3ZXAC

Structure and assembly of turnip crinkle virus i. x-ray crystallographic structure analysis at 3.2 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
295
structure length
295
Chain Sequence
QKVTRLSAPVALAYREVSTQPRVSTARDGITRSGSELITTLKKNTDTEPKYTTAVLNPSEPGTFNQLIKEAAQYEKYRFTSLRFRYSPMSPSTTGGKVALAFDRDAAKPPPNDLASLYNIEGCVSSVPWTGFILTVPTDSTDRFVADGISDPKLVDFGKLIMATYGQGAAQLGEVRVEYTVQLKNRTGSTSAQIGDFAGVKDGPRLVSWSKTKGTAGWEHDCHFLGTGNFSLTLFYEKAPVSGLENADASDFSVLGEAAAGSVQWAGVKVAERGQGVKMVTTEEQPKGKWQALRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Assembly of Turnip Crinkle Virus. I. X-Ray Crystallographic Structure Analysis at 3.2 A Resolution.
pubmed doi rcsb
molecule tags Virus
molecule keywords CAPSID PROTEIN
total genus 18
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zxaC02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zxaC01
1VRH1 1K5MB 4CDQC 1NCRC 4CDXB 1Z7S2 2MEV1 1VBE1 4QPGB 1FMD2 5C8CC 4FTEA 4IV1B 5GKAC 1BMV1 2WZR1 4CDWC 4IV1C 3CJIA 3DPRA 3VBRC 4JGYA 1FOD1 1X33A 4WM8B 2RR11 1ND2A 5ABJB 1W39A 4RHV2 4RFT0 4CDQA 4NWVA 1AYM2 3JB8A 1PVC2 4FTSA 1AR81 1RUG1 2WS92 1FPN3 2HWE3 4CEWB 2HWE2 4Q4W2 1RUH1 1ND2C 2RR12 4JGZB 2BFUL 1PVC3 2QQPA 1POV3 1SMVA 4RS5B 1AYM1 1COV1 2IZWA 2Y26A 1QJU3 4RS5C 1VBD2 1BEV1 4IV1A 1QQP1 1PO22 5L7OC 2VQ0A 2XBO3 1F2NA 4GMP1 5D8AC 2BFUS 2XBO2 2RMU1 1RUJ2 2WLPA 1VBC2 4Y4YA 1PIV3 2HWB2 1AR71 4N43A 4CDXC 4CDUA 3NAPA 3J8F3 4JGYB 2WFF2 5ABJA 1PO21 1ASJ3 4IV3B 2ZZQA 5BNOB 3VBUA 5AC91 2WS93 4RS5A 4CEWC 3HAGA 2RR13 1TME3 1AYM3 4Q4W3 1PGL2 1HRI1 1CD3G 2FZ2A 3VBFA 3ZFGA 1D4M1 1MQTB 4NWWA 4YVSC 1TME2 2X5IC 1HXS1 1MQTC 4RHV3 1RUC1 4CEWA 1RHI1 2RS12 1PGW2 2HWB3 5FOJB 1VBD1 4N43B 2BPA2 4CEYA 3VBUB 1ND3A 5D8AB 3NAPB 4JGZA 5C8CA 2HWF2 5BNNC 3JD72 1RUF2 1POV0 1AYN2 5BNPC 4IV3A 2HWD2 2RS51 1AR63 3VBFC 4PDWB 1C8M3 1NCQC 3VBFB 3JD73 1MQTA 1NY72 2GSYA 5CFDB 1HXS3 2WFF3 2MEV2 4RQPB 1AL22 1RUC3 5J96B 1A6CA 1NCQA 1HRI3 1MEC3 4AEDC 2WWSA 1HRV2 4Q4X3 4RQPC 5A33A 2R041 1AR93 3ZFGB 2HWC1 3ZFEC 2ZTNA 1WCDJ 2XPJA 1RUG2 2WS91 4PDWA 1V9U3 1RUD3 2PLV2 4N43C 3VDDC 4Q4Y3 1FMD3 1RVF1 3DPRB 1AR83 3JB4C 4QPIC 4EJRA 1QJZA 2R073 1RMU2 3JBG1 3J8F1 1GFF2 1ZBA3 2R042 5BNPB 5L7OA 1VRH2 4CEYB 2HWF1 5C4WB 3VBRB 5C8CB 1PIV1 2RS31 5C4WC 2WZR3 1V9U1 3TN93 2PLV1 1ZBE2 4LLFA 5C9AB 4GB32 2RS53 2R062 1QJU1 4RQPA 1VBC3 1QQP3 4WM8C 3JBG2 5A33B 4Q4V3 1RUI3 1RUE2 1R1A3 1TMF2 2X5IA 1VBB3 1PVC1 1V9U2 5BNOC 4QPIA 1QJX2 1X36A 1R092 1VAKA 1FMD1 1RVF3 1PGW1 1VBB2 1BBT3 5J98B 1EV13 1RUI2 4AEDB 3ZFEB 4BCUA 4CDUB 3ZFGC 5C4WA 1M06G 1VBA1 1BEV3 1HRI2 4YVWC 5CFCC 1R1A1 1OOPB 1R083 4YVWB 2DF7A 5BNPA 4N53B 1EAH3 1D4M2 1POV1 3VBRA 1VRH3 1ASJ1 3LOBA 1VBE3 5C9AC 1CJDA 1QJY2 4SBVA 4WM7C 2FZ1A 2WFF1 4WM7B 5JZGA 1QQP2 5CFDC 1AYN3 4GB33 1FOD3 2ZAHA 3JD71 4Q4Y1 1AR73 5ACA1 4AEDA 3VBHB 1VBC1 1TMF3 5FMOL 5AC92 5C9AA 2RM22 1RUE3 1HQNA 1RUE1 4Q4V2 1RB8G 4N53A 1EAH1 3ZFEA 1ND3B 5D8AA 2X5IB 1R081 1AYN1 1OOPC 4RR3C 3VDDA 4QPIB 4YVWA 3ZXAC 1VB2A 1RUG3 1RUH2 2TBVA 1QJX3 4CDUC 1ZBA2 1BBT1 1HX6A 3DPRC 1AR92 1D4M3 1PGL1 4JGZC 3FBMA 1OHFA 5JZGB 1RHI3 2HWC3 1QJY3 2RS32 1OOPA 1VB4A 4RR3A 1VBE2 1F8VA 1NCRB 1TME1 1AL0G 1RUF3 4WM7A 5BNNA 1AR61 4CDWA 1NCQB 4Q4W1 2MEV3 5FMOS 5DDJ3 1DDLA 1RVF2 5LK7B 5A32B 3TN91 2RS33 1RMU3 4CEYC 3IDEA 1R091 4YVSB 1E57A 3VBSB 4CDXA 3VBSC 3JBG3 1PO12 1FPN1 1RUJ1 1RUI1 1PO13 4GMP3 4GH4B 4Q4V1 1VBA2 1QJU2 4FSJA 1COV2 1ND2B 1R1A2 2RMU3 1NA1C 1R082 5L7OB 2PLV3 1HRV3 5BNNB 2HWC2 4GH4C 1PO11 4GB31 1EV12 3VDDB 1RUF1 1AL21 2RS13 1RHI2 3VBUC 1ZBE3 1AR82 1COV3 1ZBA1 1BBT2 1VBA3 4Q4X2 1RUH3 3NAPC 4RHV1 3VBSA 5JZGC 5CFCB 4JGYC 1C8M2 1AR62 4Z92B 1HXS2 2HWD3 4PDWC 4YVSA 1NA1A 4CDWB 1ZBE1 4Q4X1 5DDJ2 1NG0A 1B35B 2XBO1 5AC93 4IV3C 4GH4A 5K0UC 5A32A 3CJIC 3J8F2 1FOD2 1AUYA 3VBHC 1MEC2 3S6PA 5BNOA 1RUC2 2RMU2 1RUJ3 3VBOB 5K0UB 1AR72 5ACA2 2R071 1H8TC 2HWE1 4N53C 1RUD1 1NY71 3M8LA 1IHMA 4Q4Y2 2R043 1Z7S1 2HWD1 1Z7S3 2RS52 1H8TA 1VBD3 2R072 3VBHA 2HWF3 2R061 2RM23 1BMV2 4FTBA 2WZR2 4QPGC 1EAH2 1K5MA 4GMP0 1QJY1 1B35A 4CDQB 3ZFFB 1R093 5CFCA 3ZFFC 1OPOA 3VBOA 1PIV2 5K0UA 5ABJC 1FPN2 1QJX1 1AL23 2RS11 3CJIB 5DDJ1 1NA1B 1AR91 4QPGA 1VBB1 1C8NA 1B35C 2R063 1HRV1 2RM21 1MEC1 1TMF1 3VBOC 4WM8A 1NOVA 5ACA3 4RR3B 1EV11 5CFDA 1NCRA 1PO23 2BBVA 1BEV2 1ND3C 1K5MC 2BUKA 3TN92 3ZFFA 1ASJ2 1H8TB 1RUD2 1RMU1 2HWB1 4Y5Z0 1C8M1 2GH8A
chains in the Genus database with same CATH superfamily
4QGMA 1KTBA 4BQBA 3WJMA 4OUSA 1EV2E 5BXFA 4CDQC 4MH0E 1BZEA 3O12A 3AG1B 3OGSA 3QOPA 4G9FA 4X5WB 3FTUA 4B97A 5C3LD 3WIIL 4LE4A 4IIZA 4GG6F 3ZDXF 1YUDA 4EXKA 2WBJA 1FMD2 1TVDA 2CKBB 1Q0YL 2APTA 2IAND 4N0FB 3HMXA 4ZX6A 1UU4A 2H0FA 4JNXA 1JZIA 5F2FA 2ITFA 2W81C 1O6SB 4GMTL 5LQBH 2RFXB 1W0YT 4NN6B 2P1YA 3E9TA 2WR9A 4AGLA 3GXNA 2W1QA 5LEJA 2Q86B 1GHFL 1LO4L 1IRAY 1WQVT 3BT2H 2PHXA 4XXWC 4JKPH 3AKRA 4YVNA 4R7DA 1RC6A 3D85B 2Q30A 5MHSD 1N8ZB 1F8TH 3EXUA 1JFQH 4KK6D 1M05B 1Q9LB 5EOTA 5JXEA 4EUPB 4P49A 1J58A 4UFMA 4AEMA 4LQ1A 1BVOA 4CEWB 5MEOA 1QF3A 2NQDA 1QGLA 3C5ZC 3OKEA 1J5HA 4P02B 3KQRA 2X7LB 3MNVA 1RUH1 4JG5A 1JGEA 4C54A 3P5BA 4NQED 4Y16B 1JGVL 5IK3A 1N3NA 1FPTH 5FYUA 5LBSL 1Q1PA 1DJHA 2A77L 2R32A 2X89A 3MGUA 5FUZL 1AYM1 4UILH 4XHBA 3TN0A 3KBEA 4AQ2A 1X50A 4WENB 4BQ3A 3VWKC 3ZPDA 5ITFB 5AB2A 4JW3A 3Q3GA 4UFHA 3BI3A 3VQ2C 1VBD2 5JVVA 1BPVA 2P8MA 2AZAA 2FGWL 3ZSTA 3HFFA 5T1DH 4LFHD 3PWNB 3HBGA 1G0YR 5EG6C 4FQIL 4WTQA 1I5PA 5I6NA 1J87A 2Y07L 1EPFA 4HCRH 4LIQE 1YEIH 4OGYH 1A5FH 3BZDA 3FOMB 1C5DB 4OUUB 2DVGA 3P0YL 3C5SB 3LZZA 3MRQB 4AE2A 1CFNA 1ENRA 3DURB 5T50A 1NUDA 3HFML 4YXLH 1SQ4A 3AX4A 1J1PL 1CXHA 3WDJA 4L92A 2GJZA 3N1QC 1KTLB 1XF2A 1IS6A 4PJEB 4PS3A 4QQOA 2H4EA 1S55A 1TNRA 3RYRA 2PWDA 3HNVH 7PCYA 3FFCE 5I23A 2QZ3A 2OX5A 2G5RA 3FULA 4RGOH 1A6WL 4MGZE 4G59C 4XMIA 2ZGRA 1V7NH 2VAJA 1HZKA 2DIAA 5IV2B 1YC61 1G0XA 2B4CC 4MQXD 4JBSA 1FYTB 4NWUH 4HJ0C 3CVBA 5HI3C 1W6OB 3GALA 2BOJA 3KMHA 5AOJA 4X80H 3FU0A 3MOBH 5E0QA 1HJGA 5HJBA 4IERA 3KPSB 5LCWL 5AQ0A 5KS9A 2Y5EA 1BXUA 1EO5A 3LS5L 4NIKB 4HLJA 2A77H 2LALA 1USQA 4P2RE 5EH1A 3HMXL 4AFBA 1BREA 1VE0A 4ANKA 1GJIA 5I0VA 3PUAA 1A7OL 4BHUI 3HNMA 4JZJA 1JTZX 4LLDA 2D93A 4S2SB 4PRAA 5E8PB 1ZVSA 4MCZA 4FAHA 1ILUA 3HJEA 3ON7A 2AJ3A 5A6MA 3CLFH 3H2WA 4FXKA 3OC8A 3OL2A 2B8MA 4FQXD 5F89A 1IGOA 4RD7A 1JTTA 2G60L 2QKIC 3W1ZA 5CJOL 2KDYA 5L6YH 2V2XA 3QAZC 4N43B 1HN0A 3K6FA 3UAEA 2CGZA 3ARUA 2Z1PA 5IVYA 5IVOA 1GV9A 2W60A 1XGPA 4KUZH 1UO9A 2PAKA 3M2MA 2PAMA 4JPVL 1I1AC 5E08L 3KLHC 1AR1C 5FHBL 3UZVB 4XB7A 2F74A 2BVUA 3UJTL 5KSUB 1ERNA 2A6KA 4OUOA 3VBFC 4L8CB 1NCDL 3HC3L 3ZXEA 4NR1A 2GJ6E 1S7VB 3RX5A 1GP6A 3KPNB 3VI4F 1KYOJ 2VSCA 3A4EA 4DS0A 2O14A 1UU6A 4MZRA 2HKHH 4AF9A 3KPMB 4H8WL 2EIEA 1MPAH 1SEBB 3RL2A 3VD9A 2DQUH 4I5BB 1SXBA 3CQOA 4YDLB 1WS7A 3MRHA 2Y24A 4GW5B 2E7CA 4ZW8A 3MBXL 3BAEH 5J96B 1OTUC 3UDWC 5JR7B 3EW3B 4LSQH 2VW1A 2NYYC 1F4WL 2WQRA 1DBJH 3FB5B 1ZAGA 2PCXA 4KTGA 2J1AA 2AJYL 4KI5C 1I8AA 1QQDA 2XZQL 5LCVA 1V6KA 2HH9A 4FYSA 2QCSB 3U9PH 3WUCA 3NVQA 1MY5A 2KDGA 1OLLA 4OFKA 1NLDH 3QFJA 4ZW6A 1HKLH 4ZO7A 4CJ0A 2Y0OA 4QHLA 5F5AA 4OQ9A 3R0MA 3CNKA 4Q0XL 1FNEA 2AEYA 3IXAB 4JLRB 1TTBA 1UZ6E 3ZUNC 5C9JA 5LAXB 5I1GH 1TYJA 4KMQA 3K71A 2LUWA 4HMZA 1ZHKA 2QUOA 5FOBA 3POJA 2CDFA 5EUOA 2IOOA 5BZDA 5DCCA 5SWSB 4Z18A 2Q8AH 1KYOK 4XMZA 1D7BA 4HDIB 1UN1A 3QIUD 3PFQA 4F91B 4JM4H 4RFNB 2CD0A 2VXSL 3N04A 4YK4B 2XPYA 1KC5H 2ZX6A 3AYEA 4TUKH 5C4WB 3DGCR 3L5WB 4FG0A 1CLCA 4QUOA 3NIFF 4KROC 4WEEA 3U79A 3LWCA 5D7LE 1IBBA 2K6YA 3B9KA 5A7BA 1D9KD 4OLLA 1GJWA 3C08H 1OA2A 2ZCLH 2VQ4A 1JMXA 2PQSA 3BVVA 5EU6A 5LNEA 1SOQA 1SGKA 1AR2A 2CLVA 4KJYB 3G04A 3MIGA 1E4JA 4LVOB 1ETZB 2P8LB 3M17B 2XJQA 3CBNA 2VDPL 4KKAD 4PCYA 4MX7A 3UMTA 4G4FA 2PCFA 2IFRA 3TYFB 2R1XA 1RPKA 2J1YA 1G0DA 3QH3A 3KDPB 3RGVD 1PVC1 3O1VA 5EU3A 1IC7H 2CDPA 4LP4A 5C0FA 4FFHA 2GJRA 4Z7NE 2ZUQB 2IWKA 2NY1C 1BGXL 4IKJA 1W2AX 3QUZD 2ZGKA 2X44D 4AQAB 3BIWE 4AIXA 2VAAA 2VDOB 2OW6A 4M8RA 1KENL 2DQEL 4R0LC 1B2YA 1L5GA 1NDGB 1WW6A 3VWJD 2WMPA 3F6LA 2DF7A 3WOVA 3QWOA 3QHZH 3WFDL 2EAKA 3HZKB 4UIKL 2WAQA 3D0VA 1XAKA 4NJAL 4XN7A 4BSJA 1DLHA 3VQ1C 1POV1 1T22A 2PCYA 3NWKA 5GRZA 1ZX5A 2C1PA 2JB5L 4I48B 2J8UE 3CZLA 4N4YB 4Z7NF 1IJ9A 1NDMB 2BZCA 1N6UA 1PQZA 2OXHA 3AREA 3O2WL 4QHPA 4XVOA 2VDML 3TURA 2CK0H 2IGFL 4XACA 2M2DA 2BWAA 5JLZB 1J8SA 4H40A 2ZEWA 2KHAA 2PW1B 3DLQR 3QXDA 5TDOB 3I2KA 1MG3C 5AZ2L 2MHAB 3N7MA 2FX7L 3KLDA 3F62A 4DSYA 3EFFB 3MYJA 2WOBA 1Z3RA 1UFUA 3PGFH 2GVYA 2H1XA 4MA8L 4PRBB 4XNMB 1IPKA 1GWKA 1FAIH 2DQCL 1KEGL 1UCXA 2D0GA 4OZOA 2TSAA 1LO5B 1NPNA 3MO1A 1IGIH 1HJFA 4ZPIA 2DWEA 3FUFA 4OFQA 1OTTD 2R56H 1YRZA 4ZD3L 3U75A 3NJXA 3VFUB 4XFCA 4WKZB 2OSLA 2NSMA 1OKEA 3SXWA 1BLIA 3HS8A 4PRHD 4N53A 4LCVA 4XAWL 2NY7L 1ECYA 4ZDHB 1S9VA 2JQMA 3BPSA 3X11B 1AYN1 3N9OA 4LEXL 3MRFA 4L4TD 4QPIB 4FP8L 1W3VA 3C9NA 5FYLH 4MA1C 2J7MA 2TBVA 4QRTB 1DN0B 4NN0A 2F54B 2Q8EA 3VA6A 3UGXA 2YEQA 2EP6A 3MLRL 5DK2B 4OJCA 1INEH 1OW0A 1F58H 4FLHA 4G8GB 4WCYH 4AGOA 1DCSA 1GIGH 1WCBB 4OLVL 3LZNA 2WYFA 1FZJB 1KGUA 5FB8A 1NOFA 5D4QA 1O3QA 1J3RA 2FT7A 3G5WA 1OOPA 4OY9A 4XN8A 1BM7A 3WBDA 4IRJB 3U7AA 4BXFA 3WHE1 3PHOB 3ECBA 5B38G 4N9HA 1FRGH 2IXQA 1YPZA 1AR61 4RFRB 3MKGA 4A6YA 1KDMA 1U92A 2JKBA 1UD2A 1FAIL 1AP2A 2P3JA 3KS0H 4AEKA 5D71L 2IALB 1YAIA 1S2KA 3LX9A 3RVXD 1G5AA 3IB3A 3U2JA 5IROD 1H6UA 5DJ8A 3AAZA 4YHLL 2B59B 4QIRA 3P4LA 4XVTH 2XXMB 3TN0C 3H50A 1LU2A 2O93L 1NLRA 1RUAH 3H53A 1E57A 4ELMF 4PP2A 1HHGA 1XIWB 4YDMA 4A42A 3LKOB 5D7EA 4HGWA 4PIYA 2ED9A 1AHMA 5ISZA 5AALA 3LDBC 2PHUA 3ILFA 4M5YH 3NJKA 1LDSA 4WWNA 4P2RB 4MOAA 1COV2 1XH2A 1TXKA 1FORH 5IROA 4DFIA 2W5PA 4HJGB 2NR6C 2FZ3A 3D09A 4H13C 5GGVH 1OWWA 4O02B 3TTYA 4QR7A 4WHDA 2QVKA 2HWC2 1R3LA 2N3JA 4KV5E 4Z3HA 2OQ7A 3B34A 4GB31 1U8HA 1LEIB 1MS4A 1OAQH 3KWVA 1COV3 1JUIA 4UAPA 1T7XA 3THPA 2VW0A 4JDMA 1IAOA 5I1LA 4DXTA 3IRZA 4PLNC 3KR3H 3H8OA 5EEYA 3EKCA 3MA7A 5DFAA 5LBCA 2NY2D 4LZKA 1HI6A 3THML 1KS5A 2EO9A 2AENA 5E9DA 2PWHA 1U33A 4G7YL 4G5ZH 4IEFA 2NTFA 1FAKT 12E8L 5LBSA 2UYLA 5FYKL 4IOIB 4J3SA 5SWZE 3VG0H 5F7HA 5GGVY 1D5BA 4NP9A 1CLZL 2VLKA 4I4WB 3SE6A 3V65A 4NO4A 3Q8EA 4NC1E 1I4FB 4UAOC 1ZBE1 2ARWA 3DVGB 4OGAD 1A64A 1J1OL 2OV0A 3QEGL 3PJYA 5LBBA 3P11L 4ONFL 4E9QA 1HSBB 4E4SA 1ODAA 2NYZA 4RN5A 4IBTA 1ZS2A 4Z7UB 1XQ4A 3V64A 5D1QB 2JB8A 2V33A 4COUA 5C3SA 3CHXA 2XACC 1AUYA 1BBDH 2DRUA 4NHCH 1R3KB 4PYHA 1HL9A 3VKOA 4CP2A 3QUXC 1QMJA 3KXFA 3MYZA 2QTWB 4OF5A 3JBG7 5CN3A 4MQ7A 4YO0B 4FZEH 5ESAB 5HPMA 2VLJE 1NUFA 1LHWA 3NRUA 4MJIE 4UT9H 1F86A 1ACXA 4B5ZA 3QHFL 3N9LA 5CKMA 2XXZA 4L8BA 2E27H 4ONHB 1UC6A 3U0PB 3SH5A 3MUGB 1TZAA 2AABH 4OKVB 5F6LB 1JXJA 4HZAA 4UOQA 3VLBB 3C2SA 4NM8L 1W0VA 1YYML 4RAUB 4ZFGH 3MLPA 4G83A 1CU4H 4MXWB 3NIFE 3I59A 3EIFA 2X3CA 3RJOA 2BEOA 3ZO0B 4DTGL 1N47A 2DYCA 1IS5A 4JTOA 3CHSA 3ARWA 4IHOA 2A6VA 3O9WB 4GP4B 5EB9A 4Y4KD 3I84A 3UDWA 1JSYA 4WO4C 3MJ8A 2WZR2 1NBYB 1XF4A 3NIGB 1A7PL 1XNAA 2D3RA 3IIAA 4MBRA 4CSWA 2QJVA 3U78A 5D96C 4R6UA 2DF3A 5KW9L 4XAAA 1M7IB 5F7DA 3I50L 2BVOA 3HIZA 2DI7A 4M1CC 4WHTB 1BD2D 5SV3A 3RFZA 5GZCA 4Y2DD 4AZ8A 4BELD 3OJDB 4HZLA 3V5HA 1E5UI 2B45X 1UYXA 4QM9A 1CD9B 1WZKA 4NX0A 4ODXA 2Z34A 5DVPA 4DPCX 3EDFA 3PIGA 4Q74A 4ASLA 1YEHL 3AT8A 4AEIH 2I7OA 3V0WL 3S88H 3MXVL 1ACCA 1MFBH 1DJSA 1T1ZA 3W2DL 2X6BA 4M03A 4R4BB 2APSA 4IRSB 4X2UA 3GHPA 1CAWA 5AVAA 4MNGA 1FV1A 2CR6A 1T0NB 2Y5TA 4GSQA 2DPKA 3E7JA 3HD8B 4PJYA 3CSGA 4HT1H 2E76C 3OKMB 3QIBB 5D2AA 1BZ7A 3GXMA 2YAFA 5DGQA 4B1MA 3ZZ1A 2LTQB 3GSQA 4PJIA 3RTQD 2DQJH 5FF6B 2Z35A 3GXDA 2VLLB 2VUCA 4IU3A 5FUPA 1N7ML 3RNKB 1JN2P 1GGBH 5TPWH 3EYUL 3GBNL 2OMZB 3BTYA 2HFGH 4NIHA 5FYSA 3MLTA 4AVIA 3PQYB 5EJ3A 5JXEC 3NFPA 5IJKC 2HB0A 3PIQA 2I5YH 5JO5B 1I9RL 5GS1A 1G86A 3U36B 1WLCA 1QO3A 5EO1A 4N2MA 1S7RA 4YHNA 4Y19E 2DQFA 3HBKA 3N1MC 2P3IA 4RZCA 5HHOA 1VSCA 3BRFA 3T8MA 2ORZA 3SISA 4OCTA 3WYRA 1ILSA 3KNBB 4F37K 5DUUA 2H41A 3PLQA 1SBBA 4RLDA 1JPSH 4LOVA 4FTEA 1V54B 2HYMA 1QTSA 2PTVA 5IEHA 5EF3A 1SPPA 3RUGB 1DSFL 4FEMA 3VACA 3MLLA 5CEHA 2V5YA 4HEPA 4JUSA 2DM2A 5AB0A 2XWTA 4IEXA 2PPCA 5BVJB 3UL2A 2ZKYA 3FO9A 4JGYA 3FB6A 4J25A 2RR11 4ZYKB 5TTRA 4JFEB 4JFSA 2DWXA 4LCUB 4WJ5A 4HJEA 3GF6A 1JNLL 4JE4B 4DIQA 4PVBA 1I8LA 3MA9H 3KPRD 4JY5H 2WS92 2WO3B 3KAAA 5GM0A 1KGCD 2HWE3 4J3OD 3NFNA 3RWJA 1N7MH 3TN0D 4BBWA 4BXVA 3HMYA 5GJTH 3KF5A 4QRPB 1D9KB 4P9HH 3QJHB 4U6YA 2I24N 3I6GB 3B37A 2LV4A 3OMZA 4P59H 1M42A 4NI6A 4NRXA 3ECQA 4XCNA 4APQC 2UYBA 1POV3 4LHUD 3EYOA 3DV4A 1T1YB 4V1DB 2JJTC 5L4IA 3FCTB 3M3EA 2PP8A 1L7QA 4XMKH 1WWAX 5EMYA 1A6AA 4UINL 3BPCA 3H54A 5T52A 2H3NA 1LEKB 2XG4A 5I16B 4XO8A 5HDBF 1FNHA 4YE4L 3IBOA 3SE3C 4G9FB 1PX4A 2VDLB 4X5WA 5F88B 1L0QA 2BIMA 4JVWA 4NP4H 4X4YB 2VOXA 3FBQA 2D43A 2ED8A 4NFDA 1TITA 4ACTA 2AJVH 2GIYA 2QQLA 1H2MA 4FQHA 1W8ZA 3ZKMD 1F4YL 3UTTA 2VDPB 4YXHH 1OLMA 3VI4A 2OVUA 3U37A 5FW7A 4CDXC 5IVXF 3TZVC 2Z9TA 4UQBA 1ITBB 2HTKC 4U1NA 3BT2L 4IMLA 4M7KL 2UY7B 2DKSA 3TL5A 1QU0A 4O61A 3GS0A 3DGTA 3FRUA 3H6AA 4KKCC 3GB7B 4AT6B 1ORQA 5A2CA 3WGUB 2GBUA 2CM5A 3DNKA 5DJZA 3T77A 3TPUA 1ET7A 2L0DA 5T1LA 3IGAA 4XPGL 4GB9A 2OMVB 4MCNA 5JAXA 1KLGA 3F6JA 4RRPA 4TVUA 3I3MA 4N9IA 2AJUL 3BE1L 4BSVB 4Y89A 4YFDB 3SDAB 1P84K 4U1MB 4UAHA 1CONA 3WZ1A 1TYEB 4KDTA 3QHTC 3NEXA 1UH2A 3CU1A 3TEZA 5DTFB 1C8PA 3VBFA 4YFLI 2YOAA 3PRZA 3NOIA 1W8UA 2BHUA 3MV8E 4P23D 3PY9A 4GMSL 3CHQA 5D6DA 3FFDA 3O3EB 4NZFA 1OCZB 4X6DA 4Y2LA 4Z7WA 4ZG1A 2F68X 3PVEA 4HK0A 1WD4A 4GS7B 1KFAH 1P7QD 1F56A 1YEIL 3QZWB 3V6BR 1NMCC 3QRGH 3L3IA 4N6RA 4ODUB 1WD3A 3C2UA 4LORA 3EYFA 3HFMH 5D7JB 4J3OH 4PGCA 4Y5YC 3UAJD 2YUEA 3GRWL 2D3VA 3SIKA 5GRWA 1OA4A 3KV6A 5TDPA 1TENA 1WUZA 4RETB 4CSPA 4X8PA 5K39A 3MNWA 2VVFA 2LM3A 1XF2B 4CXXA 4W4ZA 3FDWA 2G75B 2X1OA 3MRMB 4MV2A 4L4TB 3CXDH 5H94B 3G6JA 1CGTA 2J43A 1RUML 4IGQA 4IEOA 5ICYB 4ZMAT 1DO6A 2OX5B 1OQ1A 2HWD2 4AV4A 2BOCA 4W4NA 2ZBJA 3FTVA 4AHWA 4AKQA 1LK2B 1CGUA 3DHJA 1WW5A 2Z7YA 3ENEA 5G5DA 3D25A 1KCBA 1QD0A 2EA7A 3V6ZB 2ARBA 1BDYA 1NLBH 1L0YA 1SJXA 4ALAH 4YQXH 3BAXA 5ISLA 2RHEA 3HMXH 5E95B 3DSFL 4AGNA 3C75A 4Y20A 1LP9B 1WW7A 5HHME 5EO9A 3FHEA 1P1ZB 4OAWA 4ZX5A 1EZVX 2C4FU 1NXD1 4UQ2B 4XBEL 5SX4I 3NFSL 3WF3A 3FF8A 5FKAA 4YMPA 2CALA 3AQZA 3OLGA 1UZ8B 5L0QB 3QIWA 1F1AA 3RIKA 2WABA 4NPYB 4L8SB 3WIAA 5HYJE 2COQA 3AL5A 3LDRA 1F13A 1VB9A 5CLZA 1RJYB 4NN7B 2VZPA 4EDWL 5I6XC 1VGEH 1EPZA 1F18A 2YIHA 1QLEH 3TESA 3H9AA 3OGRA 3BFWA 2EJ1A 5JXAL 2W60B 4POYA 4PDWA 3JZYA 3ZSSA 5EOCH 3GMMB 3RJ2X 1HWGB 2VL5B 4NDMA 1H9WA 1CL7I 3AQDA 3SGDI 3BZEB 2WNUC 5GSVA 1P0SE 4L8CA 2WLIA 1ZBA3 4JPIA 5KHHA 3R4RA 3KPNA 1EFXA 3NQHA 1G84A 2DLEA 4YHYC 5EZOL 4H8WH 1MF2L 5FO2A 4Z8FL 2D6MA 5HY9A 4QRPE 4PJXE 5BS0D 5E2VH 5DEFB 4GG6A 3HUJF 3ZHKA 4WJKB 5LN4A 1AI1L 2P5EB 2X0UA 3LQZA 4AX3A 1NKRA 1JFQL 2VR8A 2RS53 5FCCA 4XVUC 3VHNA 3I4IA 3RDJA 1QQP3 3T4VA 2JJSA 4C0BA 2NY2B 2YZ1A 2E7AA 1SF3A 1RUE2 2ZABA 5DUPH 3LNGA 4NC2B 3F7KA 4A66A 4E2GA 1UY3A 4WUUE 1SFNA 1UM6H 2EDXA 1V9U2 1B3IA 4LOUD 5J89A 1BXHA 1U3NA 3BP7A 3K6DA 5GRXG 5C9KA 5JXGA 1XGTA 3QUKA 3VAEA 1BF8A 3VWKB 4KKNA 5JYMA 1V00A 4AVSA 2YMXH 1ZRFA 2VN6A 4JN2A 1TEYA 1TQBC 3D12B 4L3FA 1DJIA 3MRCA 4CW1B 5J98B 1EV13 4BM7A 1RUI2 4GBXC 1IAMA 3TEYA 1X5YA 1U3HA 3QORD 1Z78A 2BOIA 4XNUH 2DWDB 4HDIA 1BSIA 1R1A1 1CBVH 3E0GA 4UI2A 2CUIA 1AS6A 1SN0A 2JKRM 4G6MH 4NRZA 5LAPA 3WT3A 1WLTA 2F7QA 3W11C 2HVJB 1FVDA 1Y0LB 4AUJA 2O72A 4PG9B 3VG9B 2CCVA 1ASJ1 5TDNB 5D96B 4IM8A 1GYCA 3OR6B 4HISA 3OUJA 3HC4L 4FOWA 4M5SA 3MRJA 1QUPA 4L4JA 4N2OA 1ZLSH 1HB2A 1LOFC 4RQQA 4D9QD 2B1OA 2FMYA 5IVZB 1KEML 2FRGP 1N3QA 2ILLA 4AIZA 2D73A 2A83A 1AHWA 3MOBL 4YXKH 2BSED 4B0MB 3VM7A 4FGMA 2EYTA 4NFCA 4TZDA 4LHUB 3WJLA 2ITEA 4ZZKA 3PUQA 1OGAA 4O9GA 1Z5LB 3MLUL 4ES8A 4GULA 5IQ9B 5L2KB 3OF1A 4GUPA 3KZ4C 5GGRY 1JWSA 1XSQA 5HHXH 4CU9A 4YM0A 1LD9B 1RB8G 3TCXA 3BTZA 2X2JA 4KH2A 2WJ7A 3TASA 4FXTA 3MLSL 1R3HB 5DJ2B 2ZAAA 1MIMH 1H3UA 1R081 3IETA 4LMQE 1TNNA 2HXAA 1J86A 2OI9B 3AM2A 3BCWA 5FLJA 1IGYA 1I3HA 4ZU4A 3CE1A 1H6TA 2R1BA 3D06A 3NCJL 1JE6A 4B9KC 1S0DA 2WDBA 4JR9H 4EN3A 5CEZE 4IRZL 3QEHA 4ANUA 4PQXA 2CO6A 5ENWA 5E1IA 4J23A 1CD1A 4ISRA 1NAKL 5I8TA 1JH5A 3ARDD 3CFKB 4MSWB 4R7XA 4YHML 2A6XA 1GUIA 1OP5K 5I1KH 2VDQL 4Z7OE 4KQ0A 1FLTX 1HWHB 1TJMA 3GI8L 4OZFG 1ZS8A 1HILA 1MSPA 5IB1B 2A38A 3E8UH 1A7NH 5ICXA 3I49A 4RR3A 3QR0A 4LK6A 1CFVL 5ADPL 4DP5X 5JXIA 1WHOA 2CHWA 4D7BA 1Q94B 2ET1A 5IFHH 5A3WA 2BSCA 3VMPA 1XE7A 2XKNB 1UWGL 4OD1L 1KEGH 5DDJ3 4JHBA 3PHQB 5C0RL 5KZCB 3I9AA 5GGUB 4F7TB 4LSUL 3QIWD 4OMCA 3AU1B 3JTTA 4KZCA 5CJQL 3WUWA 1SDDA 4Z3IA 5A32B 3W9DB 4KI5F 2EVHA 2C8NA 3NJYA 4OF6A 1IIIA 3AYDA 4E0RB 1AOHA 3QW9A 3VBSB 4U6TA 4WWOA 1O7VA 5CJXC 3RWIA 3D4KA 4I0WB 5JSPA 5CUSL 4GQ9H 2B1AH 2WKOA 3MX0A 1P2CB 3N06B 5J7CC 1I9EA 4JY4B 4A39A 4J1WA 3L5HA 4UFLA 1PFOA 3FN0L 2NLJB 3L9BA 5E1AB 2CIIA 1FFOA 2G3XA 4XCCH 1FI2A 1PEWA 1NEZG 1OURA 2TRHA 1AKPA 4FSJA 4R26L 1CDBA 4HWZB 4UB0L 1OANA 4AKOA 3NRQA 2P7TB 1T04B 4BZ1H 4J1UB 1E3FA 4XHXA 1K45A 3VXQA 2P5WA 1XNKA 1A7NL 1MI5D 3O1TA 5E56A 5IJRA 1Q9WB 2Q1FA 3P0VH 1JBCA 4XF3A 5KC6A 1YNTF 1NBZA 1TMCB 2PWGA 5BW7A 3EFDH 3GCWA 1OP3H 4FFYL 3V6OC 4OGAC 3LEYL 2BP0B 3G5YB 3ROOB 4XPTL 3BTAA 3ZYBA 1QWHA 3O9WC 3N40P 3O45A 3ZSEA 3B6SB 3ATEA 2QDRA 1NKGA 3H42B 4FPEA 3ZUCA 3WKML 1NFIA 1GR7A 1J1TA 4K3HA 3P0GB 4P4RA 1FCGA 1MVFA 4LBEA 4S1SH 5GJSL 4XYXA 4EQVA 5BRPA 3S36L 4PP2B 5FZAA 3ITQA 1CFBA 4Y3OA 3B2UD 2ZUVA 3E1F1 4NQCA 3PNWA 2FL5B 1P4IH 3MRKA 5AYTA 5GHWH 3RIAK 3SDAC 3ZHFA 3BPNC 4E9SA 2C24A 2ZX5A 1MCNA 1BM3H 5EQUA 4GH4A 4ODHL 3EGSA 2FR4A 1CGXA 5FHAL 4RGNE 1GLHA 3DMMC 4I8DA 2JWYA 3QG6A 4K9JA 2XX0A 3FLTA 1CX1A 4HHAB 4UM8B 4MJ6A 5DD3L 3RDTA 2XQXA 1KJVA 2G30A 1IARB 5D70L 2D0FA 2ITCA 3BLPX 5FZ1A 2VY0A 4YLCA 1QSEA 1ND0A 1MHPH 1JD7A 3OX8A 4FFYH 2N4IA 5HYJB 1TFPA 2WZEA 5AB9A 2IAMA 3BODA 2NUTA 3MA7B 3UJIL 4BGLA 3CZFB 5FUCC 3T1WA 4XUOA 3T8XB 2EXHA 1SHSA 3ES6B 2WA3A 2XDVA 1VGKA 3IXTB 3QDJE 4KZEL 1KBWA 2AC0A 4IE7A 4ZFFA 3B2DC 3W5MA 4XNZC 1NMBL 3UYOD 1P7QB 1N6QH 3B00A 1TE1B 3U1QA 1GS6X 3JWNG 3EG9A 2NY3C 3LKRA 4PP1C 2R061 1GZQB 3FQWB 3ZZQA 5LB1A 2WXHA 3GSXB 3ZRCC 4Z5RB 1EAH2 4PBOA 4OCXL 2VDQB 4MKMA 4KX8A 3UIZA 5D93B 5B3NA 3QLQA 3ZFFB 1I3GH 4H1LH 5IBUB 3QJTB 4C56E 4P8QA 4GXUM 3GMQB 3OTFA 5K0UA 5T5FA 2GNTA 3I9PA 5FO8A 4LSVL 3HC3H 1A8MA 1P6FA 3PWPB 4IW4C 3V4UH 1ZJAA 3LY6A 4AJYV 1DIWA 2DH2A 1OHQA 3GBMH 1PZBA 4DKTA 1HQWA 4MS6A 1TZHB 3BDYL 4R8HA 3IDIA 1CBJA 3NJFA 2MCAA 3BP5B 3F85A 4XE5B 1DUYA 2JWPA 1HEZA 4KZDL 4DFSA 2CIKB 4DJMA 1A6ZB 1HH9B 4ATFA 4LU5L 2EO7A 2ZKHH 1OH3A 1EHXA 1CWPA 1I1RA 3D7PA 2J42A 3U83A 2DL2A 3FO0L 3FUJA 2HPOA 3TBCA 4DTGH 5IMKB 1H30A 3FTGB 2WOYA 4GW4B 3VB9A 4E36A 4OD3H 1JGLH 2ZP9A 4DERA 1J8RA 5H2BB 3L7EB 4GO6B 1VKXB 2GJ6D 1L9NA 2J8HA 2IGTA 4XPAL 5JDSB 4L0YA 1ASJ2 3KG5A 3KPSD 3D4GA 3HEIA 1EHLL 1RMU1 3GKWH 5E4AA 2H1PL 1HU8A 1ZY9A 1A1MB 4EMZA 3P73A 2DCZA 4MDJB 3QEQE 1E27A 3C60B 4BQ6A 1DN2A 2YPKB 3MGAA 4X83A 4QPGB 1DJZA 1H3XA 4OB5L 2IPUK 4AV0A 4X8NA 2ALAA 2J71A 3D0LB 3H9SD 4RMVA 4GT7A 4LLAA 3LXBA 4PJCB 1VF5C 4HJJH 3O0LA 4POZD 4TQEL 4DIXA 4LT5A 4WI7A 1B0RA 4PTUA 5JPMA 2WLMA 1AQDA 5BUVA 2BNUB 2NYYA 2NSXA 4PJHA 2CR0A 5DMIH 5E8EA 2GC1A 4FPKA 1PAMA 5GSRA 2V72A 1U8PA 1ZSDB 1F5JA 3FQNA 3NJMA 4JFYB 4NPRA 4LLDB 2Z7ZA 5JI7A 4KTDH 1S7XB 3GIZH 4N2HA 4HC1A 4OV5A 2YROA 1U6AL 4S2GA 1AXKA 2X4RB 4D7PA 5A7EA 1J8HB 2FE0A 3VD5A 3T6ZA 2D2OA 5E89A 2EO1A 2BSSA 1CXIA 3KB5A 3EGXB 4QDQA 1W6QA 3QQ3B 5KBMA 2BFUL 3K2IA 3BVXA 1YI7A 2GDFA 3AK0A 4OM0L 4G1EA 3ASIA 4K3EH 5BS0B 3GKWL 5IW6B 1LEGB 2MCPH 2X3BA 4WFFD 3VH8B 2FX8L 2WN2A 1ZXQA 3P9LB 4GAYA 5FECA 3BD4A 4HW6A 1YRKA 2EVGA 1QQP1 1R75A 3WEZA 3D51A 1GRWA 4D0CB 4IBYA 4AOCA 4X7TA 4LKCB 3E6HA 4XTRD 5JYLA 3REVB 1UM4L 3BPLC 4OFDA 4BUGA 4AQ1B 2BWCA 4S0SD 3N44F 4LO6B 3W0WE 1L9SA 3MUHL 1QOTA 3D8MA 5MEQA 3GDCA 1W6NA 4MVTA 3WL9A 2OMXA 3MLYH 1J1OH 3IJHA 3QEGH 2IEPA 1ZZBA 4M01A 2Q8DA 2EXWC 2VM9A 1FBIH 5GLTA 3KSCA 2XOMA 3T30A 3BJ91 1DQJA 3VFSB 4YG3A 1GC1L 3VBUA 1N70A 2JCCA 4KU1A 1I3VA 3AW5A 1RZKL 3HRZC 5FDWA 2R51A 3FUOA 2JKWA 4CEWC 2HRPL 3CZSA 1CZTA 4R8WH 4X6FA 1AZZC 2PR9A 5C0BD 4JFZL 4EZLA 1ZHNA 4PREA 5CWSA 3VNYA 4QOKA 1PDKA 5DMKA 1GCFA 3LEXB 4LLYB 1CD3G 4NHUB 2AGJL 3O4LB 2H0JA 3ZKXC 3DEMA 4LTAA 4TSCL 5GZEA 4QHLB 2NY0C 3FZUC 4XMKL 1AS8A 5AW6B 4MB3A 2QQJA 2HFFB 3EOTH 2XWDA 2V73A 2J56A 3UAAA 2CHDA 4PGJA 3LH2L 2ALWA 1H0BA 1LGBA 4BHUA 3RZCA 4KXDA 3WE6B 4ZKTB 5CBAA 5KSVA 3J9SA 4RYDA 3L4YA 2RJLA 3KHQA 3KLQA 1UOWA 1VBD1 1OGTA 4MNQE 5DJ6B 5L8LB 1FNAA 5EU6D 1E5HA 2BCKA 2XLAA 1VLNA 1R1ZA 2JDZA 1OZUA 2FD6L 5DFVD 1N18A 1YNLL 1LE9B 2HWF2 4ORGB 2NLRA 3JD72 3PAYA 4EZHA 4L3EB 4OF7A 3O1UA 2CDGA 1HE8A 3GIVA 1I7RB 1EO8H 4NO2B 6PCYA 4TUJA 2VCOA 3CSPA 5T5LA 2BDNL 2HG0A 4R8WL 5T1LB 3D6EA 4AW4A 4A55A 3OOXA 3APDA 2ZNXA 2VOTA 4LRIA 3ZL2A 4CTEA 3HTLX 2GTZB 3KT4A 3T3YA 1ZT7A 1XF3A 2LW8A 3OHXA 3TBYA 5HYSA 3CEWA 2WFPA 1ZGLP 2LOEA 3IRPX 4X6BA 5D2NC 4N3UA 3VXRB 3K4DA 1DBML 3VRLE 4N68A 4ATTA 4Z3FA 4NUGH 5CR1A 1XXFC 2VIRB 1SXAA 3V6OA 5GZNA 5HCAA 4DKAA 4X4KA 1HRV2 2A3YA 1C12A 5A6QA 2G2RA 2ITDA 1EEUA 2ZYRA 3V0GA 3K1KC 4ZS6D 1DCEA 1A6UH 4DUWA 1KCSL 1NDGA 2AJSH 4AQ8C 3RZCD 5DJAA 2F9BT 2JJSC 3I85A 2BTVC 4FTDA 1NFDB 3SE8L 1UQSA 4ELDA 3CVHB 2BNRD 1WLDA 2YY1A 1YQVH 4G8IA 3UYRL 3ZYRA 2VU9A 1H5BC 2PLV2 1F90H 5IFJB 1GQHA 2OSYA 3FU5A 5MI0C 3IAGC 3HIFA 5A2FA 1PBYA 4PJHF 4J8QA 1MS0A 4NQXA 3DV8A 1MJ7L 1NAMA 3NJHA 2DQEH 2JKXA 1Z9PA 1TQWA 2IPUG 2MRYA 3NSFA 4IGBA 4WTZG 3EZJB 4K7PL 5DJDB 4XC1L 3OYWA 4TWTA 3RURA 2MHAA 3GRWA 4DK5A 4UMSA 3GJBA 4DZ8B 1AXSA 4LOEA 4EI6B 4A41A 1ZVYA 4ZUUB 3LIZH 1GHFH 1IAKB 1LO4H 4Q2ZB 3ZDYB 1OWRM 4RMTA 2OTWA 1V9U1 4RMRA 5JR1H 1KJ2H 2XG3A 3JWOH 2FQGA 2WP3O 1OUXA 1LP9A 1P9MC 1AVAA 2YC4A 4OGXH 5C9AB 2DWEB 1NGQL 1JHTB 4P9LA 4KO7A 2JKJA 2HLAB 5I91A 4LESA 3TO4C 3VG0L 1JCKA 1M2OA 1BYPA 1NJ9B 1MI5B 4J12A 4XBEH 4KHTL 5DJ0B 4ZNEE 1GKBA 3AT0A 1NZIA 4UF0B 1G9CA 3K6OA 2IAMC 5F6HJ 3HPJA 1UZ8A 2AXJA 1QPPA 1EHKB 1RGSA 4TNVK 5T5JA 2RB8A 4A2MA 1AO7A 1JWUA 4TRPH 4PLKD 3FONA 4PJ7F 4B7IA 1VAKA 2PCPA 1Q90A 2ZD0A 4G6AC 4NKIL 1IGIL 1GGTA 3FOMA 5KJRH 2W65B 2J7LA 5C7XH 3QUZB 1U8OA 5T1KD 4D0BA 1R46A 3N9PA 5C09B 1DQQB 4NE9A 4HCRL 5I1DA 5HBAA 1XGUB 4XX1G 3VSQA 2PHWA 2D3LA 2GFBA 4YC2C 1DL7H 4ZT1A 4PS4L 1IEBA 1ZLWH 3KPOA 4KK6C 2FO4B 3FK3A 2P46B 4ZMOA 2CCLA 4XC1H 2YBGA 2EEAA 1KXVC 1YUKB 3MDJA 3NTCH 4R9HA 4U05A 2Y6SC 2LROA 5FPBA 5FZ3A 2WVSA 5L4MA 1DBAL 4PJFB 1J48A 5SV5A 1U92B 5E2VL 1P7KA 2A1XA 3MLRH 5FIEA 1D5XA 3B93A 1YEKL 1CU4L 2NY5H 5CILH 4E41E 4BKLB 1OKQA 5D5MA 5CLTA 4Y9FA 1VP6A 2SLIA 2BMKA 4NWUL 2FYVA 4KHTH 4OLYH 5D93C 2Y60A 4KDWA 3AP4A 5C2UB 5I0TA 2FLRT 4CE8A 1KLUB 2FO8A 4EIZC 5JZGA 3ES4A 2I45A 1HWWA 2Z7WA 3HB3D 4PH8A 1NT0A 1FVCA 5BV7L 2PMWB 3NNLA 4JQVC 4LPYA 3ARBA 2PELA 1F97A 3GUTB 5AVVB 1DYPA 2YEVB 4W9DC 1VRSA 5D71H 3VE0B 1DE4A 1I9IL 3QQ4A 1E28A 3EDEA 3E6FB 3VI3B 2VTXA 5JMOA 1JRHH 3LEKA 2AQ3A 3WTSA 1XFPA 3HC0A 4YZ2A 1XBDA 4HMEA 4P46C 4DF9A 2YXWA 1STMA 3VTMA 1OTUD 2WUCL 2ZIDA 4WI8A 3MRPB 4WUKH 1T5XA 1ZD6A 1DUZA 1WBYA 5C08D 3IPBA 4YZ5A 5KYUB 2IWFA 5EZPA 1RZJC 4JPSA 1PY0A 5F7WC 5AAMC 1VB2A 4PRPD 2MTPA 4EV0A 2R0WH 1Z9MA 3IPVB 3CHPA 3F12B 4K23L 5C3RA 5KR7A 3U4EA 4FYQA 5TQ2L 1J84A 4WVMB 4H55A 2W07B 1QXJA 3I2HA 2ZF8A 5I6MA 1F3JA 5IVXB 5BOJA 4WW2F 4CCCA 2A9NL 2JJ6A 4DXRA 3RZKA 1QBLL 4MMXA 5I17A 1KB9J 4X9HA 2HWC3 5GZGA 2XXGA 1O9WA 2E63A 2CSGA 1IX2A 5J3HD 1BVVA 1CDIA 1VBE2 4NZRL 1NCRB 4PLJD 1C5BL 1Z32X 3W0WB 3IWUA 5ILTL 3FCBA 1L7LA 4JFFD 8FABA 3FB5A 4HEME 5FMOS 1DZRA 1UKGA 1MZZA 4U1SB 3QUML 4XDPA 1GGCL 3MNZB 2PR4H 3EOBB 5B38B 2ZGNA 5E6HA 12E8H 4X7EC 3H7YA 4XPBH 3VDCA 2A70A 2XTJB 3O2DA 1F4WH 4QXCA 3V10A 3DL3A 4GUCA 4GG6E 4YHYB 4XN2A 1YNTA 3US9A 2FWSA 2GW5A 3E3QE 2OIIA 3AY2A 3FT9A 4TYUA 1CFMA 2ETEA 3EJTA 1DR9A 4G2AA 4XZUA 1Y1UA 5C0EA 4HN0A 4PRIA 4RWYL 4IKLA 5H35B 1VZHA 2VJ0A 2BVPB 2AJXH 2MQ0A 3IKCA 3TT3H 3O4LE 3VGAC 5CN1A 2YS4A 2VC2H 1R1A2 1GKEA 4RA0A 4PGBB 2G9HA 3CFDB 1OO2A 1Z9SB 4BLIA 2O4EA 2VUAA 2VXJA 4NCDA 3B9DA 2OTUB 1KF9B 4GRLB 5CU5A 4IGOA 4FYTA 3FXIC 2WNVA 1KOAA 2F61A 3O5SA 2CLZB 2YAMA 4NZRH 2RS13 1K8DB 3JWDC 3MR9A 2JB6B 4LK4A 1HN1A 5F5IA 2GBAA 5CKNA 1R47A 3UTSE 3RG0A 4Z7QB 3VX0A 3Q8BA 3ZFGC 5EZOH 2CNZA 3JSSA 2YK1H 4HCGA 2BSTB 3TJEL 2XKNA 4B3VA 4D8OA 2ZKNA 2YD9A 1OL0A 4X99B 5CFCB 3QEUB 3IDJA 1UB6A 5F8RC 4J4PC 4QXKA 4EZJA 1P4UA 2PP9A 3V0FA 4D9RE 1P5UC 1YAZA 2UURA 1J0KA 2AJVL 2JKLA 4J3UA 5D9SB 4ELKA 1UM5L 5FM4A 4Y2DC 4KDVA 1GBGA 3AP6A 1FN4A 4YRDA 3GHBH 4DGVH 1RP9A 1E8YA 2EH8H 3A6OA 1CI3M 4G9DA 2EKSB 5BJTB 2F54D 2W08A 4E9YA 4YHZL 5LWYL 1CVNA 3HS0C 5FGRA 2QADB 2O8QA 1TQVA 4KKAC 4IYKA 4JRFA 7TAAA 1B9ZA 2D7QA 2R6QA 1L5GB 2AXFA 1O6UA 1MEC2 1RXFA 5CJ5A 5FF6A 4MD5B 2XETA 1ULGA 4NCC1 4XPGH 5AAMA 3RB7A 4YNYB 5JIPA 4IRJD 4P9JA 5FW6A 1A8JH 5DQ9B 4X5XB 4GEJA 1LYQA 4P57B 1C7TA 2YGOA 1YQCA 1SLWA 2DD8L 5T5FL 3C3VA 3SKVA 3L9YA 2P80A 4YEEA 2EXTA 3SOBL 3STLA 4AYFA 2R071 3U11A 3MPCA 4GWJA 5FA3A 2PHDA 1PKQB 2ZQKA 2BIPA 2X1WL 4L1TA 3THTA 4XH2B 3DYPA 3ROOA 2YPLA 1OF2A 2ODHA 4V1PA 3AY4A 1IM3B 1L7RA 5FZLA 3U0TA 4IESA 1NC2D 5D1XD 1YQ6A 2DI9A 4KWJA 2OP4L 2NXZB 5FYCA 15C8H 2EE6A 3BLBA 3ZZSA 1GY2A 3L2LA 4GWMA 1ZLWK 3LRSA 3RUGA 3K2KA 1PFCA 4META 1T3FA 2VZSA 3PWLA 1A1NA 2E33A 2XZCH 4QPGC 3IDNB 3KL3A 4UYQA 4UZGA 3WP5A 3TPKA 4LSSL 5A2BA 4KGQA 1G9NC 3CXDL 4XHJD 4O4YH 1ZDQA 3S3DB 4WJ5B 5DA4A 3EGSB 1NIDA 2YBRB 4I18B 5IGXL 1AKJB 1JPSL 2YD3A 4OLXH 4PU2A 2B8OT 4KOCA 5FK9B 4M6OH 4WO4B 5G4OA 4RVBA 5JHDE 5ACMA 1J9SA 3CFIC 3PJSA 3QG6B 4DN3H 1L9PA 5DDJ1 1EJOH 3BW9B 1CFQB 4YUEL 3F7VA 4P04A 5FYYA 2F53B 4FULA 4ABWA 3L17A 5HHPB 2IQAA 1J5CA 1WTGT 5HGHA 3AGWA 1VAMA 2IUWA 3L6FA 3DXAA 2APBA 2A3XA 3L3JA 2CO3A 1JF1A 4H4NA 4KPHL 2JJVA 2MQ3A 3DSNA 4Z0XA 4MAUL 4TVPD 4Z76A 2ZOOA 3SCHA 4B9GA 1SXZA 1G1CA 3QQ9C 1UJ3A 4AAPA 2DLFH 3BYYA 3S4SA 4WBBA 2ZGMA 2HCZX 1W2TA 1KRIA 1K2DB 4BK5A 2V9RA 4OR1A 1DVFC 4G3YL 3FOLB 4PV8B 3I9GH 4V2VA 4F57H 2H7WA 1JGVH 1RZKC 1R19A 2VLKE 4JFEE 5B4MC 1HXYA 1JYTA 2Q1EA 4PW9A 1W2OA 1ANUA 3AMLA 1FRGL 4WV1C 5EF2A 4MSVA 2VR5A 2QTVA 3POWA 4OZFH 2YAPA 4Y2OB 3EJSA 3GM8A 3RI5K 3ROLA 2X6MA 3BGMA 5F1NB 5GGSB 2EEXA 4AE0A 3CDZA 4R4XA 4QHUA 2NPLX 2MEV1 5JOPE 3J7LA 4OGYL 4ZXBD 5ES4B 1UXZA 4PN6A 5C8CC 4QX1A 3MRDA 4URTB 4Y4FD 1Z3GH 4CDWC 4MGIE 1OD9A 3GSOA 3CQQA 4LMFA 4DPAX 5HHQB 2YAQA 3NABH 5DAXA 3DPRA 3TIEA 3VQLA 4DVRL 4KJQC 1DQ5A 4LLMA 3MRQA 4Z1PA 4AY0A 1REFA 2K9UA 1NEZB 3HLKA 2WSDA 4JZNB 5FXWA 5DTFA 1MRFH 2DU0A 4H8QA 1PVC2 4BJLA 2Y6TE 3AZZA 3CMOH 1A6ZA 4XO9A 4O9HH 5CZXC 5D2LB 3IDBB 2DLFL 4HF5L 2APFA 1EZLA 2L4OA 5EOQL 5AD0B 4N9GA 3MJ7B 3EGDA 1BIHA 3H6JA 5EDXA 2RCSL 2Z1KA 4W9FC 4HJSA 4F80A 4M5ZH 3V56A 1LB2A 5E2UL 2CQVA 1F02I 1UM6L 2W91A 2Q3ZA 2YGMA 4XMAA 5FLHA 2GK0B 5JDSA 1PZSA 1P1VA 2CRIA 2H1PH 2HJKA 3B43A 4QTHA 3SKNA 4G8GE 3K8MA 1EXHA 5I6PA 1KGJA 4O2FB 1DLLA 3P73B 3FFCA 1UEYA 2DVBA 2FCVA 2QQNA 5I0UA 4G8FA 3CFJA 4K9EH 4LO9A 4GRMA 4XNXL 4Q9CA 5C6CA 1J59A 2Y3NA 1QSED 1R3JB 3DVGA 1RUJ2 4Q89A 5JOZA 1HCYA 4XOEA 2Q86A 2CGYA 2AVGA 5DQJB 2L7EA 3RVVD 4A7GF 2WNUB 2ENJA 3NNJA 2BO0A 4ANVA 4EI5A 2FNWA 5I66B 3O3DB 2OMUA 4LO7A 4P4KD 3P11H 1QFOA 4FG6C 5D7KD 2WYTA 4OIAA 3KS0J 3GJEB 3GM0A 1CI5A 1IE5A 4XPHH 2CJ3A 1FYHB 4OBRA 4R7NA 3OKNA 3RSJA 1JV5B 4QGLA 3K3QA 1RV6X 3HAGA 4L2YA 2W0LA 3W3BA 4YXKL 5FKAB 4P5TC 4XBLA 4XMLL 5CLWA 2JXMB 4ZO8A 1FL5A 5D70H 3DX8B 2B08A 3V4PB 2P8MB 3W82A 4F8NA 1J8KA 3EJKA 4LK7A 4QX2A 4RRPG 4HA1A 2OK0H 1ZTXE 5ESQA 1AHKA 1Y07A 3WMQA 1THAA 2CKBL 1OV8A 2WN3A 4K94L 1EERB 3Q8CA 2OJEA 3H42L 2Z42A 2XVGA 5EORH 1NBCA 2HMID 1RUC1 4F3JA 5JPNB 2E4TA 2RS12 3QRLA 2VUKA 3D4YA 1AH1A 4O9EA 3FT3A 1EA9C 4ZU7A 2FDKA 2XJRA 3BGFC 3MLSH 2OL3L 5KYWA 1H1MA 1NBYA 2MCMA 1C5DA 1RQ5A 1FAYA 2VBBA 3NCCB 3JV6B 1HHIA 3THDA 2NY1D 1Y43B 1A1OA 3APFA 4PCRA 1OAKL 4H8PA 4JJHA 2FLMA 4YW1A 1ZA6A 2PHFA 1A7RH 1LOFA 2ARJB 2ILMA 2PHLA 5D8AB 3IJYA 5C8CA 4JDNA 4PLJC 5JOEA 4GLRH 4PRHE 4BQ9A 5IVEA 4KJQD 4CDGC 1PW3A 4HH9A 3KYAA 2P5EA 3LQZB 4FFIA 3KPSA 1UPSA 2AK4B 4UNTA 5DLLA 2RH0A 4TQPA 2XN9A 5J6HB 3KEHA 1QHDA 1OAXL 2EXIA 3BVTA 5DF0A 1ZK5A 4E2QA 3WW2A 4AMKL 3VXSD 2WA4A 1YEHH 3GTVA 4FLRA 4FFZA 1NUNB 4XMLH 4AEIL 2VMFA 5E8PA 3GSQB 3O0XA 5EIIG 3D0AA 3Q48A 4YFEA 3PV7A 1S9XA 4PRHA 4JS7A 4NNXB 4J1XA 5C0AD 4N8VG 1L4IA 2VM3A 1UXXX 3OBZA 5CEZD 5EIYB 5EORL 1RVFH 5B21A 2DQIH 1NCQA 4LBKA 3T2TA 2ZWSA 1O9VA 4P46D 2CUHA 1QHOA 1HRI3 1DVFD 3DYMA 1ZOXA 3KDMB 4AM0Q 1JAEA 3BMVA 3J4UH 1OB0A 4Z23A 1MVYA 3WE6A 2ZZUT 3WY3A 4N0YH 1URLA 1U5IA 1MR5A 5CA6A 1LODA 5I0ZA 3F7LA 3T2NH 3N85H 3PWVA 3Q05A 3SDXB 3G5XA 4MNGE 1HV0A 5JNYA 4IXLA 4OHWA 1YNLH 3ZE1F 4ABQA 2R2EB 5CEYA 4Z78B 5BV7C 2ZTBA 1PZ9A 1V9U3 3FFCD 1BEXA 4L0PA 4MS8C 1GZ9A 4XF4A 1ZHLB 5BVJA 5HDWA 4QPIC 4NZJA 3EYQD 1G6RL 1CAVA 4RGMB 2PO6B 4H25A 3COOA 2R042 4P05A 1N19A 5IBUG 1ONAA 1W03A 1SUHA 4OCWH 5EEWA 2OUJA 1W2KT 2VR9A 5GPRA 4MX3A 1EBPA 1MJJB 4J5VA 3A7QA 1WIUA 4JAAA 4FQ2L 1IC0A 1KB5L 1QFHA 4PRDB 3NH7L 3NFNB 1SEBA 4LSTL 5L2JA 1ZBE2 4JRXD 4JFOB 4AYID 2GT9A 4EN8B 1BFSA 1S8DA 2EDEA 4OI9A 4UV4H 4I3GA 1FYUA 1DLHB 4DP7X 4R9DA 1T80A 4LNVA 4NLHA 4HCIA 4XP6L 4IQPA 4P2QE 1R0AH 1SYVB 5DJ2A 1PLBA 4XXPA 2ZNWA 4PY7A 1IGFH 2YC1B 2F7OA 1A4KA 3QFJB 1X6LA 4P07A 4V2CB 3QXDB 1R092 1MHHB 2DQCH 5A6XA 2XIBA 4MXWL 1ZPLA 4FABH 5JA8B 1E5IA 4XC9A 4QOKE 5JCTA 4LP8A 2UZYB 2D9QB 5F7FA 5B39B 1RZ7H 5JW4Q 2F5AL 2I9LB 5B3JE 4YE4H 3UTTB 4DP4X 1TVBA 1AD9A 2BNQA 4P5KB 1JMZA 1RK1A 4CDUB 4FZ8L 4F8AA 5C2BL 3BVNA 3ZKNC 5EIVA 5C08A 5JMOC 3L3OA 3LEVL 3QS3A 3ACIA 5FYLL 2QTEA 3PDDA 3WFZA 4JR9L 4ZDHA 2D0HA 4DZ8A 3UAJC 1RSYA 4JQXA 1N3OA 1Q72H 1GZHA 2ZUTA 3FSZA 2CLVB 1VRH3 4MJIB 1RZ8B 4BQ4A 3FSAA 1C5HA 1D6EA 4P0DA 2PWEA 3PWJB 2ZOLA 1XZWA 1ZNPA 4F9PC 3BKJL 3UPAA 3ZR6A 3MCKB 2WD0A 4PJ5D 2R4RH 5B3JF 3D3AA 4WM7C 2FYYB 1AGDA 4LDOB 4PJXB 4ZUTB 1MI5A 1PNCA 2FBOJ 2YD4A 5C08E 4HJIA 5C09E 1G1OA 4OZHE 1X5AA 1ETZA 2P8LA 1TKWB 4JFZH 5ESVB 3CSTA 3KGSA 1ZT1B 3UO1H 1P2CA 5FA4A 5G4MA 5HHNA 5HYQB 1SZBA 1DVFA 2ZS6B 1AAJA 1AR73 3U46B 5CD5D 4HONA 5DJCA 3AP9A 1DEEB 4F15B 4KTEL 2PCPB 5L88H 1CD0A 4XRCB 2QQKA 1NMAL 2GY7B 2CPCA 2CUAA 5D7IA 4JDTH 4HWZA 5A2LH 1NXMA 3JV5A 3K0WA 1BJ1H 5I75B 1IJNA 1YEDB 4P2OB 4D8PB 1S3RA 3O6FB 4NZTL 3WY6A 4NQSA 5JW3L 3SITA 1PLGL 2JKNA 3BRDA 3JTBA 3K91A 2X9ZA 4HKXA 2C5DC 2ZGUA 2E74C 3ZXAC 3NTCL 4ODTL 3TZVD 2JX9A 4KK5D 1PQZB 2OXHB 3AREB 3N43F 4YL4A 4ZUSA 1RUH2 1G7IB 3VXSB 1JGDB 1UWEH 1VZIA 1DBAH 1YY9C 4KHXL 5CBEA 1CIWA 4GSXA 2H2SD 1INDH 1V8HA 4GRLC 3MV9D 3K6SB 5I6KA 3DPRC 5ISZB 1QJX3 1AXTH 1QX1A 1IBHA 1XH3B 1PGL1 4GMP1 4TXWA 4JZRA 4BFIA 3OR7B 2DAVA 2HA1A 4YZFE 3ARDB 4ZAKD 1RHI3 3VGIA 1JRHI 4PVLA 4BLJA 4EE2A 5IUCA 1MS9A 3CN2A 2R16A 3VGBA 3WHXB 2F4PA 1IOAA 2YA2A 3H0TB 4Y20B 1RUF3 2CBMA 3OUHA 5JI9A 3ZXDA 3FQTB 4WNJA 4KBZA 1ZKAA 4LCWB 5EFIA 3O3BB 3UO1L 3VXUB 5C6WH 4KX7A 4Q4W1 2NY3D 4PP1D 1KWGA 3RYPA 4OFVA 2JD9A 5CM1A 2GBTA 4Z7VA 1UVQB 3VE0A 3VI3A 5DRXB 4HOOA 2BY0A 4RFOL 1ST8A 3TN91 1QRNA 4Y4FC 2ZYSA 1SLUA 5K1NA 3X13B 4E42A 5EBLA 3I3DA 1NCOA 4LKXA 4F33A 4OLWL 4NZTH 3ZRSA 3X1NA 1AJ7H 1ZMYA 1WIPA 2VXTL 3H3UA 3MRPA 3MIDA 3GEFA 2KLRA 5F3IA 2BVBA 5KXCA 1KCSH 2AJSL 3VTAA 3GO1L 4G80A 3FBYA 4KMTH 3OZ9L 1NGXA 3QJSB 4K23H 4H1LA 2XN9E 4KVNH 3J7NA 2YAHA 4UV7L 1U8CB 1LO2L 2H32H 4JANA 2HLFC 3NT0A 1H6XA 3MRRB 2VNRA 3X3GL 2EECA 3E2HB 1EFXB 3PP4L 1YEGH 1ZV2A 5SWQB 1N8ZA 3WVJA 3S96B 3OKDA 4TYSA 2ERJB 3C09B 2XTJE 1CTMA 2W88A 3NGBB 4UT9L 5HY9B 1PO11 5FZMA 1RJZA 1AL21 1KB3A 2AV7A 4GAGL 1V55B 3N50A 1XR8A 4FTVD 4QPEA 1WITA 4PGEA 3N43B 1VERA 4ELMA 1P7QA 5MEOB 1YUHA 2AZUA 3BH9B 4LXFA 3NRFA 4PJ5A 3RGVB 3RWCA 4HHGA 3H3LA 5FGCB 5JR1L 2RBLA 3AZYA 3TB0A 1G9FA 2JH2A 2Q8CA 1BLNA 2JCCF 3AKPA 3WDYA 1TJGH 3MNZA 4CMHC 3IJEA 4XX5A 5FQ0A 5FTTC 1O5DT 1YYLL 3VXME 1KIPB 3LKOA 4OJFL 4WO0A 3Q6GH 1B90A 5AW4B 3QFJE 5FYMA 4L1HA 1QPXA 4FHBD 3ABMB 1BVKB 5AVXB 4K7JA 4E4DX 2D6KA 1QHPA 4GRWH 2QQNL 1WH0A 1BECA 4OUUA 2QSVA 4TULL 4AGQA 2BNNA 3O1MA 2XQYG 3MRCB 5E88A 2I60H 4QWWC 5IJBC 1XIWD 1B4LA 1QZ1A 3BP5A 1R6VA 5KW9H 2O5YH 2CDEB 4Y5XB 1KBGH 4J6RH 2GMEA 3S0PA 1TQCC 4NPKA 1E5BA 4GY4A 3S6PA 4ZUWB 1PX3A 1HEJC 3TVMA 3KJ4C 3QUYB 4GP5B 4HXBH 1M7IA 3B9CA 5FY4A 5IMKA 4P9MH 2RMU2 3S7EA 1FG2A 4AZ8B 4GRLA 2IWGA 1BPLB 5E4IA 3BWZA 4B9CA 3C5JB 1A6TA 1WK0A 3MR9B 1TO5A 1IEAB 1UKTA 4OJDH 2HWE1 1IAOB 5I1LB 2OQJB 1S1AA 1CZ8L 1TPXC 1QW9A 1JJUA 1TU2B 4R4BA 2FCBA 4H8UA 1YVLA 5FPAA 5CILL 5HDOA 3UROR 4CVWA 4B3NA 1TJHL 5DT1L 4FKKA 2VLRB 5IT2L 4LHSA 5FBZA 5I0WA 3MV7A 3ZE0B 4NJ9H 4G6KL 5JIMA 1Z7S1 4F7CB 1UYPA 5KXEA 2Y25A 2QGCA 4UU9A 1H3GA 2CHXA 2MOQA 2DMGA 4N3TA 4X0KA 2OMZA 2RFXA 1DGRA 4GUPB 1A6PA 2EH8L 4NQDD 2GN7A 4N90A 3EB7A 5FZIA 2D8KA 4XP1H 5EJ1B 1DZ0A 1B35A 4GUOA 2G9GA 4PJHB 1W8FA 2Y0SA 2XIDA 3EBIA 1RJ8A 3PXHA 3S5LB 1M05A 1Q9LA 5F93C 4ZU5A 2DQFB 4BU2A 3NN8B 1CDHA 1V05A 3M07A 3ZU8A 2DEWX 3R4DB 4AGVA 3OJ2C 3UTSA 2D7PA 3ZE2E 5KSAA 5C0CB 4S2FA 1ASOA 5IKCA 1R5VB 4DEWA 2ZGOA 3C6SA 2WQUA 3ALXA 1ZGLA 5H9RA 5SX5H 3CFKA 3IWVA 4G1EB 1A22B 2R2HB 3FO1A 1C5CH 3IK2A 4OUMA 5DD6A 5C8JB 2KLTA 3LHAA 5AFBA 4YFWA 1RJCA 3ZKXB 4MVBD 2CBOA 3GZUC 1UD4A 3CLEL 5C0GA 1I3UA 1PKQA 3FB6B 1UZWA 3PGDA 2J5WA 2XJPA 5KHKA 4P3CL 3W5NA 1OP9A 43CAA 1Q0XL 5FXXA 4OI1A 1FGVH 1U2CA 2UX6A 2VDQH 4PRIE 4LSDA 1KPVB 3OB0H 4GKZB 1A9BB 4NNYA 4P59L 5BV7B 1CWVA 5IREA 3SBWC 3DURA 3JV4A 4RGMC 2VO8A 1MCBA 3TN92 3IEAA 3UIYA 4D94A 3NVCA 1WHPA 2GJJA 2VH5L 3CG8A 4GT0A 4K3EL 4QRPA 4J3XA 5D1ZB 5FO9B 3LPFA 4XCNB 4YGAB 1SFPA 5HVHB 1ZVHA 5GIRA 1DVSA 2QQLH 3MBED 5F3HA 3TXAA 4XFBA 4M6NH 5J3HC 3FCTA 1VBE1 5FP3A 3FCGA 4JRWA 1CURA 1OQDA 4I01A 4AI0A 2LU4A 4OLXL 4WI2A 1MWAL 2K2SA 4S11A 1NINA 4XMXA 2JDHA 4EZ4A 4IV1C 2DWSA 2X2UA 1F4YH 1HNFA 2A6JA 2B1AL 4U1LB 2JDYA 3DKWA 4YG0A 1FC2D 2FWUA 2E56A 5LBFA 5ABJB 1W72A 1JV2B 4NQTA 4NHUA 2BP6A 1WPCA 3QJXA 4LDCA 4IU3B 4JFQA 4PI0A 3V7AE 5T5NF 1T0NA 4WW1A 4Y4KB 4Y19D 2VISB 2A7AA 3JB8A 3WOGA 3RX8A 1I1CA 3M8OL 4XBPB 3SNMA 3HR5A 3AB0C 5I5JA 1RUG1 3EHKA 2DFBA 1NIFA 5DZNA 5GGQL 3UGFA 3WHUA 4JDZA 3HHRB 2D3NA 1J83A 3I9GL 5T3XE 3HS0B 4HS3B 4WJG3 5HYSG 1SMVA 1GL4B 2WXGA 4NHMA 5C0IA 3VI4E 1AXYA 1CXKA 4L8DA 4U7MA 4N7IA 3IVKA 1SY6H 3DXUA 5E6SB 3EJJX 2WGNB 3LKPB 4NQDE 4BINA 4JKKA 1LHUA 3MJ9H 3OXRB 1IBGL 2YB7A 4EN0A 1LE9A 1M57B 2XZAL 1Y7VA 3KMDA 1RHHA 1GQPA 1R4XA 4P48A 3PNAA 2PTTB 3SQBB 5D2LE 2ZGSA 4I0PB 1AR1D 4I9WD 2HWB2 1AR71 3U1SL 3H3PH 3L3HB 4IBLT 5KVMC 5CIPA 4PWGA 4U33A 3VD7A 2F7IA 2N1KA 4DVRH 1XPWA 3GBFA 1P4IL 4ZK8A 3FMGA 4KQ3L 4XFIA 3WTWA 1J3PA 5FZ4A 1IQWL 1G9MC 5D7SH 2BM3A 4HD9A 3RL2B 1PO21 4PJDA 4GQRA 2G5BA 3TA3C 1D9KA 5C70A 4AI1A 2RACA 4B9ZA 1IM9D 3S2CA 5BNOB 3MNWB 4HJTA 4HF5H 2GNDA 1USZA 5F2WA 1CGPA 3KLSA 4A7KA 5EEZA 1F1GA 2DIEA 3M7FB 4QTIH 2K8MA 5I15L 2E4FA 1LK2A 3MBEC 1AY1L 2WKGA 3NACH 3HZMB 3NIGF 3QPXL 2VLRE 4IUGA 5FAAA 1J8HE 3SY0A 4BH7B 2XZZA 2IVJA 4NXKA 1VEMA 2A3TA 1IBGH 3SBWA 4N2KA 5JXED 1MH5A 4F7EA 3CJXA 4G8EA 4P9GA 3FFCB 1G9NL 4AXWA 5FY9A 1F9KA 5IFJA 5AL8A 5I30H 5BZDB 1A5FL 3FB7A 1XGYL 3ILPB 3O2DL 3WI9A 5HHVL 1SDYA 3WDVA 1N3NB 1EUTA 4N24A 1A3ZA 1WZ1H 1TR7A 3HZYB 4IMKC 3S3PA 1NAMB 1A4AA 4NRYA 5CNHA 2VN5A 3T3PB 3Q2CA 2ICEA 2WSVA 1XR9B 2FCUA 4AT6A 4KU8A 3VN4A 1MCKA 4KRMB 4IKIA 2OS7A 4RFEA 1M6OB 3PUUA 4OTXL 5CINH 5DQDH 3MRNB 3B01A 3MIEA 5FZBA 2FGZA 4IMLB 5BNNC 2X4TB 3KVDD 3P69A 3T0VA 4U3XA 4TNGA 3H3ZA 1S0BA 1U8IB 2YZ8A 3UKTA 1V7NL 3QA3B 2LGNA 4U1MA 1AR63 3FB8B 4DK3A 1US3A 1B0GA 4JQVA 3FX3A 4PDWB 3KD4A 1JV5A 5HJGA 4U2YA 2D97A 3VBFB 5EC1A 1OD5A 2ZF9A 2RDSA 3ZT7A 5DC4B 2YWYA 2Z4QA 3KLLA 4ODWA 4CMHB 1VADA 5CFDB 3QH3B 5EZJA 5ILTH 1AQKL 1CGVA 3BKMH 1V3JA 5ERWA 3AYCA 2WO2B 1FHNA 4JHWH 3OMIB 3WXWL 1S0CA 5F9TA 4YDKL 5HV0A 3DX9B 5A6YA 2W1WA 4BSWA 3DTDA 4LCCB 1A6CA 3C6LC 1BVZA 1Y18A 1N64L 2CY6A 2GC7C 4OZHA 3L3IB 1EP0A 5CJOH 3CDCA 3ASNB 3UETA 1O5PA 4RQPC 3MODH 3MUJA 1PJWA 1T89C 4O58H 1VAVA 3RG1C 3ZFGB 5BMFH 1I75A 3H3BC 4WV1B 4A7SA 3ZFEC 1SDAB 2DVDA 5DYOA 1T22B 3QPQC 1W8EA 1DQDL 1MCPL 5AVTB 5T3NA 1XMEB 2Y64A 1KJMB 4ZS6C 1BMGA 4NUBA 2WZPP 3G6JB 1H1AA 3VDDC 1FYTD 1FMD3 5ICYA 2Y22A 2ZWKA 3BI9X 3UJTH 3VWKA 5ICZA 4PTUB 4PWIA 2CMRH 4L11A 1FLRL 2YJLA 5HBBA 1LKNA 1US2A 3ARGA 3BSHA 3NIFB 2Q0AA 3RAJH 3CLWA 3BKYL 1EFXD 4FFWC 3R8BB 4O02A 2HWF1 5LY2A 2FBJH 2EYRA 3MYJB 4HIXL 3D34A 3BPOC 4NQEB 4Y16D 2OZ4A 3BKML 3UX9B 3FYIB 32C2B 3US1A 2IXCA 4Y2DB 4CUGA 4O9HL 5I76A 1VBC3 3U9UA 2BS9A 2ZEYA 2EDWA 5BXXA 1RLWA 4AYEC 2FB4L 2WZPD 1NOLA 1RIUL 4N2GA 5DVLA 1K72A 3EYPA 2E53A 1QNIA 3VH8A 4ZXBC 5BCAA 1MPXA 1YC7A 2Y4SA 4ES9A 4PJFE 1D7DA 4L8SA 3FZUD 3KM5A 2GC3A 1HKLL 2HKFL 2WV3A 4A04A 3ES1A 4D0CA 2PFWA 1WBXB 3UTSD 3CH8A 4Q0XH 5IP4A 3REVA 1VBB2 1DQDH 2BSEA 4PJGA 4AQ1A 2R0ZH 3F05A 1HYSD 1YIPA 3MV9B 5HHXL 3WDWA 3BUYB 3F04A 4ASMB 4A4AA 2XWCA 4FQIH 4JFHE 4TVPL 4XXDB 5FYJU 1JOPA 1QAWA 3HG1E 1OGPA 4XOAA 4LPVA 1UM4H 4V11A 3QJUB 3KLHD 4XVUD 3NSDA 2V17H 3IF1B 1QRKA 3F7YA 2BP5M 2QHRH 1OOPB 1IKFL 2HYKA 3AVEA 1AGBA 4XMPH 4R97B 3IM1A 3RILA 3WTYA 2H9GA 3PHOA 1WF5A 2WSPA 3OSKA 3T0AA 2R7EA 2BP8A 1IILE 2QNKA 3IXAA 2JG8B 4P9XA 4W6YA 3VBRA 4XHQA 5IV2A 5KBKA 3MV7D 1YMMB 1ZHKB 3DO3A 1MY7A 4HKZA 3AITA 4LUKA 1QFWI 1NCWL 4HFWA 3S5ZA 4PJCE 1F4XL 2A73B 3EOBA 3TAYA 5C9AC 4LEJA 2HWZH 2AERT 5KVFE 1TG8A 2X53S 2AC1A 4RWHA 5DUBA 5DRNB 4LP5A 4XQ4A 1V3KA 3L4CA 4LJHA 1JPST 2EDLA 5HI5C 1ZSHA 4RESB 1QQP2 5AAPA 4DK6A 2X8KA 1JHKH 4NOFA 2WPGA 4HGWB 4P00B 5JQIB 1IGMH 2ZOKB 2Y7LA 5I8OL 2QQWA 3SCMD 1U95B 3T3ME 2VR3A 2O5XL 2VN7A 1HQNA 4ZZ5A 3TNMB 3OXSA 1NQBA 2D4FA 4LGSB 3BZ4A 3K7UA 4PTTB 1KUMA 2JCCE 4CW1A 3VW3H 1OGTB 2OR7A 1NCJA 4IBUA 2IXIA 4NHLA 5AL0A 1CTNA 1ES0B 1MCQA 2IFFL 4EN3D 1ZHBA 4YLZA 2EC9U 2Q7AA 4Z07A 4OBSA 1RERA 1OTTC 4OM1L 5C07D 4L8QA 4W50A 5L6YL 4COWA 5J37A 3B2MA 4N5EC 3VDDA 4GXVL 5C08B 1OAUL 4AYBA 1H3WM 1RZFL 1XSJA 3PWPE 4XCCL 2YQ3A 2BJML 4TUJB 4Y1TA 1FZKB 3AQXA 4M9OA 5T1JA 25C8H 2G9KA 1ZA3A 2IDQA 2ENYA 1PIGA 1NCWH 1CB4A 1FV1B 3G7TA 4AQAA 2WNXA 2ZUWA 5E9DB 3LGRA 3DXTA 3ARXA 4XF1A 2GTZA 4YM2A 3PL6A 3RZHA 3QORB 4YFZA 1S5IL 5F3BB 4LHKA 1BOGB 4OZ4B 4CVXB 3L45A 2CAVA 4LBQB 1D5BB 2FBRA 4Y5SA 1WTLA 1K3ZA 3KXFE 4Z7VE 4CNIA 4HC1H 4JRLA 1PZ7A 4A2HA 3BRGC 1N3PA 3VSUA 1Z9OA 3IS0X 5I8OH 1LD9A 2PTUA 1HB3A 3BU7A 4WO4D 3LZPA 1A0QH 4Y7MA 4QPWA 2E6QA 2VOVA 1VESA 4JFXB 4ZD3H 5EO1B 4X7SL 5TQ0H 3QI9A 1JGIA 5FKBA 3D3VD 2V7NB 4GAZA 4FXKC 1F6AA 4ZFQA 4X5XA 1IBYA 4ABUA 5DJYA 2YARA 2VABB 1TQCB 1IGYB 1RUJ1 4XCAA 5JQHC 4F92B 4MGKE 4JKPL 5FV2A 2XQBH 3VFPA 5TE7L 3GD1C 5I1GL 1JNNH 1NKOA 1YJDL 3CK0L 5KG9B 5LRRA 2DCKA 1INDL 1NCGA 4EXPX 3S7IA 3WG1A 4JFEA 3K6SA 2FWOB 3IPFA 3ZYIA 1QZNA 1KXGA 3MIHA 4R52A 2OYZA 1ESOA 2GI0A 3S3BB 1ZRCA 4Z7UF 4QHMB 3ARZA 5I8EA 4ISQA 5KBFA 4WWKC 2HYXA 1NAMH 3LDBA 3RWJB 3SDXF 4Y7OC 3L54A 1N68A 4ILDA 4TUKL 5EU4A 2ZX0A 4AKPA 3H4HA 1SOSA 1BXVA 3I6GA 1L6ZA 4MJ6B 4NENA 5TK2A 5GJ6A 1X8EA 4MB4A 1XX9C 4J2QA 3VFOA 5FAXA 1MFEH 4UXAA 1FUNA 3VBSA 4G8GA 5GGUA 1CS6A 4UM9A 3QJFA 5TQ0L 4I18A 4L4TE 3N7LA 4CCOA 3CVCA 4JHAL 1N5YL 6TAAA 1ADQL 4DINB 5EO0A 4LKXB 3N9MA 1AJ7L 3RWIB 4X4YA 5EN3A 5EXOA 4Q4X1 3QUZA 3N2JA 3K4ZA 4UFKA 4TRPL 2GC4C 4WHYH 5HGHB 1OT5A 5LXVA 2NNRA 3POGA 5I0RA 2O5ZL 2IALA 2WM0A 3BQUC 3C7HA 4J6GA 4CRQA 4OD2B 3X1FA 2X4OA 1LM8V 3N9GH 1E5CA 4UV7H 3AAZB 3ZQ9A 2E6PA 2AITA 4R96B 5DZLA 2YD6A 4Q14A 3FQWA 1CICB 5FGCE 3ZQWA 1FXZA 4S2HA 2UY7A 4RMUA 1SACA 1GKOA 5IVNA 4FPLA 4L05A 5DQ0A 5DZ9A 3QUXB 1U91B 4X80L 1NGYA 4PS4H 3VXQB 2JDAA 5H9SA 4Z8BA 1NFDE 3HNTL 2L7UA 3ME0A 3MVSA 4RSYA 4XWGL 3TX4A 2WBXA 3SKJH 3U4BH 1JU3A 2BSDA 2IPKA 1H8TC 2EALA 2X4QA 1PZ8A 4N53C 2VDMB 2GABA 1JZJA 2Y7OA 1EMTH 4P2RA 1MRDH 3N3HA 1XXNA 3P1IA 4O2EA 1CDJA 2PPAA 1BD2A 1BLNB 4AEHH 2Y1AA 4AI2A 1U41A 4Q4Y2 4ONGH 1LCLA 5FYTA 2MSPA 3VXPA 2R043 5LBEA 5F5CA 2X6AA 3UKNA 1XBFA 1LMIA 5E6RB 1QTYT 3EHBC 4NMIA 3U2SA 4WSGA 5ADOH 4BWUA 3UMNA 1AACA 4PSRA 1M7UA 5FYLD 4ALAC 5ERLA 4WKZA 5B2GB 5HSFA 1HI6B 4LBNA 3INOA 3N35A 1XH1A 2H0VA 5CP7B 3QDMD 2X9YA 5L88L 5E08H 1NCNA 4BZ1A 2Q1ZB 4PWFA 4JVAA 2WBJB 1Q9OA 4B95C 3L2MA 5LA9A 4XTRC 2RS11 1JXKA 1O6SA 3ARYA 1RXLA 3P77A 4CN6A 5DZFA 1PLGH 3RDTB 3ZSJA 1XEUA 5D4JA 1BZ9B 4JFDB 3DUHA 1KBPA 3VH8G 4FP8H 2ZPXA 3EYOB 4R7DB 5C3TA 1XWVA 2LTQC 3EJYD 1Q0EA 1LTXA 2AQRA 3GMPB 2H6UA 3L7FB 4JPKL 2V4VA 5EOTB 3SKNB 3EJQA 1JODA 1A3LH 4PG2C 4ZZ8A 3HOBA 5TK4A 3R4UA 4K8RH 4AFAA 3CJJA 4GRMB 5CGTA 5AOIA 1GIGL 4AEHL 1NEPA 2Z65C 4MQXC 1ZCRA 2XYCA 1QFWL 4N1CA 1Y1DA 2IDCA 3SDCD 4D9LL 5L8KB 5T33H 4E4HA 2BUKA 2BVQB 3PGCB 4HH8A 1KFXL 4F83A 4XDOA 1OAZH 2QBWA 1UACH 2GUOB 4HK3J 5D4HA 2YFZA 4QX0A 1N1SA 3LN4B 5FK7A 2BSSB 2EDDA 5E16A 3MJ6A 5B1JC 1CK0H 2AJZB 2DJ4A 3KYMB 1R64A 1VAHA 1A14L 3QDHA 3TT1H 1LP9F 2AF2A 1KWKA 2P8PB 4XFFA 1UWXK 3ETTA 2E7DA 1N67A 3O8XB 4YHLH 4XTPA 5F7KC 3DF0A 5HXVA 3S5LA 1CIDA 3USUA 2ENSA 4NOBA 1U0AA 3KWWA 2P3YA 4J4PD 4PRIB 3SSGA 4X5RA 3KWUA 3TO4D 1MZ6A 4JHTA 3I75B 4QDRA 1MFBL 2GUYA 1J0IA 4NERA 1HDMB 3GGWB 3F01A 5KOVC 3NJNA 3P1VA 4DO6A 3HHSB 4XNYH 3DRTB 3R7QA 4CU7A 2XN1A 3CFDA 1SBEA 2X4UB 5E8DH 1GS8A 3CPUA 5IB3A 5KJ4A 2ZCWA 1GSKA 3FQRA 5TH2A 5DD5H 5I5RA 4LGPB 3FO2B 4MXVE 2UX7A 4RAHA 4Y1AD 4DWHA 1KGYE 2A9DA 3D9AH 2CJTA 4XVSL 5C0BB 4CKVX 2P5WE 4Z7WB 5GGVL 4G42A 2RDQA 5KVFH 4DEPC 2OJ1A 3WIFB 1CXLA 2N7BA 2PA7A 2WSKA 4A1RA 1BF2A 4ANXA 4GSRA 4XDQA 4S1RH 4R84A 1I9RH 1SJEB 5CZKA 5GRUH 1MFDH 2AHIA 1QJU3 5FO9A 1E90A 1ZA6B 4GJYA 5F97E 3GBLA 3QXUA 3FCUB 5JHBA 1ZVSB 4MCZB 3EOTL 4TLUA 3NKGA 2Z2SB 3HZ3A 4BCZA 4YW4A 4X7DC 3MRMA 4F20A 2VLKB 4K5PA 2XWJB 4P9HC 5FYKE 1PX8A 3C60A 4F1ZA 4QPIA 2HX7A 4AENB 1I4FA 4OJFH 4AH2A