3ZXAC

Structure and assembly of turnip crinkle virus i. x-ray crystallographic structure analysis at 3.2 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
295
structure length
295
Chain Sequence
QKVTRLSAPVALAYREVSTQPRVSTARDGITRSGSELITTLKKNTDTEPKYTTAVLNPSEPGTFNQLIKEAAQYEKYRFTSLRFRYSPMSPSTTGGKVALAFDRDAAKPPPNDLASLYNIEGCVSSVPWTGFILTVPTDSTDRFVADGISDPKLVDFGKLIMATYGQGAAQLGEVRVEYTVQLKNRTGSTSAQIGDFAGVKDGPRLVSWSKTKGTAGWEHDCHFLGTGNFSLTLFYEKAPVSGLENADASDFSVLGEAAAGSVQWAGVKVAERGQGVKMVTTEEQPKGKWQALRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN
publication title Structure and Assembly of Turnip Crinkle Virus. I. X-Ray Crystallographic Structure Analysis at 3.2 A Resolution.
pubmed doi rcsb
molecule tags Virus
total genus 18
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zxaC02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zxaC01
1BBT2 1HXS3 1AR62 2RS51 2ZZQA 1RHI1 3HAGA 1VBC1 1FPN2 2WFF1 1GFF2 1VRH1 2WWSA 1NA1A 2DF7A 1RUE3 1NA1B 2HWE2 1FOD3 1RUG1 3VDDC 5BNOC 2RS11 1QJU2 5C4WA 2HWD1 2RR12 4WM8A 4Q4Y3 4WM8B 2MEV2 1RVF1 4WM7A 1HRV3 4WM7B 1BEV2 4N53C 2HWF3 1VBE2 4BCUA 1PO13 1R1A3 5BNPC 4RHV3 1PVC1 1QQP1 1OOPC 5LK7B 1Z7S2 1W39A 1EV11 2GH8A 1HQNA 2R061 4N43A 4RS5A 1V9U2 2ZTNA 4N43B 4RQPC 4RS5B 4GB31 4IV1A 2R043 4EJRA 1R092 4IV1B 1BBT1 3VBUA 1AYM1 2R072 4IV3A 4NWWA 1EV13 1EAH1 3JD72 4IV3B 4CDUA 5AC93 1AYN3 4CDUB 1QJY2 2XPJA 1C8M2 3VBHA 1POV0 1VBD1 1OHFA 3VBHB 1AR71 3ZFGB 4YVWC 1AR63 1RUF2 2BBVA 4Y5Z0 2RM23 2XBO1 2Y26A 3ZFFA 4QPIC 5FOJB 3ZFFB 5J98B 3TN91 2RS52 1FPN3 1PGL2 5ACA2 1TMF3 2RR11 3FBMA 5JZGA 1POV3 2HWE3 5JZGB 4GH4B 4RFT0 2QQPA 1QJZA 1X36A 1X33A 1F8VA 1VRH2 1QJU3 5J96B 4SBVA 1VBE1 5K0UC 1RUG2 3CJIA 2BFUS 2MEV3 1ASJ1 1NCRA 3VBSC 2RS12 1QJX1 3CJIB 1NCRB 1OPOA 1AR81 5D8AC 1BEV3 5A33A 1RVF2 5A33B 2WS92 4FTBA 1HRI3 1Z7S3 3JD71 1R081 5FMOL 4LLFA 1RUC2 1NA1C 1PVC2 1QQP2 5L7OC 1V9U3 1C8M1 4Q4X1 1RMU2 1R093 4AEDB 2R073 3JD73 5C4WC 1AL21 4GB32 1QJY3 4WM8C 4CEYA 3S6PA 1NG0A 4CEYB 4Q4W3 1AYM2 1RUH1 2ZAHA 1EAH2 1PGL1 5ACA1 5C9AA 1TME1 1VBB3 4WM7C 4CDXA 1RUD1 1RUF3 5C9AB 4CDXB 1VBD2 1DDLA 5C8CA 1AR72 2VQ0A 5C8CB 2RS53 2XBO2 4JGZA 4JGZB 1RHI3 1VBC3 4Z92B 3TN92 4N43C 4RS5C 2WFF3 1NCQA 1VRH3 4IV1C 2X5IB 1NCQB 3VBUC 4IV3C 1PO22 4JGYB 1RUG3 2WS91 4RR3A 2RS13 4RR3B 2HWD3 1BMV1 3VBHC 1ASJ2 1NY72 2RMU2 1RUC1 1QJX2 1RVF3 2WS93 3ZFFC 1AR82 1RMU1 5ABJB 1ND2A 3JBG1 4CEWA 1ND2B 1SMVA 5JZGC 1PVC3 1QQP3 4CEWB 4CDQC 1FMD2 3VBOA 3VBOB 2FZ2A 3JB4C 1R082 2HWC2 1ZBA1 2R063 1COV1 1K5MA 3DPRA 4GB33 4Q4X2 1K5MB 3DPRB 3ZFGA 1MQTA 1BBT3 5A32A 4Q4V1 1NCRC 1AYM3 3VDDA 1MQTB 5A32B 1EAH3 3VDDB 3J8F1 1AR91 1AL22 1ZBE1 1A6CA 1RUI1 5DDJ1 1RUH2 1HX6A 3VBFA 1VBD3 1RUJ1 3VBFB 1TME2 1AR73 5CFDA 1RUD2 4GH4A 5CFDB 2XBO3 1PO21 2RS31 3TN93 2RR13 1PIV1 1VBA1 3VBRA 2WZR1 5FMOS 1NY71 2RMU1 3VBRB 4Y4YA 1E57A 1B35A 1RUE2 1B35B 2HWB1 1RB8G 4CEYC 1VB4A 1ND3A 1MEC1 1VBE3 1ND3B 5C9AC 5CFCA 1ASJ3 1CD3G 4CDXC 5CFCB 1QJX3 1FMD1 1BMV2 1AR83 2HWC1 1HRV2 4JGZC 4AEDA 4FSJA 3IDEA 1R1A2 1R083 4RHV2 3JBG2 4GMP1 1NCQC 1C8M3 4Q4X3 2PLV1 3ZFEA 1ZBA2 4RR3C 3ZFEB 1COV2 1AL23 5BNNA 4QPGA 5BNNB 1HXS1 4QPGB 4Q4V2 1AYN2 1RUH3 5ACA3 3J8F2 1TME3 3VBSB 4PDWA 1AR92 1RUD3 4PDWB 1ZBE2 1CJDA 1F2NA 3NAPA 1RUI2 5DDJ2 5D8AB 3NAPB 1ND2C 1RUJ2 1RUE1 2X5IA 4CEWC 4YVSA 2GSYA 2RM22 1FOD1 4YVSB 3VBOC 4JGYA 4CDUC 4CDWA 4CDWB 2RS32 1PGW2 1H8TA 1TMF2 1H8TB 1K5MC 1PIV2 3DPRC 5L7OA 4Q4Y1 1VBA2 5L7OB 3ZFGC 2WZR2 1MQTC 1AL0G 1HRV1 2HWF1 5ABJA 2HWB2 5C4WB 1PO11 1R1A1 3VBFC 1MEC2 4RHV1 1NOVA 1RUC3 5CFDC 4GH4C 1RMU3 2FZ1A 1AUYA 2R041 3JBG3 1HRI2 1IHMA 2BUKA 3VBRC 3CJIC 5AC91 1AYN1 1C8NA 5BNOA 1B35C 5BNOB 1ZBA3 1M06G 1COV3 1ND3C 2PLV2 1AR61 3VBUB 5CFCC 4Q4V3 2RM21 3J8F3 4N53A 1AR93 1D4M2 4N53B 1ZBE3 4Q4W2 1HXS2 1FPN1 1RUI3 5DDJ3 1PGW1 1TMF1 2BPA2 1VB2A 1VBB2 2TBVA 5BNPA 1RUJ3 2IZWA 5BNPB 1POV1 2HWE1 1OOPA 4AEDC 1OOPB 3JB8A 1PO23 1QJU1 2RS33 4RQPA 1FOD2 4RQPB 4CDQA 1PIV3 1RHI2 1VBA3 2MEV1 4CDQB 1VBC2 2WZR3 3ZFEC 3M8LA 2RMU3 2WFF2 4NWVA 4FTEA 1BEV1 5BNNC 2HWB3 4Q4Y2 4QPGC 3LOBA 5C8CC 1WCDJ 1MEC3 4YVWA 1VAKA 4FTSA 4YVWB 4PDWC 1HRI1 2HWD2 2HWF2 1Z7S1 1FMD3 4QPIA 3NAPC 4GMP0 2WLPA 3ZXAC 1PO12 4QPIB 2HWC3 2X5IC 1V9U1 4YVSC 1R091 4JGYC 2R071 4CDWC 5GKAC 2BFUL 1H8TC 1QJY1 2R042 1D4M1 4GMP3 4Q4W1 1EV12 5K0UA 5AC92 5K0UB 2PLV3 1VBB1 3VBSA 1RUF1 2R062 5ABJC 5D8AA 1D4M3
chains in the Genus database with same CATH superfamily
4XWGL 1MFBL 5CEHA 2X0UA 5AOZA 3MNMA 3DV6A 5BOZG 3R8QA 5E56A 2X70B 4H8WL 2J8UA 2X4RB 1KXTA 1YN6A 1T1ZA 1O91A 1W8ZA 5FO7A 3HUJE 4Z78A 1A8MA 4MX7A 4BQCA 4ODWA 2I9TA 4G7YH 3O5SA 5CWSA 4CSZA 3DO7B 2GHWB 2NR6C 2AJZA 2HLEB 3D9AH 3UZVA 2WQUA 2FO4A 4OFYD 5GIRA 2ZGKA 12E8H 4YUEH 4HLTA 1L9RA 4QRRE 2IGFH 3THMH 2RS11 1TPXB 2YRLA 1QJU2 2FCBA 2ZG3A 2WL1A 1N3OA 5D1QB 5GSRA 5C4WA 1GL4B 1NGYA 3QUMA 1N0XH 5FKAA 2H8PB 4P4KD 5GRZA 3JZYA 2XLLA 3OGVA 4L9LA 4EKXA 3GSXB 4NHCH 4LEXL 5D7HA 5DJAB 4HCFA 5HHOE 5E1RA 1J5CA 3PE9A 4M00A 1NH6A 3TBTB 4IW4C 3FT3A 1JXFA 4D6QA 1H0DA 2AQ2A 2Y2YA 1S3RA 5BNPC 5BPPA 4HGWA 4JO8A 2BVQA 2Y6JA 2F8OA 3IN2A 4WK4B 4YZ3A 2VDRL 3T4HB 3FMGA 2IALA 4LSUH 1ICTA 1KELL 4FABL 2C7UA 1DN0A 4ZW8A 2P3KA 2FBOJ 2X6AA 5ISZB 3S3SA 2NUTA 5D2NB 3W37A 2GN7A 4PCYA 4EJRA 1XGUB 1XH2A 4WSGA 4H25A 1DSFL 4QX0A 1W2NA 5DMIH 3WP4A 3AG1B 4ZXKA 2UYLB 3C2AL 4CA4A 3TF7C 5C09D 4NHKA 1LOFA 1EBPA 4NIYE 5HYSA 2Y25A 4N6RB 4PWHA 1YIPA 3QDGB 3RU8H 3OMNB 2BM3A 4HAGA 4HIEB 4LDLB 1F8TL 5IBTL 4OZHB 2VM4A 3UBXI 3MA7A 4SLIA 1G84A 5I1HL 3HBZA 5FP4A 1XL4A 1RIHL 4C0BA 1YVLA 3GI9H 5JXHA 1DBKH 3L5XL 3OR7B 5EHDA 3ZRFC 2BNRD 3STBA 2VNVA 1W04A 4D0CA 1DVSA 2X88A 1GY1A 1UB5A 3VFMA 1LTEA 5AAWC 1FNGA 5SWQA 4BUQA 1PMHX 5D7IE 4D3WA 4Y9GA 3TN0C 4J4PD 5HHNB 4RESB 2YBGA 2GTZB 3KPSD 4AV0A 1CICD 4I3PA 4GAJH 2AQRA 5AW5B 4ZYKA 5TK2A 3O4LA 2XQBH 4L11A 4XP6L 1UUNA 2PPFA 4HIIB 4N20A 4NUGH 4YDVB 5AUMB 5FBJA 3UGHA 2AJSH 2ZEWA 5J96B 2GB2A 1T3FA 3TJEL 1N6UA 2J42A 8FABB 1JF1A 1OUSA 3WD5L 2WXRA 4WHTA 2EABA 2A6IB 4ATTA 3DSNB 1XCTB 5GQBA 1ZS8B 1IILE 3DBXA 4HPHA 4AR2A 2Q2LA 4H20H 1XCWA 2CZNA 2QPUA 4UTAL 2D0GA 3WG7B 3CFMA 1UIJA 3D0SA 1HCVA 3GRBA 3WDHA 5EWIL 5GS0C 1O5LA 5EOCH 2Q76A 4MJIB 1MCJA 1PLBA 2EEAA 2DWSA 5FYLD 1I53A 5CFHA 1K5JA 2IDCA 1AKJA 3MXVL 2X2UA 4UF7C 1M2VA 3WY4A 5HTSA 1HRI3 4O65A 4Z5RA 2AGJH 4MQSB 4P46D 1S7QA 1GYAA 2QPFA 3GPEA 4EWEA 4FEIA 3X12B 3ZSLA 5A70A 5J06A 1DJHA 3KH3A 4JY6A 5EOTB 3WOVA 5DK0A 2GJZB 3KR3L 5HBBA 2YOCA 3CNKA 3STLA 3V4PL 2G2RA 4R7VA 1CU4H 1DVXA 2DCZA 2LTQC 3B2UC 4Y19D 3FTXA 4YDKL 5AAMC 3RB7A 4CGUB 3PUUA 4UT5A 2XUMA 2NR6D 3BZFB 4OCYL 2J2ZB 1NGQH 4U1NA 4U1LB 4JFPA 1N47A 4AW4A 1XF2B 3TV8A 3GNEA 2JG8C 5EU5B 1C5BL 2XA3A 1VAHA 3FTGA 4KVCH 4OT1H 5BVPH 5GSVB 3RZGA 5FUOL 2GJ6E 2CIKB 5B4MD 3VG0H 2B5HA 2BGPA 1H9DA 1WW6A 1E5IA 1YEFH 2WXNA 4Q6YA 1UM5L 3U2SA 2VXVH 3A4AA 3BYTA 4L92A 2GFBA 3X2QB 5ICUA 5JIQA 4N9IA 1CCZA 4ICXA 5KAQF 4JGZB 5E88A 3P3RA 4MDJB 3ARGC 1RIVH 1ZPUA 4YQXH 5DD3L 5IMOA 3SCMC 4AQEB 1RCYA 4N43C 4PD4J 3T0BA 1A7OH 1SF5A 1E4WL 4EZMA 5LZ6A 1MVFA 1BMWA 1WLDA 3GSVB 3N9GH 4LSPH 2X5IB 3S4SG 5F93C 4QRQA 2XIIA 3WEAA 4K3JH 3B5LB 5F7MC 1CWVA 4H1LA 3HPJB 1O4YA 2CO2A 4FP3A 5CHNB 3AYDA 4MB3A 3EXJA 2RS13 3JUZA 2ZXCA 3VRIB 4NC1E 5A6IA 4NPKA 5D7JC 3MUGB 1K6QL 4JDNA 4E8DA 1ZVSA 2CDFA 2PXYC 3ECBA 1D5BA 5JPNB 2E9QA 3BP6B 1ASJ2 3LS4H 1N6VA 2EKSA 3GBWA 3OUHA 1ZRCA 1C12B 4K7PH 2EEBA 4TPRH 1I8UA 3CN1A 2VDQB 4W9LC 2NTFB 3HHRB 4ZUTA 4DGIH 2I5YL 5DWUH 3MV8B 1ZRFA 5ICZB 3QUYC 4UWDA 2Y36H 2AXWA 2F5BL 2A0LC 2VXTH 4PJIB 5KJRH 2CIIB 3CN3A 3FO9B 1A6AA 4R4FL 1QLFB 4EZJA 2FZ2A 3E6DA 2FTAA 4X7FC 5F9OL 4Z7WE 4H7LA 1JE6A 3TIDB 4BMBA 1TZGH 4JGJA 5EEZA 1UY4A 5KSBE 4M6MH 4CSPA 2YHJA 3CVIL 4ZODA 1K72A 3VXRA 5EPAA 4XN8A 3VDDB 3WVJA 2LV4A 3I6GB 3N9PA 4ONOA 1M7UA 2HEWF 1ZA7A 1OGSA 2JX9A 3H85A 1CVSC 2FAUA 2V9TA 4LBEB 2YQBA 1JWSB 1RUI1 4ATEA 4JRAA 3MRMB 3BKCH 3VBFA 2EC9T 1LNSA 5AOIA 4ZFGH 2DWTA 2FEEL 3QZMA 4OZ4A 3GUTB 2C7FA 2BRQA 1FFTB 5EUOE 3WR0A 1A6WL 1TVHB 1I7TA 4Z77A 3QLQA 4ZQKB 2YPKA 2ZYIA 3IIAA 1EVTC 4KZ0A 3S34L 5HCFA 3D34A 3DX4A 5EPMB 2V9UA 4PG9A 3VBRA 3G9AB 4R2GC 3ABMB 3PWVA 2RMU1 4QXKA 1BEYL 3KT1A 3AADB 2YSSA 4IBLT 3BVNB 4YE4H 4F8NA 4B97A 1HQLA 3ZZ1A 2R23B 5D1XE 2BEOA 4KGGA 4YZ4A 1JGVH 1Q1PA 4JM4H 4X6DA 3V0WL 2ADDA 4HALA 3SEPA 5TK4A 4XN9A 3PGDA 3BDYL 5D2LE 1MEC1 5ACMA 1VFBB 4U05A 1OE1A 4NPJA 4JFEA 3ZDZE 2F74B 3DRTA 2Q8OA 5JVVA 3QC6X 2WLIA 4PJ5A 1SN5A 5FW6A 3W81A 1H5BB 1Z9PA 2YPLB 2VBPA 2VL5A 3KYNA 1Q9LA 4XOBA 4FULA 1RURH 3H1ZA 1KBBA 1HIXA 1HZHH 2BW5A 2AXGA 1ASOA 5FBZA 3AS3A 3TX4A 1MHPH 1IPSA 2R2CA 4HQQL 4S11A 3UO1L 3KYAA 5KHJA 4QWNA 5JOEA 1F4AA 4NQCB 4WU5A 5FMDA 5KJ7E 1NICA 3DHMA 3QORC 2V8LA 3SO5A 1X7QA 1H8NA 1Z9MA 3TRSB 2IH1B 1NCQC 3HE6D 5HYEA 2R69A 4QXUL 4NSKB 3PV6A 1S8DB 1VEPA 1XAUA 2C1PB 2G3ZA 2OL3B 1KJ2B 5FZOB 3LNDA 3MJ9H 3SCMD 5IWLC 1DJYA 1CO1A 1EX0A 4PBPA 1BA9A 5C08D 5JQ6H 3ZDXE 3CVHL 4DZBA 1DQ5A 2CY6A 2GNMA 4Q4V2 4N9OB 5M94B 1CPNA 3MPPG 3QQ4B 1UADC 5I9QC 4Z7NB 4QB1A 4FPGA 2GY7B 4Q4EA 3F7VA 3OAZH 4XP1H 4BH8A 5DVOA 1FVEA 4JG9A 4M43H 3NAPA 3MLZH 1AVBA 2LABA 5BV7H 4YSAA 2CDEA 3SGKC 3OB8A 4R26H 5KXEA 4XO4A 1G9BA 4DPBX 3OZ9H 4PQ9A 2P28B 5FYJL 4OF6A 1FOD1 4P9JA 2GC3A 3B8YA 4HK3N 3VCLB 4RMUA 1YN6B 5KVMC 5FZ0A 5FO7B 1I8AA 2OZ4A 1CYWA 1H9PA 1X5MA 3WFZA 5CWSB 3W39B 2J4WH 3MLLA 4JK0D 5L73A 3O3EA 4KRPC 2A0LD 1O6TA 1YUHA 1W8WA 3UZVB 4NAJA 4ZPVB 2C9XA 2GMPA 3POCA 3EBIA 3B9KB 4NJ9L 1GIGL 1AL0G 5AKVA 3T4VA 1XXDC 1G7IA 3PU7A 2HWF1 5LG1A 1URXA 5C4WB 4LPYA 3P4OB 4MMZC 5GSRB 2ZXEB 5FKAB 1UJ3A 3SQOL 1WA4A 5A6XA 3JUYA 5EUKB 3VHNA 4POYA 4ZS7H 4OHVA 1VZIA 2Q1FA 1QDOA 1GP4A 3C6SA 4QTHB 5D55A 4M29A 2MHAB 2ARJA 4RX4A 1OP3K 3P77A 1QRNB 32C2B 4ORZC 3OGCA 1TQTA 5F9JA 2FQFA 1VENA 2NY5C 4UZGA 5IB2A 2YUVA 4HGWB 4OD2A 4GG6E 1IRAY 4KKBC 5D7KD 4KZDH 1IFHL 1U3HC 5D21A 5T3NA 4TUKH 4TMPA 5AC91 4L1SA 5T5JA 4XT1C 5JMRA 1HOCA 1EJ8A 4M62L 2J72A 2ZOOA 4XCCH 1QKZL 3UFIA 3CMOL 3U7WH 3CLEH 1ND3C 1MFCH 3Q5YA 4G6ML 2Q3AA 3EGXA 1FVDA 5HY9A 3GI8H 3P4MA 1PMIA 2CMRH 1CDUA 2F18A 2YQ2A 5AOMA 1YQVH 5GZOA 4XXCC 2C3VA 1RUI3 2ALWA 1A1NA 2WD0A 4B7IA 3MUJA 2FWSA 3GPSA 1T2QH 3ZR6A 4AYSA 3LIHA 2R0WL 4XGZA 2XNAB 4I3SH 4N8VB 1GJIA 2QJDA 1IM3B 1LP9E 1OOPB 5AVPA 4EI5A 4NRPA 3HT1A 3IGKA 3JB8A 1INQA 5J0BA 3HB3C 2PYTA 1FGNH 2XHNA 4HKOA 4D0CB 4FFGA 3QI9C 4MXVF 1M7DB 3MRHB 1GUIA 1G6RL 5FPLA 4MMYA 3N55A 3MO1B 4OZGE 5LXGL 1ZA3A 4J39A 4PJGA 2Q8AL 2DMKA 2YD7A 3ATBA 3JTBA 3G5VB 5L88H 1VB9A 2RMU3 3S8GB 3G08B 1H1IA 3B5HA 2ZUTA 4HXBH 2BY2A 4K8FA 4KAQH 2C8NA 1BEV1 4CCCA 5KUMA 3BVDB 4K9EL 3E2HC 3BJLA 3POHA 3VVVA 2J1XA 3V0IA 1MLBB 5FHAH 4DZ8A 1FV1A 1T0PB 4GY4A 1P5VA 4W9DC 1MEC3 3BXNA 3D51A 3NSDA 3AZYA 3AMPA 1UA7A 1URLA 2C26A 4IEWA 4GO8A 3GXUA 3R1GH 1U12A 4H0IA 5T3ZD 1WA0X 2PN5A 4U1GB 3NSYA 4YOKA 3ZXGA 1E9QB 1FZMA 2BFVL 3IMUA 4UBDC 2NW2B 1NC2D 3DETC 5AVWB 2IANA 4Z5RB 5HHME 2W9EL 3KJ6L 1S7QB 2VT0A 5C0IB 4LBMA 4I3RL 2NYYA 3Q5TA 1QJY1 4UIKH 2JMRA 3OPZH 4JY6B 3ZLQC 4QO1B 5FYYA 1AR1B 5A7SA 3WINE 2P52A 1WTLA 4M8RA 5DK0B 3USSA 4F7EB 5C9JA 2GTWB 1Z5LB 5EULV 4Y1SA 2G2RB 5C0RL 4MSVA 4P08A 1S2KA 1OGAE 4K55A 2RJLA 3MVSA 5B38G 5B7EA 1AY1L 2ZKMX 2ZGQA 3I9IA 2JXAA 3KBPA 2JKRM 4JFYA 4XXWA 1OP5H 5ANMA 3GBLA 4KRPD 4JKKA 4LLQA 2RS51 4K3HA 3CHSA 1HJGA 3KWWB 1CQ9A 3L13A 3EF4A 3VE0A 5FZMA 3FTGB 2ZMKA 2D7PA 3PTRB 4QHLB 1P5UA 4MA7L 5CAZA 1FG2A 3WXWL 1D7DA 3OXSB 4NRYB 1SM3H 2CBMA 2OPKA 3S7IA 4GRMA 3WE6A 3A23A 1NA1A 2XR4A 3VG9B 3RURA 4U2AA 2GTQA 4L4VD 3R8BB 4RFNB 1FOD3 3RWJA 4FA8A 5D7LA 4FFVD 3FFCA 1T4KB 4OUMA 5GGVY 1IARB 4ZW7A 1ORSB 5L4JA 1CIDA 5IVVA 4NJAH 4AI0A 3O4LD 4EZ4A 1XCXA 1E9OA 1QF3A 4URKA 3WJJA 2RR12 3N7JA 3OKLB 2AC1A 5PCYA 1W72H 2XPGA 4RGMB 1WS7A 3FU7A 2K0RA 4U1MA 2IPKA 5E03A 4Y1VA 1BG9A 1JV5B 1U3HD 1XH3B 4PRPD 3U30C 3V10A 4L05A 4FNLH 4X9IA 5E6SB 5A2IH 3GEFA 4GAYB 5EJZB 2Q7NA 2X1XR 2HWF3 1H3PL 1A0QL 5AVXB 2WXPA 3E6HA 5I5MA 3OKDA 2JWYA 4XZUB 3ECBB 2VDLL 3EFFB 1T89C 3E8UH 4D9LL 1AQ8A 1ZT7B 2EKSB 2X3BA 2ZOLA 3D25A 1GZHC 1XXFC 1B3JA 1ID2A 3EDFA 3G5ZB 4P3WA 2ZOUA 3DGGA 3PUCA 4OBRA 4QPEA 4AI7A 4B9YA 1B9KA 3S4SA 1EV11 4P2RE 1JK8B 5CUSL 1U93B 1FJ1B 3MCG1 1ZGLA 1DGRA 1WZ1H 2V72A 3CJIC 4NQVB 4P0DA 3EJYC 4GIOA 1BQRA 4AUJA 2ZX7A 4D0BB 1BBT1 1F56A 2Z7UA 2E9IA 1L7QA 4KO6A 1A6AB 1ACYH 2CHNA 2YU2A 4NWWA 4UYBA 4E4ZA 5T3XD 1I1CA 1ZVFA 3HT2A 5AC93 4PJ7E 2UUDK 3MJ7A 1H8OA 1E5AA 1PZSA 1U8KA 1JTOA 3AT8A 4DIXA 3IJ9A 3QI9D 2FYYB 5IVBA 1GCYA 1POV0 1I9EA 3B34A 4KWJA 4LCCB 3O41A 2XB6C 3VXRB 1OOWA 4P49A 3MW3A 4J25A 5KVDE 3HNMA 1A02N 3PNAA 3SCGA 5E16A 2X4OB 3L16A 5C7GA 3WQBA 4XAAA 4LOEA 2Z42A 3QZPA 2Y6LA 3MV9E 4CCEA 1BAFL 2CQVA 1KIPB 3MFFB 3DV4A 5KSVB 1FO0B 2IXHA 5IT2H 4F8AA 2YWYA 1MCNA 5IESH 4LKEA 3AUWB 4IJ3C 5C0BD 1HHKA 3GHPA 4EZHA 5B22A 1H3XA 4RGNB 3WKQA 1I7TB 3QACA 1EEYA 1MVUA 4L4TA 1PZCA 3TIEB 5EZOH 4QQPA 4BFJA 3TNMA 5KG9B 4TL5A 4PG9B 2WTOA 3ZSTA 2ENQA 3VFRB 3FUQA 3H4FA 4PREB 1LO4H 3S0PA 1HK6A 2EEFA 1X3DA 5D4QA 1AR81 4AE0A 3LS5H 5EZIL 1BEV3 3QIUC 4JN1H 3AAZA 4Y1AE 3HS0A 3ZHFA 2FCVA 3MCLH 2D93A 1YYLH 5FZHA 2XCMC 2N7GA 5IHBA 2WVTA 1WW5A 4UINH 4ZJ9A 3WG1A 3CXFA 1Z78A 5DA4A 3MLTA 4HG4K 4L0YA 1GU3A 4B7EA 2CDGA 4ZMLA 3R0NA 4L2LA 1LCLA 4IQPA 2HPOA 5IBUG 2VDKB 4OB5L 3ZT5A 3OZLA 1OD5A 4BE6A 4WVWA 1QO3B 5DGQA 4FG4A 4JO1L 4KY2A 1GQGA 2E9BA 3VXSB 5C3PA 3AZUA 1S9WB 4Q4X1 3MMEA 4CC4C 3AG4B 2WPGA 1M1SA 3HVDA 5J1AB 1YCSA 3SKJE 3KLQA 2P6HA 4WZ9A 2YXFA 2XY2A 3VD7A 5JDJA 1XYNA 3MLXL 4OZHF 4WU5B 4EZKA 2K2SA 2YPVH 3QEQB 3RWIB 1G1CA 2N1TE 1X7QB 1QJY3 2V7HA 1LE5B 5IP4A 4PP2A 5KBLA 4MJ6A 3QULA 4BQ2A 4N2GA 2L8AA 1S5IL 3CFDA 3O12A 3T1MA 4YHIB 2XZQH 2CLZA 3OD4A 3LKOB 2OP4H 3PV6B 4LSSH 4YHML 1YCIA 3ZN6B 4CDXB 1DFBL 3VWJB 1JJUA 2EYRB 3BAIA 2E27L 3EDDA 2E6VA 2X5PA 4I09A 4D7BA 1WF5A 3I7DA 1UZWA 3GXPA 4HG4J 5C8CA 4HJJL 2PCFA 4WO4A 2RS53 3RILA 2IJ0C 1YEGH 5CF3A 4IESA 3F6LA 4OD3L 2L9LA 2IFGA 2QQVA 4S0SD 3F7VB 5EFIB 1UTDA 5JMCA 1NLDH 3WFHB 3AWFA 4HWEL 1FVEB 3VGFA 5SWSA 5K59E 2CKBL 4NQUA 4B0MB 4D9RD 4OLVL 1S0IA 2DUOA 4Y5TA 1DLFL 5A6QA 3W3BA 4IV1C 2E31A 3VB9A 3U1QA 3ULSA 2VW1A 4G6JL 2EE9A 1JL8A 2CR0A 4GA9A 1OAQH 3KPPA 5HDQH 2PCXA 4HEMA 5AG8A 2A7AA 5EC2B 3MUHL 2H6BA 3LEIA 5LCWL 2Y5EA 4RR3B 3FAWA 1OAKL 5F0LB 3OAYK 5IVZA 3TT3H 2APWA 2J5WA 5TF0A 2JJSC 4XOCA 1IVTA 2BOBA 2ZICA 5ACZB 2JD9A 3HG4A 3O3EB 3EJYD 5BJTA 3BGFB 3GSNL 4QRTB 5IKCA 5TE7L 4FYQA 2A4CA 4JFED 4FADA 1JCKA 1YPZB 3LZOA 4ZY9A 3AG2B 2Y07H 4P2AA 2DMCA 4WJ5B 4PJ5D 3C9NB 3I2CL 4Y24A 2ILMA 2H32H 2YD3A 5DZNA 4RMTA 3RAJH 3JBG1 1MWAL 5GRYA 5MENA 1HT6A 2MJWA 5HBAA 1Y6MR 4BUGA 3S98A 4CEWB 1W2UA 4X8PA 3V0BA 1DO5A 4S2DA 2B8OT 4PS3A 3ZO0A 3VBOB 3C6SB 3ZL4H 3JWDL 1JOPA 2PO6A 5DUJA 1IL1A 2ARJB 3GSWA 5CO1A 1E4XL 4ECNA 3N9NA 4P9YA 1AXTH 3OGCB 1CL7H 3CN0A 4N0YL 1COV1 2EAAA 4Z8BA 5K7PA 4DP6X 4MAZA 4DK5A 4OD2B 1XOYA 4X6CB 5GGTH 2DAVA 1BBT3 4A66A 2VKXA 4BOWA 2ENYA 1E7VA 5DURD 1MZ5A 1DEDA 1OE3A 3LCYA 4JJ5B 4CXWA 3O45B 4CN6A 1HOCB 4XN4A 5BMFH 5HI4C 2E47A 5BQ7A 4DXRA 2PPAA 2AI0H 4GXUM 1O5DT 2A83B 3PWPE 3UPRA 1NOFA 3FT4A 1FE8L 1WC7B 3GJFH 1E4KC 4UT7L 3RX8A 4OZIA 2AREA 5FWEA 2EIEA 3ESNA 5EFUA 1TME2 4YM1A 3KBHE 4L48A 1FVDB 4R5TA 2ATKB 3EJZD 1S78C 4GH4A 2VLME 2DQGL 1BBJB 3AKQA 4YZ1A 2A6DA 2W68A 3N1QC 1GICA 2P5EB 1Q8OA 3MV7B 3NZ8A 4D7YA 3VFNA 3QJVB 4G11A 5BRZE 2Z93A 4FFWD 3RUGE 4MHUA 2BS9A 4QGNA 1L9TA 3H8RA 1B6UA 3D69A 1GMMA 5GZGA 2W1WA 3AMHA 3WMQA 4FFFA 4U4BA 5FMOS 1N67A 3KPNB 4B9GA 2MNWA 3IMBA 1V7ML 4EN3C 1B35B 1RUKL 3T2OA 3ZSMA 4RS5B 1MAML 2PMZA 3M70A 4HS3B 3OC8A 5T55A 1CD3G 4O2FA 2DMGA 1FMD1 4QRPB 5BS0B 4FTVD 1GGYA 2WO2A 3KM5A 5JCTA 2Y1VA 1A4CA 4PJIF 5F72S 1P5UC 1AR83 1G1OA 2KZBA 3H42L 2ADEA 3STZA 3F01A 3ULUC 2ROXA 4A6SA 2WWKT 1ZHNB 3V4VL 3FU6A 4LPCA 2HT4D 3NH7L 4XC1L 2EYTB 4TNVK 3K72B 2B5IC 4KH9A 4RDQG 2HVBA 2VDNL 2IVFC 4UB0L 5EIQA 2ED8A 4RX4D 7FABL 4RHV2 1TTAA 3GXTA 2PHRA 2H0JA 3E8VA 4XP9H 5GRJH 1NCBH 2GIXA 1WLCA 5DD1L 3NCYS 1JI2A 1PNDA 4BA8A 4Q4X3 4J23A 1IT9H 3ZFEA 4XJWA 1FNLA 2IANB 3IJYA 5H37H 3EYSH 2B77A 3IF1A 5JOFA 2PYEA 5LASA 2XT1B 1W8NA 2GAUA 1RJZB 4Y2DB 3PLYA 2YLKA 5E99L 1IAKB 4NHXA 4O4YL 5F1KC 4JZNA 2VDOB 2WDBA 1A7BA 3OAWA 1O7SA 5JW4R 1Q1JH 1BM7A 4LF3A 3VXTA 5IVCA 2G5BA 1CJDA 5IR1B 5HYJA 1X5LA 5D6DC 1F1DA 2WUCL 3TYGH 2Y33A 4AXWA 5GZOD 3LWCA 3HW7A 1U3ZA 4LLQB 2ALAA 1Z32X 4M3KB 5EN3A 4ENEC 2NN8A 3LDRA 5FGCE 3PP3H 5EJ3A 2WNXA 1UZZA 3LEKA 1QABA 3HLAA 3LJ3A 3WP5A 2VGLM 3IFPA 3KV6A 1MS9A 1FG2B 4RAUA 4HFUH 5K9QI 5LNEA 1BF2A 1PIV2 3FQ1A 3OHXA 3O6FC 4M8VA 1QHOA 2JB5H 1W6NB 4PJBE 1PZ2A 3RZLA 1WWAX 4KJYA 3D2UA 3CPLB 3EO9L 3A6OA 4QY8B 4BSVA 2VE1A 5IB4B 1CXFA 2UZYA 3V6OA 2EE6A 3FUHA 4K7JA 1PDKA 2ZEXA 3BSZA 4M01A 4XE0A 4AMWA 1E9OB 1A6UL 2HVKA 4GW5B 1QOTA 2YSTA 3DJ9A 1YYMH 4LPXA 4NBXB 5HHVH 3NUKA 3A0KA 3ARXA 4G6KL 3NZSA 1G7PB 4MASA 3L3OA 5ESVA 5EBWA 5D5MA 4UF0A 1M05A 1S2BA 3UL2A 2BVOB 2V7NB 1F0LA 3HZVB 5DABA 4PV9A 2QUOA 4LLVB 2BDNH 5HI4D 2R0HA 5F7FA 4NQDE 1AJ7H 3D4KA 3E6HB 3U0TB 1ODAA 2B1AL 1BVNP 3AYAA 3JBG3 2ZCLL 4IEFA 1CLZL 4WUUD 3W38A 5BZZA 5FO9A 4I0PC 2BUKA 3R4SA 4IKNA 1LE9B 4MFHA 4X9YA 3JWNG 2D9CA 2C5DA 3DXTA 3GKWL 4PY8J 4JR9L 1ZX5A 4ATFA 3DK2A 2BRRL 4XF3A 2NYYD 3UJOA 3FSWA 5JHAA 4KK6C 5L2KA 1ZGLB 4XMPL 1U8CB 4Z7NF 3C5JB 1M06G 1KBKA 3IAGC 1COV3 4OGZA 4K7PY 2VU9A 3THPA 2R2BB 5IFPA 4D3CL 2NY1B 4RRPM 2XKPA 3UBGA 2XWZA 1UA6H 1NAKH 3S6CA 1ST8A 2JE7A 5KYYB 2E6PA 1YNKH 1HCFX 3L2MA 3I3MA 1G9NC 1Q8SA 2Y06H 4TF4A 3EYQC 3SGDH 3Q9PA 1T83A 5DEFA 4LGSB 3PHOB 4WUKL 2EIKB 2NXZB 2EIZA 2V6HA 3NRFA 1RZKL 3KXFA 3WNLA 5C6CA 2OYPA 2TRYA 3J2PA 1QSEB 3NSCA 3BGMB 4EZLA 2KPWA 3DTUB 1C08A 3KEDA 3ULUD 1LGCA 5D7LD 3MRBB 1JHLH 3RA7H 3FFCD 3SDAC 4JFHE 4TN9A 3DA0A 2WFF2 1LGVA 3M17A 4NWVA 1KXQA 3UYRL 4HKZA 1ODUA 5AWNH 4WRLA 5DD0H 4TLSA 2DBNA 4QKFA 5FXVA 5FB8B 3IJEA 3W5NA 5AYQA 1XYPA 4WW2C 1FQ9C 1CLOL 3OEBA 5C8CC 4WO4C 2XOMA 3NFSL 4OQ8A 3MGOA 1ITCA 5DD6B 4B96A 4NM4L 1GPOH 3QWRD 1Z7S1 4U1HB 2ZOWA 5IWFA 1FMD3 3MI8A 4WW1B 5F39A 4YG0A 4OCTA 4UIMA 2FEDD 4UWQB 3ZXAC 35C8L 3PFUA 5GPRA 4AQTA 2QSTA 1O7VA 3CBJB 5I0WA 4YVSC 3V9FA 2CE6A 3Q05A 3SDCC 1RZIA 4G9FE 4D9QD 4L8CB 4TSBL 2UY9A 1I4FB 3MLTB 5D93B 3FQUA 5C86A 4YBQD 2CDGB 3V0AC 5K9KA 3SCFA 4J6RL 4X8CA 4C4KO 2D4DA 4YHZL 4PT6A 3K77A 4ZO7A 1XF4A 3WIIL 3LH2L 1OAZL 2X41A 4ENED 4LOFA 1XX9C 1INDL 3D3VA 2O6FA 3MMEB 3PQYD 1QWRA 5H8DA 1X9TA 1ZZBA 1NDGB 3MR9A 1Q4NX 4KNQA 2EACA 4XQWA 4JHZA 1KBGL 2H2PC 2XBTA 1LWJA 3QWNA 3FKUS 5LQBH 3OGOE 3U46A 3LQAH 3BKYH 2CUHA 4MJ6B 1CXIA 1OF4A 3CH1B 3BLBA 3N06B 5E5UB 1AR62 3H9SE 2CLZB 4Y9EA 3MGAA 1T0OA 4F7PA 3A22A 5D1ZI 4YWAA 1AFVL 3N42B 2DJ4A 4C59B 3T1FA 5TD4A 1DVTA 4XMXA 1ZLEA 3UTZA 5I1AA 3D8CA 3UJJL 4TL4A 2DF7A 5LY1A 1X9UA 4E9KA 3HNVH 1G9AA 4EQ3A 2B8MA 3RFRA 2JB6A 2JCWA 2LQRA 3NQKA 4JRYE 2BHZA 1RUG1 3IN9A 3FQYA 3C75A 3QFDB 4JPIA 4KKPA 2RTTA 5CILL 5IYYA 1NIEA 4DN3H 4JAMA 4QT6A 4HS6A 2QVKA 4MAYA 4PJAA 5T33L 2QZ5A 2ZEZA 1A7PH 4WM8A 4L4TD 4XAWH 2X87A 3RDJA 4I0PD 1AI1L 1KXGA 4U0RB 5AW8B 3MRDB 2PQSA 4KVPA 4Y22B 4JHAH 4CJ0A 2X9ZA 3ES6A 1GJWA 5E8EA 1IKOP 5F6HJ 1OXCA 3AL5A 2QLVB 3QISA 2F54A 3MOQA 3C08H 4KK6D 4LZKA 3TNNA 3E97A 4KKLD 2ZX4A 3LB6C 4AG4H 4PJFB 1J1XL 2DVDA 2DD8L 1N12A 3DMMB 4X8NA 1VJ2A 2ZG2A 3OSDA 5F7UA 1TITA 1R75A 2WNGA 3SQBB 4UOW0 3LSDA 4K2UH 5AB1A 1WLWA 1U8PB 3GGWA 2CCWA 1WD4A 15C8L 1QVOA 4P9LA 5JQIB 2H6PB 5F6KA 4HXCA 3V6OC 1SY6A 4FQJL 1IGJB 4XPBH 4ETQB 2WJ5A 5GZDA 4IV3A 4JDZB 3AVEA 4GRLA 1MCSA 2MFNA 3NTCH 1LDPH 2DW5A 4FFYL 4G8AC 4J5VA 3M4FA 2XPJA 2JKSA 5EG6C 3NQHA 1A7QL 2EXTA 4PIRF 1EXGA 1KCSL 1K9TA 3DX3A 3LZZA 1NWOA 2Z1KA 4R7NB 4FA7B 2OTPA 3H3PL 3O6KH 2DLHA 3PABB 1CX1A 4QXBA 3C6EA 3ARBA 4G80A 3ZQXA 4ZX6A 1H30A 3PWNA 3SCHA 1M3JA 4JFTA 1T66D 2CD0A 5GGQH 4A44A 2QL1A 2GC1A 1NCJA 5DYOA 4XCNB 4DQOL 2B0SL 3AB0A 5J98B 3QFJB 25C8H 2WNKA 4JHWH 4L5FL 1N3PA 3OAUH 2VQUA 4OZIB 4WO4D 5HVHB 3BQUC 2CJUL 3FO2A 3T4AB 3ZR5A 3QZLA 4LORA 4MYEA 4UXAA 2F08A 3ETPA 4GH4B 1KXVC 4A6YA 4I77L 7PCYA 2TNFA 4PS7A 5ADPH 3DN7A 3DXUA 5SWSD 2AQQA 1Y18A 1Z0NA 2O6PA 4IGBA 2ZJSH 3LX9A 3E6CC 3GIZH 5CJQL 1DCLA 1SF3A 3KNBB 5E6IB 3GK8L 3U9PL 3VFNB 2WP3O 1DLHB 5J6GB 2P5WB 4EDWH 3SDCD 1XR9B 3G5YA 2ZGLA 5F70A 4NKQB 1YMMA 4EIGB 1KB5H 4DKAA 3PNWA 1NCRB 2LFEA 3L7EB 3NCMA 4X4YA 1N5AA 2O6DA 3HJ0A 4ZS3A 5C97A 1DQJA 4NWUH 3APCA 1TE1B 4Y5XC 3EXUA 4QQHA 2E6JA 1Q56A 2UY6A 4AVVA 3EOBA 4ZDHA 3LXBA 1NGXB 5HHPA 1BW8A 4GULA 4I48A 1ZVHA 1NA8A 3S36L 1Z7S3 1OLZA 3QUHA 3HCVB 4HUNB 1BVOA 4F9PC 2J1ZA 3BO8A 4WFEE 5TF1L 2KUTA 5F5IA 1UCBL 2X12A 1F1AA 5MEND 3PL6B 3ZX7A 2K6ZA 2RQ8A 5L7XL 1C16B 3FSOA 4RA3A 1UIKA 4QHNB 4F3JA 4AM0A 1C5DB 5I30L 5E1HB 2R29A 2JXMA 1GY2A 4JLRA 3OTFA 2GBVA 3SH3A 3LD8A 2PO6D 1WAPA 3CQQA 4QXGH 2K9ZA 1T4WA 3MLUL 1I1YA 4KJQD 4CEYB 4YZFE 4OF7A 1AYM2 5IG7B 1AGBB 3I9GL 3SBQA 1EAH2 2BWCA 3EQEA 2ZAGA 5FYZA 4I1RA 4DGVL 3LN9A 4MYPA 2IBGA 3NA9H 4PJXE 4QKTA 4LAQH 5I1LA 4F80A 3O2VH 4OVVA 1EK3A 4X8JB 1VBD2 3TVMC 1LNUA 3ZXDA 1AR72 1TG8A 4WI2A 2F8VA 4JFFD 3F58L 4GUQA 2OZNA 1FYTE 1ZK5A 3FFDA 3K2UL 2CDOA 5IV2A 4FQHB 4ZX4A 5FV2A 2J8HA 4S2SB 5DHYA 5BW7C 1SFYA 3BPSA 1Y0LA 3TN91 1NE4A 1ZANH 3RWHA 4FBFA 3PWUB 4HMEA 4HZ1A 1TENA 4AXWB 4X5PA 1QU0A 3BTAA 4GT0A 2R1WA 2I07B 4EPSA 4JG0H 3FO0H 5G4NA 1T5WA 3T65B 4OLLA 1RUG3 5DUPL 1U36A 2VC2L 3UTTA 4HKJB 4YNIA 2H1XA 4YL9A 3R06B 2BP5M 3OOXA 3CFCH 4AQ1B 3VBHC 1O5PA 4YVNA 1CFSA 4KTEL 3KB5A 2JNZA 3KPRA 2AK4E 3OHXB 4NQSA 2EVIA 1J9TA 2OKMA 3PWJA 3VGBA 3TURA 3UERA 1JBCA 4KJYB 2J55A 4OF0A 3TWYA 4M61A 2HLAA 4G7QB 2P7TB 4Z7VB 2JF1A 5HYIA 1IPJA 1SXCA 3V0VA 3UABA 5HD8C 3IZOA 3ALWA 2HEVF 2DBLH 2VTFA 4HJ0C 1Z3RA 4XN1A 2R51A 1I5ZA 2HT2C 4BEIA 5H35A 3T4YB 1E3XA 5AVAA 5FYBA 2OQJA 4Q74A 5DJYA 2K6YA 2WT2A 4OI1A 2FBJH 3WDWA 4CE8A 5IK5A 3QUML 2EICA 4PV9B 3GZTB 1Q3EA 2YA0A 4Q1RA 5KSAA 3TZVB 1N64L 5EZLA 1KDMA 1U5YA 1K5MA 2HT3C 5ALCH 4Y2OB 4IEFB 3S7EA 3JWOL 4RZKA 1UASA 4GW4B 4L8SA 1RZ7L 5I17A 4PYGA 5T3ZL 5DG2A 3GYRA 2LW8A 2KHAA 3LIUA 2ADGA 1BIIB 2XBZA 5CEZE 4AJVA 2PYED 1RXFA 5L2KB 4NQXA 5LBSA 4QB2A 1N7MH 1U5XA 3NWKA 1PZBA 3HG1B 4P06A 1WBYB 3IU4L 2C3GA 4DMIA 3QR0A 5GZNC 2VPVA 4Z3FA 1RUD2 1FHGA 4V1PA 5LWBA 4XO8A 1I8LC 1OCRB 3MRNA 4XBPB 2KQMA 3QG6A 1J0ZA 5HYJD 5JLVA 4FP8L 3AZXA 4PVLA 1R5VA 3QPXH 4I9XA 3QIWB 5JDSA 2VNCA 3UBXA 3FHEA 5L4MA 2MIZA 2R0ZH 3MDJA 4UV7H 2QQKA 1PSKL 3QUXC 3I6LD 4U1SA 4BA0A 2H3KA 5C7XH 2VMIA 2WZR1 3TOJA 1T2XA 5LVEA 3SPJA 3NGBC 1TCRA 4R96B 2A74B 3D50A 3O8XC 3KXFB 2Q4SA 4KWKA 1I1RA 2BP3A 2OW4A 1G7MB 1WGOA 2PR4L 2X4SA 1WQVT 1RU9L 5IVNA 1YPZF 5F89B 1JXJA 1UY2A 2NQYA 1CZTA 3RWFA 4IIQC 4NFDA 5IK3A 1OPGL 1VERA 3WUWA 5CFCA 1NZIA 4ONUA 3D2UD 3BFWA 3TBWA 4OQTH 5C6PB 1IEAB 2V3DA 4XFGA 3M17B 1T80A 3Q8CA 1PFOA 3U6RA 4OLZH 1XCQB 1ZZ6A 3KLAA 4JZJA 2UVEA 3G9VA 3GBNL 1KYDA 4K3GA 4PB9H 3TTSA 3MPBA 3AXDA 4C57C 4A38A 4AHZA 3NSXA 3VUAA 3DDGA 5CXPA 1V10A 1X5YA 2DL2A 3GZKA 3KYOA 4WY7L 4XJZA 2WZAA 2YAMA 2WYZA 2W0LA 3E1F1 4X6CF 3TVMD 1IS5A 1BD2B 4GJZA 3D85A 5C0DA 3U82B 3LN5A 2P2KA 1RZIB 2X40A 4EUPH 1QBLL 1ZBA2 1Z3GH 1WAAE 4KDWA 3AVSA 1YN7B 1AYOA 5K9KB 4KOBA 4MXVE 3JVGA 2FJFB 2PW1A 2VLJB 3HI5L 1BGXL 4ODHH 2OCJA 3H2PA 1SMOA 4LHUB 4ORGB 1MS1A 2D98A 1TNNA 3HPNA 3V8OA 1N59B 3NAAL 3IM1A 2QKIA 5FV1L 4G4FA 4QU2A 4UT6L 4QHOA 3GJAA 4HK0B 3I4IA 1MHCA 1XEUA 1QXPA 4Y8DC 3MEPA 4PDWB 4DVRL 1F2NA 4HKXA 4LO7A 4D6RA 5IW3A 4UBGA 4NIGA 4EROA 4IRSC 5T3XL 4L1DA 4GXUN 4HLEA 1BXUA 1KG0A 3LMJH 4DPAX 2GT9B 3TH2T 4QHMA 2V5SA 4KTGA 2O4EA 2WB7A 4K8RL 5L8JB 1DL7H 3VRJA 2XDVA 2BIPA 1NFDA 1TZHA 2ET7A 2WQ8A 3ZHKA 5DAPA 4RISL 2OT7A 3RGVA 1EMTL 2BERA 4G1MB 1VP6A 4YARA 4IMLA 4HJ0D 3UTZB 2VLKA 2WCSA 4UZSA 4HZAA 2LTNA 1A47A 3HZMA 5DJDB 5MP6H 4BQ8A 4ZD3L 1MREH 4NQQA 5AB2A 5FKBA 4Y4KA 1ZLSL 5CKNA 1N1VA 4J3OG 1MI5B 4YDIL 3LPGA 5IMLA 2CKNA 4B1MA 2D7QA 3PLQA 3OD3A 4MAYB 5FO8B 4NO0B 1YDPA 4A7QA 3LIZH 2HT3D 4KKCC 5JXIA 2VZVA 3HZ3A 4ABUA 4IL7A 5C3RA 3GWJA 3HS9A 3MLRH 1DBMH 1WIUA 1JGIA 5IHZA 1MRFL 4R7XA 2NW3A 3V4LA 3ZE1B 4EV0A 2EILB 3VD9A 3D48R 3SD2A 2YU1A 1N18A 1A8ZA 1B4TA 2HFTA 5KHGA 3LNHA 3B9IA 4IGBC 2B14A 4P5MA 3B69A 4NRZA 1AUYA 5FZ3A 4XX1E 1XGZA 2Y5TB 2OMTB 3EUDA 1FFNA 2UWEB 1HRI2 3WLBB 1MVEA 5C8WA 1RSFA 3IDUA 4DN4L 2G9GA 4NHMA 2OW6A 4MRCA 1K5NA 3UAAA 3AMNA 1NIFA 3CU7A 4G8IB 1HYRC 4HHWA 3TBCA 4AJYV 4B6ZA 3BVXA 2XI9A 4LVOC 4U7SA 4QRFA 1BVP1 3ZUCA 4NIIA 3NABH 2IMMA 4GRWB 2ITEA 3D3VD 1IG3A 3BZ4B 2ZPXA 1V5JA 5H9SA 2EIJB 1NUDA 4XCEB 3O8XD 4DOUA 3P3NA 1T7YA 5D9SA 5GS1B 1BXAA 1YMHB 4LHQB 1WUZA 2PTMA 5C0CD 3UCQA 4JHTA 2W9DL 5F3BB 1D2PA 4X9HA 5I1KH 1U2HA 1YEHH 5KBDA 5BNPB 1HU8A 1OCWH 1FNEA 4JFDE 4LVNB 2NOYA 4B7LA 1A7NH 1DBAL 4J1UB 1FZOB 4RGOL 2VD7A 3C5SA 5DYOB 5FZFA 3QHZL 2R4SH 3AB0B 4OGYH 4LHKA 3TEXA 4J28A 4PBWD 4RIRA 4YVUA 5A3WA 2W0XA 1HC1A 4LARH 1GMEA 1ZM1A 1FUNA 3VFVA 1JUFA 1R3JB 3W20A 2WZR3 1ILSA 4LLOA 5B4XA 3U10A 1E42A 5JNYB 3WG4A 4K40A 3KPQB 3TC9A 4DAGH 5C09E 4TVUA 3ZIXA 2JKIS 5D70L 1WD9A 4DW2L 2BSRB 5FFOC 2YKKA 5KHKA 4U36A 1WRFA 1WCDJ 2CSGA 1OT2A 2R1YA 3D5OF 4YVWA 1AXSB 2IDUA 1LR5A 4A3XA 5IB5B 4Z1VA 5HGGS 5F5QA 4HHGA 4QPIA 2HCZX 1S0DA 2PYFA 5DT1L 3T6ZA 1MFEL 3SEEA 3VSVA 4MD5A 5JW3H 2F54D 2BNRE 1RUMH 4AI2A 4BPZA 1ALYA 2VSDA 2WJ7A 2ZNWA 3KDMB 5G4OA 3U6XA 3UG5A 2R59A 2UY6B 2VZ3A 4JHUA 1JERA 5HHPB 3T9WA 1WIPA 1MXGA 3WELA 5MEOA 5FY7A 1A14H 4TTDC 4O2EA 3CFBB 4Q0UA 2OW7A 2XV3A 3TN0B 3IFOA 3KT4A 3BEWA 4K71B 5D4HA 3NSJA 3KPSE 4HWZB 3U1XA 1KJMA 4CVXB 3BAJA 4K94C 4EJ1C 5DHVH 1O4ZA 2R042 3NNGA 4ISVA 3AU1A 4AC4A 3MACH 5D1QE 4BQ5A 2AEIT 1AMXA 2E7BA 4HANA 4DP0X 4F5CA 3TPUA 3L2LA 5A6YA 2OSWA 4WFHE 4GRLD 43CAA 5CCGE 3V7MA 3MNZA 1OTTC 2PLTA 4HJTA 5IQ7H 3LD8B 1D7BA 1LVEA 1Q0YL 1XGRB 3FQ2A 3CJXA 5A2FA 4C56A 2QDNA 3VDAA 4IEVA 4AQ6A 1M71B 1NCIA 4ELKB 1QLEB 3CIAA 1DG6A 3PPEA 4F37K 2FJUB 1NMAH 3B2MA 2HTLC 1WPCA 3ARBD 3NCJL 3Q13A 2ZZQA 2VLRB 4J3TA 2LGNA 1BJMA 1MNNA 2R69L 5I1LB 5EDXA 1K4CA 1RVFL 1T0NA 5FXCH 4AJ0A 2DTYA 1SFDA 4KKCD 2D31A 5K5YA 1UZ8B 4HD9A 1A34A 1PVHA 2VDMH 4AK2A 1ZEAH 2GKIA 4L8SC 2EUZA 3BWZA 1F4YH 4AGOA 1RZFH 4NE9A 4OMCA 1THAA 4H8VA 4BZ2L 4KWLA 4MNQA 3ZDSA 5FIXA 2B4CH 4IGBD 4G8EA 2XWTB 3SJVD 1TSHA 2DM2A 2ID4A 3SITA 3K6NA 2XWBB 1LODA 3QDGE 4DP9X 5A2AA 1QHPA 1V70A 2D2CC 3CFEA 2ZWYA 5E8NB 1BFOA 3KGZA 2O30A 3VYPA 1YMMD 2NY6D 4GUOA 4OZHE 5EU3B 1BWWA 4UI9L 2IQ9L 3A4FA 2WNWA 1DZBA 2JG8B 1AGCA 3MZGB 1HSAA 3GMMA 2V3FA 5E9DA 3IETA 3JWNC 5JR1H 5ESQA 1H9VA 4BCUA 2X53A 3IE4A 2G2PA 2OZ4L 5D1IA 5J89A 3BALA 3CMGA 4AGMA 4F92B 4WZFA 4KV5F 4M61B 3LYRA 2BRTA 1AO7E 3BWSA 3WSOA 3UJTH 2GH8A 5B1KA 3S96B 4DINB 3ARGB 3L2NA 2OX5A 4S0TD 4N43B 3MRKB 4ASMB 3K5SA 4YHLL 1D6EA 1HEHC 4B53A 2OQJB 1D5XA 3OJDA 5B3NA 2GBAA 3BTXA 2DVGA 1QYGH 3C8KB 1HLCA 1BEXA 1NAMH 1QSFB 3C12A 4MGTA 4DPCX 2NY2D 5DZVA 1K4DA 3RG0A 1HJCA 5D7JB 5E2JA 5A6MA 1XTMA 4QHKI 4EN6B 2PXYB 3FU5A 3P4LA 1DUZA 3N42F 4MAUL 4LKFA 3W58A 1OCZB 1KLGA 5LDSA 1XBFA 4JG5A 5DC4B 2Y26A 1M7XA 2YUWA 3IDMA 3NFNB 2AXFA 4RFOH 4AC2A 4JDOA 3VXUA 2BHFA 3F6JA 4JRXA 4UNVA 5H2BB 5E2VL 1AXZA 4Z18A 1J3QA 1P7QB 3QUYB 1JPTH 4L9DA 3EJPA 1YY8B 4JPVH 4L9BA 2B39A 2Q30A 1KUMA 4G42A 4F58L 3FLRA 1F9KA 1ZJAA 4IYKA 1RUPH 2ZCKH 5T5FA 1IEBA 1UPSA 3H54A 3HAEB 4QI3A 2OK0L 3SB3A 3GM8A 1GW6A 2O26U 1GYVA 3GO1H 3EO0A 5F3HA 3KWTA 1R5VB 3HNYM 4YEEA 2GC7C 3WFEL 5DF0A 4M6NH 1P7KA 3QUZC 4TTDD 4U1SB 1RFDL 1ODMA 3FN0H 4UTCA 2DQJL 3D0JA 5JI7A 3UTTD 3HG5A 3LZLA 4PJFF 4XNQB 5HGHA 4G8GB 4BIKA 5BO0D 4QX8A 3VKOA 3BU0A 3AP4A 4W50A 1PZAA 3WSQH 5KBKA 4DY3A 5B39B 1U95B 1XL6A 5DJXB 1Q43A 4QHZA 1TQBC 3KPRD 5E2TL 3FF7A 1QPKA 4GWIA 4XVOA 1RVF2 1IG0A 4O58L 3RL2B 4BA6A 3HE7B 1OFNA 3MBXL 3SGJA 5B7FA 2IWFA 3O6LL 3RVUC 2D5HA 3SKVA 1OTTD 4BMEA 1N26A 5LK5A 2WIIB 1H6TA 3O6ML 4JKWA 4MD0B 4Z76A 2P37A 3K4DA 5IF0B 3EOAB 4UI2A 4AI1A 2Z91A 3KLAB 4PJEE 1DQLL 5KYUA 1SLIA 1HL4A 4BUHA 4IEQA 1NBYB 3EF7A 2EEXA 3L3KB 2LRPA 4HLZG 3ARFC 4ZUSB 5AZ2H 4PMEA 4BM7A 2BIHA 1NIBA 3L3DB 5F1NA 4EMZA 4R2GB 3IXTA 5GRXG 3WKMH 1HHIA 5KSAD 2ZAAA 3BVWA 4GB32 3U0ZA 1X9QA 4A2EA 4Q6KA 3D85B 3M88A 1L0PA 3FTVA 2A5ZA 3NV2A 1RUQL 1IBFA 5C9AA 1LL1A 4KG0A 1VAMA 1CR9L 3H0TB 4WM7C 1DDHB 5E51A 1ZHBB 1BAWA 3TM6A 4KTDL 3SKNB 4OZIF 1S5HB 2O72A 1W6QA 1FH5L 1QKQA 2RIKA 1FVCB 1BLZA 2I9LB 4W6XA 5J09A 2ZX3A 2XHKA 3T2TA 4GKOA 4ZSOA 2QKIB 6PAZA 2QDWA 3AMMA 4F7TB 2YZ8A 4JBSA 1NKRA 2AAAA 4GUPA 3AM8A 5K9QG 4PJIE 2L7JA 1H3UA 3MYZA 5F7HA 1J1OH 3NRUA 3NSFA 1Q9KB 3EJKA 2ORBH 4BE3A 1RK1A 4HKXB 2IAMA 2HKFL 3QORB 1ZLUK 2ARCA 3RVHA 1MJ7L 1NCQB 4BKSC 4TSAL 3HRZA 2OSXA 4AMKH 4KU8A 3BPLC 5FLHA 1UXSB 1NFDB 2QKSA 2VR7A 1FFOB 3RGVB 4HVRA 4KI5C 3FBYA 5HGAA 5DJ8B 2VLKB 1JDCA 1R24B 5DD5L 4NGHL 1NBCA 2RMU2 3FULA 2BNQA 1EZVY 5C08E 1QJX2 3FX3A 4QTIH 3N50A 3K75B 1ES0A 2GJ6A 2XRAH 4WI5A 3ESOA 5I9QB 3WFDH 1NC2B 3GSQB 1IC7L 3V9CA 1QZ1A 3ULUL 1DBJL 5F1IB 3DYOA 2DM4A 4GLRI 4WKZA 1TEYA 4LIVA 4ICWA 3S35L 3HC0A 5IB1A 4LXLA 2OCFD 4MVTA 1U91A 4X7SL 2QLYA 3R4DA 3UGUA 5A16B 2W1UA 2XG5B 5A6LA 5SWZB 3CVBA 5C71A 3DXAB 4FNPA 5DVKA 3PVOA 2BP0B 3MLPA 2EIBA 3S7GA 3L9EA 1XBDA 1TQVA 5IK8A 1MCOH 2NNXA 4URAA 4AYID 2KKQA 3ML8A 3VI3E 2V2XA 1ZLWK 1KNOB 2EIGA 1NJ9B 4UQIM 3OKEA 4IBUA 4WEBL 4UUJB 1YAIA 3EFDL 2VXUH 4M5ZH 5IW6B 1DZRA 4COYA 3ARUA 1AR91 5KVEH 4NWTH 4JQXC 4W9IC 1RP8A 4LCWB 3COOA 4L1HA 2JENA 1R3IH 2ZX2A 5IW0A 4MMZB 5FHBH 4OQ1A 4LDCA 1RUJ1 1A22B 1VGKA 4NUJA 3QUZD 2XG4A 2C3XA 3SC7X 4LUMA 1F90H 3NEXA 4J7RA 1N5YL 3DVGA 4PGCB 1MRCL 4LL9A 2KBGA 4CDWA 1U0AA 1MJ8H 5CIPH 4KPHH 2JJ6A 4V1DB 1RUAH 4ZK8A 3QJHB 4ISRA 2WZPP 1NSNH 5HCAA 1BZ9B 3NT0A 4JW3A 3AP6A 4NJ4A 2ZHNA 3QO1A 1FORH 1WA6X 3NNFA 3G6AA 2ZOKB 1U3HB 4TVPH 2XETA 3FUNA 3MLSL 4Z7WA 5EC1A 1E57A 2NDFA 3L1OH 5D96C 4ATWA 1IAIM 1U2YA 1FATA 5KSBA 1DVQA 5E94B 2IH3A 1JYWA 3I50H 2YUEA 1LD9A 4WEEA 1A1MB 3RZKA 1ROWA 4LSVL 4Z7VF 2N0MA 2WO3B 4DO5A 1N6QH 2FR4A 1D9KA 2XXGA 4D6SA 4ERSL 1JUFB 1KOAA 1ND3B 5I8OL 4Y4KD 2HUHA 4UM8A 4Z95H 3GFUA 1E8WA 1MJUL 4D8MA 3MJ8A 1JGEB 3ULVF 3FT1A 3QCUH 2MCPH 4KKAD 5LNGA 4RN5A 4L8BA 4EWAA 2BSSA 3VFTB 2GSIB 2WXHA 2R1YB 3RIKA 3VJ6A 4IOIB 4DVBB 1I85A 1GAFL 1ODNA 3PWLA 1YA5A 3ZTDC 2ZTBA 5PAZA 2VTXA 4PCRA 4MCZA 5HVWA 2HLFC 1I7ZA 3HB3B 5FFLA 4OJFH 4KBZA 3ZXJA 5FPVA 1A25A 5DZLA 1O4TA 1OB1B 3WE1A 4LSQH 5MEOB 1J5OH 2PLV1 1B4LA 4KRLB 2WLLA 4IGOA 4KVNH 1S0JA 1A9EB 1WO2A 4GS7C 1BWMA 5CGTA 1UYWL 5AW2B 5DI8A 4N9GA 1KJMB 5D2LA 5HJBA 3UX9B 2ITDB 1IZKA 1OD7A 5FXWA 4MGQA 5GJTH 4KZEL 5CM1A 1QTPA 2OSLA 3E2HB 4BQBA 5B1BB 3AACA 2H2SC 4B95C 1CAUA 1G9NL 4X99B 4MWFB 1D2QA 3VFOA 3P0YL 3F5WA 3FRPA 5E7BA 1X5JA 1UACL 3TJHC 3CSPA 4L3ED 4ESKA 3JCIA 3OGSA 2EDFA 1R0AL 4POZC 3FZUC 3ZE2B 5C0BB 4YHNA 1DUYA 2AK1H 3MZTA 2WO7A 1TUPA 1ND2C 1W0VB 4C56B 4NHLA 1S7WB 4RA0C 4PRIB 2GSYA 3RL1B 1QRNE 2EDXA 5JORA 3KHCA 4B5ZA 3IRPX 5CZVH 3QIBA 4X4XB 1USZA 1PK6C 1BZOA 2FSEA 4GKZA 3AX4A 3LZPA 2ZXDA 2CLRA 2KD7A 3Q8EA 5FDYA 3ASWA 2R30A 2CO1A 2ZSWA 1H6UA 1H8LA 4Q4Y1 4QMAA 1X4YA 4ZBJA 1QBBA 3OJ2C 3F83A 4XUPA 2E7CA 2V17H 3N1PC 2IPUK 4ADIA 2VIRB 4JO4H 4BSWB 4W93A 2F1BA 4PLOA 4CBZA 2HWB2 4FT8A 2XA8H 1KWKA 2YA2A 1MRDL 3KCPB 4G8EB 1UH3A 1U8MB 1DR9A 1WCQA 4CRPA 4OJYA 2R0KL 3B6SA 3BWAB 1IMHC 1OGPA 5HYQB 2COVD 1R1ZA 3BHBB 4HONA 5JO5A 1YECL 2COQA 3GEWB 2VABB 3ZXFA 4PS4H 5FPXA 1OANA 2FZ1A 3AITA 5IFTA 4WCYL 5MERB 3JV6B 2G75A 3HBKA 4JZOA 2XQYG 1LM8V 4DF9A 2P5PA 5A7BA 1NGPL 4LLDA 3CX5K 3MRPA 4P2OA 3V9EA 4AQAA 4FPCA 1XIWB 1GGBL 3PAYA 4YIQB 1DVFA 3MBWB 5GLZA 3U0WH 1RZJH 1R3HA 3PHQA 5L4FA 4RSYA 4YPGB 4TLFA 1V7NL 1WH0A 3O4LE 3W9EA 4JVAA 3ASNB 1FN4A 3SKMB 3ACHA 5AZEL 5I8SA 4UQEA 5LEKA 3EHBD 4Z9KB 2WANA 4R9CA 1KY7A 3ME0B 2MH4A 3SGJC 4Q2FA 2FBRA 4C1XA 1AR93 5SX5H 1BQKA 1E8ZA 3HBQA 1F2XK 3IXAB 4XMZA 3BGAA 2AENA 1J86A 3BKJH 4ALAH 4MGKE 3L81A 2O5ZL 2EDLA 3EYFA 3AY4C 3ETBJ 1SHXA 4PJ8A 1DUZB 3ZPDA 4DT2A 3N41B 4F3FA 1RUJ3 2IZWA 2WNUC 1PYWB 2LHAA 2GSGB 3BLPX 3WEXA 3MTXA 1TQUA 2RALA 1U8JA 2R4RL 3LRLA 4LRNL 3SO3C 3F8UB 3JXSA 5FYVA 43C9A 2SLIA 4JRXB 2NY4B 3TA3C 4B0MM 3CX5J 2OCCB 3Q2VA 1QJU1 1OA2A 2CJSA 2B59A 3D39B 2D44A 4FQZA 3Q6GH 2FWLB 3VXNB 4KU7A 1K5WA 3MREA 5HHQB 4R9AA 3MYJB 4PRAA 1ORQA 1KPRB 1P0SE 3JV4A 2NZ1A 4JANB 3S3JA 4FQXC 5T3XE 4MNQD 4DUVA 3AKSA 3SOBL 1E9PA 2HLFD 3D08A 3QJRB 1LOBA 3RX9A 2C4FU 3ZE1F 4HA1A 5IQNA 3LOBA 2JTYA 2QVTA 1FHNA 4QTFA 5EH1A 3QSKB 4DP4X 1P7KB 3RJQB 1YNLH 3QEHA 5MI0C 1D0GA 4G6FB 4AENA 2JJTA 2OYKA 1Q8PA 1W72A 4KK9D 4LUKA 1NDMB 4AVCA 4UDTA 2UWEF 1Z9OA 1TQSA 2PHLA 2YYOA 3KYKL 3K46A 1ZSDA 5TE4H 1LP9A 4GPVA 1XGYH 4HS8H 1IGOA 3RZJA 4TQEL 3RTQB 3AQDA 3S3CB 5I24A 3BP7A 1HI6A 1RITA 1I9RH 1SZBA 2AABH 3PUIA 1QGLA 4IGQA 5DURB 1BF8A 3OGRA 3FC8A 4OZGA 4POZD 4YXLL 1P4BH 4IJ3B 3FUEA 4P5TC 1BPLB 2OMZB 4GRWF 1R34A 5DWPA 5E00B 2Z91B 5F9AC 1Q9OB 5T1LB 1CFQB 4X4KA 3TBSA 3DK0A 4BFEA 5HXVA 4XE5B 2WBKA 3I02B 4MNGB 2YK1H 5E2WL 4EDXA 1I9IL 1THCA 1J48A 3HG2A 1YQ5A 2BGCA 1CT8B 2PLV3 4KMLB 3TJPA 3WXPA 3IXTB 1CG9A 4N0UA 4Z7UB 5D8AA 5DUML 3VHRA 5A1LA 2W65B 2YD9A 2ZXAA 1D4M3 4ONGL 2AXHA 4Y4FC 1BBT2 2D3RA 3QIUB 2AW2A 2G9HB 4LIQL 3S88L 2C24A 5FZDA 5F44A 3CNAA 2R9HC 3Q3GB 2G9FA 3NJYA 3HAGA 3OLIA 2YXSA 5DK2A 3MNWB 1JVOA 2KZKA 3Q1SH 3O1UA 1AE6L 3CFKA 4W6XB 2ETWA 3PDQA 1UCTA 2WAHA 2O93L 1F58H 3L5WB 3OQ3B 1NFAA 1OL0A 3IGFA 1Q9WA 4GUPB 5FWRA 3KYMB 4NDMA 1UM4H 3USUA 4DFIA 4G3YC 5JHDB 1RMFL 5C0JA 3J7LA 3WENA 4ELDA 2VWEC 2CCLA 3N40P 2JKJA 2XACC 1MFBH 3E80A 4XWGH 4J1XA 4O02B 4Y16A 4Q4Y3 4Z7QB 3SY6A 4AF9A 4H8WH 1A4KA 1DQIA 4YR6B 3EUUA 1JPSL 2EH8H 1NGWA 2BOLA 3ILPB 1XPWA 4N2BA 3VXRE 4N53C 3ZZSA 4WHDA 4Q9RL 3QDJA 2AV1B 3L17A 1SDDA 2RFXB 2LT9A 3FU8A 3O11B 5JI9A 2DIEA 4FZEL 4GSXA 3AFKA 2Q7YA 1FSKC 4YW3A 4G5ZH 2H7WA 4L0PA 2AJUL 4YBLB 1W39A 2EXKA 1VHPA 4NBYB 5TDPB 4S2HA 3GMRA 5SV5A 1Q8MA 2VR6A 5HVGB 2OMYB 2KLSA 3FB5B 4RS5A 4WKZB 1E28A 4YZWA 2FWOB 4D9RE 3BWUC 1QPXA 3HC0B 4RGNE 5CADA 4LEXH 4IV1B 2BZDA 4HVOA 1QFOA 1TNFA 3B7UX 1AS6A 3BSZL 3U4EA 3ZRCC 5FDWB 3KCYA 1AXKA 2X6VA 3MIGA 1E5ZA 1JN2P 1JI6A 2OYLA 4Y89A 2VH5L 4NUQA 1SHSA 2FUTA 2AQ3A 1B0RA 3SYCA 1NEZB 1JZ4A 1ENQA 2VO8A 1WISA 1JWMB 4GBXA 2BWIA 1YNTB 1BZQK 3MW2A 4HEPG 4XB8A 2VDRH 4QXTB 1FLRL 1T5KA 5J56B 1ZDQA 3VKFC 1ZLVK 4AL8L 4E42A 2WQSA 4XNXL 3HD8B 1E90A 4FQXD 4FABH 5HDOA 1FL3A 4AXOA 4JFEE 2JK5B 4XVSH 1OQDA 1VIWA 3MRGA 3Q9QA 3POFA 4PJ5E 3FRUB 1HNYA 2DTWA 3IN0A 4MS6A 1ET7A 1LILA 1DSFH 1QQDB 1VGKB 4NUJB 4P2RA 5EBGA 3QUKA 3HPLB 3UGEA 4CXYA 2UYAA 4KQ3L 5D1XC 3C2AH 4J12A 4OV5A 1UWWA 1QAWA 4V2BA 3AKPA 4L3CA 4RMRA 4NROA 2QQIA 1BQSA 1QJU3 3IE9A 4FAGA 2IAMD 4DEPC 1E5YA 4NRXA 3RRQA 4PJ9C 5IBTH 1RIHH 1UX6A 3CJIA 1ASJ1 1RHFA 4IBVA 3G6AB 2CHDA 1KTDA 1COBA 3MC0A 5DQ9B 5BV7B 2V2WA 3L5XH 4J3BA 3MLWL 2XVBA 1SPPA 2DYRB 4A4AA 2CK0L 2BSTB 3DYPA 5CSZA 4P5TD 3LRHA 2V73A 1R4XA 2ZONA 5ELIA 1DHKB 2E3VA 4HP5A 3TEWA 1AD0B 3C6LC 5E6RB 2AP2A 4LULA 4ZFZB 3POGA 3OG2A 3KS7A 2FR4B 2BNQD 1EO7A 2J1YA 3MV9A 4NO2A 2VVEA 2GJ6D 1E43A 3K8KA 4XP6H 3K71B 1FYHB 1YEIH 2GIYA 3WQ7A 3UAFA 3POIA 1YLLA 4EI6A 4RNRA 3TJEH 4Y4FD 4OZFH 3NJHA 3WD5H 5DUBA 4XB3A 1AJOA 4KXAA 1BVLA 4TS6A 3ACFA 2R9HD 3AXLA 2FB4H 5ICXA 3BI3A 2H32A 3PWLB 2Z5WA 4FPFA 1L6ZA 4UTAH 2Z2SB 3TL5A 3CFTA 5AD0A 1HB2A 1PG7L 4HC1L 1UD3A 1JWUB 5EWIH 4PLKC 3TFKC 3WO4C 4EN3B 4F15C 2OMXB 2PF6A 4QHUA 5EEUA 3PVEA 4Z82A 2WMPB 4J3OD 4P3DA 4HXAL 2Z35B 3MRQA 4G9DB 2LLNA 3AROA 3MXVH 5GXBB 4LBAA 2YC2A 3UP6A 1DIWA 5B8CC 3D3AA 2NMNA 1ETZA 1YPZE 1ZT4B 3ARSA 5CSBA 1NBQA 1NGZB 5DI8B 4N1HB 1VE0A 2VNOA 5GGTA 5JXAL 4NLAA 3KR3H 5AVUB 4IE4A 5IOPB 3D18B 5F6IC 4UAHA 2SEBA 3V4PH 2UXFA 3F7KA 3N9OA 1ROCA 3W9DA 1CBVH 5JSOA 1DVFC 4BH7A 3AVRA 4FPHA 4GXLA 1BVZA 1S9KC 1KCLA 1QFUH 3CPUA 3OC5A 2B5IB 4M9OA 4MTMA 5EF3A 4OCYH 4GAFB 5ENWA 1A1OA 3GJEB 1KT2B 1UCXA 3MLJA 5E4IA 4CMMA 2RB8A 3EGDB 4LBOA 3VBUC 5D1ZA 2YXVA 4NN5B 2Z6FA 3X11A 1TVBA 4X4ZA 4FXGC 4PG2A 4LKXA 1I6XA 2VDKH 5F7DA 2R8SL 4BFIA 1UM5H 5TQ2L 3PHAA 4HH9A 3GHMA 5F9WB 2F61A 5I5JA 3LKSB 2V37A 1D9KD 4AVJA 4NQEB 3VXMB 1IUZA 3K48A 1DN2A 4NCC1 4AYDC 4P9GA 5ALBL 5DD3H 3MRLB 3IPEA 3E6FA 3RY6A 4RGAA 1E4WH 4RFEB 1ZS2A 3INAA 5KVGL 4F8PA 1B0WA 1EAJA 4RQQB 1ENRA 3LFMA 5J7MA 3KVDD 4HHAB 4HPYL 4XJAA 5JO5B 1FMD2 4KI1A 3WEZA 2VOKA 3GSUB 4FL4C 1M57B 4NHUA 1U8NA 1E8XA 2G3MA 4ADGA 1WTGT 2N4IA 2HG0A 3N40F 2W92A 2V2TA 1JMUB 2G75B 4JZOB 4HCGA 1U33A 5F7NC 4CC1A 2KMWA 3LKNA 4L2YA 4OIIL 3VD1A 1CI5A 3DPRA 3ZFGA 4P2OB 3O6FB 3SE8H 5KAQG 1BOGB 4WGKA 4KFZC 4Q4V1 4MYWB 5FZ1A 2I5YH 5EQUA 3KWUA 2DEXX 4LOUD 2X3CA 3PDDA 3ZDYB 4QRPE 3CFJA 3W9EB 4XVUC 3DX8A 4X7CC 2ZP0T 1V00A 4Q8KA 2YC0A 3L4CA 2PCYA 5H37A 4R4FH 1C4RA 5CFDA 2XQYA 1BLNB 2D40A 2WV3A 3DUIA 2GK2A 4OKVB 1YJDH 1I5PA 3Q43A 3AKTA 4YBHA 4LLYB 3V5DA 5CD3A 5IVXB 4FLHA 5C70A 1NFDF 1SJVA 3CVIH 1U2CA 2XJLA 1S7RA 1JVKA 5I0DA 1ADWA 3QIBD 5EU6B 5ID1B 3MODH 2X4UA 3BEVB 1NM9A 2OFQA 4QOKB 3KHQA 1WZKA 4WI3A 2DB8A 4N3TA 2KR2A 2CO4A 2IANE 3VDBA 3VWKA 1NE6A 5IM7A 3CDZB 2IXQB 2J25A 2NPLX 3JV0A 4G6AD 4UMSA 5L4IA 4UM9B 2B59B 2BZCA 5JIIA 4B3NA 4E8CA 3O9WA 3ZKXB 5AVTB 3M3QA 1ASJ3 1KENL 4TUJB 2VSCA 3RZWA 3WNPA 1ESOA 1P4LA 2BWQA 3P30L 1A6WH 5IY5B 1FIGL 4RRPG 2BDRA 2B1HL 1JVLA 5E08L 2H1PL 3TFKD 4N7UA 3S34H 1AQKL 1QH6A 4PIYA 3OSKA 4HFWA 4A6YL 5I6XC 3D05A 1CAWA 5ANME 4HULB 2CTVA 2F6BA 1G7YA 4P8QA 4N6QA 2FZ3A 5FYKE 2PW2B 1BEYH 3HIFA 2GVYA 1NIDA 1XF1A 5BRZA 3H7JA 4BIFA 5DFVC 1ECYA 1NX9A 1W72B 1YAZA 4UDTB 3V0WH 3D30A 2O5YL 4RSUA 2ESVB 5FF6A 1UOGA 1LO5A 3BDYH 1OV8A 4XB7A 5LY2A 3GLEA 1TEFA 1J05B 3MNVB 4U1JB 4YG6A 1HI6B 2E9WA 2ICCA 3NFPB 5JIMA 3SDAB 1DVFD 4NR1A 5L9RA 5D7LE 2ZGSA 1PZ3A 3AG3B 6FABH 4WI4A 4Q9CA 3F7YA 1MY5A 2OA9A 3V55A 5T1DH 3V0HA 5JHLA 1ONAA 3VXOB 1PZUB 5DS8B 1LHNA 3SGEH 4AFBA 2A7BA 4HQQH 4FZ8L 1OAUL 5HVFB 1U5IA 3M7AA 4MRBA 4Y5YA 5I1CH 2ZABA 1X7NA 4FQLH 1IAII 4DKEL 4EAEA 4OGAC 3ILRA 5D8AB 3OUJA 4WI6A 2YRZA 4TLTA 3RDTA 2XKOA 5FZ8A 5FUZL 4QXUH 2CBTA 1UWYA 4PJ8D 5G4MA 2BY3A 2GDFA 2HFFA 3NEOA 4Y26A 4YVSB 2XZCL 1X8MA 3O2DH 4OLYL 1JGDB 1B4JH 1O7DE 1J8RA 4PMFA 3V0AB 4LP5A 4F7CA 1J83A 5M0TA 1BZWA 5T5NF 3CVHH 2WM0A 3R6SA 4RL7A 1MAKA 1QBML 1DQ4A 2O1QA 4LTAA 3IDYC 1AX0A 1MQTC 1Q9WB 2LLGA 4PRHB 1WVZA 4GQ9L 3GSOB 2AMUA 4N90A 3USUB 2VJ0A 5IJVA 2DTML 5IEKB 1NINA 2P6CA 1VDGA 4FNQA 2PP9A 2F58H 5FYJH 3O4OC 4YK4B 3OKOA 3UC0L 3TAYA 1CGVA 4X7DC 2D43A 3OKKA 1CLYL 1CE6B 2CRMA 2VZUA 4OM1L 3DTXA 2OJZH 4NN7C 2G2NA 3T8VA 3QDJB 3FT2B 4OJCA 3TWCL 3W82A 1GZWB 2CV6A 4XVUD 5E2UH 4AVKA 3KLHC 3JTTA 4Y1ZA 1OB0A 1G94A 2G5UA 2Q7YB 2BH0A 2CO7A 1O5UA 1GIGH 1OUXA 4MXWA 1WICA 4L0PB 3RG1C 4A7GA 3QDMB 4FKKA 4RVBA 1Y7BA 3FQNA 4UT9A 1KIUA 2VDOH 3BPCA 1U9KA 3FCUB 2V8MA 3IK2A 4KJPC 1UQXA 3K4AA 4PRNA 1HQ4B 1MCCA 4ANKA 5F21B 3SQOH 4AT6A 1QXRA 1T21A 1C7SA 1UXLA 3HZYB 5KWRA 5EU4B 3RWGA 1R64A 1XSQA 2EDKA 2KM2A 3V79C 1A6TB 2RA1A 3OKYA 4JFFB 3U4EB 2JI3A 3ZE2F 4DGYL 2VCCA 4Q4V3 4IDLA 4NPYA 4H88H 3GTNA 1IOAA 3UTQA 1YY9C 3SE4C 2EXIA 2P5BA 3IPVB 5FZ4A 5LATA 1DE4B 4ZX5A 1IFHH 2P1BA 4IHOA 2WBJA 5TQ0L 4GMSL 5ITFB 3FCSA 4KJWD 4N2LA 1BCIA 4NQDA 4R90L 4U1KA 4M62H 5GRVK 5IMMA 2JQMA 1FL3B 2FT7A 3BP5B 3K7UA 3N0AA 4J2QA 3DJSA 1VIWB 2NY0D 4XUNA 1QKZH 2NX5B 4PJDB 5F6LB 3CMOH 1IGIH 4G6MH 5HYFA 2YDEA 4CDQA 1JNHB 3MFAA 2GAZA 3QUKB 4X5LA 2QADC 2QBWA 1DANT 3T8MA 5EA0L 2K3TA 1ZVYA 4WI0A 4C54A 5LBSL 4ZMOA 7CGTA 1HXKA 3QRGL 1CAVA 1F4WL 5DFVD 2HZHA 3FPXA 1DYOA 1U3YA 3WJMA 5BNNC 2NCEA 1UKRA 5ID0A 1JYIA 1XEDA 4NRXB 4ZAKA 1F02I 4CSTA 2NNFA 2BPBA 1OGAD 4Y16D 5B3JE 2F8XC 2ZGMA 4FTSA 2IXJA 4HK3J 1KTDB 2J6EH 3RGBA 3GXMA 4GD4A 2E7HA 2QQKL 2JIJA 4LO4B 4XEZA 3D0VA 5ABZA 1QFWM 5CEXA 3MOAH 2J6WA 5LXGH 1MZYA 4JDVB 3WL9A 1UXZA 1IC4L 4ODVL 1OWRM 3NIGB 3BQUB 2PELA 3FB8A 4KXDA 1Q94A 1H6XA 1ZREA 4X6FA 4WTXA 5I66B 4YE0A 4WKXA 1AQDB 2NY3C 4HDIA 1F18A 2YAHA 1H8TC 3UAEA 2FUQA 4IU3B 1LWRA 3GJBA 1UOBA 4GP4B 1BPVA 2CA4A 3LKPA 1BVLB 2YBKA 1EA9C 2WSUA 2O5XH 4C1WA 2UXVA 1HOEA 2JG9A 3F2ZA 3RKDC 3VFWB 2H32B 1XGPB 4YGAB 2GJJA 1W6MA 4BLIA 4HEME 2FK9A 2HFGL 5LDUA 1ZV9A 5AD0B 3RY6C 3N41F 4XUTA 4UW6A 2QGCA 3DOIA 4W4OA 4Y1YA 1K3IA 1J8HB 1GYWA 4GBXD 5D8JL 4AWDA 3PU3A 4HFSA 2BFVH 3PGCB 1DGWA 1I3HA 4JG1L 4XZPA 3H4HA 4PJFE 2JKXA 5CLTA 5LBGA 4X7TA 4PLMA 1GOFA 1L3WA 2W9EH 2B08A 2ZHMA 4XFHA 5E95B 2ADIB 1JRHI 1D5ZB 1EDQA 1DQQB 4TTGA 4P4RB 4WU7B 2XTJE 3W2DL 4CCLA 3RI9A 4Y8AA 2Q86A 3GMNB 4QDGA 3A3YB 4P2RD 2DQFB 5E8OB 5DJ2A 3TBVB 1YNAA 1WUNT 1YRKA 5MENE 2G0KA 4KO5A 4AKPA 3MIDA 1AY1H 3GJFB 1CGSH 4QRUA 1NKOA 3WDXA 5FFOA 2VOXA 3DBSA 2I24N 4C58B 5BVJB 5IHWA 3AP5A 1CXEA 2O0OA 1J88A 2F68X 2JD4A 3PMSA 5FZ6A 3P9LA 3BN6A 5EO1A 5I6KA 4P23A 2YZ4A 4PBOA 4N2EA 4JKPL 3NCWA 5I1EL 4FPOB 4IE6A 3RMXA 5ISLA 1YRZA 3NV4A 1IKFL 1QLRB 3K6SB 1IGFH 3VI4B 2AJ3A 3WXWH 2OQ7A 1PIGA 2VMCA 5A1FA 3ZIYA 1IFGA 3RWCB 2ZUWA 5F7DB 4FXKC 1BQLL 1IJ9A 3ABKB 3QFJE 4HJ1A 4KK8C 1FPTL 2CO6B 4M7KL 1Z9LA 5AW7B 5CGMA 3C7HA 4OZIE 3H8XA 4R4NC 4UTBH 3MV9D 1RL3A 2YBPA 3P0GB 4WWOA 1GHFL 1K8IA 2AJYL 5J9PB 1FA4A 4WNQB 2WSVA 5LBCA 4JM2C 1LHOA 4JRYA 4W6YA 1IBGL 3P02A 5F88A 3Q1EA 2YMZA 4H26A 4HPKB 4RGGA 3ZKND 4WO0A 5FAXA 4XX1G 2ORXA 3ROLB 5T54A 4BJLA 3PY9A 4OLEA 4Z7UF 3SKOA 2AEZA 2VVFA 1RJYA 4P3CL 1H3PH 1NLBL 4XNMB 3UPCA 1A0QH 2V2TB 3BVTA 4CTEA 5FW7A 4DNYA 2VDLH 3U7AA 4QQOA 2OSYA 5HJ3B 4D9LH 3E9UA 3VFPA 4QGTA 1KLFA 3VBHB 4ET7A 5HCHA 5EYXA 3ZFGB 2DLIA 4MJ5A 3BN3B 2QADD 2HKHL 3HJEA 3ACIA 3BISA 2YC1B 3ZYGA 4G82A 4KUZH 5CUSH 4Z7OB 3PG2A 2J1VA 2WWNA 3DX8B 1DSWA 1FZJA 3LNGA 1RZGA 4WHYH 3ETSA 4CPBA 4ZMVA 3FU3A 4LT7A 4F33A 4RFT0 1CQYA 3V65A 5I1JH 4ZFOA 1XSIA 2IO5A 3BH4A 2BIQA 4Z7QF 3VXPB 1IBYA 2DUPA 2VO5A 2OPWA 5E4EC 4LIUA 4DB5A 1CTNA 4WI8A 1G0YR 3SDDA 2QQNA 3GXIA 5DEGA 4LIQE 3I85A 4N28A 2Y0IA 3HEIA 1JG9A 5D4IA 3HN3A 1VBE1 1QI4A 1W0WB 1IX2A