A;  2A40 A;  3K9J A;  2QK9 A;  1C1C A;  4CK3 A;  4NLB A;  1N34 K;  3LWL A;  4BC2 A;  3VEY A;  3LP2 A;  2XY6 A;  4WE1 A;  2NZT A;  2WFB A;  4F4K A;  3IMX A;  1X9M A;  3HL8 A;  1VQM N;  1VRT A;  2LSN A;  3K0S A;  1V4T A;  1BDG A;  4H0Y B;  3OYL A;  5KTQ A;  1ESV A;  2YJE A;  2P9K B;  2PY5 A;  3SUO A;  3QML A;  1JL1 A;  3AVC A;  4CFC A;  2V7Y A;  1VSH A;  1QVF M;  3VQB A;  4FYD A;  5BR8 K;  3M8P A;  1JKH A;  1ZBU A;  2JGU A;  4GV9 A;  5BR9 A;  3HOS A;  3VPZ A;  3NCI A;  4DQP A;  4H0V B;  3RMA A;  4LFB K;  2VCP A;  2VQE K;  2HHV A;  2GX9 A;  1FKO A;  4M3Z A;  1HYZ A;  4QAG A;  3PX0 A;  1T44 A;  2BUP A;  1V4S A;  3CCR N;  4DSF A;  4Z94 A;  4G1Q A;  1TK0 A;  1NOZ A;  4EZ9 A;  4K42 A;  1GOC A;  4DR7 K;  3ISN C;  4FWQ A;  4GVM A;  5E26 A;  3V9X A;  4B3R K;  1E3M A;  4JHD A;  1NGI A;  1X3M A;  4IDK A;  1ASU A;  2F8T A;  4IO8 A;  3JSM A;  3VEX A;  1JL2 A;  5J2M A;  4C8N A;  4YHH K;  1HQU A;  5JLH A;  3S3M A;  1QHA A;  1KAX A;  4NXM K;  1KAZ A;  2XRI A;  2Q1N A;  3EE9 A;  2PZS A;  2XHB A;  3C6U A;  3C0B A;  3ZT2 A;  3EL2 A;  4B9S A;  3L8B A;  2FF3 B;  3O3G A;  1NNE A;  3CQX A;  5AQY A;  4E7H A;  4CZJ A;  4BR9 A;  1RIL A;  4CJE A;  1HR0 K;  4KTW A;  3SBG A;  1IG9 A;  4NYN A;  5CZ2 A;  4C23 A;  1BHL A;  2ZE2 A;  3ZYY X;  3QET A;  3M6G A;  2RKI A;  3KJV A;  3CJB A;  4DR6 K;  4FJ8 A;  4FOI A;  3NH0 A;  5AZJ A;  2DPN A;  1TK5 A;  2KHO A;  5EY4 A;  3WXI A;  3A5L C;  4FLV A;  4JK8 A;  1WB9 A;  2B6A A;  4L8R B;  2YHB A;  4DTM A;  4LF6 K;  5BPL A;  3NH2 A;  1EP4 A;  3WNG A;  5E84 A;  1U4B A;  2ZF5 O;  3OJS A;  2P9S B;  2QM1 A;  4O0I A;  3D45 A;  4H5T A;  3KTQ A;  2RE2 A;  4BG8 A;  1OVQ A;  3RTV A;  3SNN A;  4JI7 K;  3VES A;  4BQL A;  4RCH A;  3IDH A;  4BRG A;  2FBY A;  1OH6 A;  3SYZ A;  2P9L A;  2OAN A;  3MXI A;  3FZK A;  2VWB A;  1IBM K;  4OLA A;  4NLC A;  4EZ6 A;  1FKP A;  3DAW A;  1C0G A;  1NGG A;  2IVP A;  3NF7 A;  4Y0W A;  5GAG P;  2OTJ N;  1WBD A;  3NVK A;  3F5T A;  2HHU A;  3PSF A;  2X6S A;  1NM1 A;  4J2D A;  5B8H A;  3UKR B;  4JI6 K;  4BRQ A;  3E9L A;  1RTI A;  1TAU A;  1NJY A;  5LMU K;  4FXD A;  3MX2 A;  4CJ7 A;  2HF4 A;  2O8E A;  2DFE A;  4E1J A;  3VQP A;  3MN5 A;  3MK6 A;  3GOI A;  2YNG A;  4DCH A;  1LAW A;  4FVM A;  3TAR A;  3DMJ A;  4BC3 A;  4FO0 A;  4GY2 B;  2D0O A;  4O0J A;  1SQK A;  3IG1 A;  3KLH A;  4IG0 A;  1HUX A;  4KI4 A;  3ZX0 A;  5KGW A;  5F0X A;  3L2V A;  1GLB G;  5GAD P;  4DTR A;  4JD2 A;  3OYK A;  4KHS A;  4CGF A;  3H3O B;  3EEQ A;  4AH9 A;  3OYD A;  3A2F A;  4X64 K;  4O4G A;  4DV0 K;  3V9W A;  3OVN A;  2CH6 A;  3LDQ A;  4A5A A;  4CJP A;  3SAF A;  4KAZ A;  4IFV A;  3OYC A;  1XMQ K;  3M8S A;  4Q5V A;  3SQ4 A;  4DU1 A;  4FJK A;  2QXF A;  5DK5 A;  4JK7 A;  1ZXO A;  4DTX A;  5AFU H;  1P8Z A;  1W7A A;  1QHT A;  3BGR A;  1Q9X A;  2YHA A;  2YHX A;  1O1W A;  3LP0 A;  1J5O A;  4A5B A;  1TKT A;  5HOO A;  1JLB A;  1RTH A;  1BWF O;  2O8E B;  3OS2 A;  4JI0 K;  3K2P A;  3J7A P;  2UYT A;  1YTU A;  4CBU A;  3MWP A;  4DR2 K;  1BQM A;  3OYA A;  3DLE A;  4JI5 K;  3TPQ A;  3S3N A;  1YVN A;  4CF2 A;  3H46 O;  3CQ8 A;  3QB0 A;  1LCU A;  3EKS A;  4BRO A;  5BRE A;  3HVR A;  4CEF A;  3HP6 A;  3MDQ A;  4B9M A;  2BGG A;  3NGZ A;  1VHX A;  4FJG A;  2NRT A;  1Q18 A;  4M3Y A;  4FWO A;  2YJF A;  1QZ5 A;  4DMN A;  3PY8 A;  1S5J A;  3SZ2 A;  5KPR A;  1KXP A;  4BRP A;  4C1N K;  4DLG A;  4HVJ A;  3AAQ A;  3AA4 A;  1JCE A;  1RDW X;  3BY5 A;  2GEM A;  2HBM A;  3M3Z A;  3OS1 A;  4BR0 A;  4JRQ A;  3I8B A;  3U3Y A;  2QWM A;  3DLK A;  3OYB A;  4CZK A;  3KLE A;  4BAC A;  3K5O A;  3U3G A;  2EHG A;  2NLX A;  2XY7 A;  4C8M A;  5LY3 A;  2ATQ A;  4DF4 A;  3CM5 A;  3CCV N;  2V7Z A;  2CGK A;  2R7Y A;  4Y1D A;  3O08 A;  4Z4C A;  4BRD A;  3HPG A;  3HRG A;  3ZX3 A;  3SUQ A;  1BI4 A;  1RBS A;  1Z26 A;  4FZY A;  2RPI A;  1ZBI A;  1J53 A;  3VGK A;  1S6Q A;  3GDQ A;  5LL6 Z;  4K41 A;  2W6L A;  3L0Q A;  3GE1 A;  1J54 A;  4YDU A;  3ZCM A;  2CGL A;  3L2W A;  1T05 A;  4JI4 K;  3OYH A;  1IBK K;  2IVO A;  4JI8 K;  3DWL A;  4O5F A;  4K8X A;  4J2A A;  1X1P A;  2VQF K;  1VQ7 N;  4CHN A;  1WSF A;  1YAG A;  1L3T A;  2OPQ A;  4AHS A;  1W2B M;  3SBT A;  4CE9 A;  1TGO A;  2KZZ A;  4IBN A;  3VEO A;  5BN8 A;  1P90 A;  5C15 A;  3ALY A;  1BOT O;  2O8C B;  1Z25 A;  4MLE A;  1NK9 A;  3LDN A;  1YIT N;  3NDK A;  1S1X A;  2FBT A;  3TI0 A;  5J2N A;  3AVB A;  1HJR A;  3DLG A;  1NJI O;  4NCG A;  1BG3 A;  1TYQ B;  1D9F A;  4BRN A;  4AHU A;  5GAE P;  1VRU A;  4JKF A;  1SV5 A;  3SAG A;  4YOY A;  1RNH A;  4FLY A;  3TAB A;  2WBN A;  2DFF A;  3CCQ N;  3WNF A;  3TAQ A;  1I39 A;  4F3T A;  2E1Y A;  4GKJ K;  1GOB A;  1X9J A;  3KWG A;  3BDP A;  3F9M A;  5F2R A;  4JAX A;  5BPN A;  4NCA A;  2ZWH A;  1YI2 N;  4E0D A;  1BA1 A;  4M45 A;  4F2R A;  2BDP A;  1W97 L;  3SQ0 A;  4CF9 A;  1WSJ A;  3BF3 A;  3MWT A;  3CPW M;  1QZ6 A;  2NRZ A;  4QS8 A;  1DEJ A;  3ZT4 A;  4XIU A;  2YHY A;  4LH4 A;  2V51 B;  4BRL A;  4AHC A;  4BR7 A;  4W5Q A;  3PLA A;  3LPU A;  3NH1 A;  1HQE A;  5AQJ A;  1U6Z A;  3I8D A;  1NKE A;  4DTJ A;  1KVA A;  3ULE A;  1ILY A;  4FVU A;  4FWN A;  3EYZ A;  3MEG A;  1KSP A;  2DY4 A;  1VQ8 N;  5DMR A;  2NRW A;  3PV8 A;  1G99 A;  3FFK B;  2E8A A;  4IJN A;  4JK9 A;  3R6M A;  4O44 A;  3ZSZ A;  4CJQ A;  4E7K A;  4I6M A;  4NXN K;  3B8A X;  4MO4 A;  4OPJ A;  2A42 A;  2IOC A;  4HUE A;  3QEX A;  3H3N O;  1VQO N;  4K8Z A;  4CK2 A;  5BRH A;  3LWM A;  4HTL A;  3D2F B;  2KLA A;  3TAF A;  2P9I B;  3CET A;  2UUA K;  4WFB L;  1JCF A;  3CER A;  3MCP A;  4AM6 A;  3R1X A;  2O8D B;  4LC9 B;  2RHK A;  4KRE A;  2YX6 A;  4DV7 K;  5J1E A;  4K43 A;  1TUU A;  2D1K A;  2E6M A;  4KHU A;  4OKE A;  3R9P A;  3TAM A;  4ELV A;  3BP8 A;  3WXL A;  4OX9 K;  3O9R A;  4AHT A;  3MN6 A;  1EXQ A;  1DTQ A;  2O8F B;  2D0B A;  3AGR A;  1A5X A;  1Z6R A;  1IO2 A;  1VQK N;  1D8Y A;  1NK6 A;  3QEV A;  2VGM A;  2E6L A;  3ENH A;  3AVA A;  3VF6 A;  3THV A;  2E2N A;  2NRX A;  4CZI A;  4B9L A;  3OYJ A;  1WN7 A;  3AA5 X;  3OS0 A;  1NJZ A;  3EE8 A;  5IT9 O;  4ISG A;  4KTQ A;  4QCL A;  3G25 A;  2O8D A;  2X74 A;  1RBR A;  3C65 A;  3LDS A;  3TAE A;  2BTF A;  4I9L A;  4FW2 A;  3KVG A;  3AVL A;  1TL3 A;  4E1M A;  2P5G A;  1FK9 A;  3ID6 A;  4U67 L;  4CJV A;  4FJL A;  5FPD A;  3QEW A;  4ICL A;  1NG9 A;  4J2B A;  3I0R A;  5T7B A;  3G71 N;  2FBX A;  3V1R A;  4PQU A;  2QKK A;  4M3R A;  2WOM A;  5AJ3 K;  4B1Y B;  4BWM A;  2HNY A;  4CEZ A;  1B9D A;  3QIC A;  3O9U A;  1T03 A;  2UXB K;  2XY8 A;  3G10 A;  2O4I A;  3VEN A;  4BE0 A;  3V1Q A;  2W41 A;  4B8C A;  3B6O A;  4Z4I A;  1GLA G;  4WFA L;  3NF6 A;  2HW3 A;  4MFB A;  2HVH A;  1IKV A;  1VQP N;  1JLE A;  1DKG D;  3ITH A;  2JWL A;  4IG3 A;  4LSN A;  4OPK A;  4E7I A;  2QKB A;  4ILG B;  2QTD A;  3DLB A;  4B3T K;  4J2E A;  3M8Q A;  3DOK A;  4PKG A;  1VSE A;  2Q36 A;  2GV9 A;  3RR8 A;  2IIR A;  3G6E N;  1S1U A;  2KQ2 A;  4KH4 A;  3TAG A;  1BA0 A;  3AAP A;  4UQG A;  4N76 A;  3SMP A;  2GTD A;  3K5L A;  3H1V X;  2OZM A;  1VSI A;  3KLF A;  3O6W A;  3E66 A;  3SI6 A;  3LAN A;  5KI6 A;  3FZM A;  4FWS A;  2B5J A;  3AVH A;  2P9U A;  2VWK A;  1RTD A;  3NHG A;  4WCE L;  1BL3 A;  4CEO A;  4KKO A;  1Y64 A;  3O80 A;  1IBL K;  3VGM A;  2OCE A;  4BGB A;  5C2F A;  3RMC A;  5JS1 A;  3VEZ A;  1GLC G;  4R5P A;  4CIE A;  4OKK A;  1YXQ A;  3M5R A;  4O55 A;  3HXM A;  3HM8 A;  3AO1 A;  3QIN A;  4CER A;  1NLV A;  3J81 O;  1HKC A;  3AA2 A;  3CM6 A;  1EWQ A;  4FWM A;  1D5A A;  3SQ2 A;  4AF1 A;  2HBJ A;  5DM7 L;  3DXK A;  1HPM A;  2ASO A;  3TR8 A;  3ZT1 A;  3O3H A;  2QW9 A;  5CHI A;  4FJI A;  4M3T A;  1S9G A;  3NF9 A;  3SQ1 A;  4C1N I;  2ZJR L;  1CZB A;  1TV6 A;  4M3W A;  3AVN A;  3K9K A;  3D6R A;  5F1X A;  1NMN A;  3NF8 A;  3O9T A;  5BN9 A;  3BEX A;  3PUF A;  4PY5 A;  4DU4 A;  4DHY A;  1LOT B;  2GUP A;  2A3Z A;  2D0P A;  3M1F A;  4DSE A;  1K8A O;  3MEC A;  2W6K A;  4B9Q A;  4K25 A;  3CIP A;  1JLF A;  3G0Z A;  4GV6 A;  3LP3 A;  5CYM A;  5ELZ A;  1RT4 A;  1RBV A;  2FXU A;  3WEE A;  3T3F A;  2VGN A;  2HBK A;  5I3U A;  4KHP K;  1Q86 O;  3WEE B;  2KFZ A;  1VSD A;  3Q7C A;  4BY9 C;  4GMJ B;  1ATN A;  1KLM A;  2X78 A;  3D2F A;  1KQS M;  1RT7 A;  4FJ7 A;  5CE3 A;  2YI1 A;  1MA9 B;  1QSY A;  5AQW A;  1SKR A;  3VQQ A;  5CR4 A;  1C0U A;  3A5M C;  2O8B A;  3CC2 N;  2WUS A;  3RRH A;  3NGY A;  1GLF O;  1YUW A;  5AQT A;  2Q0R A;  3K5M A;  3C95 A;  1NK0 A;  5GIO A;  3WNE A;  4DU3 A;  1UA1 A;  3UIQ A;  4CBW A;  2NRH A;  2Q0U A;  2BE2 A;  2IDO A;  1U48 A;  1VQ4 N;  2PBD A;  3VQ9 A;  2FC0 A;  4RW6 A;  1SAZ A;  4FLT A;  4YY3 K;  4KHN A;  4EHT A;  3VQC A;  4LF9 K;  1RT1 A;  5C0Y A;  4IJA A;  3O8M A;  4I6M B;  2A41 A;  3HYF A;  3W0L A;  3IRX A;  5HRR A;  3VQ5 A;  2ITM A;  3C7N B;  1RDC A;  1NKB A;  2QWL A;  3LZI A;  4F8R A;  3EKU A;  4QS7 A;  2KTQ A;  1E4F T;  4DKW A;  4IFY A;  1R0A A;  1RBU A;  1NMD A;  3KIO A;  3ZX2 A;  3RMB A;  3SAH A;  2HVI A;  4FM0 A;  3J7Y P;  4C8K A;  1KFS A;  1DTT A;  2NNW A;  4JS5 A;  3NGI A;  3CC7 N;  1T7P A;  1VQ6 N;  3BF1 A;  3AAR A;  2A1R A;  2NRR A;  1J5E K;  4CEC A;  2YNF A;  1WBB A;  1ASW A;  2EX3 A;  4B9V A;  3L6Q A;  4RW9 A;  4BRM A;  4CJT A;  2DTU A;  1HNV A;  3KLI A;  3V6D A;  4CGI A;  3PO5 A;  4Q0B A;  1WSI A;  1G15 A;  4DV2 K;  4AM7 A;  3KWI A;  2OA8 A;  3DRP A;  2O8C A;  1ZBL A;  3KD5 E;  4IDH A;  3VEV A;  3CCS N;  4OGC A;  4MLH A;  4NYF A;  1N6Q A;  4W5N A;  2E1Z A;  1KRP A;  4G9Z A;  1JXE A;  1FJG K;  3H6E A;  4BVP A;  1TYQ A;  4KH5 A;  4FZZ A;  5HRO A;  1L3S A;  1JCG A;  1XI1 A;  2WTU A;  3K57 A;  3LM2 A;  4DR4 K;  1QQO A;  1GLE G;  1OH5 A;  1DT9 A;  2GUI A;  5KGX A;  1RDD A;  1VSF A;  5JVH L;  1BQN A;  1WSE A;  1BI4 B;  1EET A;  3VQ6 A;  2WC9 A;  4KFB A;  4JKB A;  4CEB A;  3CXC M;  1DGK N;  3GL1 A;  3V81 A;  3IAY A;  4FWK A;  1NK7 A;  4BR4 A;  3VMF B;  2F96 A;  5JMV A;  2P9S A;  3ZT0 A;  3K58 A;  1SZ2 A;  4BVO A;  3CCM N;  3SV3 A;  3QIO A;  4Z4G A;  3LDL A;  1NGA A;  1NJX A;  3PIP L;  4B9T A;  4H5W A;  4NB4 A;  2IC3 A;  1N33 K;  4FJ9 A;  1REV A;  1HYV A;  3V1O A;  4DQR A;  3NMU A;  3OA9 A;  1Q82 O;  2I7N A;  3O3F A;  1K8K B;  2CGJ A;  2Z1J A;  2QWQ A;  2E88 A;  3WXJ A;  5AZI B;  1GLJ O;  3OY9 A;  3CCE N;  1KCF A;  4IKF A;  4H4O A;  3C94 A;  3PSI A;  1GLL O;  4K0K K;  2QA4 N;  3AVF A;  2IAJ A;  1OVY A;  3DJC A;  4A59 A;  1JLA A;  4N56 A;  4DF8 A;  1WLJ A;  1ZC6 A;  1ASV A;  2BAN A;  3ENB A;  4JKA A;  4YFU A;  1IJJ A;  2IS3 A;  3SJJ A;  2QXL A;  2FSN A;  2A6A A;  3HPO A;  1BUP A;  3AV9 A;  3O4Q A;  4M7X A;  4KH6 A;  1HRH A;  2GWJ A;  4IFE A;  1RBT A;  3S3O A;  4I2Q A;  4Y1C A;  5AQV A;  3O4W A;  3RMD A;  4YOT A;  1QQC A;  3CI5 A;  4H5R A;  4CZF A;  4U7B A;  1SKS A;  4DSK A;  5J2Q A;  3ULD A;  5DM6 L;  3UE5 A;  2UXC K;  3VER A;  4I2P A;  2Z1I A;  1FW6 A;  2YV0 X;  3AVK A;  5BRD A;  2QWO A;  1GLD G;  3OTO K;  1NGB A;  3NBP A;  1JLC A;  5C24 A;  2G8F A;  5FPE A;  3L4I A;  4CEA A;  5I42 A;  2IVN A;  2F7T A;  4W5O A;  1BCM A;  4XH1 A;  3QEP A;  2ETJ A;  3DXM B;  1Y97 A;  5SWM A;  1HMV A;  3ZSQ A;  5FRN A;  1C0F A;  4J8F A;  2XY5 A;  3DXM A;  1RFQ A;  1XHZ A;  4DUY K;  5HBM A;  4KHQ A;  5C10 A;  3E1Y A;  1XC9 A;  4QS9 A;  1ZYQ A;  1QSS A;  1D9D A;  1QQN A;  3ZSR A;  4M41 A;  3F2K A;  1S6P A;  3A5N C;  4PUO A;  3WNH A;  4KRF A;  3RWU A;  4MQ3 A;  3WXM B;  4DQI A;  3QNN A;  3BZC A;  3FZH A;  1NK8 A;  5FRM A;  3I0S A;  3KLG A;  1L3U A;  3K5N A;  3QBX A;  2P9K A;  4JD2 B;  1X9S A;  1VSK A;  4FPB A;  5AQF A;  3DLH A;  5FDL A;  2NUB A;  4CGG A;  2ZM6 K;  3OYM A;  4HUG A;  3VET A;  4DFM A;  3TSU A;  3OBY A;  1A5V A;  2KKZ A;  3U8X A;  3R8E A;  4EP5 A;  2HOE A;  3TSP A;  3HK2 A;  2KZM A;  2OZS A;  4B1U B;  4FW1 A;  1S22 A;  4DB3 A;  4I7F A;  4E19 A;  4CK1 A;  3FLC O;  5AQZ A;  1EO1 A;  4ZHR A;  2P9P B;  4H03 B;  4Z4F A;  1HPZ A;  4B8A B;  1W9H A;  4LY7 A;  1C6V A;  4CD1 A;  5FPN A;  3UKR A;  2GBZ A;  4DTO A;  3CFR A;  3QLH A;  1RDU A;  3CCL N;  4DS4 A;  2NRV A;  3D7E O;  4RW4 A;  5AQL A;  1NBW A;  4CHY A;  4FJN A;  3TTD A;  2YNI A;  3S41 A;  4CGJ A;  4DQS A;  3AGK A;  5TKW A;  2ASM A;  1JJ2 M;  1TAQ A;  1WSH A;  1KFD A;  4BGA A;  3NE6 A;  4BG9 A;  1QSL A;  3CJ9 A;  4FOE A;  3SUN A;  3DM2 A;  3FZL A;  3TSQ A;  3FZF A;  5K14 A;  1T6D A;  2W42 A;  1HNX K;  2EWS A;  3IKM A;  1X3N A;  3B6P A;  4CF0 A;  4CJR A;  3IS9 A;  3VEW A;  4GVE A;  3VA3 A;  3U6F A;  2HHT A;  4F3O A;  4OLB A;  4H5N A;  3UKU B;  4DV1 K;  4BRA A;  4LF8 K;  4Z4H A;  3QO9 A;  1K6Y A;  3JYT A;  1KC8 O;  1C0M A;  1HLU A;  2JLE A;  3QNO A;  5CYQ A;  1YJW N;  2HHW A;  1S3X A;  4CJ4 A;  3AVI A;  4AHR A;  5FLX O;  2G8I A;  1ITG A;  3ASM A;  5EOY A;  1Q7Y O;  5AQR A;  3L2Q A;  3ZSY A;  4H4M A;  1S72 N;  4CZE A;  1SUQ A;  1ZBS A;  3FFI A;  4F9O A;  4WQ5 C;  2QI2 A;  1JLG A;  1HKG A;  3SV4 A;  4RTF D;  3TU5 A;  2QEX N;  1HX1 A;  2Q2R A;  2WON A;  3EY1 A;  5KQD A;  4W5R A;  2G8V A;  3KD1 E;  5AQS A;  4UY8 O;  1BIS A;  3CJ1 A;  3G4S N;  3OBW A;  1VQ5 N;  4FJM A;  1VK0 A;  3C6H A;  1E4G T;  4RW7 A;  1T3V A;  1DLO A;  3HT3 A;  4DSJ A;  1QS4 A;  2HST A;  1WAF A;  1U2V A;  4CJU A;  2IGI A;  4ILH A;  4B9U A;  1VQN N;  4WQ4 C;  1U45 A;  2HMI A;  2P9N B;  3LPT A;  2B4J A;  2JWK A;  4ISE A;  1ZBH A;  1XHX A;  1ATR A;  3KZB A;  3VN5 A;  4DFP A;  3O1W A;  4CZG A;  4WF9 L;  4JYA K;  4M42 A;  4CHQ A;  4PKI A;  4EHU A;  4DSL A;  3HST B;  5TKY A;  1CZ9 A;  2VG7 A;  4KI6 A;  3C6A A;  4MDB A;  3BZK A;  5KPZ A;  1U47 A;  4O8K A;  4IEE A;  1LWE A;  3N4P A;  5FRO A;  4HHT A;  3P38 A;  4IEI A;  3JAM O;  2P5O A;  3HPH A;  3OYF A;  3HOT A;  1RCH A;  1S9E A;  1OH7 A;  2GWK A;  2OPR A;  4B1W B;  4F2S A;  2HND A;  4XH5 A;  2P9N A;  4JKH A;  2UUC K;  3CMA N;  1RT5 A;  5SZT A;  3TTF A;  4KPY A;  4C8O A;  4KV8 A;  3LL3 A;  4BDP A;  3KK7 A;  3NFA A;  3O4N A;  5LJV A;  1VQL N;  1WOQ A;  3FR0 A;  3D0P A;  5LMN K;  3HZ6 A;  2Z1G A;  3MX5 A;  1SKW A;  4FLX A;  4XEI A;  1L3V A;  1KTQ A;  1N5Y A;  1CXU A;  1BU6 O;  4DV3 K;  3CHW A;  5HRN A;  1VAZ A;  2E5L K;  2ZJP L;  3R3L A;  4V19 S;  4JLH A;  4LH5 A;  1I94 K;  5D3G A;  1J9A A;  1S1T A;  3V4I A;  1UAX A;  2FBV A;  4N5S A;  5JVG L;  2G8H A;  4CJK A;  2AA4 A;  5AQH A;  2O8B B;  4CEQ A;  3HVT A;  4O8U A;  1NGF A;  3LDO A;  4CBX A;  2E2P A;  3AY9 A;  4CJL A;  1NK5 A;  2P9L B;  4FWL A;  2E4L A;  3C6T A;  2HNZ A;  2PAV A;  4PKH A;  1QQM A;  4RWT A;  3KK1 A;  4DR5 K;  3F9K A;  1VSJ A;  1M1K O;  3SUP A;  1BGX T;  3VQD A;  3QFU A;  3TAN A;  1KD1 O;  5ADX A;  3A0I X;  4HCB A;  4CD3 A;  3VF4 A;  3DLL L;  4IO9 L;  4E1N A;  2OYQ A;  4B1Z A;  3QEI A;  3T1A A;  2G8U A;  1LW2 A;  5AZI A;  3EZW A;  4M7Y A;  2UU9 K;  2QWN A;  1X9W A;  3JXU A;  4X65 K;  1SL2 A;  1K8K A;  4CFB A;  2P51 A;  3OYI A;  1L5U A;  4CJ3 A;  2Y1J A;  1EWR A;  1RT2 A;  4M3U A;  4ID5 A;  2KW4 A;  1N8R O;  1TL1 A;  2ZGY A;  5AR0 A;  4HTU A;  4KHW A;  4CGD A;  4CW7 B;  1SS6 A;  5ADX H;  4KO0 A;  4R79 A;  5J2P A;  3EN9 A;  5GIP A;  4CI6 A;  3VQA A;  4WQ4 A;  1NWK A;  1NOY A;  2G8K A;  3QES A;  1C1B A;  2X6N A;  5AQN A;  1XQS C;  1RT6 A;  4OKJ A;  4BRI A;  4OJR A;  2XO7 A;  4CJF A;  4XH4 A;  2FLO A;  2BH1 A;  3P31 A;  5AFU A;  2E2O A;  4DS5 A;  1MU2 A;  1NGH A;  2O4G A;  2G8W A;  4FLZ A;  3WUH A;  1JLQ A;  4N41 A;  2FSK A;  3HJF A;  4CFD A;  3S9H A;  4JI1 K;  3DLR A;  1R59 O;  1CLQ A;  2HF3 A;  4CZL A;  4JHD B;  4YOV A;  4BWJ A;  1Z05 A;  4B3O A;  1IKW A;  5M1N A;  3MXM A;  1H1V A;  3CFO A;  3VQ7 A;  4CED A;  4FLU A;  4FJ5 A;  4PA1 A;  5GAH P;  3OYG A;  3RR7 A;  5E41 A;  3MCA B;  2CH5 A;  4FZX C;  2HHX A;  2D0C A;  3THX B;  4DSI A;  3EO3 A;  1KVB A;  4PWD A;  4HWI A;  1UWB A;  2YHW A;  4H0P A;  4QOZ B;  1C1A A;  1BO5 O;  5IWA K;  3IUC A;  4CJS A;  4IWV A;  5BRF A;  3EZ5 A;  4LF7 K;  1IKX A;  4BRH A;  5C12 A;  3THY A;  3AO4 A;  2YKM A;  5EU7 A;  4FWR A; 
#chains in the Genus database with same CATH homology
 3SK3 A;  4CZM A;  1ZC6 A;  2YCH A;  3H45 C;  1T6C A;  1TUY A;  2I7P A;  3ENB A;  1RGI A;  4JKA A;  2P9P A;  3ULE A;  4B1X B;  4FVU A;  1IJJ A;  4FWN A;  2P9I A;  3ZEU B;  2A40 A;  2QXL A;  1VQ8 N;  2HMP A;  2NRW A;  2FSN A;  3K9J A;  1G99 A;  3WXK A;  3FFK B;  2E8A A;  2A6A A;  4IJN A;  4JK9 A;  3CC4 N;  3C7N A;  3CJC A;  4NLB A;  2ZJQ L;  1BUP A;  3R6M A;  4M7X A;  4ISF A;  2GWJ A;  4IFE A;  4KH6 A;  3VEY A;  4BC2 A;  1J6Z A;  4IZ9 A;  5EXW A;  2NZT A;  2WFB A;  5AQV A;  3O4W A;  3IMX A;  4I6M A;  1VQM N;  3B8A X;  3O1B A;  3E9O A;  4YOT A;  3CI5 A;  4H5R A;  4MO4 A;  4CZF A;  4U7B A;  5I9E B;  2A42 A;  1YJ9 N;  3RSE A;  3H3N O;  1VQO N;  5DM6 L;  4BC4 A;  4FL9 A;  3UE5 A;  4DQ8 A;  5BRH A;  3VER A;  1Q81 O;  4H0T B;  4HTL A;  3D2F B;  1V4T A;  2KLA A;  1BDG A;  2P9I B;  4H0Y B;  3UB5 A;  5HL7 L;  3CET A;  5BRD A;  1ESV A;  2YJE A;  2QWO A;  2P9K B;  1K9M O;  1GLD G;  1JCF A;  4BR5 A;  4WFB L;  3CER A;  3QML A;  3MCP A;  1NGB A;  4AM6 A;  3R1X A;  2V7Y A;  4H5V A;  5M1O A;  1QVF M;  5KQ8 A;  3CCJ N;  4LC9 B;  2RHK A;  2YX6 A;  4K43 A;  3U4L A;  4JEP A;  3OHR A;  1TUU A;  2D1K A;  2FF6 A;  4MDA A;  5FPE A;  4GV9 A;  5BR9 A;  3HOS A;  3R9P A;  3L4I A;  2IVN A;  3VPZ A;  2F7T A;  3BP8 A;  3U9D A;  3WXL A;  4XH1 A;  4H0V B;  3O9R A;  2VCP A;  3ATU A;  3MN6 A;  4WFN L;  2GX9 A;  3DXM B;  3HBT A;  4BRE A;  3AGR A;  1T44 A;  1C0F A;  1V4S A;  1Z6R A;  2BUP A;  4J8F A;  3T69 A;  3CCR N;  3DXM A;  1VQK N;  1RFQ A;  4Z94 A;  2VGM A;  3ENH A;  5M1K A;  3VF6 A;  5C10 A;  2E2N A;  2NRX A;  3E1Y A;  4CZI A;  4QS9 A;  3CJ7 A;  3CD6 N;  3EE8 A;  3U9Z A;  4K42 A;  3W3D A;  1QQN A;  4ISG A;  3F2K A;  3A5N C;  3G25 A;  3WXM B;  4FWQ A;  3FZH A;  5E26 A;  3C65 A;  5EX5 A;  4IXC A;  4JHD A;  1NGI A;  3QBX A;  2P9K A;  2BTF A;  1X3M A;  4YOX A;  3ATV A;  4IO8 A;  3KVG A;  4JD2 B;  4FPB A;  3VEX A;  5AQF A;  4U67 L;  3ID6 A;  5FPD A;  5AQG A;  3ZET B;  5BPM A;  4YDU C;  3G71 N;  3VET A;  4PL8 A;  5JLH A;  3TSU A;  3ENO A;  3LM9 A;  1QHA A;  2D4W A;  1KAX A;  3OBY A;  2KKZ A;  1KAZ A;  3VOV A;  4A2B A;  3U8X A;  2Q1N A;  3EE9 A;  3R8E A;  2HOE A;  4B1Y B;  3FE1 A;  3TSP A;  3C0B A;  3QIC A;  3EL2 A;  4B1U B;  2FF3 B;  1S22 A;  1NGD A;  4DB3 A;  3CQX A;  3O9U A;  5AQY A;  4CZJ A;  4A61 A;  3FLC O;  3BUZ B;  5AQZ A;  1EO1 A;  4BR9 A;  3VEN A;  2P9P B;  4H03 B;  2W41 A;  3ULE B;  1GLA G;  4GV3 A;  3SBG A;  4CD1 A;  5FPN A;  3UKR A;  4WFA L;  4WQ5 A;  4JKG A;  1VQP N;  4C23 A;  1DKG D;  1RDU A;  3CCL N;  2JWL A;  3ZYY X;  2NRV A;  3D7E O;  5AQL A;  1NBW A;  3Q7B A;  3I56 N;  1NGC A;  2PFU A;  3M6G A;  5JIC A;  3TTD A;  3HTV A;  4ILG B;  3CJB A;  2QTD A;  2ASP A;  3S41 A;  3AGK A;  4FOI A;  5TKW A;  5AZJ A;  2ASM A;  2DPN A;  4MO5 A;  1JJ2 M;  2KHO A;  5EY4 A;  4PKG A;  4BGA A;  2Q36 A;  4BG9 A;  3WXI A;  3A5L C;  2F9T A;  3MMV A;  3CJ9 A;  4FOE A;  4JK8 A;  2IIR A;  3FZL A;  3TSQ A;  3G6E N;  3FZF A;  4KH4 A;  3O5B A;  1BA0 A;  3AAP A;  1T6D A;  3SMP A;  2GTD A;  2EWS A;  3IKM A;  5BPL A;  3H1V X;  1X3N A;  5E84 A;  3A5O C;  1OKJ A;  2ZGZ A;  3E66 A;  3O6W A;  2ZF5 O;  3FZM A;  4FWS A;  2P9S B;  3VEW A;  1MDU B;  2P9U A;  2QM1 A;  4GVE A;  1MWK A;  4JKG B;  4H5T A;  4JN4 A;  3WT0 A;  4WCE L;  2RE2 A;  4BG8 A;  1Y64 A;  3O80 A;  4H5N A;  3NVM A;  3VGM A;  3I55 N;  3J8A A;  3UKU B;  3VES A;  4BGB A;  4BQL A;  5C2F A;  3VEZ A;  4BRA A;  4RCH A;  1GLC G;  3IDH A;  3CQY A;  4BRG A;  1YXQ A;  3M5R A;  1KC8 O;  1HLU A;  2P9L A;  3HM8 A;  1YJW N;  4IOC L;  1NLV A;  2J4R A;  1HKC A;  2OAN A;  1K73 O;  1S3X A;  3HSC A;  3VGL A;  4FWM A;  1XC3 A;  4BRC A;  4AF1 A;  1YF5 L;  5EOY A;  1Q7Y O;  2HBJ A;  5AQR A;  3FZK A;  2VWB A;  1S72 N;  4CZE A;  5AQX A;  1ZBS A;  5DM7 L;  3DXK A;  4NLC A;  4F9O A;  4WQ5 C;  4YOU A;  2QI2 A;  1HPM A;  2ASO A;  3KHY A;  1HKG A;  3DAW A;  3ZET A;  1C0G A;  1NGG A;  2IVP A;  4RTF D;  2OTJ N;  4Y0W A;  5GAG P;  3TU5 A;  3D2E B;  2QW9 A;  3NVK A;  2QEX N;  3F5T A;  4FPA A;  1HX1 A;  2Q2R A;  1NM1 A;  5KQD A;  3I33 A;  5B8H A;  3UKR B;  5AQS A;  3E9L A;  4BRQ A;  3CJ1 A;  5CHI A;  3G4S N;  3OBW A;  3TTC A;  1VQ5 N;  5AQQ A;  3C6H A;  3ID8 A;  3PIO L;  1E4G T;  3N4Q A;  3MX2 A;  4C1N I;  4CJ7 A;  1T3V A;  4A57 A;  4BC5 A;  2ZJR L;  2HF4 A;  3OW2 M;  2HST A;  4E1J A;  1U2V A;  4ILH A;  3GG4 A;  3MN5 A;  3CME N;  3MK6 A;  1VQN N;  3GOI A;  4WQ4 C;  4BR2 A;  4DCH A;  3K9K A;  4UY8 O;  3D6R A;  5H1S Q;  2P9N B;  5F1X A;  4BC3 A;  3VTH A;  1D4X A;  3O9T A;  4FO0 A;  2OTL N;  5BN9 A;  2JWK A;  3BEX A;  4GY2 B;  4ISE A;  4NO7 A;  5AQI A;  2D0O A;  4DHY A;  1LOT B;  1SQK A;  1ATR A;  2A3Z A;  2GUP A;  1HUX A;  3KZB A;  3ZX0 A;  5GIN A;  2D0P A;  3M1F A;  4JKE A;  1GLB G;  1NGE A;  4B9Q A;  4L3Q A;  4EFH A;  4K25 A;  5F0X A;  5GAD P;  1K8A O;  1O13 A;  3T7Z A;  1ATS A;  3CIP A;  4JD2 A;  5LJW A;  3O1W A;  4CZG A;  4PL7 A;  4GV6 A;  2AP1 A;  4JNE A;  3H3O B;  2F9W A;  5ELZ A;  4WF9 L;  3SJH A;  2FXU A;  4PKI A;  3WEE A;  4EHU A;  2VGN A;  4OPH A;  1CZA N;  3GBT A;  5TKY A;  2HBK A;  1Q86 O;  3WEE B;  3C6A A;  2CH6 A;  3LDQ A;  4MDB A;  4WYB A;  3LDP A;  3SMS A;  4A5A A;  3SAF A;  5KPZ A;  4OO1 J;  4O8K A;  4IEE A;  3WQU A;  3Q7C A;  4BY9 C;  3CJA A;  1ATN A;  1M90 O;  5JLF A;  3D2F A;  1YHQ N;  1KQS M;  4FSV A;  3N4P A;  5M1F A;  5CE3 A;  2YI1 A;  3P38 A;  4IEI A;  1MA9 B;  4JK7 A;  1ZXO A;  5AQW A;  5AQO A;  5AFU H;  3HOT A;  1YJN N;  5CR4 A;  2GWK A;  4B1W B;  1P8Z A;  1ILY A;  3WQT A;  3A5M C;  4XH5 A;  2P9N A;  4JKH A;  3CC2 N;  2WUS A;  3CMA N;  1GLF O;  2YHX A;  3TTF A;  1YUW A;  5AQT A;  3LL3 A;  4A5B A;  2Q0R A;  3KK7 A;  5LJV A;  5HOO A;  1BWF O;  1VQL N;  1WOQ A;  3FR0 A;  5GIO A;  3JS6 A;  4PHT X;  1YIJ N;  5M1Q A;  4CBW A;  2NRH A;  2Q0U A;  3HZ6 A;  3ZEU A;  4KBO A;  3MX5 A;  2UYT A;  4B1V A;  4XEI A;  1VQ4 N;  5AQM A;  4CBU A;  3MWP A;  2PBD A;  1SAZ A;  1BU6 O;  3QDK A;  3CHW A;  3CPE A;  1VAZ A;  1YVN A;  3TPQ A;  2ZJP L;  3R3L A;  4YOR A;  2QWP A;  2Q31 A;  3H46 O;  3QB0 A;  1LCU A;  3D2E A;  3EKS A;  4BRO A;  4EHT A;  5BRE A;  2Q97 A;  3MDQ A;  3RSE B;  5JVG L;  5C0Y A;  2NRT A;  4IJA A;  1Q18 A;  3DXK B;  3O8M A;  4I6M B;  2AA4 A;  5AQH A;  4FWO A;  2A41 A;  2YJF A;  3W0L A;  1QZ5 A;  4FWP A;  4O8U A;  4YOW A;  1NGF A;  3LDO A;  2ITM A;  4CBX A;  5KPR A;  5KPT A;  5MLC Q;  3C7N B;  2E2P A;  3AY9 A;  1KXP A;  4BRP A;  4BRK A;  2QWL A;  4C1N K;  3EKU A;  3AAQ A;  2P9L B;  4FWL A;  4QS7 A;  1VQ9 N;  1E4F T;  3A8Y A;  4DKW A;  1JCE A;  1RDW X;  2PAV A;  4PKH A;  1QQM A;  4RWT A;  2GEM A;  2HBM A;  1NMD A;  1WUA A;  3M3Z A;  2GEL A;  4BR0 A;  3ZX2 A;  3I8B A;  1M1K O;  2QWM A;  3SAH A;  4CZK A;  5C2D A;  3QFU A;  3MN9 A;  1KD1 O;  2NLX A;  2P9U B;  5ADX A;  5LY3 A;  3A0I X;  4JKD A;  4CD3 A;  3CCV N;  2NNW A;  3CC7 N;  1VQ6 N;  3BF1 A;  3AAR A;  2V7Z A;  3VF4 A;  3DLL L;  2CGK A;  4IO9 L;  3HI0 A;  3O08 A;  2NRR A;  2V52 B;  4B1Z A;  4BRD A;  5AZI A;  2E2Q A;  3EZW A;  3L6Q A;  4M7Y A;  3E9P A;  3HRG A;  2QWN A;  4BRM A;  3ZX3 A;  3JXU A;  5EVZ A;  3P4I A;  4CZH A;  1K8K A;  2E20 A;  3RVC A;  4GNI A;  3VGK A;  1U2V B;  5M1P A;  3GDQ A;  2HBL A;  4K41 A;  3L0Q A;  4AM7 A;  3KWI A;  3GE1 A;  4YDU A;  2CGL A;  1N8R O;  2ZGY A;  4IOX A;  5AR0 A;  4A62 A;  3VF2 A;  2IVO A;  4ILJ A;  3DWL A;  4O5F A;  4IDH A;  5FPM A;  3VEV A;  1SS6 A;  5ADX H;  3CCS N;  1VQ7 N;  1YAG A;  4MLH A;  4EAH D;  4R79 A;  3EN9 A;  5GIP A;  4CI6 A;  2E1Z A;  1W2B M;  4WQ4 A;  1NWK A;  4H0X B;  3SBT A;  4G9Z A;  3H6E A;  4BVP A;  3VEO A;  1TYQ A;  4KH5 A;  5BN8 A;  1JCG A;  3LM2 A;  1P90 A;  5C15 A;  5AQP A;  5AQN A;  1QQO A;  1GLE G;  1XQS C;  4BRI A;  1BOT O;  5AQK A;  4XH4 A;  1DT9 A;  2FLO A;  3FGU A;  2BH1 A;  4MLE A;  3P39 A;  3H1Q A;  3P31 A;  3LDN A;  1HKB A;  3O9S A;  5AFU A;  2E2O A;  1YIT N;  1QVG M;  2W40 A;  3L4Q A;  5JVH L;  4IOA L;  4EIA A;  1NGH A;  2WC9 A;  3CCU N;  1NJI O;  4JKB A;  3CXC M;  4BRF A;  1DGK N;  1IG8 A;  3J7Z O;  1BG3 A;  3UKU A;  1TYQ B;  2VYP A;  3GL1 A;  4BRN A;  5GAE P;  3WUH A;  1HJO A;  4JKF A;  3SAG A;  4YOY A;  3O9Q A;  2FSK A;  1XUP O;  4FWK A;  4BR4 A;  3VMF B;  2WBN A;  5JMV A;  3CCQ N;  2P9S A;  1R59 O;  1SZ2 A;  2HF3 A;  4BVO A;  3SLC A;  2E1Y A;  4CZL A;  4JHD B;  3CCM N;  1X9J A;  4YOV A;  3KWG A;  4BQZ A;  4JKC A;  3LDL A;  1NGA A;  3F9M A;  5F2R A;  3PIP L;  1Z05 A;  1KAY A;  4H5W A;  4NB4 A;  4JAX A;  5BPN A;  5M1N A;  2A5X A;  3MN7 A;  3VTI A;  2ZWH A;  1YI2 N;  1H1V A;  1BA1 A;  3NMU A;  3OA9 A;  4A2A A;  1Q82 O;  2I7N A;  4M63 C;  1K8K B;  2CGJ A;  1W97 L;  5GAH P;  2QWQ A;  3BF3 A;  3MCA B;  3MWT A;  2CH5 A;  3CPW M;  2E88 A;  1QZ6 A;  3WXJ A;  5AZI B;  1GLJ O;  2NRZ A;  1DEJ A;  3EO3 A;  3QBW A;  4QS8 A;  5AZJ B;  3CCE N;  2YHY A;  4OPA A;  3IFR A;  1NGJ A;  2V51 B;  4BRL A;  1MWM A;  1GLL O;  4HWI A;  2FSJ A;  4BR7 A;  2YHW A;  4H0P A;  3PLA A;  1BO5 O;  2QWR A;  3IUC A;  5BRF A;  4IWV A;  2QA4 N;  1EQY A;  5AQJ A;  1OVY A;  3DJC A;  4BRH A;  1U6Z A;  2H3G X;  3QFP A;  4A59 A;  5C12 A;  5AQU A;  3CF5 L;  4H0O A;  4FWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...