3ZXAC

Structure and assembly of turnip crinkle virus i. x-ray crystallographic structure analysis at 3.2 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
295
structure length
295
Chain Sequence
QKVTRLSAPVALAYREVSTQPRVSTARDGITRSGSELITTLKKNTDTEPKYTTAVLNPSEPGTFNQLIKEAAQYEKYRFTSLRFRYSPMSPSTTGGKVALAFDRDAAKPPPNDLASLYNIEGCVSSVPWTGFILTVPTDSTDRFVADGISDPKLVDFGKLIMATYGQGAAQLGEVRVEYTVQLKNRTGSTSAQIGDFAGVKDGPRLVSWSKTKGTAGWEHDCHFLGTGNFSLTLFYEKAPVSGLENADASDFSVLGEAAAGSVQWAGVKVAERGQGVKMVTTEEQPKGKWQALRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Assembly of Turnip Crinkle Virus. I. X-Ray Crystallographic Structure Analysis at 3.2 A Resolution.
pubmed doi rcsb
molecule tags Virus
molecule keywords CAPSID PROTEIN
total genus 18
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zxaC02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zxaC01
1MEC1 2BFUS 4N53B 4N53C 1ZBE3 1VRH1 5L7OC 5L7OB 2BPA2 1FMD1 4GMP3 1H8TC 1H8TB 2RS12 4IV1A 4WM7C 1RUH3 4WM7B 1EV11 3NAPA 4CDQC 4CDQB 1AYM3 1FPN3 1R093 1VBB1 4CEYA 1V9U1 4Q4Y2 4FTSA 1AUYA 4EJRA 1BBT3 2R042 2RMU3 5BNPB 5BNPC 1PO13 2R072 3DPRA 1HRV1 2MEV2 4N43C 4N43B 1D4M1 5C9AA 5FMOS 1QQP2 1VBD3 2XBO2 4CEWA 3ZFFA 1BBT1 1PO12 2R073 5D8AA 2VQ0A 3TN91 2PLV3 1R091 1AR82 4JGYC 1E57A 4JGYB 2DF7A 5K0UC 5K0UB 1RUH1 1C8M2 1R1A3 1FPN1 4GH4B 1EV13 4GH4C 4NWVA 4JGYA 1NOVA 1COV2 3ZXAC 2BFUL 4QPGB 4QPGC 1M06G 1VRH3 5CFDA 1MEC3 1ASJ2 4QPIA 4AEDB 4AEDC 2RR13 2WZR1 1X36A 2RS11 1RUE3 1ND2A 1EAH1 2TBVA 5DDJ3 1NCQC 1NCQB 1TME2 1MQTC 1MQTB 4CDXA 2WLPA 1NCQA 1QQP1 1BEV3 3HAGA 1C8M3 4CEYC 1HRI2 4CEYB 1NA1B 1NA1C 4GB32 3VBUA 4Y4YA 1WCDJ 4YVSA 5JZGA 4CDWA 1HRV3 1QJY2 1VB4A 5CFCB 5CFCC 2WS92 1POV0 1RVF3 4FTBA 5A32B 5D8AC 5D8AB 3CJIA 1POV1 1AR91 4Q4X2 2WS91 2BBVA 2RS52 1K5MA 4AEDA 1ND3C 1ND3B 1NCRC 1NCRB 5ACA1 4GMP1 5AC93 3ZFEA 2HWD3 1RUG2 4QPGA 4GB33 4SBVA 1PIV1 4PDWA 1AL0G 4WM7A 1OHFA 1OPOA 1Z7S2 1GFF2 4PDWC 4PDWB 1TME3 1AYN2 4Q4X1 1RUE1 1TME1 1PGL2 3JD72 5C8CC 2WFF3 5C4WA 1R1A2 5C8CB 1OOPC 1OOPB 1VB2A 2RM23 5BNNC 5BNNB 5L7OA 2HWB2 1RVF2 1H8TA 4WM8B 4WM8C 3JD71 5ACA3 1C8M1 3S6PA 5BNPA 1AYN1 5A32A 1TMF3 1RMU3 1RHI1 5FOJB 3TN92 2QQPA 1VBE1 2R043 2R071 4RHV3 1OOPA 4CDUA 1RUG1 2BUKA 5DDJ1 1VBC3 2RS51 1R081 2RR11 2WZR3 3IDEA 1AYM2 4JGZA 1ASJ3 1RUE2 5GKAC 3VBOA 2HWB1 3VBRB 3VBRC 4IV1B 1VBB3 1VRH2 4IV1C 1RHI3 1AYM1 1V9U2 1FMD2 3JB4C 1NA1A 2X5IC 2X5IB 1R082 4RR3A 5A33A 4GMP0 3LOBA 2RMU1 2PLV2 5ABJC 5ABJB 1QJY1 1RB8G 2MEV3 2RS53 1TMF2 3VBFA 1ZBA1 2R041 4Q4V3 5C4WB 5C4WC 4RHV1 1VBE2 2GH8A 3ZFGA 2HWB3 1PO23 2HWC3 4Z92B 3JD73 1AL22 4N43A 1NY72 5J96B 2ZAHA 1SMVA 3JB8A 1HRI1 4Y5Z0 2RS31 1FPN2 1VAKA 1Z7S3 1AL21 2R063 1BEV2 1PVC3 4YVWA 1COV1 1VBC1 1V9U3 1AR83 1FOD3 1RUC2 1AR73 5C8CA 5DDJ2 2HWF3 1PVC2 1RMU1 1PIV2 1VBE3 1D4M2 3VDDA 2GSYA 1NG0A 1TMF1 1QJU1 4BCUA 1ZBE2 1AR61 5BNOB 5BNOC 2ZZQA 4RR3B 4RR3C 5A33B 4IV3C 4IV3B 1PGL1 3NAPC 3NAPB 1RUF2 1RUJ2 1VBA1 2WFF2 1EV12 1QJU3 4QPIB 1AR93 4QPIC 4Q4V1 1RUI2 3JBG3 3VBHB 3VBHC 1VBA3 1QJU2 3VBRA 4RS5B 4RS5C 4Q4Y3 2IZWA 5ABJA 1HXS2 5JZGB 1MQTA 5JZGC 1RHI2 2RS33 2WWSA 5AC91 1HRI3 4GB31 1RUC1 4LLFA 2HWD1 1BEV1 3ZFEC 3ZFEB 1HQNA 1PO21 2HWC1 2XPJA 1FOD1 1PGW2 1POV3 1W39A 1AR71 2WZR2 1IHMA 1ZBA3 1COV3 3M8LA 1PO22 1EAH3 2HWC2 2RS13 1RUF1 1RUJ1 1MEC2 1VBA2 1AL23 2R061 5K0UA 4CDWC 4CDWB 1PO11 4RHV2 4YVWB 4YVWC 1BMV1 1K5MC 1K5MB 1VBD2 2HWE3 1QJZA 3J8F3 4Q4W3 1AR63 1RUI3 4CDXC 4CDXB 5C9AB 1BBT2 5C9AC 1NY71 1CD3G 1RMU2 4RQPC 4RQPB 1RUD3 2RMU2 4RS5A 3VBSA 1RUI1 4CEWB 1VBD1 4CEWC 2HWF2 2HWE1 3J8F1 4Q4W1 1D4M3 5J98B 4IV3A 1HXS1 1EAH2 1HRV2 2MEV1 4NWWA 5FMOL 1ND2C 1ND2B 1B35B 1B35C 3DPRC 3DPRB 1R083 1X33A 4RQPA 1R1A1 1R092 2R062 1RUD1 2RR12 1RUG3 5CFCA 3TN93 1ND3A 4YVSB 4YVSC 5AC92 1AR62 1QJY3 2XBO3 4Q4Y1 1RUJ3 1RUF3 1HXS3 1QJX2 1A6CA 2WFF1 4N53A 4WM8A 1AR92 3CJIC 3CJIB 2FZ2A 1RUD2 3VBSC 2RM21 3JBG1 3VBSB 2FZ1A 4RFT0 5ACA2 1AYN3 3VDDC 3VDDB 1F2NA 1RUH2 1VBB2 5LK7B 1ZBA2 5BNOA 1FMD3 1FOD2 1PGW1 1RUC3 4FTEA 1ZBE1 1ASJ1 4JGZB 4JGZC 1PIV3 1QJX1 5CFDB 5CFDC 3FBMA 1B35A 1CJDA 2ZTNA 4Q4X3 1HX6A 2RS32 1RVF1 5BNNA 4Q4V2 2HWD2 1BMV2 3VBUB 3VBUC 1NCRA 4FSJA 3ZFGC 3ZFGB 1VBC2 1C8NA 3JBG2 1QJX3 3VBFC 2Y26A 3VBFB 2HWE2 3J8F2 4Q4W2 2WS93 3VBHA 4CDUC 4CDUB 1QQP3 2RM22 1DDLA 2PLV1 1AR81 2X5IA 3ZFFC 3ZFFB 2HWF1 3VBOB 3VBOC 4CDQA 1AR72 1PVC1 2XBO1 1Z7S1 1F8VA 4GH4A
chains in the Genus database with same CATH superfamily
2NLRA 3GBDA 4H2AA 1G9ML 2BFUS 3VRIB 5DJ0A 4ODUA 4YW3A 4LCIH 2R15A 2J6EA 2ZSWA 5EZIL 4AGRA 4QXHA 3C60B 1EP0A 4D0DA 3MV8B 2D31A 2O8OA 1NKRA 2WKOA 3BFOA 1F6AB 3QQ3B 4N2DA 5LJYH 3FFCE 2AGSA 4OKVA 5TK2A 3MACH 3O6KL 2XV2A 4MMXB 4MJ6A 4XI5C 2N4IA 5I8CB 1R093 4XPBH 4N20A 1VBB1 1FNZA 1PY9A 5E1RA 5HCBA 4ZFZB 2YRBA 5JXIA 4AL8L 3AXLB 5ILTL 1Z5YD 3W81A 2PTMA 4XFFA 3DI2B 1MNUH 5K5YA 1PZUB 3QJOA 2QQLA 3Q2WA 3QXDA 3KF5A 3WIAA 2OMZB 3GBML 2LLGA 2OXGB 4JUSA 4O2EA 4LLYB 1U42A 1YPZF 1ADWA 3EO1B 1M7DA 4QRTB 4MCNA 1X5IA 1HN0A 2RDNA 4HIHA 1F45A 3ACIA 3HC3L 1U8JA 5CM1A 4R4NC 2NXYC 3NH7L 4GXUM 2WWJA 4DZ8B 1GYAA 4AHZA 4AZZA 1YUKB 4AMKL 1XBFA 2PYED 4MA3B 1FNHA 2E0PA 4XNYL 4ZTEA 5E2TH 5I8OL 3PF2A 4Q6IC 2X7LA 3W9DA 3AROA 3CU1A 3TEUA 1FNSL 3FQXA 4EI5C 1FCCA 2TSBA 5JSPA 5D9SA 1MRCH 5ICUA 3ZN6A 1UY4A 2VNCA 3DGTA 4FKEA 4Y4KC 2E63A 4PG2C 4QGMA 3Q5TA 4FL4C 1ADQH 3ZIYA 2ED9A 4IMKA 3AMKA 3X14A 2D31B 4U36A 4Y5YB 4P05A 2K4WA 1GGIH 3GXIA 1Q72L 3N44F 5E2VL 3ABZA 5EHFA 1G9NH 4X5XA 3WQ0A 1ONAA 3EHBD 1SRDA 2KLSA 3B6SA 4XC3H 3QCUH 3WFHB 4BINA 4FA7B 1HDKA 5DDJ3 3TBTB 3ACGA 3VZNA 4PWJA 2P52A 1EJ6A 3KWTA 4DK3A 4Y22A 4H20H 2VN6A 1E4WL 1NSNL 3PHQB 4N68A 5DAPA 4BQWA 2FL5A 2EYTB 1CVRA 3CIQA 3VMNA 4HGMA 3OZKA 5JA8B 1PG7H 3QDMA 1JCVA 5SX4H 1OAJA 1CLOH 5CP7A 4LCWA 1HRI2 4KK8C 5CCJA 4NC0B 4IE7A 5FY4A 2VUJA 5EO1A 2EINB 1FZOA 2X40A 3F65A 1WTGT 4K9EC 3CDGA 5E8EA 4GUQA 1WCDJ 2WO7A 3WR0A 5AWNH 3IE4A 4NRPA 1P84K 5HJBA 5JZGA 5J9PB 5FAAA 5E6SB 4FFVC 1IFGA 4E9KA 1OP3K 5HV0A 3HBKA 3C9NA 1ZYBA 3F83A 3O4LE 2WS92 4PJDA 4FTBA 1WZKA 1ACYH 2HKAA 4LP5A 3II3A 3JUZA 4H88L 4KDVA 5D8AB 2HT2D 3EJTA 5DUBA 2PQSA 2H1PH 1LTXA 3IJHA 2WINA 4ODTH 2FR4A 1OKOA 1W6PB 2ATPB 3WXPA 3RJRA 1U21A 3LIZA 1ZZ7A 3G5YA 1L9TA 3NESA 2BZDA 3B5TA 5LEKA 2GTQA 2XPZA 4LIUA 3K51A 2WA3A 5EOTB 4MJ5A 2XQYG 1H6XA 2Z69A 2OW7A 2MIZA 1A4JA 4F7KA 3WTWA 2WYZA 2W47A 5FYBA 3P30L 2VTXJ 2G0LA 3LZZA 2FCVA 5DAWA 1AL0G 1L9PA 4YDJB 1UMHA 1OCWL 3FHQA 1MIEL 5CN1A 1OBNA 3FTUA 2FATH 1FVDB 5E6IA 1IKOP 1W91A 4LGPB 5CD5C 3L13A 3WJMA 5L4JA 1TQTA 4TL5A 1KFUL 4NAOA 1R5VA 3WP6A 4PJDE 4H55A 4M62H 1RIVH 2DYPA 1OM3L 3IBOA 5IUCA 3BU7A 5JUVA 2CBPA 1H9PA 4MKMA 3TBBA 4A38A 1CAWB 1NFDE 4LIQE 2OJZL 3L17A 2Y7OA 1OOPB 2WXKA 4ZXKA 5AVSB 5ACLA 5BNNB 2WZEA 4JGUA 3NZ8A 2XJRA 3W0WD 1H9WA 4N0YL 1OSYA 1OVPA 4WM8B 3IF1A 1CGSL 4A7KA 4X6FA 4JVAA 1AFVH 4MLOA 1BLNA 4G6MH 3D52A 1NZCA 2QE3A 1BBJA 4F92B 4AX3A 4IRZL 4R8WL 3VUAA 5FPBA 2VXQA 3RYRA 1RHI1 2MNGA 1ZS2A 3ZZQA 3BPCB 4GMTL 5AQ0A 3SODB 4F24A 4JTNA 2R071 1ASPA 4N1HB 3CFDA 4RQQA 2J5WA 1IC1A 2DQJL 3WN5C 4WKXA 4XNQA 1NC4D 1TFPA 3RTQC 5ITBH 5FYKH 3RVTC 2XFXB 3ARFA 4M8QA 1OP9A 3I3EA 3RA7H 4I48A 3BGMA 2XIIA 5TSWA 4K71C 4LLYA 4KI5M 3BAIA 3T1MA 5HYFA 3KYMA 2D0GA 7FABL 1CX4A 3TVMD 1KUMA 1GKBA 2YBSA 5E08H 3M7OA 3FB6B 3SDDB 3ZM8A 2LW3A 1M7XA 1JYVA 5F9OL 4Y2OA 3FO1A 5BVPL 5JHLL 1BVOA 1KJMA 4HHGA 4PRIB 3OGJA 3AG4B 4G8GD 2WYTA 5AVYB 4TM9A 2HH9A 3QJXA 4MX7B 4IKKA 2JI3A 3NDZE 5B4NA 3BSHA 4GRWE 2XH6A 3JB4C 4FEMA 5BW7A 3FFQA 5IMOB 3N41B 3DVFA 5T1DH 2VCCA 2X5IC 3O3BB 3MCKA 2E9QA 2E51A 1BXVA 1LEGB 2F19L 4OH2A 2Q8BH 4DGYH 2AH2A 4XXDB 1OB1B 2X8KA 2Q8CA 2P24A 3IXTA 4N28A 3WTXA 3KV9A 4AQOA 5E00B 1TMF2 3TONA 3CO2A 3SKOB 3LA7A 1ZBA1 5EHDA 1KG0A 5LXGL 3H3LA 4FQ2L 1DR9A 5T1LA 1FAIL 2XI9A 1DBBL 1BJ8A 1DBAL 2FO8A 3DK2A 3QXAB 4GBXC 4OCSL 1Y4WA 5GM0A 3TBCA 4M7ZC 4XACA 1VBE2 1NCNA 4LBAA 5BUGA 2GH8A 2VZTA 5GLTA 2G3NA 1HXKA 2NNRA 3D2TA 3EGDB 4DMIA 3TGXA 2BIMA 4FLSA 4ZO6A 5F7AA 1IC4L 1G6VK 1TNNA 4MXWH 4ZTOH 1AL22 4UFKA 3HEIA 5FZ4A 4EWEA 1D2PA 2JDAA 4MG2A 5I76A 1XL6A 3FPXA 1W6NA 4LHSA 1AY1L 3C8KB 5LA0A 1CGVA 3OKKA 4LOSA 1ZHNA 3SYQA 1BVZA 3I84A 4GAGH 3WE6A 3X2QB 2NY2D 4GXUN 4FYTA 5J1TC 4PS4H 4B3VA 3Q2VA 3CFBA 1Z7S3 5DZEA 2BQPA 2X10A 4AYGA 3NFSH 1RURH 1IAIL 1M2VA 4KVCH 3DJZA 3WNIA 1LR5A 4QWWC 1COV1 3EJPA 4MMZC 3RWDB 2GMEA 3HPLB 4C58B 3RIKA 1V9U3 5H94B 4BGLA 1YO8A 5F9AC 5KVEE 2Z7UA 1RZJC 4HH9A 4N0RA 4A7VA 3IFOB 3GTTA 4JRFA 2K7PA 1WWCA 3UGXA 4E41D 3Q8CA 4JRXD 2XCMC 3SDYH 3WD5L 4UV7L 2CKBL 2RFXB 2APFA 2HB0A 5GGSA 4R9DA 4GQ7A 3QEQE 4FAHA 2VSDA 3OB8A 4JFOB 3V0DA 2B42B 1U30A 1G9NC 5DS8A 3UYPA 4XILA 3V7MA 1Y6MR 1G9NL 1FIGH 3ZDZF 3S9DB 3NAPC 3P9LA 1GYKA 1K9TA 4WDIB 4MHRA 3CZKA 2QL1A 4MGYE 5LNGA 4QKNA 3RG1C 4YL4A 5AB2A 3ZE1F 5DI8A 2V5SA 4XBPB 5DD6A 3S36L 4BBWA 5KSVB 4RZCB 1VMFA 1IAKB 1B4RA 3CIHA 5F88B 1FBIL 1I8MA 1HU8A 1HB4A 3VBHB 1FNAA 4OLXL 2N59A 4HKJB 4F8QA 1O5LA 4D7YA 4WUUE 1RJCA 1QJU2 3DX8B 3ELQA 2AREA 1RXLA 4NM4L 2G2NA 2JJTA 1FV3A 2P5EE 4XI5D 3KSCA 4N2AA 2CGPA 3MKGA 1CUOA 2Z7ZA 5IMLB 1JZJA 1MQTA 4DEVA 1DSFH 2RS33 2JKJA 5AC91 5IKCA 1C08A 4OLVL 4U1NB 5CGYC 1IZJA 2FX9H 4Z7VE 2IF7A 1WW7A 1I8AA 5IHZB 4QJ3B 3VFMA 2P8LA 4G7YH 4AQ1B 3KLKA 3EOYG 1L5GA 3F5WB 3MJ9H 4NAMA 4YE4L 5DGQA 3EYUH 4GI6A 1U3HB 5IESH 1RZFL 1M7DB 2AEZA 1VGKA 5MEQA 3DHUA 3KXFB 1OGTA 4I2OA 4KU8A 3MV8E 2KDYA 4P9HL 2PMWB 1KPVA 3I8TA 3ZVXA 2FB4L 2AUYA 1NEZA 4K3HA 2XWCA 2Z9TA 3T8XA 4TZDA 1S9YA 2ESVD 1PO22 4L4JA 4LXFA 4XP6L 5T5FH 2V5YA 4AMXA 5GRYA 1KT2A 3QDJE 5D96B 5AW1B 2DZEA 4X50A 3OKOB 3GSQA 4HJGA 1KSRA 4JFEE 2O1AA 3D25A 3CFTA 5DYOA 3HPJB 3GZOA 3ZMRA 4YVWC 3HKFA 1A4CA 3APBA 3GHBL 2F7IA 4JFWA 2AJ3A 4RISL 2OTWA 4Q4W3 4M43H 5AZUA 4CADA 1NE4A 3P0VH 2DIBA 5EZLA 4K7PX 5I82A 2KH2B 5FWJA 4XMAA 1YG9A 1J8SA 5LBCA 4E42B 4OZIB 3K6OA 4U1MB 1CGXA 5HY9A 3QO1B 5GS1C 4ETQB 2EXTA 4ZMYA 4P14A 4QRUA 2FJGA 4ATTA 4GXLA 2VXTH 2K9UA 1A6VH 3PY9A 3PQYD 4F15C 3G6JE 2DLFL 1BZEA 1NGPL 3ILQD 5KW9L 5JW5B 4L18A 2X41A 1IC5H 3OUHA 1HRV2 4CN6A 3RVUD 4RZKA 1MFEL 1A6PA 1R6VA 4HD9A 4JDEB 5HHME 5L2JB 3M7AA 5HI4D 2WN2A 2VW6A 3SBRA 3I3DA 3QAZB 3AMHA 3GGLA 1DL7L 2D6KA 3DPRB 1DCLA 4LL1A 3PJNA 5FWRA 4GAFB 3NJXA 1AG6A 1YYML 4GYBA 1G7MA 4ZBJA 4ODSH 5HBBA 4LPTA 4Y8DC 1LO3H 3WI9A 1HH9A 5KTEH 2H2PD 3EOAB 3SO3C 3VWJC 4YXLH 5KXBA 4PJDB 1I5PA 4J1UA 2DWXA 4KKQA 1TIUA 4OMDA 1DFBH 3D0LA 3ARQA 2J12B 1N5YH 1AX1A 1PX8A 5AC92 1JYWA 7PAZA 3WAJA 1JYTA 3WIHH 4LE8A 1S2BA 2QPUA 1PYWB 5I93A 3MLYH 2FDBP 2IPUK 3GMMA 4H8VA 1H8LA 3QEUA 5FCUH 3TM6A 3UTTB 1SJHB 4YAQB 4MSWA 5ADOH 4PTTA 3VWJD 1PZ7A 3LRSA 1W80A 1U58A 4YGVB 2JB4A 3CJXA 3EMRA 5JIKA 1D7FA 2VDMB 5DJAA 3P0GB 3NNMA 5INDB 2CG9X 1SY6H 4OLWL 1O8SA 3LKOB 4OT1L 3UTOA 1T22B 3ZX7A 4G8IB 1J87A 4QU1A 1USQA 4HUKB 4CC4C 1F2NA 2ZYSA 5E9DA 1L3NA 5FYJU 4FXGB 4F93B 1PY4A 2IBZX 3NEXA 2WQZC 1YO4A 1JUFA 4QHLA 1RUAL 4GAYA 2BEOA 4KKBC 3F8UB 4I13B 4LUKA 1W6QA 1ZTXE 3TU6A 2D3SA 3VXQB 1LHWA 1D9KA 5HPOA 4LA3A 3WSOA 2I7OA 1S0FA 4FFZL 3T9WA 5LRRA 3RGVA 2ZXQA 3ISRA 3DDGA 3K5SA 3UZQB 2NT1A 3PTRB 2MPAH 3R0MA 1JGLL 3KF3A 4QRQA 4COYA 4QHUA 4HUVA 3Q3GA 3RGVC 4NO3A 3GXUB 4AM0Q 1CGPA 4S0TD 4UYQA 5KSVA 5KUKA 4MA3A 2DN7A 1HE7A 5T3ZL 3LOWA 3N9PA 4TULH 3UOAB 2MKWA 2WQXA 4UU9B 3CZNA 4XNZB 4JCKA 1CL7I 1EEZB 2WXJA 2BS9A 4X83A 2ZOLA 3FUIA 3WUWA 1SFDA 3ZKXB 4B9CA 2GJ6D 2BOCA 1G7PA 2D2OA 5JR7B 3IMUA 4Q74A 2HWE2 2YGMA 3GSWA 3K4AA 2WS93 4F1ZA 4EN9B 2OSWA 4K3DL 1WWAX 2X6MA 5I1CL 4IKLA 4EV0A 4IKNA 4R0LC 3VWKA 3ZFFB 1QABA 1RVFH 1BOGA 2QT6A 3WOVA 1QTPA 4MMXA 3D39D 5I1EL 2WMPB 3GBLA 3T8VA 4Z77A 2XKPA 4N8MA 3NN8A 1BFVH 3MLZH 5E8NB 4RGMC 5I28A 1Z7S1 4KTGA 3OKKB 1P6FA 3RY6A 2KZBA 3P9MA 1X5FA 1FO0H 4NM8L 3BYWA 4LQ1A 4WI0B 3QNXA 3D3VA 1NAMA 4N53C 1UJ3C 1RJYA 3MLYL 5DC4B 1GSLA 4EDWH 4X5WA 2BSRA 5C3TA 2XMLA 2O6CA 5L7OC 3MBEA 3T77A 43C9B 2P6HA 2DOCA 3QNYA 4H3WA 4JTOA 1U93B 4Y19B 2DM4A 3P4OB 3PV7A 4F8OA 1QPXA 2UX6A 1GZQA 2VXVL 4WHYG 1NFDF 4LIQL 5DVOA 4GXFA 3UJTL 2XQBL 4S2GA 3MRPA 4ARXA 4NO3B 4ATWA 1UN1A 1GYWA 1JHTB 2LFGA 4IK6A 3UGUA 3V0VA 1FA4A 1FPN3 1OP4A 3WEZA 5F7DA 4OFQA 5K1NA 2ZWSA 1N67A 2BNOA 1YFWA 1I8LC 3GSVA 1USZA 4F5CA 1Z78A 2H0FA 5C97A 5DUVA 1H8VA 2VDQH 3TH2T 2AJSL 1JXJA 2R042 5FZCA 3TEWA 1HQ4B 2EXHA 3V65A 1TEFA 4NIHA 2GNTA 3VFGH 1PO13 3LVEA 3QCTH 2Q20A 1UWGL 5FO2A 2ZKXA 4OLYH 2F4PA 1QA9B 3REWA 4PLKD 1JUIA 4Z78A 4OCNC 3UP1A 4R84A 4M93B 4POUB 3S98A 1CDUA 2ORBL 3UTSB 3AX4A 5DAVA 4Y5YA 1V0AA 4UMSA 3L4XA 4ZODA 1ADQL 3DKQA 1R091 3O9WA 4XVUD 4LDCA 4E9XA 4FS0A 4NUBA 4I0BA 2RQ8A 4CP9A 4XPFL 1MS3A 3MRRA 4BWOA 5K0UC 3VD0A 3LN4A 3Q2NA 3V4VB 1CL7H 4B9FA 1NGWA 5C0DB 3SPCA 5K39A 1PLBA 1GZ9A 3V56A 1KLFB 3PGCB 4QHOA 2FH8A 2WCPA 3TT1H 5I6LA 4JHWH 1EZVY 1M06G 4HXAL 1EXUA 4GG8B 1I7ZB 3F7VB 5EBMB 3O3DB 4AEDB 4QAWA 3SKJH 2NY0D 3G04A 4PJXA 3STZA 1I7TB 4JJOA 2ZHNA 4F83A 1X6LA 5EH1A 4AVKA 4JRYD 3H9SB 2X4RB 4QX1A 5B4XA 2A9ML 3JT2A 3IGLA 4P3CH 5BZDB 1K4DB 1P5VB 1UGKA 4QTIL 4KZEH 3LSOB 4O00A 2XFGB 3L95A 1DO6A 4PHZA 1AZVA 5I73B 2IANE 1UQSA 5CF3A 2DLFH 4PJEB 1UO9A 3V4PL 1YQVH 1WLWA 4H25B 3GRWA 1FO0B 3LEXA 4W9KC 2BNRA 2JDHA 4I0PB 3CFKA 2R2EA 1HOEA 3FBKA 3O6MH 5HYJA 1H6FA 4OYUA 1UU6A 4FQLL 5EBMA 4S2DA 1EV2E 1NA1C 2C3VB 2ZKHH 4WW1B 3SCFA 2EILB 1ACYL 2NNXA 4RDQF 3ZVVA 4F58L 1HXMA 1KGCD 2N1KA 2BP0A 3ZMEA 1W9SA 2NNAB 3EZJB 2PWGA 3GPSA 4JG9A 3RHWK 2IBGA 3ARSA 3Q6GL 2W39A 4G6KL 2X4NB 3QO1A 4JY6A 4LVHB 3SE9H 3CLFL 3V0BA 2WBJA 4ERSL 1U2HA 1LOBA 4W9ZA 2ZOOA 4CA9A 1L6XA 3FXIC 1HFUA 3PNWB 4Q4X2 5EB9A 4P02B 3VRJA 4HUVB 4WW1A 4ZMZA 3IKCA 2X9XA 4CAGA 1DQQA 4S1SL 5F9JA 4PBOA 4ALAC 4YGDA 2VDQB 5ELIA 1U3HD 2XTJB 3CBNA 1RZ8A 1KGJA 4OQTA 4ENZA 1W28A 4PCSA 5LCVH 3OKOA 4U7SA 1YMMD 4OLZL 5I30L 1F0LA 1OHFA 2FJUB 3U1SL 3X17A 2ATKA 1NPUA 3A4EA 1GZHC 4BGDA 2QDVA 4OCYL 4M6ML 4UTBA 3SOBL 1AQDA 3ULVE 2D97A 1WLCA 4Q5OA 1DJWA 4ZXBD 3M17B 4PRNB 3L48A 1R1A2 2QDRA 5I0SA 5LCVA 4MNHA 4N87A 4BK5C 1A6WL 1YEIL 2NMSA 3V4UH 4JQIH 3BIKA 3BUPA 3V0IA 1IKPA 3QACA 1EHAA 3ARDD 2APVA 2BSBA 1DVFA 2OMVB 1CDCA 5EUOF 4XFIA 2J88H 4GMSL 1UXMA 1JGDB 2ATKB 2IO5A 1SJEA 4AENB 5BNPA 1MHEB 2DQEH 4QNPE 1TMF3 2JDZA 3ARRA 2YSSB 3GMPA 3INUH 4RA0C 4M5ZH 2GT9A 2VLMD 1HILB 4MOAA 1CXIA 4XCYA 4OFYA 1XB8A 5K33A 3MA7B 4OJFL 4GW5B 3PAYA 2C9XA 2OPCA 1UJTA 3HKZA 1OWWA 1Z9OA 3EOAA 3IDMA 4RRPG 3UABA 3KHQA 1A34A 4F2MA 2K9FB 1HWHB 3RU8L 1GIGH 5EU4B 4N2FA 1V6LA 2QR0A 3FB8B 1R081 4Y2NA 4Z7OE 4IEFA 5HHOE 1BREA 1CAUA 2GAUA 2WZR3 1CF1A 2I07A 4L8SB 5EO0B 4OIIL 1T3FA 1ZRRA 1RURL 4P06A 4KVCL 5B7MA 1GLHA 1A5FH 5HYQA 1Y07A 2VH5H 1KYAA 3K48A 5FP3A 1T83A 3UC2A 1C5DB 5EORH 3IDIA 3BMVA 5FYJE 4J4PA 1GZCA 4EI5A 4IL7A 5IWFA 4IV1C 3O5SA 1LEDA 2R0ZL 3R4RA 5DVPA 4MNHB 3I97A 4IBSA 4H7VA 2X4QA 5INCA 1QBLL 4HS6B 4PJ7B 2C24A 1XSOA 2G75B 4CJ1A 4KAQL 5AD0B 2V9QA 4AGMA 4MB1A 2CLVA 2GP5A 4GRWB 2FX7L 3QQ9D 4FXKA 4U6XA 2CDFA 5TQ2H 3CVCA 4HIHB 4HIIB 4LCYB 3W39A 1JI1A 3RWHA 2PXYA 3RIFF 4IDZA 1JK8A 4PV9B 1JUFB 4G82A 1B2WH 4LAQL 4U1JB 1W6NB 1CLCA 2VC2L 2H4EA 4CC1A 3TCLB 4QTFA 3VQMA 3PV6B 1ZX5A 2ARCA 5I0UA 4L3EB 1IEAA 3X3FL 1J5DA 1W72B 2ZPKL 4OAWA 5K59F 1OAYL 2M2DA 5AEAA 3GJEA 2VW2A 3RL2A 4ZFFA 1H4GA 1SN0A 3FT2B 3KLQA 5C7XL 4NQEB 1KB9K 2Y36L 5IV2A 2HWC3 2CDGB 3PABB 2JJ6A 3KLHC 5E9DE 4AUJA 1S7WA 4WWKB 3BN9D 2B9VA 2DVFA 1GJWA 1TCRA 2HLFC 5JHBA 3ZBMA 1D4VB 4JPIA 3OHMB 1ID2A 3KCCA 5C07B 1U8OA 5LGYA 5IK8A 2RS31 4FE9A 4CCCA 1L0YA 4PLNA 4IXLA 1KENL 2IPTL 4UU9A 5FP7A 1M2OA 1S3RA 4QQHA 3IRCA 1F90H 2X53S 3FSOA 4APQD 3BAEH 2ZXWB 2QQLH 5H9QA 2OMYA 1S5IL 4LSPH 3C7EA 4MZ3A 4Y19E 3ELAT 2DYPD 4XE9A 2DQIL 2UY7B 1RMU1 4MDJA 3SKMA 4O2CB 4L37B 1J1OH 1NDMA 3QH3B 4CTEA 2WKLA 1QO3A 4H13C 4PG2A 5D6DC 1RPUA 3D4KA 1MCLA 2VERA 3T1FB 1NBQA 4G4FA 4PJ7E 1HXYB 4EBQL 2BTVC 1U5IA 3LD8C 1OZTG 4NUGH 3S35L 3IDAA 4S1QH 3LZRA 1MW3A 4PBWD 3CVHL 3ZKMC 4HVQA 5DJ8B 5L19A 3ITQA 4XHJC 5T3ZE 1FNEA 4J28A 4PCYA 3S5YA 1CVSC 2WWMD 2BVUA 1E4XI 1DCEA 1D5ZB 3A3YB 4Z7UA 2PAEA 1UHVA 3KPLB 2W1WA 5FP4A 1KIRB 1FQ9C 2Q0ZX 5FKPB 2FVNA 1YMHA 3MACL 4RS5C 3H9ZA 4TYUA 3DPBB 1JHLL 3M7FB 3TJHD 5ABJA 3MV7D 5GS0L 1P7KB 5F1OB 5JZGC 4H0IA 1CTMA 3MRJA 1L7LA 4MV2A 1TXKA 5IT2L 4GSUA 1E5BA 4HJ1A 3FQTA 3G5WA 4FX5A 3SQBA 5BS0E 2ZSVB 1RUC1 1M2VB 2WNVA 3D05A 4LLFA 4E27A 2AACA 3LPWA 1YY8A 3OAYK 4X9HA 4FG2A 5LQBL 3NZHL 5LHDA 4KWJA 3RBSA 1YECL 2E6VA 1NPNA 3L5HA 3VYOA 2XPJA 3NDYE 4DVBA 1MZEA 4OI7A 1AIFA 3QWRA 1P9MA 3BXNA 2B1OA 2OZ4H 5C0AB 1GY1A 1OLZA 3QPXH 4NP4H 5IWLC 2PF6A 4AQ8A 1JZ2A 4C4KO 5D1ZC 5EUOA 2WKOF 3TZVD 3NKGA 1PU0A 3UYRH 3I50L 5J37A 3LKSB 1KCRH 4UCFA 5BZZA 4DP1X 3B7MA 4H7MA 4UT9H 1KULA 4OB5L 5CZXC 1O3QA 3IWUA 4K9SA 1I5ZA 4O9EA 1BMV1 1K5MC 4O9GA 1UATA 1EFQA 4M4RB 1A6VL 1OVZA 3N42B 5B1CA 1QJZA 4QGLA 5DJDA 2P24B 4XPFH 4AG4H 3CLWA 1BM7A 3CQFA 4Q4IA 2XTLA 4DGVH 4CDXB 4OZHE 5CNHA 1OAZH 1D9KB 1RMU2 1F56A 4G9FB 3L7FB 4MJIE 4F37F 3IB4A 1BGXH 2BFVL 1ANUA 4MA8L 3QUYC 1UT1A 2Y38A 3CL1A 3J8F1 3MU3A 2G3XA 4HLZH 4HLZG 4BSVA 3IDJA 4X8JB 3EZ8A 4XNAA 3FLPA 2JQMA 4IV3A 1MWOA 5A16A 5C7GA 4JFFB 1J8HA 1E4WH 1NSNH 3P30H 1HXS1 3KYOB 2RDSA 1UXSA 2DQDH 2FBRA 2OS7A 2Z6FA 4G6AD 4YHNA 4MHHG 4D7BA 1R3KB 3K8MA 4HDIB 1TJGH 1B35B 4XTPA 5DXDA 3LS4L 3UJQA 2B8OT 3WEXB 2Q8OA 1XR9A 2VZVA 4PJXE 1MCOL 4X4YA 4LULA 3BMWA 3SEEA 4NUPA 2FGZA 4YGVA 1A9VA 1M71A 2DJSA 1NEZB 3V4PB 2OMXB 5IBTH 3B7SA 4UTAH 2ZTBA 5K9KA 2WOBA 2YY1A 5ETUB 5DRWB 1HS6A 2C3HA 1CXFA 4ZMWA 3GXNA 2W1UA 1EH9A 2EDLA 1FFQA 3HNMA 4FPYA 4XF3A 2ZX3A 4OI2A 4A04A 1ZIBA 1S5HB 3UBXA 1D5RA 4EQ3A 1J05B 4HIXH 4TULL 3WTYA 2AJZA 2D5FA 3T3YA 5DD3L 2H26B 4M6AA 1JHNA 1DQKA 1JFQH 3BKCH 1HLCA 3S34H 4D0BA 3B00A 4R96B 2VAAB 3QQDA 1A7NH 2YC2A 2NX5D 4UDTB 4XVJH 3NV1A 1MFCL 3HNVL 4RAUA 5F39A 3VZJA 3IPBA 3H42L 3RFZC 2W0KA 5FR3A 3VXQA 2XJKA 2P7TB 3FQXB 1XNTA 3MV01 5F2WA 3RKDD 2HT3D 2VMGA 1SVBA 3KCXA 3MUY1 3AMQA 1WCQA 1H0DA 4MDIA 3OLDA 1SYVA 4OCTA 1VFMA 3EW3B 1BSIA 1I3UA 5CB7A 2F8OA 4YFDB 1BBDH 1FMD3 1VRSA 1XF4A 2BSEA 3R7RA 4DS0A 4FNLH 1PZ3A 2PA7A 1N6VA 1EAPB 5HGAA 1F58H 4UMGA 1A9BB 3NZSA 4LLQB 5FZ6A 2WWNA 1CAXA 1L0XA 4PLKC 5DGRA 2BSDA 5HGBB 4EDXA 2A3YA 2F54E 1FNGA 4M1GH 3J2PA 3WV0A 2X4PA 2VXUH 3T0DA 2AI0H 5AZEH 4Q4X3 1A4JB 1C16B 3E6HB 5FKCA 3HBZA 1WFIA 3B9KA 4RGOL 4FZ8L 2MTAA 5KVFH 4BA6A 4FRWA 1XV8A 4QRPA 1KN4L 4LKCA 4YM2A 1SFHA 3EYVB 1SBEA 4KK6D 3RWJB 1ZVSB 2Y0OA 3RG0A 3C7GA 5B39G 3OGSA 4WSKA 1T66C 3KB5A 5GGTA 1ULGA 3HFML 4OLUL 4Y20A 3QA3A 1VBC2 2WO2A 1YDPA 2L0DA 2YLKA 1I1RA 1S9WA 4XBLA 4U1JA 3PQYB 5CBEB 2VGDA 4X7TA 3BISA 2B4CC 4AYBA 2HFGH 1CFQA 2OJ1A 3RPKA 1NLSA 5DZGA 3VBFC 1MSPA 3TNNA 2FDJA 2CR6A 2Y2YA 3GSOB 4L8DA 1UXWA 4Z7WE 5KYUA 4J6RL 3L9RA 4OGYH 4NC1E 4N0FA 2EDNA 2OL3B 1NIBA 4MYEA 4OSUH 4PJBE 4F8TA 5E1AA 2J22A 3SBPA 1L7TH 2HLAB 3CZUA 2V8LA 3CU7A 1R0AL 4PJHA 2VR3A 4MZ2A 5GRJL 5HV4A 2E8ZA 1PVC1 4GFXA 2AJUH 4APQA 1CBVL 1Q8QA 3UJTH 1XRUA 2WXNA 3IZOA 4K7FB 2ZBJA 3I59A 4PY8J 4QGNA 5DVLA 1X9QA 2APSA 4XWGH 4OHVA 2L04A 1RCYA 3ZE0B 5B3SB 1B4TA 3BPOC 3F7PC 3FCTB 3T30A 5DURB 1U12A 2AJZB 4D7PA 2ZEXA 1IQWH 1XZWA 2XQYK 3QIUC 3ARBC 3REVB 5EUKA 3DWTA 1BVKA 4KO7A 1V7NH 1RD6A 4GKNB 2PYFB 4R96A 2YG0A 3ZXEA 4PB9H 4P9HC 4YEFA 3PIGA 5FV2A 4WM7B 3JXSA 3NSXA 4XC1H 1EV11 3I4IA 4LPLA 1KIQB 2OYMA 4NO2B 4AQAB 5I24A 4HD5A 3VGAC 1IO4C 2D03H 3WFCH 3WY1A 2D6PA 1KLGB 4UBGA 3FO1B 3FCGA 5J4MA 2CGNA 2QSTA 3LB6D 2A77H 5FUZH 3ETBJ 4QJ5B 1UD1A 3QI9D 5EBWB 3OPZA 1TZGL 2VC2H 3ZSJA 4XNUL 3KZ8A 4NQEA 3D50A 5K39B 4ELDA 1AXZA 3WV6A 2X09A 1OF3A 3I9GL 3U9PL 1URLA 4JFFA 3BWUC 4KFMA 4GAJH 2Y72A 1Z3RA 1ACZA 2VUOA 1G0XA 1QNZH 4LE4A 5FMOS 2R8SH 3UL4A 2AJXL 4I85A 5DT1L 1VBD3 2NXYB 4WLCA 3JWOC 2F4LA 1GHFH 4B97A 4BA0A 4HG4K 1B6DA 4FQIH 5E51A 1GGUA 3B3BA 4NHKA 1JNJA 4Q6IB 4V2WA 4WO4D 1W2OA 2W65B 1R1A3 4D2NA 4NWVA 4XIKA 2FD6L 3UO8B 4OLUH 5LN4A 5E03A 1SMDA 3FTVA 4HMDA 4ISVA 4Y4KB 4A6SA 1E65A 3B83A 4XJ9A 1MZ5A 2B4KA 5HXVA 2HT4C 1KACB 2ED7A 3SDCD 4FULA 3SHRA 3TWYA 3DO3A 3KGTA 4FGMA 2G5UA 1CJPA 2NCMA 7FABH 3DMMC 3GYRA 3O8XA 4LSQH 5F37A 1BIIA 3E6FB 4TWTA 2WK2A 4Q7DA 2JD9A 4Y1UA 4TUJB 1YEFH 3MYJB 3S5QA 4L1HA 4CCOA 1OB1A 4XCFH 1NL0H 2RA1A 1QQP1 2FBJL 2ENJA 4NQVB 4M0HA 3IFOA 3AGWA 4OV6F 3MA7A 5FCSH 1D5IL 2EEAA 2XNAB 1A7RL 4ERSH 5JOZA 2WNUB 4Y4YA 5C0JB 1HN1A 2ZEYA 3BCFA 4KJQD 5J8OA 1U8CB 3CZFB 3FO9A 3UGGA 5TJWK 1CK0L 4GSDL 5E94A 4PY8I 1LYQA 4ZXBA 1Q8MA 2FEEI 2WP3O 2X4PB 1XIWD 3QFDB 4WU5B 1VRBA 4QB6A 5HHQA 4HZAA 4NO5B 1OPGH 3VKNA 2ZUQC 4HETA 1OF4A 2EDKA 1ZV9A 3OJVC 1POV1 4DH2A 1E4HA 5DHVB 5BVJB 5I5JA 5K69A 2Z31A 4DFIA 3N85L 4MQXC 5LWYH 5HBAA 3HQRA 1PFOA 2RS52 4Y5VB 3O3DA 4AEDA 2WWOA 4QD2E 4N22A 4HS6A 3K46A 5EPAA 5IVNA 4HOOA 5F21B 3I85A 1BPLB 2D7TL 3CMGA 5HDBE 1L7QA 4K1ZA 2ZHLA 2DF3A 1YZZA 2EIBA 1H6YA 2QPEB 5KJ4A 3CSFA 4Y4RA 2JIXB 5ERWA 3GSXA 5LATA 1U3JA 4X4ZA 2OUHA 4O65A 4YGCA 2WBJD 4HQQL 1FUNA 2C1OA 3QQ3A 2XL9A 2AC0A 1GYVA 5FY1A 1ZLVH 1DBNA 3IT8A 1SLUA 1UWEL 3EDDA 3KLDA 3L5XH 5MERB 3U7YH 4EN3D 5CBAB 2AP2A 1YCSA 2P5WA 5KBLA 4KG8A 5BNNC 3NJIA 4X4ME 4IBWA 1S55A 2Y64A 2NX5E 3RSJA 5LWBA 3L7EA 3LKQB 4XCCH 1C5BH 5ADOL 3C5ZA 4Y16A 3WIIH 1YN7A 2F54A 4EVNA 1LU2A 4ONUA 2ZNXA 5HYJD 3S6PA 3GSQB 4FHJA 3WLWD 1G7YA 5I17B 2E53A 2R1WA 3NIGB 1MFUA 1G7LA 5A32A 4HZFA 3B56A 4JAAA 1KGWA 1NJ9A 2QMKA 3ZOAA 5HJGA 3O2WH 4AV4A 1TJIL 4PP2B 1VBE1 5EOQL 2PN5A 2XN1A 4QB1A 1XSKA 2K3TA 3RA7L 3NVCA 3SCMA 5KC6A 3MXVH 2J7MA 3FOLA 2HVBA 4PSPA 3A67L 5HHPA 1RUAH 4OJEH 5C1MB 3P3RA 1WF5A 4PRHD 3EGXA 4Q0UA 5E5MB 3RTQB 4ANXA 2ZG3A 1KXQA 3IFPB 1ZE3H 4GMTH 1BZ9B 3SJVA 1XMWA 4AKOA 4TUKH 3AREB 4ANKA 3UZEC 4G7VH 2YBKA 1MW1A 4PW3A 4XUNA 2V6HA 1AYM2 3FX3A 2P48B 2PP7A 4N2MA 1JK8B 5KUMA 2KZKA 32C2A 4UM8B 5I8CA 1FRGL 3SDDC 1JPGA 5HYIA 3DVNB 3WS6C 3VBOA 1XGTB 1Q4NX 4G83A 3KT4A 2OSLB 3G6AA 5EMYA 2BV4A 4XMXA 1DEEA 5LA2A 4MJID 1PZ8A 3UGFA 2KBGA 5FREA 4OFKA 1FMD2 1ENSA 4JPKH 1JBCA 5DJ0B 1RV6X 1P69B 1DZTA 6FABL 1I4FB 3AP5A 3QJQB 3ZIMA 3PNWA 1Z3GH 4G6FB 2G60L 2WNWA 3BP4A 1MS8A 2W46A 3HRZA 4IESA 3NNJA 1M57B 1APNA 2NY3C 4F9PC 1B0RA 1VLXA 2COVD 3BQUC 1QATA 1K5NB 1POQA 2M1KA 4ELKA 3VFSA 2FO1A 2JI2A 5JZ7D 4RHV1 5MEPB 4QKFA 3L5WA 1OLMA 3VI3B 4CSPA 5GIRA 3BTXA 2BIOA 2H9GB 5IW1B 2AXWA 1RUPH 2TRHA 4FTVD 4QAMB 3V0FA 5JOWA 1XJAA 3GHMA 1ZVSA 3B5LB 4FHBD 1S5IH 2FSDA 3RQ3A 4AAXA 3DJ9A 3BEWA 3CFBB 3I9AA 1LOCA 3UACA 3BPNC 2NRDA 3M45A 4Z8FH 2V7NA 1LE9B 4Y5Z0 3ACLA 4LSTH 4PY7B 5BS0D 3VFWA 3IDGA 4L05A 4QT5A 4LIQH 1NWPA 3L45A 3NRFA 3LSOA 4QRRE 3EH1A 1P7QA 4YSRA 3JTTA 5EN2A 1OP5H 5E4AA 1BK1A 5ERLA 3APMA 5DFAA 3IJSA 3N41F 1SHWA 1OP5K 2ZUTA 1MH5A 2Q9OA 4M00A 1AZUA 4L4VA 5KANG 1FDLL 3CC1A 1UZVA 1G9CA 4XO9A 2YBGA 4JRXB 2WYIA 1KXTA 4ODSL 1PIV2 4X7SH 3M86A 2Q76B 2UUDH 1YNLL 4TQEH 5HHQB 4JFZH 5GRWA 3L9JT 1OSGA 4PCRA 3VDDA 3ZPYA 4JCLA 1NG0A 2IAAC 3PJSA 5DJZB 5T3ZD 2WQWA 3FRPB 1O91A 2V17H 5DAXA 2QQKH 5I1EH 1Q8OA 1IM3A 1E5ZA 2OKXA 2IDTA 2YAPA 4F8AA 1UFUA 4P4KC 3PWVA 3MRMA 3VQ2C 2A70A 3WIHL 2J55A 5D7SL 4IV3B 3BWUF 4L11A 4N7IA 1B0RB 1KYFA 1X9TA 4LSQL 2JXMB 1YLBB 2CO6A 2VXQL 2WFF2 3DOSB 1EV12 4QPIB 2W95A 3REVA 5C0GB 4KMLB 1QWUA 4FQXA 4Q4V1 3E9TA 4KGQA 2UWEB 4OZFG 3VQ1C 3NV2A 3UTTD 2XN9B 2WGXA 1ULCA 2WOYA 3BIWE 1MREH 2KMWA 3EUUA 3T2TA 1IM3B 3WMPA 3CQOA 3KPRB 1V3LA 3N04A 3SC7X 2CRIA 1W90A 3E97A 3R4SA 3UXFA 2XWJB 1KFAL 5DJCA 1RL3A 5A7WA 3RX5A 3TJPA 5KWRA 2XV3A 4YHOL 1A7QL 4GW4B 4LKXA 4X6DB 1GOHA 3KL3A 1MQ8A 1ETJA 4Z07A 5E9DD 3BVWA 1HB2A 2OPWA 2EAAA 1P5UA 4UANA 4PJEE 3VXUD 2WLLA 4QRAA 2FX9L 4Y19A 1ZVHA 4HWNA 2A3WA 4PW9A 3L3GA 4NBXB 5F7EH 1G0YR 4KGLA 4IKIA 2QHRH 4W93A 1GPOH 3Q6FA 1ET7A 1RUJ1 2BOBA 2X6CA 2G4EA 2R061 2YUEA 1LO0L 3SDDD 3THDA 2EDEA 4KOBA 5DHVH 2X4QB 5INCB 1O6SB 4NI6A 5ILTH 3QJTB 2I24N 2CIKA 2A6DB 1DQ1A 3GO1H 5E5MA 5TD4A 4UBDC 5D5MA 5E94B 3RTQA 4JZRA 2GJZA 2BWIA 4MXWA 5T54A 1SZBA 4EN3A 1ML0A 1QPKA 1RUMH 2X9YA 5IJVA 4XOGA 3OC8A 3T2OA 3T2NH 4Y2DB 4ZU7A 3GT6A 4P99A 4WFGD 5I1DB 3WG1A 1LEIA 1CAWA 3H8RA 5E00A 2JKSA 1BVLA 5TDNB 3SE6A 1KRIA 1MFAH 3PAVA 4S1DD 2LLNA 4LSRH 2HWF2 1TTCA 3KHCA 2GQHA 2VE6A 4HALA 5JLZA 3I2KA 2Z91B 1X50A 4QKBA 1D4M3 3H9HB 2XTJD 4KKCD 3F7KA 5TDOA 1HHKA 2OL3H 3K72A 3VSTA 3HBGA 2YOCA 3KPQB 4N8UA 2MEV1 3BGAA 3S0MA 3DX0A 4KJWD 5K9JL 5KHKA 4LHKA 2CCLA 2D4FA 3JTBA 1P2CA 2UWCA 5MHSD 4K5NA 3TL5A 4WFHD 4MJ5B 5D6CA 1L7IH 2OYZA 1OTTC 2HFFB 4LDLB 2FCBA 4NENB 1Q8PA 1R083 2ILLA 5FYLH 1UM4L 2XPGB 3T0XA 1GMEA 3GLEA 4BKLA 3QISA 2X7LB 4DN3L 2FLMA 2ZZUT 1JBJA 2DCJA 1LP9B 3N7LA 3WJJC 1EMTH 2Y9RT 2YRLA 1T0MA 1ND3A 1NUFA 4YSAA 1HHKB 3WVJA 2D3NA 1U8PB 2J1XA 3NG5A 4PREA 3L9YA 1P7QD 4NQSB 4FXLA 1A3ZA 2LUWA 5B39A 4E4ZA 1RK0B 4RGND 2MCPL 5A7BA 4AI7A 3PFUA 2ARJB 3BN3B 4TVSa 4O02B 4WEBL 4XO4A 4BFJA 3BZFB 3AU1B 4HFUL 4WI4A 1LKNA 4DPNA 4UUJB 3WS6A 2DH3A 4KNTA 4F3FA 3QEHB 1UM5L 4E0RA 1O7SA 1RZIA 5I1DA 1A6CA 3D33A 4PY7A 1G9MC 1CESA 4KVNH 4OCWL 4JM2B 4N53A 1QUPA 3CJIB 2WLQA 3VBSC 2R1YB 3NO8A 1LO2H 5A3WA 1I9JH 3POEA 2Y60A 1KB5L 3QJHA 5AKRA 1IS3A 5ACA2 4AW7A 2DYCA 4W4OA 5J48A 1P6AB 4S2HA 1FZMA 3BJ91 1O75A 4FXGC 1SNRA 2ITFA 3LRGA 3T3MB 2DWTA 5E8OB 1CZTA 2G9FA 4PEEA 1FV1B 5FZ7A 4YSOA 1ZBE1 1ASJ1 4EWDA 1MI5D 3U4BL 2P1BA 5EZJA 1DO5A 5IVEA 3MI6A 4UT9A 3CK0H 4HLJA 4Y1AA 2NQDA 1VPHA 3RWFA 2NY5H 3VTMA 1JGVH 3QUML 3EAKA 4S2SA 3QZPA 2CPUA 3Q3GB 5EJ3A 2AAVA 3KPSA 4YOKA 3WFZA 5EEXA 2GU9A 1F4YH 4NBZB 4AL8C 1RSFA 5SWSA 2BXZA 1JPTL 3O0RH 4MAYA 3UBFA 4B9PA 1A1MB 4N0FB 3QW9A 2XACC 3BAKA 4LBEA 2YQ3A 3MIFA 3U7WH 1EPWA 1DN0B 3WF3A 4LT7A 4I2XE 3QJVB 2MMXA 4TSAH 5EZJB 3P5BA 4KJPD 4LQRA 2N7SA 1IKNA 1EZUA 4AI1A 5D93B 1FFTB 1KGCE 1L7TL 4KDTA 4RAUB 1W8FA 4LBJA 2IAMA 1TZIB 3DRTB 3GKZA 4XOCA 5AOIA 2WZPD 3RHWF 4K9EL 1NAMH 3DO7A 2EE9A 1SOKA 2ZGUA 4U1IA 4IRSC 2JKXA 4YMPA 1BYNA 3ZIWA 5AW4B 3WEMA 1UX6A 4HSAC 1AZBA 5JZ7C 1BFVL 2WBKA 4PFEA 3D25B 5DLMH 5ANME 5DYOB 1J5HA 1CGSH 3ETSA 4B0MB 1CFMA 5IJCC 2EH7H 6CGTA 4PRHB 3LDKA 2AJ3B 3KHBA 4UIMB 4A66A 3RUGE 1DZ0A 1M3IA 4P5KB 3FFDA 1QR4A 2NY6B 3L3KB 1FZOB 2WL1A 3NCXA 2OMXA 4K3DH 4RGMB 4G8GB 3FQRA 1OI6A 3BD4A 1NFIB 1XYOA 3LD8A 1UM6L 4L2LA 3RB7A 5HGBA 2V4AA 3QCVL 3ET9F 3OGVA 2IPTH 3ULSA 3OD0A 2O0OA 5EBWA 1FI2A 3DHMA 1DQ2A 5FYKL 2EIZA 3V8CA 3PIQA 4YZ2A 2WPGA 5EO9B 4PJXF 5JMCA 3NCJL 3BZFA 1UG9A 3O2VL 3HJ0A 3IT8D 3RY5A 1XQ4A 2ZX4A 3ZXLA 1BQLH 2ZMLA 1S78D 4UB0L 4ORFA 4FQCH 4UFMA 3RYKA 2MNJB 4CDQC 3CZSA 4P3WA 1EFXD 1U92B 2FWUA 2E5EA 3QCTL 2A6XA 4PLMA 1TKWB 1BHGA 4XN5A 2DDUA 1HQ4A 5FV1L 4UILL 1E7VA 2V4LA 3G5XB 3Q5YA 1D5BA 1BA9A 2MTPA 2O6FA 3WUWG 1AUYA 4X42A 3ARGD 2GC0A 4EJRA 5BJTA 2XY2A 1A7QH 4P9IA 1Q9KB 2OTUB 3DRQA 4MQTB 5TF1L 3LEMA 3ORJA 4M7JH 5BNPB 2FBEA 2E26A 3K72B 1TITA 3MCLH 4A6OA 4AI9A 5C9AA 5CJOH 5FF6A 2J44A 4PMFA 5ANQA 2DBLH 2VM4A 2X4SA 3FQ1A 4TOYH 2XBO2 2ADGB 4HJEA 5HY9B 5E1AB 1PO12 2VQ0A 1QZNA 2JIJA 1LWHA 1IKFL 2R1BA 4X6QB 2Z92A 4PJBA 3MRDA 3TB0A 1MF2H 3ML8A 2CIIB 1KMGA 4XCNA 5EP9A 3QXUA 4YEEA 4KXZH 4ADGA 4QUOA 4META 2AAAA 4O2EB 3P4MB 4XFHA 3I75B 4YXKL 2QPFA 2IH3A 1LEKB 5F9TA 1JOIA 4ABUA 1R3LB 4P5RA 4CADB 4HOZA 4NO0D 3T0EC 1ASJ2 1E5CA 2GSGA 5LBSL 1D3CA 5FQ0B 1A7BA 5A7NA 3KQ4B 4LF3A 4OZGE 3MIDA 2OZJA 3V4PH 1RPQA 2FBJH 3DGCR 5CINH 1SN2A 1M7IA 3NH7H 5GZNC 1NLQA 4HEPG 1QLRA 2XXZA 5DVMA 3QUYA 1OALA 3UG5A 3WKYA 4EO5A 4U1IB 4M61A 2UUDK 4DESA 2EVXA 2A6IA 3ETBF 4HQQH 4CCKA 2VIRB 4FNQA 2O61A 1DGRN 1MQTC 3O8XD 1UUSA 4YW7A 3KXFE 3RWKX 1XBRA 4XNXH 3RL1B 4IGBC 1Q72H 5E2VH 1OAKH 4JY4A 4JDZB 3WX5A 5C3QA 4NFCA 1NA1B 4B7LA 5I71C 4AC4A 2PLTA 3N55A 2IDQA 2RIKA 4TSCH 4AYFB 4CDWA 1OXYA 5SV4A 2IALB 3JWNG 3JWNH 2DJ4A 4GJZA 1HXYA 4QYAA 5LWYL 1AGEB 3T4AB 3EOTL 4PVMA 1D7CA 1EYBA 4Y22B 1N0XH 4DP5X 4KX7A 2JDUA 4LVHC 3VZKA 2R49A 1EVUA 1X7SA 2QQMA 1BVNT 3MCKB 4JRWA 1ZHLB 1C5HA 1ORQA 3G5VA 4YGEA 3FT3B 3HT1A 3BP5A 5AVPA 5FYSA 1QR1A 2VLKB 5CBLA 2FEDD 2AENA 1A22B 2ENQA 3GTVA 3MDJA 2JIXD 5HGDA 2OZ4L 3AAZB 4TS6A 3CSPA 2ZJCA 1SOSA 1U8QA 3IKWA 2J1ZA 1YIFA 3GXMA 1Z2KA 4WDIA 1HYSC 2YROA 4XP1L 3AP7A 4GB33 5HHNB 4ZS7L 1NKOA 3CXHJ 3IFLH 1XZ0A 3D34A 4GAZA 2BWAA 1N68A 4W4NA 4LO9A 1GFF2 2W60B 4HVOA 2AV7A 3EHBB 1XL4A 4X6DE 1C5BL 3IKKA 5A7EA 1PPIA 4Y5SA 1UZWA 1BZ7A 3EADA 3MRLB 3VL8A 3S57A 2VZUA 4F7ZA 4B5EA 3TS8A 1E5UI 2MNUA 3D9AH 3VWKC 4J39A 2P5EA 1KIQA 3P1VA 5BOPA 1JMZA 1XSJA 4M4PA 3HR5A 4J1UB 1SF5A 1OTSD 1INQA 4WJKB 3VFMB 5E1QA 4M5TA 3KPMA 4JDVA 4JPVL 2BVVA 3BO8A 5TPWH 1J1PH 3UH8A 3VDBA 1OCWH 2MOVA 4KK9C 1N8ZA 1HKDA 1IIKA 3GNEA 1BOGB 1LK3H 4WTZA 3CVHH 2IOIA 5AALA 3NUKA 1LTEA 1XE7A 2D7PA 2F8VA 5D6CB 2D43A 4Z2WA 2WLZA 2BS8A 5F1SA 5D72H 4KPHH 2PHDA 5F1IA 1K12A 1OOPA 3RS6A 1UXXX 1EBPA 4PJFB 1MW2A 2VDML 3FW6A 4KJYA 3S3CB 3QIWC 1P4IL 2VDLB 5D55A 3GC3A 4QHMB 5LB6A 5DZAA 4IRZA 1LK2B 2WXPA 1ZLWH 1CGYA 2O5NA 1PBYA 3ES4A 1P84J 4IEWA 2V5TA 1NAML 3E0GA 2AK1L 4PI2A 1RHHB 1KJ2L 2FK9A 2GTWB 4HJTA 3L3IB 1EEYB 3L4VA 1MRDL 3RWFB 2Q87A 4L8SC 4X9YA 4E36A 2EF6A 3LCPA 5C0ND 5FGRA 4GRLD 3HZMB 3QIBC 4FDWA 3FMGL 1NBVH 2H47C 5E95B 2ISDA 2DQHH 1U91A 2WIIB 3S3JA 1YNTA 4ALAL 1AIFB 4YSSA 5I0ZA 4PP1D 3A6CL 1A3LH 1LNUB 3HNSL 1NZRA 2FWOB 3VBRC 3WG4A 3NABH 4HCRL 2VZPA 1W04A 1FT9A 1AZDA 2HEWF 3O41A 1QEWB 4N5EC 5IB3A 5FIEA 3MJ8B 1VIWA 3P4NA 4PRIE 4FPFA 3FPYA 4WNQB 1A5FL 4A6YH 1VSCA 1SXAA 2Y2TA 1I75A 2Z7WA 4AY0A 5E8DL 1OD3A 1TYRA 1E4JA 4FFZA 1TENA 4BQCA 4I48B 4UV4L 3BRFA 4LQFL 1EQWA 1JPST 2I9LB 4L3EA 12E8L 2RMU1 2D0HA 3DF0A 2X1WL 4N2EA 1HSAA 4Q0VA 1LO2L 1OW0A 5C0AD 4QGYA 3RY6C 5B3NA 1JYNA 2CU5A 3THPA 3DV4A 3MKKA 4LCVA 1FVCB 4PR5A 1DGLA 4DRRA 1YUDA 4FFYH 3W21A 1CF8L 2OZ6A 2E56A 1QTYT 1V6NA 1KOAA 4OZIF 3CXDH 3QS3A 4LIVA 2YD9A 3L3DB 2ZCWA 5TGBA 1OAUL 5HHPB 3MNWB 1O3RA 4N4YB 4K07A 1T7WA 2RH0A 4N0CD 4RMSA 3NCYS 5IFJB 1W03A 2Y0IA 1WZ1L 1BG1A 1A1MA 4LO6B 4NQCA 3E2HC 2WLNA 3FU3A 3SGDI 3CK0L 3MJ9A 2NX5A 5T55A 1TQCB 1CC3A 4HUWB 1TE1B 1XB3A 2A6KA 4NZUH 4RRPA 1EUTA 3MA9L 1DEDA 1CLZL 5CNAA 1MJUL 2JDNA 2P3KA 2LE9A 5F7HA 2XZZA 5A6YA 5DTFA 4LLVB 2PELA 2P5ED 3UC0H 4OIAA 4CN1A 1U92A 1HW5A 3C60A 3T4VA 1UF2C 1OFNA 2D73A 5TQ0L 5CR1A 1AR83 3UBXB 3VHOA 4FAGA 3C6SA 4N6RB 3GRGA 4LOVA 5HPMB 3GMOA 2GIMA 1KJMB 4PRIA 4I0KA 1DP0A 2HKHH 1S0EA 3IPEA 1VFAA 4MXWL 1Y6KR 4N2BA 5DQJB 1H2KA 2L9LA 1O5UA 4HJ0C 3QB7C 1FORL 5LBSH 2PPFA 2DYSB 2WNKA 5BNOB 4AQTA 35C8L 2FNWA 2R0WL 3LD8B 4KUCF 4QRFA 3B8SA 3F7RA 2XA8H 2P5BA 3C2SA 3EFDH 3BU0A 5GGRY 3HWJA 1RUJ2 3VG0L 1LJ7A 1TEIA 5FLIA 2ZOUA 3K6DA 3RKDC 1CICD 4M1CC 3RNQA 4J2XA 1I9RA 4FP2A 3FUKA 4RH4A 4Z3GA 1B09A 3L2YA 1NLRA 3P2BA 2E46A 1UB5B 2WWKO 1QSFB 3ZE1B 1SJMA 4JB9L 4ZAKA 1XF3A 3KPSD 2F19H 4DGYL 5IFAL 4OCMC 4CCMA 4KO5A 4Z3JA 2OI9C 5BV7C 3T0ED 3POWA 5DWPA 1ZXKA 2AEYA 3RI9A 5FPAA 5ANHA 1IC0A 1HRI3 1MI5A 4MHUA 4G5ZH 4FQ2H 3G7TA 5FZAA 1ROWA 1NGZA 1EXUB 4YW1A 1LO5B 5L2JA 4OY9A 3R8BB 1SDDA 4P8QA 1JNHA 3D87B 4GAJL 2VL5B 1CT8B 5GPRA 1UPIA 5C5UA 3K6FA 4OFYD 4I89A 4MCYA 1Q1JH 3FZ3A 4KBBA 2GHWB 3ACFA 1YC7A 3U11A 4NJAL 5HYQB 5A3NA 4AEIH 3HW7A 5TDPA 4ACPA 4Q56A 3WJMB 5AAMA 1PG7W 4R7NB 4G7YL 5D1ZB 3D2UB 4WFHE 4WEUD 4Q9QH 4KJYB 1AL23 4MGKE 1DVFD 2Y25A 1OUSA 4ZMNA 1PO11 4FLHA 4OVUA 3SD5A 1LO5A 4XFCA 2XC8A 5D1QB 3WHXA 1E5AA 4I3RH 5EZWA 3PUSA 1IBDA 4CCJA 4HK3N 2YKKA 1AR63 4Z0BH 3GIVB 4A6YA 3KXFD 1K4CB 2GC4C 4LLMB 3S36H 5IFHL 2A71A 4COVA 4I5BB 3SDAA 4EZHA 4OGYL 3MNVB 1BG9A 3CUPA 2J1WA 4XMPH 5FYLL 4J3UA 4WJ5B 5IG7A 1UWYA 5I1KL 2EALA 1R0AH 1ODNA 4DSYA 4RD7A 1URXA 1L0PA 1J0ZA 5DR5H 4PJ8C 4FABH 5AVTB 4NKMB 4AGVA 1WMEA 1B35C 5IHUH 2ZWNA 5SWZA 3WF0A 4WWOA 3NSDA 1JDCA 1SXZA 4HCRA 4OZOA 3HG1E 4K0OA 1IBGL 4XDOA 3IDGB 4K4KA 3SKJL 4UFHA 4GI9A 4GEJA 3BKCL 4ZXBC 2RR12 4U0RB 3ILPA 5C7ZA 3TLRA 2V7HB 3C8XA 3POIA 3TN93 2ITEA 3US0A 1HWWA 2B5HA 3V79C 4YO0B 2VDOB 4AQZA 2PW2B 5BO1H 5J13B 5ICXB 3H0TA 4NIYE 3MPCA 4ONHA 1KYUA 3FT3A 3QJFB 1VPOH 1O8PA 2XG3A 4UTAL 5EU7C 4FOYA 1MCJA 4UOZA 1QJY3 3EYFB 3D7PA 5L88L 2V2WA 4FQLH 2C9KA 1P0SE 3AWFA 3MUGB 1PLAA 5EBLB 3ETTA 5JDSA 3V5KB 2FZ2A 1KB5B 1T1XA 4UNVA 2EE2A 1SJEB 3ZTDC 4WJG3 1F58L 1XSIA 2CMRL 3AZVA 2XOTA 4I77L 5D7EA 5M7QA 5KTEL 4JM2F 1WE5A 4H40A 1WQVT 3H42H 4MAYB 4FT8A 3LNGA 2NYYD 4MJIB 2NY2B 1JNNH 2GK0A 1I8KA 2VLLB 4W9JC 1RZ7H 2FJGB 3Q2CA 3L3JB 4HK0A 2WZPA 4WWID 4MB3A 1U5ZA 1K5WA 3JUUA 1MEXH 2DDQH 4RIRB 1D5BB 3P0YH 4JGZB 1MHPL 2ZX5A 3APNA 5M94B 1WA6X 1MFVA 3P9MB 1UY2A 4MMYA 1C1EL 1MJJA 1ZD6A 4FFTA 5JPNB 2MOQA 5E6YA 4L8CA 3CDCA 4X5WB 4EN6B 3BO8B 4HYTB 1Q9LB 3VD5A 5FC9A 1BW8A 3AW5A 3FB5B 3HG3A 4FNUA 4HUXA 2VITA 4WQOA 4B9GA 3GZUC 1IG0A 5AFEA 1HZKA 4FO9A 2YRZA 2QVTA 3U1SH 3VCLA 2HWD2 2BVOA 1E2VA 1O4ZA 2VLLA 1YNAA 2XNAA 3OMZA 3UX9B 5I1HL 5IVXA 2DUOA 3GZTB 3H1YA 4TXVB 3M88A 3TBWB 3ZX1A 2XHKA 1ZLUK 5JTWA 1NL0L 3GJAA 3BKYL 5DZOA 4NX0A 2OQJB 2W3JA 4M7JL 2DJMA 1QJX3 2WNEA 3VBFB 3I75A 2Y26A 1ZVYA 2IQ9L 4OF5A 1PYWA 1EEYA 1R17A 1VGKB 4R0LA 5AOZA 5EU7E 1RHHA 2DBNA 3AM2A 1N7ML 3OZLA 5D2LF 3H50A 1UA6H 3PHMA 3I2CH 3GMLB 3GMRA 4LKFA 4BQBA 4CP2A 4CRQA 2HKHL 1WD3A 4YWAA 2EE0A 2G4IA 1X4XA 3ZTCC 4WVVA 4IOSD 5A6IA 1XCTA 5C0BE 4YDVB 1AR72 1QW9A 1NIEA 5D2AA 4A2FA 1P9MC 3P11L 4YR6B 1MWAH 1R3IL 2A6KB 3AWGA 3M3IA 1F8VA 3DXAB 3CVDA 4NQEE 3RUGF 1DVZA 3V6ZA 4LSSL 3N5AA 4JZJC 3GM0A 2UXTA 1JGDA 4X6DF 1UPSA 3ENEA 4HUCA 2COQA 2F5AL 4XBPA 4P4KD 3QIUB 2J21A 2X2IA 2BW5A 4XN8A 1ZK9A 2ZEZA 3DV6B 4G72B 4WM7C 4MJJA 3QUZD 1BAWA 1KJ2A 1E50A 1VENA 5C08B 4NRQA 2HXAA 3MLSL 4WCYL 4BH7B 2A6YA 4FPHA 4GWJA 4D7TA 5I19H 2YXWA 1NUGA 1JZ4A 2OQ7A 4N90A 2G9ZA 4BRVA 5J11C 3F2LA 3AQZA 5DG2A 4AG4A 5TTRA 1V9U1 3U4EA 3EYQD 3E6CC 1VCBC 1DZRA 5K9KB 2XKUA 1SLXA 5G2NA 1RJYB 1EDYA 5GGSB 4JLRA 5DDHB 4ZFOB 1N5AB 4GKSA 4I1RA 4AW4A 1R1CA 1KCUL 1MCPH 4GSXA 5GS3A 4YHZL 3O9WC 1PMJX 1AX0A 2Y6TE 1I1AC 2AW2A 2W91A 3BH8A 2ERJC 4UIMA 2AR6A 1KEGL 1HCVA 2APXA 3HS0A 2E9IA 2QSQA 5FY5A 4NOBA 1ZGLP 4FFHA 4IBVA 4AI3A 2YKLH 5A3UA 1OAXH 1QHQA 1YPZA 2DMGA 3OCPA 4Q9QL 1J9CT 2A9NL 2WYHA 4GH4B 2OUJA 2IG2L 5CIRA 2L7UA 1MRFL 1CFNB 4FQIL 5FECA 2NY3D 2WCSA 1OUXA 4FNSA 5K93A 1OA2A 4KH2A 3HE7D 1RJZB 4O5LH 1J1TA 2WZAA 3H53A 4U1NA 5ISLA 1VJSA 4ZSOB 3I6GA 4UM9A 4C83A 2HUEA 1Z0NA 5IIEB 1HDMB 4ELMB 3UO1L 2AV1B 5B8CB 5C0CA 3QUZB 4Y4KD 4C91A 3I6LE 2ZOKA 2A9AA 3TIEA 4NNXA 1I82A 1XHHA 1LMKA 3EG9B 4HMCA 4ZT1A 1KITA 2BRQA 3CSTA 1TME2 1I8LA 2QR0B 2ORXA 1IAKA 4K5LA 5BXFB 1RUKL 4JRYA 1GGCH 4I9WE 1TNFA 4BH9A 1BEV3 2Z2SB 2YC4A 1W6QB 3K1KC 1MWAB 1XF3B 1AHWC 3HE7A 2VERN 5JORA 1AGDB 2GTZB 2WNUC 4K1YA 1I7TA 1EXHA 2C9QA 4PGDA 5IK5A 4G3YH 1ZT7B 2BLFA 4AXWB 2VNOA 3BH8B 1MLBB 3HG1A 1ECZA 3HI5H 2VNRA 5F3HB 4LXLA 2DL9A 1XXFC 2UZYA 5EU6A 3VI3F 2YGOA 4MAZA 1PKQE 2YPKB 3UTTA 4EJ1C 1POV0 4Z7UE 3KYMB 1BQHB 5FY8A 5GGQL 2G0KA 1M6OB 3USUA 4LAJH 1IBBA 3VGIA 3O3EB 5MEQB 1HCZA 3HMWL 5KVMC 4KQ3H 2CK2A 4CP9B 4BH7A 1EEZA 1L4IA 5FYKD 1JDDA 1E4KA 4GSRA 1K5MA 2YZ4A 1NCRB 1WZLA 1P7QB 5EN2B 2VLKE 1F18A 3T0BA 4DP8X 3ZFEA 3QORB 4P2RB 1EGJA 4X5QA 4J3VA 4KKPA 1LO0H 4WM7A 1PCXA 2R4SH 3MGTB 5IB5B 2XG5A 3N85H 5HYEA 4J1WA 1G9AA 4UINL 2YA0A 4NFBA 3POSA 5HYSB 4KDWA 2WABA 1BLNB 2X4TB 5GGUB 4N1EA 4OHWA 4W65A 2FQGA 1KCLA 1ETA1 4LCCA 3TT1L 1NBYB 1DQQB 3CXFA 1AGBB 2WW8A 2WFF3 5C8CB 5JNYA 2VCBA 2IG2H 5JOPD 5F6HJ 3PL6C 4ONGL 4PTUA 5E8DH 5CJXA 3QORA 4P2RA 1ZHKB 4QRUB 4NIIA 4IE5A 1KGXA 3HLKA 3BFQG 4L8DB 3WNPA 2JV6A 1MDAA 4NQDA 3KZ4C 1ORSB 1C5CH 2ZXGA 4IGQA 4JK0D 5AVRB 1F8TH 4GLRI 1C8M1 1ZV2A 3U0PA 1I9IL 3VJ6A 4QX2A 3TO4D 3FOMA 2ALAA 2ZP9A 2BNQE 2GK2A 5C9KA 4DUXA 5CLTA 4FTVA 1AYN1 3OPTA 2KL6A 4RRPM 1BJQA 2FIRT 1ICTA 1KD7A 3EFFA 1WWWX 3FT4B 1E30A 3NRQA 2J20A 4YWGL 2RVAA 3RTLA 3U07A 3DXUA 3NNFA 4YZFF 1F00I 1SLCA 4HA1A 5C6TL 4CC0A 2B7DT 3MCG1 4IIQA 2DCTA 5EZOL 5ADPH 4XN4A 2V7HA 4OJYA 3TC9A 3ZE2B 1JG9A 3SDCA 5I75C 2BOIA 2K8QA 2OMTB 4B3NA 32C2B 2R56L 4UM8A 3TEZA 4P9XA 4JG0L 2PYFA 4IU2A 1J5IA 2VLJD 3AREC 3RAJH 4Q2ZA 3DHPA 1FWXA 3M1OA 5DDHA 3ZTNH 1P5UB 1S8DA 3R1GL 4G8FB 4X5LA 4ZS3A 5D1XC 3LN9A 1QMJA 1JV2B 4N3UA 3CHRA 1J0IA 2E8YA 2HLEA 1E40A 1K6QH 2VSCA 2HWB1 4QLWA 2FE0A 2FT6A 4OGXL 3HAEH 5BPPA 5IHWA 1ULFA 2X88A 1Z6JT 4FCHA 3RDTB 4OCRL 4PTUB 4DAGH 5E2TL 3MIGA 1UB6A 3E3QE 2XETA 1FRGH 3RWEB 3QFGA 3NSFA 1GS6X 4QQ2A 2E3VA 1NANH 4DKEH 1EAJA 4AT6B 1HHGA 1R3JA 2R0WH 1CU4L 2KPWA 5G4MA 4DK6A 1OC1A 2FMYA 4AFBA 5K9YA 2O5XH 3CSGA 1SDYA 2PHUA 4JCWA 4LARH 3QI9A 4KITB 1CG9A 2E27H 2H0EA 4AZ8B 1ITCA 2NXZB 1CFQB 5IT6A 1DHKB 3SH5A 2NYYA 4Q6IA 4MZIA 1FJ1B 4RLDA 1ZANL 4A2MA 4J12A 1P8JA 1JWUB 4XR8C 4AJ0A 1A66A 3OY8A 2PCXA 1US2A 5T8IA 2LW8A 4H26A 5TDOB 3QYCA 5CHNB 3M1BB 2RAMA 4NDMA 5C33A 2BP8A 2F17A 4Z92B 4P0DA 3V95A 4BKSC 2K6ZA 5EC2A 1RUOA 3DUSA 3VZLA 5CGBA 3RZHA 1XBDA 3NP4A 4MGIE 2VZ3A 1WFOA 1ND0A 4YSUA 2K3HA 1RIVL 1TTAA 1ZSHA 3NIDF 3LRSB 1FDLH 1VACB 3OMIB 4KXBA 2ITCB 4MQ7A 3PRZA 4FNLL 1MH5B 3LRKA 5L8JB 2WC7A 3E1F1 3EDKA 2N01B 3LSEA 3AKQA 4X80L 5HVFB 4XQWA 3WN6A 1JZIA 2EZ0D 4QMEA 5JOFB 2F2HA 3C12A 4PREB 3BH9B 1FI8C 4LHUG 5D1XE 1FYTB 4A7QA 4URKA 1AAJA 2Q3AA 2X4OB 5I1JH 3ULUC 1D0GA 1J8HB 1E43A 2ZG2A 2NMOA 2GN3A 2EH7L 1NGYB 1OGPA 1XO8A 1YEEH 4LLMA 5EF3A 2XV0A 4KKBD 1H9VA 2PXYC 4OGAC 3VFTA 1ZBE2 5C09A 5AYTA 2C9VA 4E9LA 3CBKB 4GI8A 4LK4A 3AVSA 1W6WA 2J6EH 1J86A 1ES0A 2C7FA 3OXSA 3I2CL 2BRRH 1S7RB 5SWQB 1RTVA 5A6MA 4YDZA 3GZEA 3HVDA 1J8KA 1QSFE 2DD8H 5E24E 3AFLA 4ECNA 1S0CA 4U4BA 1YEHL 4N26A 3MUZ1 4E9VA 1DLHB 1CPMA 4X0KA 2F08A 1QBLH 3HI1B 1P4BL 1J7VR 2ODHA 1XAUA 1NCOA 2WIIA 1NEUA 1XWVA 2DQIH 4QRPD 4YXKH 1WD9A 5IVXE 4CNIA 2WZPP 4MH0E 2Q1MA 5J1XA 4Q4Y3 2OBGA 3V0BB 5T1DL 1QBBA 1U95A 2NW3A 3TVMA 1K45A 4MVBC 3V7AG 2DFBA 4TSBL 1ZLEA 3FHEA 5AOKA 1JYXA 4NKQB 1MCQA 1G5AA 4CP1A 3B5GA 5G55A 3O3AB 2MPVA 4OZGF 3RVXC 5JUEL 4DQOL 3V2AR 1CQ9A 3BOWA 3UV9A 1R3KA 3VXSA 5BNXD 3AC0A 5EU5B 5BV6A 2DWSA 3BSZA 4OZHA 2HX9A 2ZKMX 4JG1H 1FOD1 1NKGA 3V6OE 5KOMC 4AMWA 2KZWA 4A42A 3Q6FB 4XMLH 1YRZA 2ROYA 5CWSA 4AEHL 5AKSA 5DZ9A 2CRYA 5BZDA 1WLDA 4PB9L 3KDMB 5I6XC 1CR9L 4G71B 4GP5B 3MZGB 1ZBA3 2K0GA 2B2XL 3M8LA 5DSCB 1UURA 2BXYA 3NZHH 4FJYA 3MNWA 1MCHA 4ETYA 1MEC2 3BPZA 3ABMB 4R9AA 1IC7H 3NTCH 4QXBA 3PDDA 4JL2A 1X4YA 3KCWA 3V6FB 1C9SA 1N2RA 1PM7A 3ZIXA 1AHWA 1QFWI 1WZAA 3VU1A 3Q5OA 2PWFA 5FJHA 2BC4A 5DK3A 2J1SA 4LL4A 3IAPA 3DVIA 4PIXA 3HZYA 4HV8B 1XEUA 5FPZA 4Y2DC 2YFZA 3UTZB 5C9AB 4GP8B 4LRIA 3VL9A 4CPBA 4QHZA 5AFAA 4ENED 1MCNA 3BSZH 4U33A 2WO3A 4CVZB 2NLJB 3OYWB 2IWGA 4A37A 2DWEB 5AUMB 3IXAB 2NR6D 1NAEA 2UWEE 3J7HA 4FQPA 2FH6A 1UM4H 4NLAA 5GIRB 3WF1A 2HP4A 2QPSA 2VRAA 5CEZH 3PL6D 5FW7A 3SPIA 4WV8A 2YU1A 4JRYB 3FU7A 4HIJB 4IDLA 2AEQL 4JPSA 1WIUA 4MS8D 4L23A 4Y1AE 2YMZA 4LRNL 2CH8A 4G9DB 3N0PB 2XX1A 4N0CC 2GW5A 4NOFA 3VXSE 2E7HA 4B0MM 3AS3A 3PE9A 2J1TA 5IUSA 3ZHKA 2IXHA 3TBDA 4ZUTA 1SVCP 2PW1B 1B9KA 4CVZA 3GBGA 2CDGA 1O9WA 3PABA 4XNBA 1RUG3 4Y5XA 3DIVA 4PGCB 1J9RA 1WA1X 3GB7B 3L2LA 4HFUH 2H32B 4I4WA 4N8CH 3PUHA 1V05A 3ILDA 2O14A 1YRKA 1G7IB 2WINB 1W6PA 2DQCH 1U8KB 2XBTA 3HI5L 1SM3L 1HOCB 5E23A 3VXTA 4UT9L 1NC2A 4L3EE 3DVNA 3S88H 3OGOE 1H30A 2JLLA 4X7TB 3BCDA 1QJX2 4NIAA 4AVCA 4NQUA 1BP3B 3QNXB 2YD7A 4JM2C 1AR92 4DW2L 1MJJB 3SDAB 3QUGA 4PJAA 3VXOB 3KS0H 2PXJA 3QJRB 5TE6H 5FYMA 1MEXL 2DDQL 3HOGA 4JGNA 5DRNB 2IVIB 3WO4B 3PAZA 5E56A 1QO3B 1F3JA 1JP5A 5MI0C 4P2YA 4U6XB 3QUYD 1YEJH 5IBUG 3H42B 4JKLA 2ZUUA 1XPWA 2F7OA 1EHLH 1Y1DA 4FG6C 1CFSB 3WD5H 5C0JA 4LTAA 1IFRA 3OX8A 4R90L 3D2UD 1KB5H 4YHMH 4C47A 3AUWB 3S34L 4FN0A 1PGW1 1X82A 1B0GA 4L3FA 4IBUA 4G1MB 4OD2A 4Z7NF 2HX8A 1D5MA 3IE9A 3PVEA 1M1SA 2LV4A 2VAUA 2X4NA 3C6SB 3W37A 1X9PA 5KAQF 5D71H 1KBVA 1OA3A 1WH0A 3HMXA 2JWYA 1FGVL 3M4FA 4IE0A 1M05B 1XNAA 1BF2A 1O7VA 3U4BH 3UTPD 3UTSA 4DP2X 3IDXH 3C7HA 3HAEB 2E4FA 4Q4V2 1PLCA 2ICEC 2P42B 4K23L 4BIOA 3O0LA 3U6RA 2A1WH 3PWVB 4PV8B 2GG1A 1Q94B 2AI0L 3UBHA 3LMJL 2X3BA 1TJGL 4LO8A 4N9HA 5C8WA 2VMCA 4IE6A 4AVSA 4H1LB 4YR6A 3LWCA 2DWEA 5AUMA 1WW5A 2I85A 4XTRC 3N40F 2OCCB 5ESQA 2R83A 4K20A 3HPNA 1QLEH 3X1NA 2PWDA 3U9WA 4HKBA 1CZVA 2E9JA 2ZGTA 4Q4W2 2JNZA 4BHUI 5KJRH 1JS4A 1MWAL 1R3IH 3KBPA 1NOAA 5LGKA 4KKNA 2N1TE 3RZCD 2CWSA 4WW2A 1W16A 2V9RA 1HHIA 5FYCA 2EQDA 3DL3A 4XXAA 3QFJA 1HHJA 4P59H 4LKSA 1J58A 4YSFA 2DH2A 1MS5A 5E9DB 4GRWH 1LU1A 4WTZG 2XUEA 4M3CE 2W9EL 4QQOA 3T3PF 2BU9A 1YMMB 3VBOC 2LGNA 1BMWA 1EA9C 2VN7A 3ZYPA 3NA4A 2G5BB 3PWLA 3DNKA 4QYOA 5FHAH 3V9CA 4W6XA 1GTFA 2BIHA 4AI2A 4YFLF 5KG9B 2YAHA 4I4WB 4XVJL 1N1TA 3ARBA 1KF9B 3P40A 4P5TA 5CU5A 5EA0H 3VI4E 3B3IA 1J8RA 4TN9A 1E8WA 2AV7B 2GEEA 2V5MA 1K6QL 3OF6A 5BVPH 4X99A 5JHLH 1FMD1 2NY6D 2YK1L 2XXMB 4HWBH 5D7JA 4DJMA 1BEYL 2QQKA 2XR4A 3LQCA 4IV1A 4P57A 4ZW7A 4B7IA 3AK0A 1AHSA 3I2HA 3WFBH 5FUPA 1B4LA 3TVMC 2BHUA 3V9EA 1TZ8A 2Q10A 5I76B 4RMQA 5DRZB 1FFPB 2OK0H 1JWUA 1HI6B 3WOGA 2PPEA 4JY6B 4BZ4A 1ONQA 4Q8KA 1EHLL 3DIDA 1DN2A 2AMGA 2ZOLB 3WUWB 2NLJA 3B37A 1BBT3 2OXBA 4NQQA 4PCTA 4RAHA 3OYWA 4A2LA 4XBNA 1WVZA 2GJPA 3FU6A 1EWHA 3I02A 3U1PA 4YS4A 5LGJB 4I0AA 4XVHA 2UXVA 3CVHB 1XTMA 1NGPH 4MNQD 4PWGA 1CGTA 4K94H 2IUWA 2R072 3IN9A 1DBBH 1SXSA 2WUBL 3JTSB 3VKOA 1UIJA 3CCHA 4XNMA 1B90A 1UADC 4TF4A 1CIYA 3TNNB 2XONA 5T3NA 2E9BA 5AAMC 4RGAA 1CFVH 4I3SH 4JRLA 3W2DL 3MRNB 4JGYB 4XJ8A 1ZREA 5EFIA 2EIKB 3HAEG 5KANI 1RUH1 1MG3C 1N59B 2UURA 2VITB 3AYCA 2YV8A 3UADA 4NRXB 4D0BB 1AQDB 2A7BA 1RLBA 3WG3A 1M7UA 3RGHA 2BFUL 5FXZA 1MFBL 5GGRB 1CE1H 1NGYA 3BWAB 5C0IA 3HC0A 3NA9H 1AKPA 4YNYA 3ZKNC 3ZPOA 2WSKA 1PSKH 2Z4FA 4XMTA 1RUKH 3L3JA 2UXFA 3MAWA 2PCFA 2JE8A 4JQVA 5IMMB 1GZHA 4KWUA 2MWCA 4BMBA 4OCXH 1MCCA 4X6DA 1EAH1 1MCDA 4NJAH 1NBZB 3WNNA 2WWKT 1N1SA 3IMNA 1ROCA 1NCCH 4UQ9A 3H7YA 3GSWB 5ID0B 3ULVD 3RUGA 2DQMA 4UZSA 1QSZA 3SE4A 1XMEB 4JJ5B 1G9EA 2ID4A 5F7NC 1I9RH 4ISRA 1BVNP 3NJLA 4GRLB 5KBFA 5FUOH 1G7JA 4OT1H 3KPLA 2B39A 2WVSA 5CINL 1NA8A 4L5FL 4CNIB 4JW3A 5IHZA 5IQ7H 5KBNC 2VMJA 4NIGA 4LLWA