3ZXAC

Structure and assembly of turnip crinkle virus i. x-ray crystallographic structure analysis at 3.2 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
295
structure length
295
Chain Sequence
b'QKVTRLSAPVALAYREVSTQPRVSTARDGITRSGSELITTLKKNTDTEPKYTTAVLNPSEPGTFNQLIKEAAQYEKYRFTSLRFRYSPMSPSTTGGKVALAFDRDAAKPPPNDLASLYNIEGCVSSVPWTGFILTVPTDSTDRFVADGISDPKLVDFGKLIMATYGQGAAQLGEVRVEYTVQLKNRTGSTSAQIGDFAGVKDGPRLVSWSKTKGTAGWEHDCHFLGTGNFSLTLFYEKAPVSGLENADASDFSVLGEAAAGSVQWAGVKVAERGQGVKMVTTEEQPKGKWQALRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN
publication title Structure and Assembly of Turnip Crinkle Virus. I. X-Ray Crystallographic Structure Analysis at 3.2 A Resolution.
pubmed doi rcsb
molecule tags Virus
total genus 18
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zxaC02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zxaC01
3ZFEB 4N43A 1QJX1 4SBVA 1ND3C 1EV11 1PO23 1AYM1 1HQNA 5D8AC 4QPGC 1HRI2 1VBB3 1NY71 4RS5B 1QJZA 5L7OB 5A33B 3TN91 1AYN3 1VRH2 1NOVA 3NAPC 2R062 1AR73 5CFCC 1TMF1 4RFT0 1VBC3 2RS33 1F8VA 1RVF3 4RHV2 3VBOA 1PO21 3JBG3 1AUYA 1A6CA 1VBB1 3IDEA 1VBD2 1BMV2 5J98B 1ASJ3 5C4WB 1V9U2 2R073 3ZFFC 1RUE3 4AEDB 1RUI3 1AYN1 1HXS3 4JGZA 1FPN3 3VBHC 1AR71 1PGW2 1VBC1 2RR13 2RS31 1RVF1 4GMP3 4N53B 4JGYB 1MQTB 1F2NA 1RUD3 3JBG1 1D4M2 4CEWB 2HWF3 2HWE2 5K0UB 1ASJ1 2RS53 2R071 4RQPC 5J96B 1RUC2 4Q4W2 5ABJA 4Q4V2 2RM23 1ND3A 1RUE1 1RUI1 1HXS1 1FPN1 5D8AA 4QPGA 1PO13 2HWD3 2RR11 1POV3 4GMP1 5BNNC 3VDDB 1NCQB 1RUD1 2HWF1 1VB2A 3NAPA 4IV3B 1EAH3 5CFCA 1B35B 2RS51 2XBO2 1R1A3 4CDQC 4Y5Z0 2RM21 4WM8C 1C8M2 3VBSB 1PO11 3VBFA 3ZFFA 2HWD1 1POV1 2BFUS 1MEC2 5C8CC 5C9AB 3VBHA 1FMD2 1EAH1 1QJU2 1R1A1 3J8F3 1PGL1 4Q4Y3 4QPIC 1VBA3 1VAKA 1K5MB 1QJY3 1R093 2HWC3 4IV1C 1BBT3 1BEV3 4RQPA 1ZBE3 4YVWA 2BFUL 1AR83 5BNPB 1COV2 3ZFGA 4YVWB 4CDUB 1AR63 1AR92 4N43B 4CDWC 3M8LA 5DDJ2 1FOD3 2WZR3 3J8F1 4GH4C 1R082 4Q4Y1 5BNNA 1VBA1 2DF7A 3ZXAC 2BPA2 1QJY1 1R091 2HWC1 1BBT1 1BEV1 2WS92 1ZBE1 5ABJC 4Z92B 4CDQA 4GB33 2RMU3 4CEYC 1AR81 5GKAC 3VBUB 1H8TC 1OPOA 4WM8A 2HWB2 1AR61 1VBE2 3VBOB 1FOD1 2WZR1 1Z7S2 1NCRB 5C8CA 1NA1C 1IHMA 1POV0 5BNOC 1PVC2 1M06G 2VQ0A 1OOPC 4JGZB 4GB31 2RMU1 4QPIA 4PDWC 1AL22 3DPRB 1TME3 1ZBA3 3JD73 3VBFC 4IV1A 2MEV2 1PIV3 2X5IB 1HRV3 2ZTNA 1SMVA 3VBRB 4BCUA 4YVSC 1RMU2 2RS12 4WM7B 4CDWA 5ACA2 1ND3B 1QQP2 1RUH3 5D8AB 3CJIC 4GH4A 4QPGB 1QJX2 1RUF3 1TME1 1ZBA1 3JD71 2R043 1EV12 2WFF3 1PIV1 1AYM2 1HRV1 4Q4X3 4CEYA 3ZFGC 3NAPB 1H8TA 1NY72 5CFCB 5AC93 4FTSA 1HX6A 3TN92 2QQPA 1RUH1 4RR3C 1RHI3 1OHFA 1TMF2 5A32B 1NA1A 5BNOA 3ZFFB 1RUG3 1RUF1 3LOBA 2PLV3 2R041 2WFF1 4FTBA 1RUJ3 1PO22 1OOPA 1W39A 1VBB2 4Q4X1 3VBHB 1AL0G 5AC91 5CFDC 2Y26A 4PDWA 2FZ2A 1AYN2 1HRI3 2WWSA 1AR72 1RHI1 3JB4C 2ZZQA 5BNPC 5LK7B 1VBC2 2RS32 4YVSA 4RQPB 1RVF2 1RUG1 1VRH3 4CDXC 2PLV1 2R063 5JZGC 1RUJ1 3JBG2 3CJIA 1X36A 1ASJ2 2R072 4RHV3 1ND2C 1RUE2 4IV3A 3S6PA 1RUI2 1HRI1 1HXS2 1FPN2 5BNNB 1VBD3 3ZFEC 1V9U3 1CJDA 2RR12 1NG0A 1VRH1 4CDQB 2R061 1RUD2 4FTEA 2HWF2 4RS5C 4RR3A 5L7OC 2RS52 4RHV1 4GMP0 4LLFA 2RM22 1D4M3 2HWE3 5C8CB 1VBD1 1BMV1 1V9U1 1PO12 1RUC3 4Q4W3 4Q4V3 2HWD2 5FOJB 5CFDA 1K5MA 3FBMA 5C4WC 1E57A 4QPIB 2BBVA 1EAH2 1DDLA 1PGW1 4NWVA 4AEDC 1X33A 1R1A2 5BNPA 4CDUA 4IV1B 1PGL2 4WM7C 4CDXA 1D4M1 2HWE1 5JZGA 1VB4A 2XBO3 4N53C 4CDWB 1RUC1 4Q4W1 4JGYC 1MQTC 4Q4V1 5FMOS 4CEWC 1ND2A 5K0UC 4FSJA 4GH4B 1C8M3 3ZFEA 1C8NA 3J8F2 3VBUA 1MEC3 5ABJB 2TBVA 4Q4Y2 1WCDJ 1FMD3 4CEYB 1VBA2 1H8TB 1QJU3 2GH8A 4RS5A 2XBO1 5L7OA 1QJY2 1R092 5A33A 2HWC2 1BBT2 1BEV2 1NCRA 1ZBE2 3VDDC 5FMOL 1NCQC 4IV3C 1AR82 2XPJA 1B35C 1AR62 1C8M1 1NA1B 5BNOB 1FOD2 2WZR2 1MEC1 1COV3 1OOPB 1AR93 3VBSC 1FMD1 3DPRA 5C4WA 5DDJ3 1QJU1 2X5IA 3HAGA 4PDWB 4AEDA 3VBFB 5C9AC 1R083 4GB32 3VBRA 2RMU2 4WM7A 2ZAHA 4NWWA 4YVSB 2WS93 4N53A 4JGYA 1MQTA 1COV1 1K5MC 4CEWA 2HWB3 1AR91 5K0UA 3CJIB 5DDJ1 1VBE3 1RB8G 1Z7S3 4YVWC 4CDUC 1R081 4N43C 1GFF2 1PVC3 3ZFGB 1TME2 1ZBA2 2WS91 3JD72 1PIV2 5A32A 3VDDA 1HRV2 1NCQA 2HWB1 3JB8A 4RR3B 4Y4YA 1B35A 1AL23 1VBE1 2IZWA 2MEV3 1CD3G 3VBUC 1Z7S1 1RUH2 2FZ1A 2RS13 1RMU3 3VBSA 1PVC1 4WM8B 3VBOC 5ACA3 1RUF2 1QQP3 5CFDB 2BUKA 1NCRC 2R042 2WFF2 5C9AA 4Q4X2 1QJX3 5AC92 1AL21 1EV13 4JGZC 2MEV1 1AYM3 4EJRA 4CDXB 5JZGB 1RHI2 3DPRC 2GSYA 1RMU1 2RS11 5ACA1 2X5IC 3TN93 1RUG2 1QQP1 2PLV2 2WLPA 1ND2B 1RUJ2 1TMF3 3VBRC
chains in the Genus database with same CATH superfamily
4PS3A 3X13B 3GB7A 4H0HB 4P59H 4YHIA 5AZ2L 3ZX7A 2QMJA 4YHNB 5KAQG 1PO23 1JZGA 2K0RA 2Y2TA 4YW7A 1DN2A 5F72S 1J5IA 3KWUA 1QH6A 4X6BA 2DV9A 2W08A 3N44B 2XONA 3Q5OA 2VERN 3DGGB 5JA9A 2W1SA 1MWAB 3FT4A 4RS5B 3ZSJA 5AALA 1GZQA 3BYTA 3GRWA 3NN8A 2FDBP 3FZUC 4X7EC 5D4IA 2GSGB 1W06A 1EDHA 2WKOF 1ET5A 4TNGA 5I5MA 2XB6C 1E5BA 4QTHB 2ZX4A 3GWJA 1IV8A 3CFDB 2XIDA 4XC1H 2D31B 3GNML 3PDDA 3T6QC 2ZMNA 5M95B 2WNXA 3LNDA 1JI6A 1YG9A 1KYAA 4AAXA 12E8H 4NRMA 2VZPA 4LBQA 3C6LA 3TF7C 5EDXA 4YSPA 5KZCD 4MADA 2ZCKL 4FKHA 4WI6A 1QFWH 1CIUA 1I7UA 2CDGA 3MYJB 2XZQH 4KI5C 4GP5B 4MMXB 1AAJA 1AJ7L 5LAXA 1NEUA 3TPKA 1HXS3 1NJ9A 1G7PA 3I6LE 4LLQB 1M71B 1RUMH 1E7UA 3AS1A 4OF8A 5GJTH 5FUZL 2A6XA 4ONUA 1AC0A 1XB6A 3SDDD 2P5WE 1LVEA 4Y0GA 2Z8SA 4UV7H 4Q56A 5C0JB 4JGYB 4NDMA 2X42A 5HVGB 1J3RA 1WD3A 3MOAH 3APBA 4K9EH 3ILNA 3I54A 4AFDA 1C1LA 2WLJA 4Y16A 4TUOA 1X5MA 3V5KA 2EINB 8FABA 2X9XA 5DHXB 3ZHKA 5FPXA 5GS2D 3ARWA 3F12B 5IVXB 4MUVA 4NJAL 2BJSA 1OMIA 4M0NA 3LEYH 2YPLA 1SMDA 1UT9A 2APXA 2JDPA 1W90A 1S5HA 2D3NA 1ILUA 4A1RA 4FPOB 3WENA 4GMP1 4Z3IA 1NGWB 4U1JA 4GUOA 5EZLA 2CCVA 1WD8A 1JD9A 2F2HA 2W94A 3EIFA 5CFCA 3OHXB 4FQXA 2NDFA 2VDQH 5ALBL 1R1A3 5FP3A 4N8MA 4MTMA 4OZIB 2Z31B 3ZTJG 1ZOXA 4XTMA 3PJNA 4C4KO 4EI5A 3V4VA 3W3BA 3RVVD 2HMIC 2DQTH 1W3VA 1C8M2 1SDAB 4FHBD 3CPLB 1VCAA 5AYUH 3PUIA 3ZFFA 4PJXA 1TJGH 4M00A 3QPXL 1POV1 1X8EA 5I73B 1URZA 2WVSA 5FX3A 2X4OA 3PQYA 5CG8A 3POYA 1P7KB 3PNWB 2WLLA 3VD4A 1KBGH 1D9KA 1VGEH 2WYTA 3JV0A 3QHZL 2ZOUA 3MRFA 4OCRH 4BSWB 1JZ8A 1DVFD 5T54A 2XWEA 4XP4H 4C8DA 3NIDB 3O1SA 1L5GA 3MRGB 3TT1H 2DVAA 1N8ZB 2ZT9C 2NT0A 4NZUH 4OZHE 3DXAA 4K9EC 1P2CA 3OG2A 3WQ0A 5F0MB 5K1JA 3RGVA 2XKPA 3K0YA 3QIUD 2VN6A 2R27A 1RZGB 3SBPA 3IDMA 1Q9OB 1CAVA 4BQ8A 1KB5H 4NHMA 3ZDSA 5D1ZA 3QGVA 5BNPB 2J1ZA 4KGGA 4JFZL 3HG1E 2GITB 4IOIA 1LE9B 1MNNA 2Y0IA 1BXUA 1N1YA 4O02B 1PG7L 1H8LA 1ECZA 1FFNB 2ICEC 2VDOL 4QRBA 5FM8A 4DGVH 1DZTA 2WZR3 1L9RA 1I9JH 1OT4A 4ONHA 4C1XA 3GSQB 1IGML 4YHYB 2FYYA 3AB0B 1J8HE 5FK9A 5B1JC 2D97A 5AVTB 3RKPA 3UPRA 2FIRT 4KI1A 4PR5A 4JFFA 3UG3A 4FPJA 5K59F 2AITA 3RJ2X 1GY2A 3FCSB 1OB1A 1O7FA 2UVFA 2XJKA 1CG9A 1OPOA 3EH1A 1AVBA 2LTNA 1QFWI 5GRJH 3FCTA 2HWB2 5DG2A 1UWGL 3EXJA 3QHFL 4NIIA 1F1DA 1H8OA 1NBZB 2AK4B 2DRUA 4MZ3A 4BSJA 4WGVB 4G9FE 1OB0A 3WHXB 4NPKA 4XNYL 3RFZB 4AVAA 3TB0A 4F7PB 4WW2A 1KXVA 4KMTL 4L1HA 4GO6B 2EQDA 4FPEA 1AD9A 1F11B 1O3TA 3FQ4A 3SCMC 1E2WA 2ERJB 4AHWA 5E8NB 2W87A 4QD2A 2VQ0A 4A63A 3UBXG 2ET1A 3UBXB 1OPMA 2VDKB 3KHBA 5DN2A 3RG0A 4GRLB 5GZDA 2DI7A 1OPGL 2JELL 5DJ2A 3FT9A 1NCWH 1QABA 1SVBA 1I3GL 4AC4A 4EI6A 3LZQA 1UX7A 4PDWC 5I6NA 3NABH 5KBFA 4B9FA 4ZW6A 1PIV3 1JSYA 1NXMA 4PLOB 4WWPA 1Q1PA 2W95A 4EAEA 1IQWH 1P4BH 2KBGA 2R83A 4GAYA 1K8DA 1XHHA 1TEIA 1HHHA 2Y36L 1RMU2 2RS12 1UASA 1ZA4A 3RX5A 3VRIB 4JV4A 1U0QA 4ZU4A 1J0ZA 1ND3B 4UAOB 4ZS3A 3WXPA 4CXYA 1ZREA 4MA1B 1EEQA 4P3DA 3PU3A 5E2TL 1VJ2A 3A0NA 3DKWA 3II3A 1YMME 1IS3A 1XCQA 3JVGC 1KWGA 4R4XA 4ODTH 1NOFA 1ZT4A 5F1SA 3GXPA 3KEDA 2IADB 3C60C 3P1VA 3QZMA 3P9MA 5IQLA 1FYTD 3QUYD 4X9FA 2D31A 4PUBL 3V5DA 3L3HA 4YW1A 4FTSA 1IM3A 4HF5H 5BO1H 5FDWA 4YNYB 3FOMA 4LDLB 4Z3HA 2JV6A 1DVSA 4BFEA 2YUEA 3H3LA 5L73A 1UQSA 5HBBA 4MA8H 3U37A 2YC1B 1HI6A 4XXCC 1YEHL 4NP9A 3T0DA 2H7WA 3TJPA 4DW2L 1JWSB 2OBGA 3S7EA 4QNPE 3B7MA 2I5YL 2DCYA 3MXVL 3KCYA 1JCVA 4JLRB 3T1FB 1HLCA 3KPMA 5EHDA 4IRSB 3T2LA 3HHRB 2UZIL 2XIBA 2OLDA 4MJ5B 4Q4X1 2CXGA 4MMZA 3BVXA 2HJKA 5JI7A 3X3GH 2RCSL 5C0JA 5K9KA 2BO0A 4YR6B 2YK1L 1C08A 2XQYG 3RZCD 4JJHA 1H4HA 4K73A 3IBMA 2GC2A 2NY0B 3QNXB 3U0WH 1EXUB 5HHOE 1X6NA 2A6IB 4Z3JA 4YHZH 3DEMA 3JB4C 2H2PD 4MWFB 4NZTH 5CR1A 4TQPA 1TJHH 1PW3A 3V8OA 3PAUA 1NBQA 2J8HA 4NM8L 2XN9B 2OS2A 3A4EA 1Q8QA 2R063 2CJTA 4J39A 2E31A 2A9NH 1PS3A 4G6MH 4FYQA 1OGPA 43C9B 2ZCWA 1LGNA 1K4CA 1OAZH 3HR5B 4I2XE 4Y9BA 4EF3A 5DD3H 3DC0A 1QEWA 1X9QA 4YHKL 2PFWA 5CINH 3P1IA 4HJ0C 5KVGH 3CDCA 1Q72H 3K6IA 2P24B 4M5TA 5SX4I 5L8LB 4KQ7A 5EO0B 4G80B 1MI5D 4HAFA 2CO3A 5D1XD 2XFXB 3FFCD 4EZKA 1M3IA 5K1NA 4DVRL 4Y5SA 1M05B 5JIAA 4Q58C 3HG3A 1LP9B 4UBGA 5TF1L 4COYA 2QADD 4XNXH 4UTAH 4M43H 1D6VH 1NCNA 2DB8A 4GUPA 2J42A 3L7FB 4K5MA 1UY0A 3HKFA 3EXUA 4DEPC 1BJMA 2QZ5A 2VMDA 4BSWA 1GZCA 3MIDA 35C8H 5CZXD 4XNZB 3BO8B 1AOHA 1F3RB 2JJSA 5AVYB 3V0EA 4ES9A 1D2PA 3KJ6H 4B27A 1AF9A 1IQDB 1BK0A 3MBWA 1S0EA 1S7QA 3G08B 3UTTB 4CKQA 2EDHA 3G04A 4KAQH 3CSFA 1XNTA 5KC6A 1RZGA 3LIGA 3ACHA 2A99A 2VR7A 3ES1A 3MV9E 4XGZA 1Q9OA 3VFTB 5E03A 4MCYB 3ARFD 1X33A 5BNPA 3PVBB 1GR7A 4OZHF 4PWGA 3FC8A 3RE0A 3FTGA 4HKXA 1I5ZA 2PXYB 4MDIA 1OH3A 2GITA 3HRZB 3FDWA 3IMVA 1G9CA 5F8QC 1F4YH 4UFMA 2V3EA 2WUBH 1FFNA 3U7WL 1FNYA 4S1DC 3D3VE 1QLEL 1JPFA 2J6EH 3FB5B 3GO1L 3OX8A 4P3CH 4QRFA 3U4BH 3PVNA 3AB0A 1TU2A 3HC3H 5IMMB 3K51A 3QWOB 4CEWC 2LQRA 3MV7B 4GH4B 4RIRA 3R4RA 1FNSL 5B7FA 1KTLA 1U93B 4XHXA 3D39B 1CFNA 1P84J 2PO6D 1TT6A 2GT9B 1SOXA 1DQTA 3M3EA 4NWUL 2V4AA 4N24A 3QVAA 4M7LL 1PAZA 2LW3A 3SQBB 3WP4A 5APAA 1UA6L 2KS0A 3GZPA 3WNPA 4P49A 1BYPA 1OQXA 3ZMOA 3RFZA 3ZXLA 1UWEH 4GAFB 5FFGA 5BVJB 4LO7A 4OQTL 1R46A 2FJGA 3OAZH 4UU9B 4KROD 5KUKA 3TZVA 4ZJ9A 4PLMA 2WC2A 4NAMA 3WTYA 3BP7A 4TQHA 4PV9B 3TCXA 1P4UA 4B50A 2ZCLL 5E8NA 4CAGA 3BLBA 4BXVA 3CGTA 1WGPA 3GBNH 2Q7YB 4LVOB 5INCA 5IVZB 4LT5A 3LB6C 4I0PA 3M3CA 4XBEH 4A7YA 3QFDB 1FOD2 3AWFA 3WE6B 5F3GA 1QSVA 1DJHA 5C5TA 1H3XA 1HHIB 2BH0A 1I85A 4JFHD 3QH7A 3IDNA 3QO1B 1W0YT 5FWRA 1PM7A 2OYLA 5D6DA 4HK3J 1U8NB 5EHFA 3V0AC 4XABA 1YEWA 3FFDB 3UACA 2X1XR 5D9SB 12E8L 2ATKB 1ETZB 3OPUA 1W6QB 4W4NA 1VACA 4NQCA 4J3OD 4JFXA 1DQQA 3OKLA 4B4RA 1YYMH 1FZJB 4CC0A 4Z0XB 4COVA 1SLVA 3JUZA 2XZQL 5D7JC 2DMKA 4MXWH 1Q8OA 3QO0A 2IMMA 2ZEWA 3GZQA 1FP5A 4FTVA 3LPWA 5CR8A 1MQ8A 1TOXA 4H8VA 5GGVY 2W5FA 3SBWC 3LE0A 2R39A 3K6SB 4GULA 3IN2A 5C7ZA 2DUQA 4O65A 2W38A 3EBIA 1JDDA 4G71B 3DGCR 5A2JH 5FYHA 2NZ1A 1ONQA 3IN0A 1IC7H 4ZFZB 4APQD 3ENRA 3CFIC 3KGZA 1LOFC 2RALA 4W9IC 3KPQB 1ZRUA 2E46A 3B2VH 3KD4A 2H4EA 4PS7A 5C3TA 1KYUA 1JNNL 4PIXA 2YSSA 2OJEB 2CRMA 2G4GA 2WLNA 1ZLSL 2QKIA 2NLRA 3QAZC 4HT1T 4LBJA 5DJXB 4YNYA 4ZFGL 4M8VA 1VAVA 2VZRA 2D6MA 3GSRA 3H9HA 4M03A 4FAGA 3TT3L 2IXQB 3RTQA 3WFEL 5I1JH 5CKNA 5EIIG 4PH8A 5EIIB 3FPYA 2Q9OA 3QQ4B 3RMXA 5J37A 5JW5A 3TVMC 1Q0XL 1PHMA 1GGBL 2WKOA 3ZRSA 2F0CA 2NMSA 1U8QB 5ITFB 1OTSD 4IEWA 2XG5B 3DX9A 1N0XH 2HTLD 2DDUA 4OAWA 4JHVA 2PQSA 1PZ3A 4FHJA 4CCNA 4CZSA 1RUH2 1GCYA 1NCTA 3CAFA 3ZE0E 5KYYB 4NHXA 3ZDYB 3VBSA 1FIEA 4WM8B 4JO1H 2QQJA 4COUA 2VITB 2BHFA 1MJUL 1A6TA 3LZOA 4G8EB 3QJHB 2A6IA 4KI5E 3VFUB 3UPCA 5JXAH 4F8AA 4MWFA 2LABA 2QDWA 5DJYA 3VXTB 4DGIL 2OPWA 5CBEA 3TIDA 3MGTB 4OIFA 4QGMA 1TJGL 1A2YB 5FM4A 2XN9A 3NVCA 3N04A 1D5MA 3QXTA 4NUJB 4A2HA 4QX0A 2LTQB 3EO0B 3RI5F 3VMNA 2EUZA 2C7UB 5JR7B 4A2DA 2MQCA 1RHI2 4OCRL 3CIHA 1RULL 3MMEA 2A6JB 1M3JA 2AV1B 2CPCA 5FB8A 5I6OA 4O9GA 1LEGA 2YPKA 4ARYA 5FYCA 1FN4A 3QISA 4PWHA 1QQP1 3BKJL 1FI8C 3TWIA 4JM4L 4LHLA 4G80A 4OFKA 4XPTL 1L7IL 2W0XA 1O5PA 1NQJA 1QJX1 4F9PC 4Y9EA 3QDMD 4LBEA 2NZ9D 3U9PL 2WYZA 3C09B 1C5IA 5T1KB 1X4XA 1DBAH 2Y06H 3ISWA 4JFPB 1RYYA 4IEQA 5BPXA 1YEKH 3LS5L 2F1BA 4I48B 1PFCA 2W92A 2Z0UA 3BVDB 2SODB 4NKMA 4LASH 3TV3L 4F33B 5L7OB 3GHPA 3I2IA 1SJHA 4EN2A 2VXTH 2YD4A 4FFZH 4LLMB 4WUUE 3K3OA 2X4PB 3DURB 1IPKA 4UFHA 2XOTA 2GJ6D 3V64A 3C7EA 4WZFA 3BO8A 1M4WA 2G75B 5HHVH 3QBTB 3SKOB 4OJAA 4JRLA 3IDGB 1OK0A 3E3QC 3UTSB 2MHFA 4L3ED 3RRQA 1OARL 1F8VA 3UTTA 1QQDA 3I2JA 4NYLB 5FA4A 4M6OL 4YDIL 4QHOA 5LN8A 3OGRA 1KCSH 3UL2A 4KZCA 3B3IA 1PKQB 2GY5A 1TNMA 3QJXA 3L5IA 3MRCB 1UGKA 4JQIA 4LCCC 3CXDH 1OOAA 2OYKA 1CFMA 3HRZA 5T5JA 4OJEH 3QDGE 4TVUA 4AT6B 1Q56A 4WNQB 1AVAA 1AYN1 5D70H 5GGRB 1WWWX 1S7WA 3C08L 4B97A 4HUMB 3L7EB 4R5VA 2Y6HA 2PWDA 3DMMA 3H1ZA 1W72L 3AGWA 2KXLA 3MV8A 1YEJH 1P7QB 4BZ1L 3MREB 3WW1A 1HKLH 2IPUK 3H7BA 1OAKL 4NPMA 5I1EH 3PL6A 2WWMC 4I87A 1IKNC 1PZ2A 3QSKB 1H6YA 2ZS6B 4XOGA 2BMKA 1JNLL 3L6FB 4PHXA 5JPNC 1ASJ1 2EE9A 1FDLH 1PYWA 3CZNA 1T0MB 1UVQB 4OZHB 1DBJH 5SWSE 5IFAL 3IJSB 1TTUA 2HPOA 4B8EA 3M1HA 5IMKB 1P6AB 5L9BA 3EYUH 5CJOH 2R0KH 2OXGA 2IEPA 3Q2VA 2JQMA 3QJZA 3B56A 2VAJA 4AVKA 3K6DA 4PW4A 2WQWA 1IBHA 4FXGC 1GGYA 3HC2A 1O4YA 5LNDA 3HG1B 3FUKA 3R0NA 4NQQA 1UXWA 1IGCL 3POJA 3K7UA 5EEZA 3QQXA 3DUSA 3RB5A 3DLQR 3DV6B 5IZ7A 5FYVA 2X10A 4W9HC 5MEQB 1RUD1 3VZOA 4ANKA 4IV3B 5FAXA 2ZX5A 1B35B 1NPJA 5I1GL 1J8HB 3BT0A 2V73A 3GZUC 4EDWH 3SDAB 2J6WA 5H9RA 4OYUA 2HKXA 4MHHG 4TSBL 1C5BH 2ZYRA 5EBMA 5ECGA 5I2IA 3KMDA 3OBAA 1XF1A 4MJIE 1UMHA 3LHAA 3RWCB 2IJ0C 1B4JH 4M1DH 1ETZA 4KDWA 4UV4H 4HG6B 3HBKA 3ZQ9A 5KOVC 5L2JB 2V6HA 3D7PA 1SXNA 1QMJA 4QRRE 2QE3A 3GMQB 5C71A 4G9FB 5C8CC 3PWUB 1KCLA 5GGTA 1VFOA 3Q3GA 1KELL 4JL2A 1YQCA 4MQTB 2JG9A 3MV01 4Z0BL 3RX9A 3SKJL 5C6TL 5KSUA 4UT6L 3J8F3 3K6SA 4ZAKC 4EWEA 3EJSA 1G9HA 5JIIA 1QSFA 4MX3A 2H45A 2Z35B 1OTTD 2Z9TA 1DLFL 1RZ8A 1E43A 4LSUL 5KYWA 4Q1PA 3FUFA 2VDPL 5EV7A 4EQ3A 4RBPH 2GCYB 5I82A 1R093 1UY2A 4P99A 4YHMH 5IQOA 3M70A 3U0WL 5FJHA 2IAAC 1VE0A 2VNGA 4YHZL 3TBBA 1COV2 3BAJA 2AXJA 1TJHL 2HT4C 3V5HB 3FFZA 2RD0A 1AR1C 4PRDA 2I2SA 3CN2A 2XG3A 3RZHA 2AI0H 1R082 3EO1B 4NP4L 1NWPA 1I1AC 1QLFB 2YBRB 2B15A 3L4YA 4U2ZA 4Y4KB 3VG0L 1XE0A 5LXVA 4KZEH 1YMMB 4C83A 1BBT1 1ZBE1 3O6FA 4CC1A 5IR1B 3CH1A 4Q6IC 4OFYD 3TBDA 3GLAA 4G7VH 5GGRY 1P4LA 1H8TC 4WM8A 3A0OA 4NNXA 5GLUA 3B6SB 3VBUB 5JSPA 2I45A 4ELMB 4YIQB 1QA9B 1T1WA 3JV5A 4G8EA 3QJHA 5FY8A 1YQ6A 1UFUA 4I3RH 1VBE2 2VZ3A 4KK9D 1H3PL 4FO9A 3ZE0F 5IVNA 1DG6A 2EDEA 2BIQA 3MGTA 4X5LA 1JPTH 2VO5A 5CZRA 5C0ND 5TE4L 4DNLA 5H9QA 5BV6A 2X6MA 1ORSB 4QYOA 2Y64A 4YM0A 2OX5A 5A1LA 1MIMH 4KI5F 1HINH 3GI9H 2FNBA 4YE4H 4Q0XH 1AKJA 4HWBH 3EO0A 1UO9A 3RRDA 3H1MA 2J88L 2CBPA 3HTLX 3V7AE 2XKSA 4E41E 3F04A 1LODA 2NMNA 4JMNA 3HFML 4YSQA 2ZMLA 5LGKA 2V9RA 2CHHA 4AMKH 4AM0B 2P5WA 4MDJA 4X7DC 5JR1H 3GSNA 3MRHB 5L9VA 1CX1A 3TX4A 2OMYA 3F8UB 1KZQA 1CTMA 1C8QA 2WK2A 4KAQL 3LEKA 1QAWA 3CVIH 4O00A 2M1KA 4X5QA 4F1ZA 2WNVC 4BZ2A 3KPLB 4N87A 1SHSA 5HHOB 2EDFA 4K9JA 1PMHX 1LGCA 1XGTB 3AZXA 5HTSA 3L9RB 1CURA 1BGXH 5FKPB 1LDPH 1VMFA 1M2VB 1T7YA 2ZJSL 4IDZA 2WLYA 3QWRD 3QDAA 4ZO6A 2Y9RT 1LNUA 4LLMA 5F3HB 2X4PA 3DURA 4PJ5E 3CBNA 3LPPA 3WOVA 2QVIA 5HI5D 3UCRA 2F74B 4HALA 5IFPA 2BP5M 3IDGA 2EXTA 4A2GA 5BVPH 4IE7A 2YAOA 1W6PB 3NL1A 2EDWA 4Q0QA 1MNUL 2HG0A 4OV6F 4IE4A 4OD3L 1CFVL 3X17A 1ENSA 4UYPA 4UI9L 2DVBA 4AI3A 3BLPX 4HUXA 5IMOB 1LK3H 4ZO8A 3SKJE 5DJ6A 1TMF2 4QI3A 5JCTA 1EEYB 4U05A 4AT6A 1TCRB 1WC7A 4FQPA 4JVPA 1NAML 2ZD0A 1MRCH 4WNQA 1L7RA 4XUNA 1IBDA 2H0FA 3EADA 3PUCA 1EV2E 2WINB 4XTRC 2AS5M 3WJJC 1L7LA 2QCSB 5FMDA 4NIDA 3OQ3B 3O9WD 3OBTA 2WYFA 1D6EA 2W47A 1K5NA 4JS7A 3ARPA 1UB6B 2PWHA 2YARA 4BFRA 3NNMA 5EULV 3ROUA 3SD2A 4IYKA 3ULVD 1E5YA 1MAML 3QI9C 4N3TA 2Y26A 5CFDC 4JANA 4KTGA 1ULOA 4DN4L 3IFOA 1RZIB 2K2SA 4A2EA 3SD5A 4OZHA 3ZYJB 1Q9WA 3HZVB 4KHTH 3IJSA 5DVNA 1II4E 3Q48A 3U4KA 2YD3A 1ZMYA 2WWKT 3H2PA 3ROOA 3IXAB 1ND0A 2ZXEB 3DRQB 5EJ1B 5LA9A 3FO2A 4N0FB 2OTWB 2WLIB 4TRPH 5KSAB 1G7JB 4IS6B 1RV6X 4UT7L 3O3EA 1RUJ1 1Y18A 4I3PA 1ZHKA 4PJGE 2Y22A 2FEJA 3KNBB 4EUPG 3QJTB 5KYUA 2KERA 2GSIB 1TZAA 3VTTA 3QG7L 1RXLA 4KNQA 1X9UA 3W82A 2GK0A 1H2KA 5CAYB 3H2QA 3PXHA 4IV3A 2CWRA 1W8EA 1FPN2 4Y22A 3BB6A 5DEGB 2H0JA 4X4KA 3QEQB 4F3FA 3FCUB 3WY1A 5DLML 1CJDA 3OKEB 3MDJA 4LKCA 3FUDA 1U3NA 5KBPA 2DN7A 1XNCA 2ZUTA 4HDIA 1R9FA 3TXAA 4ZOAA 5FZGA 2WMPB 2FDFA 3RWCA 2IPKA 2ZX8A 3T0EA 1P9MA 4CMMB 1JHKH 4RGOH 1XFPA 2BCKB 4ODWA 4OJFL 3UEQA 2X40A 3S98A 3GMQA 4AJ0A 4G9FA 4M9PA 3PWUA 4P2CG 2ADIA 4TPRH 2H9GA 1D4M3 1W0VB 1ERNA 2YOAA 2NY1B 4WNSA 2BOCA 5E56A 2VCCA 3PUHA 1BMV1 3GBGA 4JHAL 4AW7A 5HJ3A 3C3VA 1AQHA 4LOTA 4NQDE 4D9RD 2PPDA 5EWIL 5GLVA 5KEZA 1NGPL 4LO4B 2VR3A 3OXRA 2VDML 1V7NL 2DWEB 4JO1L 2WWUA 4NBYB 3V55A 3VKOA 1FG2A 1TLMA 1FO0L 1UOBA 1PAMA 1K9TA 3HC4L 4PVMA 3ZYHA 1HFUA 3AZZA 1KTBA 4QF1A 4M7KH 3VKFC 3HMXA 2A9CA 3PNRB 1KJLA 4CE8A 2C1OB 4LXFA 4PY8I 5F0LB 4EVNB 2VL5B 3ARYA 5JZGA 2BIMA 4MNGB 4XILA 1LMKA 1JPST 1QUNB 1UZZA 1JXDA 2ZYIA 2YAMA 2QQKH 2LU3A 1OVPA 4N53C 3L08A 2JK5B 1G1OA 3RWEB 2BV4A 3TJHC 4N6RA 2D2OA 3NFPB 3WLWD 2XJLA 4Y4KA 1VZIA 2OPKA 4CYDA 1UWYA 5BZWB 4KXCA 2D2CC 1FIGH 2I9TA 3M7OA 3AY4C 3C8XA 3GUTB 1OD7A 5KJ4A 1HH9B 3VM5A 5EEXA 3VBUA 5HVWA 1PIFA 2XWDA 5C07E 1QA9A 4Q4Y2 5FZ0A 2LFGA 1AI1H 1FPTH 1N68A 3VXNA 1T5XB 2VE6B 3F7PC 5DZFA 4HS6A 3CHOA 1OE3A 3F00A 4KUCD 4AYFB 1F02I 1LO2H 2J1YA 2Y06L 3SY6A 1JYCA 4E2SA 2R51A 1IC5H 1YEKL 3RY5A 4HVBA 5J6GB 2N4IA 5AKRA 4M0HA 3FTUA 1UZ8B 1T0NB 3RURA 3EKCA 1A1MA 4FFZL 1A8DA 2IBGA 3H8UA 4ABVA 3TO2B 3K2MC 4JJ5B 4UAPA 3QJOA 2BOJA 4ZPIA 1A6ZB 3OAUL 3BE1L 2YFOA 1YUDA 5FMBA 3VV1A 2NXZD 3MNMA 3MLZL 4YDZA 4BLIA 3ZE0B 4HWNA 3MROB 3FFOA 3P4MA 5K33A 2B9AA 3NVQA 1I31A 3HE7D 1I8KB 2QJDA 5G4OA 1QFOA 1F0LA 5HHOA 2K8QA 2VISB 3I02B 4QU2A 2ARJB 1IGJA 1TO5A 1QLEB 3NJIA 4N1HB 1KIPB 4O61A 4XNAA 5J3UA 4XUTA 5FYZA 3L9RA 1JFHA 1WQVT 5DMKB 2BY1A 1ZM1A 2J1EA 4DXSA 2OFQA 2K1MA 2QPFA 3Q9QA 1NDGA 4K20A 3ZY7A 4LL4A 4WO4D 5FYYA 2Q0ZX 4IMLA 4PJBE 3RY6A 4BBWA 5F3EA 5K0UA 4BQ5A 1ZS8B 1AGFB 3HT2A 1YEJL 1Z32X 4NRYA 4JPVL 4JRXD 5DVKA 1HKLL 5FZEA 4I2XA 2JD9A 5I1EL 1UB5B 1JP5A 5EU7C 2PXJA 3B00A 2HT3D 1YY8B 4KBZA 3X29B 3MLRL 3APCA 3CC1A 3ARDB 2BS9A 2VC2L 3PGFH 3DJTA 1PVC3 4GKYA 2YEVB 3DTDA 3O3DA 4GQPH 3S34H 1TME2 5GJ6A 5H2BB 4WEBH 5AVUB 2UWEE 1A8JH 1M6OA 1VSCA 3DSNB 4LLUB 4YO0B 2EF6A 3O14A 2EO9A 4WVVA 1EEYA 4P9WA 1HK6A 3M3OA 4N0CC 4PJYA 5FAAA 4TWTA 2AQQA 2OULB 1AL23 2Q1EA 3QUMA 3BZ4A 4OI7A 5HHME 5JORB 1CR7A 4X99B 1I1RA 3ARBB 3BAEH 3DO7A 2ZKWA 5AZUA 1FCCA 1E50A 1XGQA 4P2QE 2NMOA 2ZQKA 3BHBA 4JDEA 3W0WE 2YGMA 3EMRA 3AS2A 3PGCB 3HZVA 4X9HA 2WFF2 1C5BL 2BGOA 1YDPB 4IE5A 3P6BA 1HXYB 1IS4A 2A73B 2HPTA 4ZS2A 2ZUVA 3MV9A 4XNMB 2JE7A 4O2EB 2ZICA 3EGSB 4LVHB 1JPEA 3IXTA 4ONGL 3WBDA 1JXFA 4N7IA 2IALA 3C5ZD 4K23H 3BD4A 3USUB 3CFCH 4FYRA 3CXHJ 2YPDA 2UXVA 3S35X 4Z7WE 3GSXB 3D3VA 2LVCA 4WENB 1GHFL 4PBVC 1INDH 3T65B 3WQ7A 4AI0A 4CUBA 2C4XA 1HSBB 3CQPA 5DEGA 5DRXA 4PJGF 3WS6C 5HYJD 3PWNA 1QBAA 2IGFH 4HANA 3HI6H 3MAWA 4A7QA 2BP6A 4NX0A 1RHHA 4MXVE 1VFUA 4TVPH 2JD4A 1B3IA 1EDQA 5ITBL 1BSIA 4X6DB 4XMPL 2WMPA 4P2AA 1MZFA 1UHVA 3ZZLA 5DAVA 1HQNA 5SWSB 1CN1A 4BELD 3BUPA 3MC0A 3ZMRA 3VMPA 1TZIB 1X4YA 1GMEA 4OI1A 1U36A 2YGOA 1NCGA 5IB1A 4XNQB 4AVSA 1EVUA 2X3CA 4KL1A 4OUOA 3PVOA 1QKQA 4LU5L 2F58H 4XOBA 4X8GA 4HJ1A 4MBRA 2EAAA 3BQUD 2WCGA 4PJDF 4BINA 2CSGA 3ILEA 3P3NA 5FYKH 3POGA 4LPLA 4OM1H 4XDPA 3LS4H 5FLVA 2OMWA 4J1UA 3ZOIA 4U7SA 5CJ5A 2DUPA 1F58L 3OTTA 3WCYA 1I3UA 1UPIA 4PM1A 3DTXB 4JRFA 4U1HB 4NHKA 4L1DA 1PO21 4AIZA 1ZANH 2CKNA 2D98A 3H7JA 3MJWA 5D1QD 3TESA 4N2EA 4FQ1H 3NRUA 1MQKL 4D0CA 4DP6X 4P8QA 2YB7A 4R0LB 5B38G 5B38B 1W8WA 2V7HA 3QRLA 5FZAA 5PCYA 5IJKC 2JICA 2QUOA 2W5PA 5DJDA 5F7EL 4Z8BA 3T08A 4Q89A 2AKRA 1QPXA 2VABB 3ZXDA 1BXHA 4V1DE 5JMCA 3I6SA 2W9DH 1T3FB 1V5JA 1O9WA 2FJSA 2VTFA 4JREC 1BQPA 4QX8A 4HWBL 4N8VB 3D0LA 3S88L 4BQXA 1VB9A 3KB5A 4JQTA 2E63A 1OF3A 4BWWA 3VFOB 1AZDA 4CSSA 2MPFA 4KITB 2HWF3 2BOBA 4IRJD 4Y2OB 5EO1A 1A6AA 4MJHA 1IQAA 3GUTA 1OV8A 1VRSA 4KWKA 4NQED 2WBJB 3HNVH 1WUNT 1AANA 3IKCB 3OMZA 5BOZG 4RQPC 1A7RH 1ET7A 1HQ4B 4HS3B 1RUC2 1W2TA 5DD1H 4Q4W2 3RY4A 4WJKB 3WFBH 2NQDA 3DV4A 4E42A 4HV8B 1HXS1 1GZ9A 3PJLA 3OWEA 2BNNA 5B21A 5A2IH 4NE9A 4Y2LA 2CG9X 4PGJA 1W3XA 2BU9A 1KZYA 1GU3A 3FLTA 1YEGH 2XA8H 5EDSA 2MKLC 4W9ZA 4ZXBB 1LO4H 3S4SB 4AEIH 4IHOA 4Y4RA 2ADFH 1PG7W 3H9SE 2DOCA 5J6GA 4QMAA 3ZIWA 3EO9H 3CBKB 4MB4A 4XJWA 4OCXL 1T0NA 5I66A 4JFDA 5AW4B 2GPZA 4MB3A 5IJDC 3RL1A 2OSYA 3NW4A 4P9JA 3NCWA 3FU7A 1RPKA 1RZ7H 4KKBD 4WCYH 4HUKB 2J5LB 3UG5A 2YU2A 4A45A 4HBCH 1BD2B 2R49A 2F6AA 3B9KB 3O3BB 1X9RA 4F2ME 2Z4TA 1XU2A 3JQWA 2HTKD 1PZ7A 4ODHH 1F2QA 5HYQB 1HL9A 4YZ5A 3NTCL 4R7NA 3VXMA 5DMJB 3B2DC 1MEC2 2QQLA 1MHPL 1A1NA 2CUMA 2N01B 1SLTA 5D7KD 3HPNA 1W72B 1QKZH 5IF0A 32C2B 2VIRA 3KLLA 2FQDA 2Z4QB 2P49B 4LCWD 3UTPE 1R1A1 3LA2A 1F4AA 1RU9L 4MJ6A 4QHUB 1XJAA 2V9TA 4MAZA 1J1OH 3AXLB 1ZS8A 1S7RA 5T3ZH 4GW4B 1G6RH 4QXGL 4HUUA 3VSQA 2DQDH 4JZJB 4ENEC 1XE7A 5IBTL 1GC1H 1WYJA 3FK3A 4DIXA 1MY7A 2DTYA 4AI1A 5E6IB 2AEPH 2IPTH 1RINA 1QBBA 4U3CA 2JI2A 5CHNA 5HGHA 2D6LX 3JWNG 4OQTA 4HK9A 1DQ0A 5TDNA 4JK0D 3DX6B 3BGMA 2CKBH 3OSVA 4CDWC 3QYNA 4WJ5B 2GTWA 2ZXDA 4MYEA 1DQKA 3FQXA 4TULL 4YSFA 3P77B 4R7DB 4WSJA 2LT9A 5BJTB 1XZWA 3HB3C 5HGAB 1KEML 1XSOA 1RSFA 1CLZL 5K9JH 4A44A 3ARTA 4GBXD 3AW5A 5FPZA 5F7DB 3MCG1 5C7XH 3MO1B 3AKPA 2BX5A 2OMTB 5JORA 3D0JA 1HJGA 2UWEF 3NGBB 4X99A 4YGBA 1H9VA 5DMIL 3LJ3A 2J56A 1KBPA 4WUUA 2VDNH 5SWQB 2GIYA 4PJ5B 5A7WA 4OZFG 3KPRE 4FQLL 4OZFB 4Z7OB 1NGZB 2EKSB 4P5TD 3WMQA 2ZOWA 4PD4J 4EUPH 1VAMA 2JTYA 4YZ4A 2EIJB 5CCKH 4N9HA 2V2XB 3ARED 1RZKH 3ECVA 4IGBB 2WZR1 1JOPA 2JKWA 3AFKA 1HXYA 4JDVB 4TS6A 1NA1C 2D3RA 4O2EA 1POV0 2F53E 4QPWA 5FOBB 3SBQA 2VTXA 3ARQA 3NCFB 4KJWC 3U25A 1ZV5A 2JB5H 3QDGA 4L8DB 4IEFB 5C3LD 2I7OA 3S35H 4DOHE 1NMCC 2E27L 1T7ZA 2QSCH 3PPEA 4DPBX 3GKZA 5HVHB 5L8JB 3S8FB 1HN1A 2VDPB 2DBLL 2XXMB 4POZC 1HSBA 2HFEB 4JKLA 1GC1C 3MLPA 5IVVA 4C8XA 3UYPA 4HQQH 3GXDA 1HRV3 5CGYD 4Z7WF 4LRNH 1USZA 2ZGKA 2BK8A 2RQEA 4HKZA 4M1GL 3V95A 3J2PA 4AIXA 5KS9B 4FFIA 1IBZA 2B0SL 3W59A 4ZQTA 2IWEA 4P23C 5FP7A 3CZUA 3MRDA 3R4DA 4U31A 2ICEA 3ZQXA 1NOAA 1U41A 1XCXA 4HCIA 4N8UA 1BPVA 2IXLA 4EN8B 3AFGA 2HWZH 4OUSA 4XNQA 1PK6C 2GMMA 1WCSA 2X1OA 3OZ9H 5JQ6H 1LR5A 3WN5B 2V5TA 5DWPA 1HE8A 4OF6A 5DUXA 3K46A 2UZYB 4W9JC 5LB1A 1XH2A 2MWCA 3H3BC 1PIV1 4YEEA 4S0TD 1TQSA 2PR9A 2JCWA 2YAPA 4YL9A 1CIDA 2GC4C 3QDJD 2P5EA 1F5WA 2DCJA 5EYXA 4WFEE 4Q14A 3DTXA 1WWYA 3B9EA 4K8RC 2WVTA 1QP1A 2LALA 1SN0A 1IBFA 1RZKC 3BUBA 4NWTL 4XHBA 4TF4A 5ERWA 4FABH 2J1UA 5IMLA 3HI1A 3KCPA 4R0LA 4AE2A 5IHZA 1W8TA 1INEL 1OAXL 1KGXA 1VESA 2HX7A 4MJIA 3SCMA 1HEJC 3ZSLA 3MXWH 2VABA 1A6UL 4KFZC 1UEYA 4CVXB 1Q9KB 4IMKA 1FNGA 2VQ4A 1I8UA 1YNLL 2OR8A 4WV1C 4XWOD 4QRRA 4FTBA 4N8VA 3WJMA 5DHVB 3P3TA 1OAJA 3G6DH 2FBJH 2OSXA 3C8DA 3VFOA 2ZX2A 1ETB1 3GI8L 1YFWA 4I18B 3VFRA 3BRGC 4PDWA 4FMFA 4NO5B 2HVKB 1HRI3 1R3LA 5DF0A 4NQDB 3QEGL 1V05A 4KXDA 1HQ4A 1BOGA 3APDA 5I1IH 3KQ4B 3BC9A 4U1IB 1CLYH 4A7ZA 4O58L 5A6XA 4HV8A 3RIAK 3VB9A 2YJQA 3QQNA 4YBQC 2OJ1A 3C6EA 3V6OC 3VA6A 2G2RA 2H6UA 2NR6C 2DL2A 3W81A 5KSBE 1U5XA 3S4SA 1RMFL 4U6HA 3GRBA 3JVGA 3SO3B 4ETQB 2C3VB 3LDBC 1H9WA 2DH3A 2QGBA 2X6AA 1N7MH 4YSUA 1UD3A 1RUE2 3S6PA 5BO0D 3C60A 3BZDA 3NZSA 4KRNA 1ZVSA 5E0FA 5I6XC 2WQZC 1DJSA 4C56A 1CU4H 1L0PA 4ZS6D 1BW8A 1X9PA 4U1SA 1KJMB 3T3MF 3THTA 4DRVA 2RR12 4K3DL 1BIIA 1L0YA 4AH2B 1TFHA 4AK3A 1YHPA 1EDYA 3H1YA 4CDQB 1CWVA 2VVEA 3IGAB 2R061 4E2QA 2O6PA 1XTMA 1D5XA 5EF3A 1SFNA 4MQ7B 3NQHA 3ECBA 1BFOB 3NAAL 4XXCA 5FZOA 1OIOA 2FHRA 1NUNB 2RS52 3M1BB 3ZSTA 4HUWB 4B9IA 4I30A 2ZOTA 4Z78B 5HV0A 4AQ1B 5IY5B 2OPCA 4FOWA 2RM22 2HFFB 4IRZH 4Y1SA 4IKJA 3FT2A 3A67L 3ZIMA 1ZHBA 32C2A 4BZ1A 3POEA 4P2OC 1I7RA 3I9PA 4KY1H 5E1AB 1A02N 4UQEA 1BCXA 2QBWA 4X8NA 1TTAA 1E9PA 4RDBA 5TPWH 5KW9L 5HJGA 2N1KA 5KVEL 3SJVA 5F32A 1BLNA 2W8CA 5T5NF 3NZHH 2AENA 5DA4A 3P0YL 4E41A 4EMZA 3FU6A 3CDGA 2H1PL 4PG9A 3DETC 1O91A 4D0BA 1BKZA 2O4EA 3UO8B 4IV1B 1QY4A 1LHOA 3QG6B 5FLUA 2JX9A 3CFKB 2NY4C 3OJMB 3QB7C 4NZ8A 1U8MB 4BIKA 3DX6A 3O6KL 5EZIL 4P46C 5BOPA 1O5UA 2WTRA 3QJFA 3N7LA 4HIXL 4OZ4A 4HAGA 1G9MC 5DR5L 4ZKTB 3TNMA 3P77A 3HW7A 2I69A 5A40E 2NNRA 5C0IA 1OC1A 2Q3XA 4FYTA 3VH8A 3L2YA 5I30H 3THPA 5ILTL 4K3EL 5FPAA 3IETA 5CIRA 5CXPA 5JHAA 43CAB 1MF2L 5JVVA 2VR9A 3FOLA 1C8NA 5KN5B 2ZOKB 5AOZA 4PJBB 5IFJB 2DQGL 1UMIA 4H5SB 4XFFA 3SPIA 3P4OA 3WG1A 1NGZA 1JGDA 5LA0A 1XGRB 2CK0L 1KDIA 1WW7A 2GI0A 2EO7A 2VC9A 3RJRA 1BZ7A 2PYED 3B34A 4AYMC 1PMJX 3SGDH 4I0WB 4IGBA 1CAWB 5EBLA 3HHSA 1REFA 2HWC2 4KK6D 4Y1AD 4BWTA 4XXDA 2AHIA 3IT8A 4TV3A 2DBJA 2ZYSA 3NSTA 3RWIB 2UZXB 1OKOA 3PNAA 4RD7A 4YFZA 4RISH 1F90H 4H8PA 3BKZA 3L48A 3BTYA 4YSEA 4NBXB 2PTUA 3JV6A 3D8MA 1PLBA 3K8KA 3LQZB 4MXQC 5JW4Q 5BNOB 4IEFA 5L4IA 4FXTA 4ISRA 4NM4L 3KT4A 3EYVB 2VDMB 4KUZH 2Y1AA 2HFEA 3DHMA 3AP7A 3NA4A 2FSEB 4HUVB 1MFAL 2DYPD 2X9YA 2BXYA 3EFFA 5GRUH 3VHPA 5IQ9A 4P2QB 1RP9A 1WGOA 2ZXGA 4I1NB 4LCYB 3S37X 1MIEH 4IM8A 4WWKC 4WVRA 3S3PA 5EA0H 3W0WB 4XMKL 4CJ0A 3C9NB 3ECUA 1CVNA 1MEXL 5C5UA 2WAOA 4NWWA 4Y19B 5D7IB 5LJYH 4JRYD 1JS9A 3INUL 2RIKA 3CU7A 1PPIA 2WXMA 2W60B 3W9DA 3TIEA 1GZPB 2HG5B 4JC1A 4CEWA 1QR4A 1WIPA 2Q3AA 3I74A 4HISA 4PJGA 2UZYA 4WFGD 3SY0A 1U33A 5BXXA 1MFMA 4AV5A 4D7BA 4PVNA 3OEBA 1AMXA 1NMAL 5C0BE 2XTLA 1Z7S3 4YZ1A 2YS4A 4NSKA 4UQ9A 1TQBB 2EDMA 3IWUA 1AIFA 1GFF2 1CO1A 2NQ3A 3KDMA 5DD1L 1VP6A 1RK7A 2HLEA 3BRDA 1U3ZA 3K75B 2M2DA 5C6PB 2X3BA 4TYUA 4FQHB 4UTAA 3X11B 4U6XA 5KVEE 1WEJL 1IE4A 1WGVA 2XA8L 4YWGH 3E2HB 3POWA 1UYWH 1A0QH 2FE0A 4PJDA 3LA7A 3N9GL 3WDIA 2A6DA 4AENA 3CZEA 4UIKL 2MEV3 3C5SA 1A8MA 4MG2A 1KC5L 2BNRB 2CGNA 4M4PA 4DT2A 1DQMH 1CFSB 4XE9A 4ERSL 5J09A 2IFWA 1L6PA 3QUXC 4DGWC 1KDKA 3NYKA 2K7PA 4JQXC 3VBOC 4LHJB 2B2XL 4AHZA 1NCJA 2D40A 1FE8H 4Q7DA 5CEZD 3V0AA 5AG9A 3MRKB 4L8QA 3T0EE 4D0QA 1W2OA 1FBIH 2VMIA 4U1IA 3SODB 1R0AL 5JR2A 5EU3A 5LK5A 1OGTA 4AFBA 2Q5TA 2X44D 4ODHL 1KNOA 2RB8A 2RH0A 3ULUC 5D7JA 3NCBB 5FZFA 3EOBB 2J6EA 1AYM3 4E27A 1TTBA 2VCOA 1U8PA 2H5UA 3NH7L 1X7QB 1QZNA 1IB5A 2NX5D 1BM7A 3SBWA 5F6HJ 3WS3A 4V2BA 2DWSA 2C3VA 4UOQA 4OQ1A 5IVEA 2Q2EB 2YFZA 4JN2B 3S8WA 4V1DB 3JWDH 4YH6A 3T6ZA 5MI0C 1OD5A 4Z7NF 4DEQA 1FH5H 1W9FA 2P80D 3DIFB 1AD0B 5KSBF 2NYYC 3WNJA 4HKLA 1I3HA 2ZP0T 3D0SA 4ZPTA 5JHDD 2VC2B 2P4EA 1KJMA 5EJZB 1MKFA 2C24A 4KX9A 4RMUA 2EE6A 4AH2A 4XJZA 2F7PA 4SBVA 4LMFA 1YQ2A 3MQIA 4MS8D 4LULA 4XMLH 4UUJB 2WSDA 5EZJB 1B4LA 5FDYA 3WO4B 1IEBA 4OGXL 4XN8A 1G6NA 4WFFE 1VBB3 2AEZA 5C07A 1NAMA 1OEZW 3M1BA 1J3PA 4HUWA 5FKBA 3VJ6A 4MD0B 4F83A 1RUAL 3FU8A 4N2DA 5BMFL 5F2WA 3TVMA 3TF4A 1YSOA 1GAFL 3JTTB 2HFFA 1IC1A 4NO3B 2CIIA 4XX5A 5C86A 2Z64C 3VFNB 4EROA 2OMNA 1VRH2 2EC9T 1NC4B 4ACTA 1DJYA 3RX8A 2Z7YA 25C8L 1NOVA 1B4RA 2EVXA 4SLIA 3R06B 2LOEA 4EDXB 3NV1A 1XZ0B 4LIVA 2XT1B 2EZ0D 3ACIA 3I6KB 3AL5A 1Z5LA 3FN0L 3MLXL 3MJ9L 4PGCA 1YJLA 4LF3B 4MHUA 5AVWB 4EQVA 1GYWA 4KU7A 5GIRB 3RNKB 3MGUA 1KN2L 4K8RL 1FZMB 1V9U2 3ROLA 2TSAA 4F2MB 5BV7C 4X8XA 1TEGA 1U8MA 4YSOA 4YSTA 2CO7A 2CUIA 4JBSA 2LFEA 2IVIB 4P57B 2WYSA 4WLCA 3VGHA 4NHUA 1WAPA 1GP6A 2A9BA 2XV2A 5JLZB 3AVSA 3LB9A 1PGW2 3C6LD 4LBQD 1PZUB 1WUZA 2IVJA 3TYGH 1CDUA 43CAA 4B7IA 5IT2L 4BH7A 4ZQKB 2EIEA 4A7GF 3H6JA 2HWE2 4PJBA 5J6SA 3IIIA 3OYWB 2VLRE 4ALAL 3HE6B 4WVWA 3WP6A 3MLUL 4GSDL 2C8NA 1J8RA 4N2MA 4F8TA 5I18H 1FL5B 1W6WA 1WBXA 3NACH 2UU8A 2X28A 3OB0K 2CLVB 3GSWA 3NFSH 4F9PA 2IDFA 1J1PH 3D5OF 3T77B 3DO4A 4L4VA 3AYAA 4KRPC 1E7VA 7PAZA 1CAWA 3I84A 2PP7A 4ARXA 1QSED 5E2WH 1IZ3A 4Y16D 3QNZA 5E2UH 1CX4A 3OGCB 1R34A 2PP9A 3HAEH 3LZRA 4JKPH 3NP3A 3BALA 3H9AA 2UWEA 4XBLA 3D85B 1YI7A 3T0XA 3TH4T 1YY9C 4IJ3B 5DUPL 3V56A 1D2QA 4DPCX 1UJ3B 2OUHA 3T1WA 3WGVB 1DIWA 3I59A 2W65B 2R9HD 4P9ML 1TG8A 2OL3B 3WUCA 1FO0A 5C0RL 4JG1H 3WKYA 2YJLA 4PT6A 1G7QA 1NMBL 1ALYA 5HYIA 4UTCA 1G0YR 3BXNA 3GXIA 3KPRB 3S37H 4LCYA 2ARCA 3LTVA 1CFTA 1UOKA 3EDKA 4LCCA 4L23A 5FUCC 4B4PA 4LSPH 3M3QA 3WSQH 3QWQB 4JM2B 4F2EA 3ACFA 5DTFB 1KBWA 1IM9B 1O8SA 3TNQA 3MNWB 1FMD2 1MFDH 3U4XA 1ZGLB 1JYTA 1T80A 4URAA 3VZLA 5AWNL 1F3JB 5ANHA 3FH7A 4JUSA 1UZYA 4LGPB 2W68A 1PGL1 4D6RA 1I1YB 1YAZA 1IC4H 2NY3C 4YVUA 5AAPA 1V6KA 1VBA3 1IKNA 5T1MA 3BZEB 2FYVA 4CC4C 4AXOA 1T22B 3PQYD 2D9QB 4DOHB 4NJ4A 4Z7WA 4K7PX 5JPNA 3HMWL 2OZ6A 1I3VA 2VOXA 4RGKA 4YW3A 4WEMB 4DKAA 1E6OH 3O4LE 4PY7B 1KLFA 2G9HA 1AR83 1FAYA 1JN6B 4PRHE 2CDEB 5ID0B 4E9RA 4XFHA 4BXFA 4JM0A 1NCUA 4JFYB 4ZHNA 2C9KA 2VSMB 3DXAD 3ARVA 2X8KA 3TBTB 4FXGA 1FLRL 4J23A 1C12B 1TVHB 1KY7A 2YOCA 3RGVD 3WFCH 1KCVH 1PX3A 2H47C 1G9ML 2AJSL 4LRIC 2PAEA 2KL6A 5D7SH 2RDRA 4K94H 4I3GA 4FFZA 1N5AA 4IIQC 1DBMH 4GMTH 4PGDA 3WIAA 1JV2B 3D4CA 4OLUH 2KD7A 1M7XA 3V6FB 1R091 3GIVB 1CFSA 5DT1H 2Q1MA 3U11A 1XCTA 2VZSA 1SQ4A 3MRJA 3PTRB 1WZ1L 3MLJA 2XG4A 3BMWA 3SGJC 4FQIH 4FA8A 1W6OB 2XWTA 1G86A 3OLEA 1IFRA 2OQ6A 4LK4A 2ZKXA 2EDNA 3QORC 4EPSA 1T66C 3K71A 4MGTA 5EC1B 1MHHA 2FRGP 3AYCA 1LOBA 5CVRA 1OTUD 3Q43A 3WLUA 3SDDB 2PCPB 5C8CA 1A3RH 4PRBB 1CDJA 2VJXA 1F3DJ 2NW3B 2V2TB 4XC3H 1ULVA 2W0FB 1YFUA 1X7QA 2WP3O 2VQUA 1YEFH 3KPPA 5F96L 3ZJAA 4DCQB 3MRNA 1RJCA 5DFVC 2IWFA 4ZAKA 3EYSH 4MCMA 2E7AA 5C70A 4AYDC 1IGYA 4FVVA 3QUZD 5LO7A 5IKCA 1AD0A 3UG4A 3TAYA 5E4AA 5EF2A 2W59A 2EECA 1SY6L 3LSOA 4KWLA 1W8OA 1KGIA 3N1GC 1KEXA 4RFOH 4X6EB 2ZOEB 2A7BA 2ICWJ 4HLZG 1GWKA 2FZ3B 4P5YA 4UUJA 1Z66A 5HVFB 4LBLA 4NLAA 4A7UA 4PBXA 4X8PA 1XMWA 3AACA 3N9QA 4CU9A 5D8AB 4YBLC 3B37A 4I8DA 3HOGA 4K94C 2O5NA 1JJUA 1VFBB 3SPVA 3VAEA 5K9YA 4KFMA 1I1AA 4PWIA 3WIHH 1EHKB 2AQNA 3ET9F 3FQ1A 4P2RE 3VL8A 3R06A 3PP4H 3H9SA 1KDJA 1VKXA 4FAHA 4LP8A 4S1SH 5JNYA 4ZXEA 3RPIA 4U7MA 2WLMA 3A4DA 4AVJA 4MA3A 1H8TA 1A66A 4HIJB 3TTSA 1G9DA 1LEIA 2FMDA 1V3MA 3MRMA 2NXYB 4X80L 3KGTA 4FD0A 4P00B 1HB4A 3A0KA 5CZKA 4FQ2L 1DVFB 3AM8C 4PP1D 2Y0SA 4G2AA 4P57A 3IDAA 3TFKD 4PB9H 2ZKHL 4G4FA 1IM3D 1Q1JH 3O3AB 2WZPD 2Y7SA 2ZUQB 5F7NC 3VG9C 1VF5C 2CLZA 1YNTB 4FMVA 2V72A 5AFBA 3N9OA 5T5FL 3INOA 2HVBA 5CNHA 1CB4A 3KYOA 4NXKA 1W6MB 1OHZA 3RFRA 4ZQKA 4HD5A 3U9UA 3RVHA 1L0XA 3IMNA 2D7FA 4Z7UB 4JKNA 1IBBA 5L6YL 3V0VB 3CWGA 2FQGA 5DD5H 1D5ZB 4UWDA 2CLVA 5GRUL 4DGYL 3SE3C 2WNVA 4DP8X 1R5IB 5DZGA 1NFIB 4CGTA 2G9GA 1O7DC 2V17H 2VDLB 2QVKA 3L1FA 1FF5A 4LLDB 2F68X 4CDXC 1U92B 5CP7B 3MIFA 3TL5A 3GLEA 5I5JA 4GW1A 5JUEH 3ULUL 4UYQA 2DFBA 1PZ8A 3URFA 4FEIA 4NKOB 4AYGA 4AITA 3ULSA 3FKUS 4GQRA 3HR9A 4PV8B 3RWHB 3AKTA 1KIQA 4S0HA 1GV9A 3KYMA 1SQ2N 4E5XG 4E5XB 3IIAA 2JKIS 4QX2A 1GJWA 3BN9C 4NC2B 4Z18A 4LCUB 4M6NH 3T2NL 2O5XH 3MZTA 1YNKH 1S0IA 3NV4A 5FY4A 3QCTH 1EVTC 2Q20A 4XTPA 4YM3A 1CGWA 5I5IA 1Y9MA 5DJAA 1KFAH 2JLLA 3UGGA 1AE6H 3X3FH 3ZL2A 1G1CA 4HOMA 2BDRA 5DTFA 3VGGA 2VNVA 2MPAL 1DQ1A 5DUML 4HWBA 1GSLA 1MH5A 3WJJA 3M6DA 1XXFC 1PF3A 4DGUA 3VXRE 2P42B 1F3JA 1MFCH 1OGSA 3ULVL 1PO12 1UKQA 2F53A 3L3OB 3LEIA 2WSVA 1WD4A 5EWSA 1E27A 1FVCB 3PAYA 5CFDA 3QI9A 1S3KL 2WB7A 3BZEA 2CWSA 4LEOA 3V0WH 2DIBA 4K7PH 5HDOA 5F7KC 1IJ9A 1RPQA 1ASPA 1FE8L 3CH8A 4NWVA 4CU7A 4BK8A 1KV7A 3PJSB 2YUWA 2CA4A 6PCYA 3O1VA 4XMZA 3BVVA 5ID0A 5FPIA 5GGQL 4YXHH 1I75A 4M1CC 3SB3A 1GANA 2F15A 1D4M1 3VI3F 4RN5A 3U83A 3TBTA 5BV7L 3BAIA 3OKYA 1UM5H 2IDSA 2X70B 2WT1A 4PBWD 2AABL 1CF1A 5F5IA 2VULA 3IFNH 1UD6A 2OXHA 1FYTB 4PTUA 1A6VL 3PHOA 4OT1L 1AGDB 1BFTA 2WCSA 1N59B 1ITBB 3VQ2C 2VUOA 3J7NA 3GIVA 5BQ7A 5LG6A 4NRXA 5C0DA 5ADOL 1MLBB 4KU8A 5D7LA 2DJUA 2NNAA 1FC1A 2E9IA 1CICC 5MP6L 4TSAL 3HLKA 3RJDA 5CSGA 5J98B 4WW1B 3VFPB 5C0BB 5KJRH 4FPCA 4G9SB 1JV5B 5E5LA 4HETA 2DWTA 1R24B 1ZYBA 4WO0A 3T3YA 1Q0YH 3OKKA 3LVTA 1T03H 2YD2A 1K3ZA 4KVNL 3BWAB 3UTZB 4N3UA 4P04A 5JHMA 3WDVA 3LZNA 2Z42A 2HUHA 2XPJA 1IKFH 2XNAB 5TE6H 2W0FA 3U2IA 1OUSA 2CRIA 1OE1A 2AK4D 3RWGB 2CTVA 4A55A 2YZ4A 3RNSA 1EIBA 4AXWA 4CCKA 4HCGA 4TXVB 4FP2A 2R2EA 1JUFA 2DPKA 4LARL 1KN4H 5DJ8A 3OAWA 3TZVD 2F5AH 3WCSA 1HXMB 5DDJ3 2A74C 5AW2B 2DQFB 4P2YA 4XVUC 1JRHH 3MRIB 4X4XA 2Q5BA 3SSGA 1BDYA 2Q87A 1SEQH 5DYOB 3ULUE 4GRLD 1CXIA 2GDFA 3X1GA 4WSGA 4TOYH 1D5IL 5D21A 1MREH 2WGXA 3EUUA 3L3IB 3LZPA 3GTVA 4XE0A 3T0EB 4NO0B 1BG1A 2WUCH 3A6BH 4P5MB 4YVSB 4CP9B 2ITFA 2P7TB 5EO9A 4N53A 2Y07L 4JREB 4DTGH 1CFBA 3VX1A 4Z82A 4LHSA 2J8UB 5HDLA 1VFBA 2NPLX 1D7FA 4KK8D 5KSBA 4JO4H 5JZ7C 1R17A 2HB0A 3FFCB 3IAPA 1FFPA 1SLIA 1IGFH 3VHNA 3AJZA 3AY4A 3JTSA 4PJFB 1D2SA 2EIBA 4WFHD 4Z2WA 4CSPA 1MJ8H 2JJWA 1V70A 4IEXA 4CDUC 4OCYH 2QADB 4R4FH 3NJLA 4B9YA 1ZLVK 1DBBH 2EXYC 3DHPA 1G84A 9CGTA 1J0HA 5C0FB 3KZ8A 4BHUI 5F9AC 3CG8A 5L4JA 4Q4EA 5B3JF 1J1PL 1P5UC 5HD8D 2WNOA 2W9EH 3QULA 5EOQL 1PNCA 2YD6A 3VFGH 4AVIA 3LRSA 2OI9C 2ORBL 5EZPA 3X1BA 2R8SH 1YEDA 4BZYA 2Y6SC 4QXTB 3O3AA 4U1NB 1F6LL 3EDFA 3OKNB 1HIML 4AMWA 4F37F 1O6UA 2KA3A 1A9EB 1Z0NA 4GXVL 1OCCB 4Z7QE 1IARB 1MJ7L 3ALWA 3RTQD 1KDMA 1G4MA 1WTGT 2JF1A 2ZTBA 2YLHA 1SYVA 2WSPA 1XF3B 3BH8A 4LLVB 1JUIA 1PVC1 3QRFM 3ESPA 4PCTA 1ACYH 1X5KA 3SDCB 3HLAA 1EAJA 1JFQH 5KHJA 3MCLH 4RWYH 5FCUH 1OUXA 8CGTA 4PP2A 4LLDA 4DN3H 3W38A 1EBPA 1NIDA 1AL21 1GRWA 4ZMLA 4CCJA 4H25A 3WSQL 2OP4H 1SEBB 5I8CA 2OL3H 2R56L 1JWMB 2QQKA 3CDFA 2NY0D 3DX8A 4UQCA 3WTSA 4NKOA 5DHMC 1E8ZA 2VDRH 4RAVA 4A7GA 2YG0A 2Q6WA 1KJ3L 2Y5QA 1QFWM 1AGCB 2IMNA 4J8QA 1NM4A 5KYNA 2B4CL 2XN9D 3BAXA 3EHBC 1QF3A 2EICA 1ND2B 1MVUB 2EABA 1BQ5A 3EJPA 3O0RH 4QQ2A 3D5OA 3U07A 4AHYA 3AMKA 4LNRB 3ZQWA 3C87A 3PP3K 2QDNA 2WZPP 1EGJL 3OHMB 4S10A 5CCJA 2EXWC 1URIA 3K2KA 4HU2A 1RAMA 4IQPA 1B0RA 4GEJA 5BZDB 3NSYA 4NUGH 1NY71 1D4VB 3I4IA 4F9LC 4TUJB 5HGDA 4XP9H 4A6SA 3OCPA 3II2A 2Q30A 1SDYA 3FN3A 2H3XC 5D7SL 4U1GB 1BVOA 1UACH 3UJIH 3B01A 1AY1L 3CKHA 4OLYH 4XPBL 2PHTA 1ECYA 5AFEA 3HZYA 1JRHI 1H6UA 3L3OA 5DQJB 4YC2B 4IOSA 3FYEB 1FL6A 4GY4A 2YD5A 4FS0A 3CIAA 4TQ8A 4J3OG 5A6MA 1YQVL 5F6IB 1WBYB 4K7FA 2JQZA 1LEKB 1MPAH 4FN0A 2F5BH 4OM0H 3RVTC 4LCIH 1RURL 5F1OB 3RQ0A 1I9IH 1ZA3B 1H6TA 5DUUA 5GZND 3SE4C 2IBZY 3BVWA 3NK4A 4A3ZA 3L4XA 1ZV2A 1H8VA 4I77H 2Y6FA 3UTTD 5CLZA 3N5AA 1WLTA 1RZJL 4APQB 1RL1A 2Q8AL 1DGWA 1YEFL 1AGDA 3GGWA 4JY4A 1N59A 2BIPA 4YARA 4A39A 2PXYD 1QX1A 1MQTB 1NC2A 4JY6B 4CCLA 1HJFA 1J05B 2YKLH 3L3JB 1F86A 4KBBA 4YXKH 4I1PA 2D0GA 1KENH 4M7ZB 2H2SC 5HPMB 3S0MA 2H26B 3O4OC 4GG8B 4YN3A 3VFPA 5JW4M 3F7KA 1CK0L 1G7IA 3MV7D 1R3HA 5JSRA 3I3QA 5J1AB 2HZHA 2ZF8A 3O4LB 3S5QA 4CA4A 4D9LL 3SDXF 1FT9A 3BWAA 1LK2B 1MCJA 2KHAA 3UTZA 2YEQA 3L5XH 1TZHA 3AKRA 4I0AA 1A7NL 1E4WL 2C9SA 3VDDB 4DF9A 4PJCF 3RWGA 2OZ4L 2P45B 2WXOA 3MOBL 4IDLA 4Q9QH 2ITCA 2HWF1 3LF7A 4YWAA 4J8RA 4LHQB 5EYYA 1U30A 4L2YA 3HG5A 4CU6A 3GS7A 2YBGA 1E5RA 4JHUA 1YN6A 1W03A 4P9LA 2IDTA 1SM3L 2XJPA 5EPMA 4K8RB 2QHRL 4MA7L 4X83A 5B8CB 4PF5A 4PJEF 2R23B 2PYFB 3RI5K 4AMXA 1Y7VA 1J58A 2CSPA 1X5AA 4NT6A 4IKNA 4UNUA 3RL2B 5J6HA 5IJKA 2IBZX 1OAYH 2WC7A 4FCAA 4L8BA 3RWDA 5L2KE 4GAZA 1CYXA 5C9AB 4CN1A 3WG2A 3EGXA 1L7TH 2DWXA 2VH9A 4CP9A 3ULUF 5JPMB 3UYRL 1RIUL 3EJUA 2Z65C 3E6FB 5F3CA 4DPAX 4ZG1A 4APXA 1S5IL 1E67A 2C4FT 5F6HI 2QZ2A 4GWJA 2BY2A 4JDZB 4HKJB 1T89C 3GPSA 1TPXC 3OR6B 4RQPA 1VRBA 2HJLA 1OT2A 4R9DA 4HX1B 2PWFA 3ARXA 5A6IA 4Q9RL 2CGOA 2XPZA 5DD5L 5C0FA 1XIWC 3O0LA 4A6YL 3O1TA 1FL3B 2WWNA 5AFAA 1GZHC 2BHUA 2E8YA 2VH5H 1FUNA 4KTEH 2QT6A 4N1CA 5CILH 4ZUTA 3MN8A 2X9ZA 3ARSA 2A4CA 3GSOA 3ABGA 4XXWC 5DUBA 1BF5A 3GMNB 1QPKA 5ESQA 1CGSH 3TBWA 3LDBB 3ESVF 4OD2B 2MCPL 3U10A 4HWEH 4RGNE 3WI9A 2BWAA 3R7QA 4UFIA 2BPA2 5FZBA 1BXAA 5I6XB 4RVBA 5DUJA 5I0VA 4MAYB 4XI5D 5I8OL 2N7GA 2EP6A 2RMU3 4KDTC 2K3TA 4FQQA 4X98B 4P2RB 1ZLWH 5KJ7E 2ZPXA 1IT9L 1C1FA 3RX7A 4FNRA 2H6BA 3PF2A 3SDCA 3U75A 4UWQB 2FO1A 4PJAF 3FHAA 4Z7QF 1X9TA 1T5WA 3FT0A 3SDYH 2GC3A 5DI8B 1E8YA 1TVBB 3RVVC 1LYQA 3O6FD 3P73B 2VLKE 3HNTH 4ZMYA 3VMOA 1XAKA 2NNXA 3UDWC 4ZOEA 1R19A 3QPQD 5LXGL 3QIBB 1YC7A 1NGQH 2FGZA 3FRPG 5IJVB 3FRPB 2WNUC 1BQKA 3KWWB 3G7DA 1G7MB 1GY1A 3WXVL 5E89A 2NDGA 5BRPA 1T7WA 1TNFA 4AFAA 1GGIH 1HDMB 4JDTL 3SNMA 3VSTA 1S0FA 4W6YB 2Q8EA 3OKMB 2VBDA 3IYLW 3JD73 3Q01A 4RQQA 4HHAA 4X7SH 1LLAA 4XP1L 4EN3C 2OX0A 5HCAA 4NNYB 4RX4A 1QI5A 1MFUA 4WI3A 1AKJD 1Z0MA 3GKWL 5F9WB 4BQ6A 4K3UA 1PSKL 2Y3AA 5JOFA 3QJQB 1OP5K 1ZLDA 3QIUC 5KTEH 2VLRA 3I6LD 1J7VR 4CDWA 2G4IA 3MRQA 3KLAB 5BZDA 2EEXA 1Q9LB 1PX8A 2P5WD 4FFVD 4PV1C 3R18A 4TUJA 4KWJA 1S9VA 1SLXA 3F7LA 5E23A 1KS5A 1FZOA 4E68A 3I75A 4TUKH 1CE6A 4R96A 2YWYA 4HFWA 1FV1B 4JN1L 2BFVH 4W9EC 2EDBA 2DJSA 1A9BA 5DQJA 2XQRA 4TSCH 4AQOA 4N0YL 1HRV1 5F7BA 4G9DB 4R90L 2FO4B 4CCMA 5AC93 1BVNT 1LXMA 2FL5B 3WDUA 3AITA 4ZUVA 4FQCL 1Y7BA 4XBGB 4MVBD 3PWPE 3LZLA 2F8XC 1HX6A 4TLTA 5FHBH 1UOWA 1JZJA 1ENQA 4XXAA 1PLGL 3L45A 4PJ9B 4RGGA 1ZA3A 3LH9A 4GSUA 4DJMA 2AACA 4RR3C 2DQ6A 3AU1B 4OLXL 5GJSL 3KPOB 4QQLA 1NA1A 1T03L 1D7PM 5DK0A 2ZGRA 2HYXA 2JE8A 1RUG3 3X14B 3WIIH 1WTLA 2XYBA 3V4PL 4LIUA 4GAJH 1HZHL 1Z9SB 1D7DA 1F35A 2QGCA 3FQUB 5IM7B 3VXSA 3DUHA 2Z8WC 2R1YB 3O8XB 2XY1A 4BUHA 4JY6A 2ZXWB 5AW5B 5ABAA 2HH9A 4G8FB 3PURA 2HFGL 5T5PA 3BUIA 3M17B 1AR72 3RDTC 2KZWA 4L9LB 3WUWG 5DU7A 3WUWB 2E7QA 3VI3A 2ZE0A 4ECNA 2ESVE 4O2FB 1P7QD 2YA0A 2R16A 1LEDA 2CKBA 1UOJA 4TOYL 3LZZA 1ACCA 4P23A 3VXOB 3MCKB 1OM3L 3O4LA 3QQ3A 5DURB 3ZW3A 1VIWB 4PRHA 2AXGB 3MIBA 3VA2C 2OYPA 9PCYA 1U5YA 1PK6A 4DZGA 2M8XA 5IB2B 4Z07A 2R2CA 3QCUL 4J12A 1G8WA 4TTGA 5DK3A 2K9UA 3LKPB 1IEAA 1TTCA 2F19H 1WZMA 1A4KB 2V0AA 1HRI1 5BNNB 3WLBB 4R97B 2NSMA 4GKXA 3HKZA 2V9UA 4XVTH 1S8DA 1XR8A 5CLTA 2V4VA 3R0MA 3EQEA 3HG1D 1CS6A 2WXKA 4NKDA 5JDSA 1YC8A 4EXPX 2EIDA 4DXZA 1A7PH 1C5DB 3IF1A 3IMMA 1XWVA 2V4LA 1J10A 4F8PA 1OSZB 1Y0LB 5T1DL 2ADGA 4S2SA 5F9JB 1RUOA 2NTFA 1J8HD 4QTIL 6FABH 3RJOA 5FYMA 3RL2A 5IQNA 3RGBA 3ZPDA 4JPWL 3VFGL 5ICYB 1D5RA 4MMYA 4WV1A 2X4SA 3WD5L 1WBZB 4CXWA 3RVXC 5A7OA 3R8QA 1T7XA 1DU3D 5LCWL 1A78A 3RWJA 3OR7B 3EUDA 3LEVL 5EOTB 5E9AA 1SPPB 1NCBH 5F8PA 5LWYH 1XVSA 4G9FD 4MSVA 4Y5TA 1CIWA 3PMSA 3OR6A 4WDIA 1LD9B 1EP0A 4GIQA 1MW3A 2EUWA 3RZCC 3AKQA 3LQAH 5C3RA 3NA9H 2XN1A 1JFQL 3A24A 1PJ9A 4RFEB 2JKLA 3VRJA 1FJ1A 2VKXA 1OLZA 2BVQA 3GBMH 3EH3B 3V6OA 2Z6FA 5EU6E 4BU2A 5GZEA 2NR6A 3HZMB 4EKXA 3WTWA 1EEUA 2ICWI 4LKSA 1S7UB 2X2YA 4W9CC 5E00B 3WDHA 3KL5A 5I15H 4E0RA 1VEPA 2Q4SA 4OD2A 4WNJA 5J0BA 1U21A 2JKRM 2SEBB 3LDBA 5CNAA 1JF6A 1JL8A 2E6PA 3RDJA 2FECI 5CSZA 3RUGE 3MLVL 1QW8A 4FI8A 2XDHA 1N1VA 3FNKA 1DEEA 1MAJA 2ID4A 3EYPA 2H3NB 1NDTA 3BKCL 2NP0A 1C4RA 1NA8A 4P2RA 5EUKB 2YHGA 4MB1A 2XKOA 3ATGA 4W1TA 2JNZA 2FUTA 3CVHL 5JYLA 1OH4A 1S2KA 5IVCA 4Y9GA 2GH8A 4UNVA 4HJEA 4Y4KD 1P4IL 3NCYP 3U46B 1VFAB 2X4UB 1QJY2 2ZXBA 4L37B 1YMMD 2E9QA 4FL4B 4YLCA 1IGIH 2PR4H 4HHGA 4L3CB 5H4ZA 4Z7VB 2ZXCA 3FT3B 2XQXA 4P2OA 2FX8H 3GYDA 3FBKA 3TCTA 2Y7MA 3QIBA 5F2SA 3KJ4B 3SKNB 3VNZA 1W2AX 3KWWA 3DPDA 3VFMB 2XV3A 1HAUA 1HDMA 2XZZA 4OJYA 1A3LH 1MJJB 3SPJA 4AGOA 3KW7A 4B60A 1R6VA 4L48A 5ACZB 5L0QB 2MNGA 3OKMA 2D43A 5FGBA 3THCA 2XN2A 2YEZB 1O4TA 4DVBA 2O6FA 2NY6B 5J7CC 4QJ3B 4N2CA 1CPUA 2BIIA 2ICCA 1CJPA 1MPAL 3LQAC 3OB8A 4KZDL 1KYOK 4KRMB 4LHUA 5EN2B 2FB4H 2ZAHA 1CGYA 3IWVA 4KJYA 2LLLA 4P46A 4W68A 3IDYC 2B1AL 3ARFC 5LGYA 2F54E 2BP8A 3D4GA 2J1AA 1U8CA 5LCVL 4DY5A 1RVFH 2YXMA 1NZRA 4ACPA 4G8GA 2DQCL 2PNDA 5E95B 1ZS2A 5I17B 4UCFA 5D2LE 3DI3B 5T3XL 3OY8B 1LHZA 4JZOA 4RZKA 4BFBD 2IH3A 4R9HA 3VW3H 2JXAA 4H20L 4H7VA 4M6MH 5HHOD 1DZRA 4CADA 1P6FA 5DJ0B 4HS8L 1BVKA 3USSA 3MA9H 2YPVH 2FO4A 2NM1A 4KDVA 2ZGQA 3D48R 2WQUA 4Z6AT 1IEHA 4HFUH 4FFGA 3OPZH 4B1MA 1S7VB 2V5MA 4N90A 4XR8C 1ID5I 1AZNA 4CILA 3ZFGB 3ZE1E 2XKUA 2VXSL 1T4KB 2PO6C 3REVB 1YIPA 4PJ9A 2BSEA 1EA9C 1AZCA 2Y6LA 5E88A 2ENJA 4JPKL 4DKEL 5IFTA 1UW8A 1H3TA 5JOXA 2XJVA 3MUGA 1WZAA 4FG6D 3NCMA 3JB8A 2VW2A 1DQLH 4AQ8A 5GPRA 4ZUSA 3BT2H 3NZUA 2GTZA 3CSYA 1RJZB 4KROC 5EG6C 1N1TA 2WO3A 4EN9B 4E4HA 3BYYA 4WU5A 1Q4NX 1O3QA 1KTDA 4MZRA 2GYSA 1Z7S1 1RUPL 3QEUB 4L4JA 3WEBA 4FCHA 2V5RA 5L4MA 3P4LA 2Y5TB 1W99A 1PJWA 1SY6A 1WZKA 2R1YA 2XRAH 1BG9A 1QO3A 3VXRA 1EAOA 4FNUA 2AJYH 1T5KA 3QFJE 5FECA 2ATAA 5ACA3 4ITCA 4XBPB 2D03L 2IV8A 2CDPA 4OHXA 3CX5J 1AP2A 2KQMA 4FFYH 4XN7A 1GIGH 2HN7B 4XB7A 1JGLL 1I8LC 4WWKA 2CH8A 5ALCL 3U0PA 1Q90A 4TSVA 3RYMA 4P5KB 4LO5B 2AXWA 2YROA 4YK4B 3THMH 3MCKA 4W9KC 2GJRA 2MEV1 4F58L 1PU0A 4AE1A 2K45A 3GXUB 4B96A 3GZAA 4EJRA 2VXUL 4H26A 3LH2L 3I8TA 3IU3B 5EZOH 1RJLA 4U2YA 2B20A 4HZLB 1ROCA 3QDHA 5E08L 5FS5A 4X7TB 5E6HA 4K5NA 4UTBH 4XO9A 5KSAD 3UPAA 3W39A 1DQDL 3HZ3A 1KCKA 1U3HB 2A9MH 3SH5A 4G1EB 3ZFEB 2D0FA 2XLLA 4JFEE 5HI4D 3AGVA 2VXQL 4R8WH 1HXKA 1NIBA 1OM9A 1TMCB 5DCCA 5ANMB 4ODSL 4UBHA 2EEFA 3OJDB 2IGTA 2VMFA 5AOJA 3D3VD 1R1ZA 1AYM1 3RWKX 3T30A 3U4EB 2ED7A 3CJJA 3O0XA 1NTDA 2Y2YA 4P9YA 4ATFA 4P02B 2NLJA 3D50A 3GQFA 2ZWLT 4NEHB 5AZEH 5IK3A 2BBAA 2LW8A 5I9QC 1U91A 4GRWE 4PJCA 4XAWL 2YU1A 5ICYA 3HUJB 3NRQA 4AUYA 5T5FA 1CAUB 3EOYG 1E4XL 4L29B 2KPWA 4WUKL 2ENRA 1OQOA 2XZCH 4PJ7E 3T2TA 1WBZA 3NAPC 2E59A 2D6OX 2R0FA 1TMQA 5E99L 3QUXA 4H1LB 1GJIA 3MLLA 5JOPE 3HE7B 4JQXA 1RVF3 4RHV2 2HTLC 4Q9CA 2JDKA 4Z76B 2X6CA 3UP6A 3VBOA 5DLLA 3LD8B 1JDAA 1NKOA 2N1TE 4PJEA 1Z2KA 3JBG3 4XCEA 1LD9A 4XN9A 1VBB1 4GKZA 4KJQD 1BJQA 3C7HA 3AP9A 4ZW5A 4AGRA 4ZNCD 5T3XE 2XJRA 1YEEH 1B9ZA 2V3DA 4GI8A 1Z9NA 2BZDA 2ZAIA 3HA0A 1QMUA 2NY5H 3MPCA 4XZUB 5IGXH 4XZUG 3BSZL 1G9FA 3B43A 3UJTH 4KO9A 4AI2A 3E8UL 5E00A 3GS0A 3B7UX 3VFSB 3HPLB 3VXQA 2E7TA 1C5HA 5L2KB 4QDSA 5IB5B 4YZ3A 1YN7B 5KUMA 4OV5B 4YSDA 3ZYFA 5LEKA 2HVJA 1F2NA 3OC5A 4IW4C 1CQ9A 2NYYA 1O6TA 1WK0A 3S2CA 2XC8A 1D5BA 1SMAA 5DSCA 2EEAA 3S36L 1E4JA 2DIJA 4WHYH 3BPOC 2BY0A 5CKAA 4FT8A 5EU4A 4LKDA 5FYLH 3CFBB 5L7XL 1ZRFA 3K74B 4M6AA 5FZ7A 1UPSA 3MBEC 2RHEA 1L4IA 3Q8BA 4GXLA 5AVAA 1N3NA 4L37A 3L3GB 4FG4A 3AYDA 2NZ9C 3IJYB 5I26A 2NN8A 5B39A 2CCWA 1RZPA 5I1LA 1QVOA 3BEVB 3PDOB 4XJAA 4KC3B 2IWGB 3LKJA 2PWGA 3QQDB 3RI9A 1RJYA 1A6WL 2G3MA 1OW0C 1SFYA 2CAUA 4Y1UA 4ZDHA 1XEDA 2XBO2 3LPGA 4XFGA 2HKHH 4RGNB 5GZOD 5C2BL 5ACZA 4NQSB 3T3PE 3GRWL 1SOSA 4HJJL 4AW4A 4ZMPA 1KJ2B 1UM4H 1EPWA 2ZGLA 4N2KA 5D71H 1S7TA 4G5ZH 4PJAA 1DSFL 2FECL 3FZUD 2C5DC 3PL0A 1LO5A 4RGMB 4HWZA 1M56B 1S2BA 1OANA 1BAG