3ZXAC

Structure and assembly of turnip crinkle virus i. x-ray crystallographic structure analysis at 3.2 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
295
structure length
295
Chain Sequence
QKVTRLSAPVALAYREVSTQPRVSTARDGITRSGSELITTLKKNTDTEPKYTTAVLNPSEPGTFNQLIKEAAQYEKYRFTSLRFRYSPMSPSTTGGKVALAFDRDAAKPPPNDLASLYNIEGCVSSVPWTGFILTVPTDSTDRFVADGISDPKLVDFGKLIMATYGQGAAQLGEVRVEYTVQLKNRTGSTSAQIGDFAGVKDGPRLVSWSKTKGTAGWEHDCHFLGTGNFSLTLFYEKAPVSGLENADASDFSVLGEAAAGSVQWAGVKVAERGQGVKMVTTEEQPKGKWQALRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN
publication title Structure and Assembly of Turnip Crinkle Virus. I. X-Ray Crystallographic Structure Analysis at 3.2 A Resolution.
pubmed doi rcsb
molecule tags Virus
total genus 18
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zxaC02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zxaC01
1ASJ3 4CDXB 1ND2C 1ASJ1 5C4WB 1EAH2 1PVC2 1POV3 5FOJB 2R072 4N43A 1POV1 1AL23 1AYM2 1COV1 4NWWA 1QJX2 5BNNB 1AL21 3TN92 4SBVA 1NY72 4RQPB 4BCUA 4FTEA 4IV1B 3JBG2 1AL0G 5A32A 1EAH3 1VBC2 1EAH1 1NA1A 1PVC3 2XPJA 1AYN2 2R073 1PVC1 2R062 1H8TA 4QPIB 1CJDA 2R071 1QJX3 2MEV2 4PDWA 1AYM1 3TN93 4Q4W2 3TN91 4YVWB 2HWF2 2HWC2 4AEDA 1NY71 2BBVA 3JBG3 1BEV2 5A33B 1PO13 3JBG1 1NCRB 1VBC3 1X36A 2RS32 4WM8A 2ZZQA 1VBC1 4Q4Y2 1AYN3 3VBHA 4RR3A 2R063 1AYN1 3NAPA 5CFCC 5C8CA 1RUD2 2R061 2MEV3 4CDUC 4Q4W3 1R092 2MEV1 1W39A 2RS53 1ND3A 4Q4W1 2HWF3 2HWC3 1F8VA 4YVSA 4CEYA 1BEV3 2HWF1 2HWC1 1BEV1 4RS5C 3ZFGA 2RS33 5K0UA 1B35C 4Q4Y3 2IZWA 2RS31 2X5IB 3CJIA 2GSYA 4IV3A 4Q4Y1 4Q4X2 1RUD3 4RHV2 3VBSC 1RUD1 1R093 3ZFEB 5L7OC 1R091 1OOPC 1RUJ2 4GMP0 1RMU2 5ABJC 3VBRB 4Q4X3 4RHV3 4QPGB 5BNOC 4Q4X1 3VBFB 1AR62 4RHV1 2FZ1A 2PLV2 1H8TB 3VBUA 1RUJ3 1MQTC 4JGZB 1ND2A 4GH4C 4CDQB 1RUJ1 5C9AB 3DPRB 1OPOA 5D8AA 4NWVA 1FOD3 1RMU3 3HAGA 1RMU1 2ZAHA 3VDDC 4CEWA 4WM8B 1AR63 3VBHB 2PLV3 1AR61 4CDXC 3NAPB 2PLV1 4Y5Z0 5C4WC 2TBVA 1RB8G 3S6PA 1ND3B 4CEYB 1AUYA 5BNNC 3ZFGB 1QQP2 1RUG2 1V9U2 4RQPC 1QJU2 4IV1C 5CFDB 4N53A 1MEC2 5LK7B 1M06G 1DDLA 2ZTNA 4QPIC 2RM22 1QQP3 3ZFFB 1RUG3 1V9U3 1PO12 5CFCA 4YVWC 1QJU3 1QQP1 1RUG1 1V9U1 1BMV2 5BNPB 1QJU1 1X33A 1MEC3 1MEC1 2BFUS 1NCRC 1POV0 4CDWA 4RS5A 1QJX1 2RS52 1B35A 1AR92 2RM23 1VBD2 5D8AB 2GH8A 2RM21 5ACA2 1QJZA 3VBOB 3VBSA 1PO11 4WM7A 2BPA2 1BMV1 4CEWB 1GFF2 1VBE2 1RVF2 2R042 2HWE2 4JGYB 2X5IC 1AR93 3IDEA 1RHI2 1VBD3 2RS51 5ABJA 1AR91 5ACA3 1VBD1 1Z7S2 3ZFEC 1HRI2 5BNOA 5ACA1 5J98B 4EJRA 1VBE3 1QJY2 1RVF3 1VBE1 1EV12 2R043 1RVF1 2XBO2 1MQTA 4GH4A 1RUH2 2R041 4N53B 2HWE3 1AR72 3VBRC 2HWE1 4N43B 5JZGA 3M8LA 1RHI3 4QPGC 3VBFC 1RHI1 1E57A 1Z7S3 1H8TC 3VDDA 1HRI3 1Z7S1 1K5MA 1NCQA 1HRI1 1ZBE2 1QJY3 4JGZC 4CDXA 1FOD2 4CDQC 5C9AC 1EV13 1QJY1 3DPRC 5A32B 5C4WA 1PO22 2XBO3 1EV11 1RUH3 2RMU2 4Z92B 1NA1B 2XBO1 1AR73 1RUH1 1AR71 4WM8C 4PDWB 3VBHC 4CDWB 5BNNA 5AC92 1A6CA 3NAPC 4RQPA 4AEDB 1ZBE3 3JD72 4FTSA 1RUC2 4IV1A 1ZBE1 1ND3C 1PGL2 1FOD1 1WCDJ 1PO23 4WM7B 2DF7A 4CEYC 1D4M2 2RMU3 5DDJ2 1PO21 2WZR2 2RMU1 4RR3B 2RS12 4QPIA 3ZFGC 1BBT3 5C8CB 3LOBA 1R082 5AC93 5CFDC 1VRH2 5AC91 4YVSB 3JD73 4YVWA 1RUC3 5FMOL 4Y4YA 3JD71 5A33A 1RUC1 1D4M3 5DDJ3 3JB8A 1PGL1 5K0UB 2WZR3 1D4M1 4FTBA 3CJIB 5DDJ1 2WZR1 2RS13 4IV3B 4RFT0 3ZFFC 2BUKA 2RS11 4LLFA 1HRV2 1TME2 1R083 5BNPC 1PGW2 1VRH3 5JZGB 1R081 1VBB2 1VRH1 1K5MB 1FMD2 1NCQB 1FPN2 4CDUA 1AR82 2X5IA 2HWD2 5D8AC 1HRV3 1TME3 3VBOC 1HRV1 1TME1 5FMOS 1COV3 2WS92 3ZFEA 4CEWC 1SMVA 1VBB3 1PGW1 3VBUB 1VBB1 1ND2B 4GB32 1HQNA 1FMD3 1FPN3 1ZBA2 4JGYC 1FMD1 1FPN1 2Y26A 2HWB2 1AR83 2HWD3 3VBRA 1AR81 5L7OA 2HWD1 4QPGA 3VBFA 1OOPA 2WS93 1AYM3 1TMF2 2WS91 4GB33 4JGZA 1C8M2 4CDQA 4N53C 1ZBA3 5C9AA 1RUE2 3DPRA 4GB31 1VBA2 4N43C 1ZBA1 1RUF2 2HWB3 2WFF2 1RUI2 2HWB1 1HXS2 3ZXAC 1TMF3 4Q4V2 1IHMA 1VB4A 1TMF1 1C8M3 1NA1C 1RUE3 1C8M1 1VBA3 3FBMA 1RUE1 1RUF3 2WFF3 3J8F2 4GMP3 1VBA1 1RUI3 1RUF1 2WFF1 4GMP1 4PDWC 4CDWC 1HXS3 1RUI1 5CFCB 1OHFA 4CDUB 1HXS1 4AEDC 1VAKA 2WWSA 5CFDA 3JB4C 2VQ0A 4Q4V3 4Q4V1 4WM7C 1BBT2 4RR3C 4RS5B 3J8F3 5C8CC 1B35B 3J8F1 3ZFFA 2FZ2A 4YVSC 3VBSB 2QQPA 5BNPA 1NG0A 1PIV2 5L7OB 1OOPB 5K0UC 3CJIC 1BBT1 5GKAC 2WLPA 4IV3C 2RR12 1R1A2 5ABJB 1HX6A 5JZGC 5BNOB 3VBOA 1ASJ2 4FSJA 5J96B 1NCRA 1C8NA 1PIV3 1PIV1 1K5MC 1NCQC 1MQTB 4GH4B 1F2NA 1NOVA 4JGYA 2RR13 1VB2A 1COV2 1R1A3 1AL22 2RR11 1CD3G 1R1A1 2BFUL 3VDDB 3VBUC
chains in the Genus database with same CATH superfamily
4XC1L 4YM1A 1DN0B 1I1FB 3NGBC 4FNSA 2PA7A 1DLHB 2GMMA 3MBWA 4XPBL 1OH3A 4MUVA 4P3CL 2ZWYA 4TTDD 2P8MB 1JGEB 1O6TA 4EQVA 3HRZB 4UWQB 5T5FA 35C8H 4PJGA 4K3DH 4FEIA 3DETD 1MCFA 3DF0A 1ZHBB 3U46B 5EZOH 2F1EA 1PVXA 2F54E 3DHJA 3HT1A 5CA6A 2AKRB 3GMMB 1MNUH 1X9RA 4UDTA 4Z7VE 1DL7H 5GPRA 4OMDA 3AJYA 1ROWA 3PRZA 4I3RL 5FC9A 3GBDA 2PHXA 3RBSA 1X5GA 2UUDH 3WTYA 2VDQH 4JUSA 1CFVL 1I3GL 4J1UB 4Y19D 2VG9A 3PTYA 5BNQA 1RVF3 1X6NA 1HQWA 1P4IL 3N9OA 4WNJA 2JIXA 4YHML 4UW4A 2ZCKH 1UZ8B 4NQXA 1G1YA 4U33A 4XHQA 1BLIA 3QI9A 1PVC3 4LRIA 5IVFA 3CQOA 2ZG2A 3BTAA 4PJBA 2E7MA 1CPNA 4FQIL 3IDGB 4HHAB 4NHKA 4KJYA 3VNZA 3MNZA 2ZONA 4NQQA 1U8OA 4M48H 1W9TA 4DRVA 1YAIA 1ZE3H 2G2RA 4UWDA 4AI3A 3LKPB 2CA3A 3QG6A 1FZKB 3B3BA 3VX0A 1TZAA 4A67A 1M3JA 4ZXEA 4U1LB 3L4WA 1TT6A 1KLUB 4CU8A 4XPGH 3EQEA 2IC2A 4B50A 1RUNA 3OZ9L 3T8XB 2WCSA 12E8H 8PAZA 4CDUC 3FLPA 4F33A 4JNXA 3UG3A 1VPOH 4MX7B 4CA9A 1J11A 3BIKB 4Z95L 1ZHNB 2J5LC 3P11H 5LDSA 1DLLA 2R0LL 4GEJA 3SEEA 4PWFA 1G7QA 2YRBA 4ZMQA 3NA4A 1C08A 4WWID 4QOKA 3O9WC 1LOEA 1DUYB 4CVWA 1H5BC 3FTUA 6PCYA 3EG9B 3AT9A 4QRFA 3W0WD 2X2JA 5ID0B 3QR1A 2IWKA 3BUIA 4EUPH 2J21A 2RS33 5FK9B 4IETA 3X3GL 5K0UA 4M56A 3X12B 1DGLA 4NKMB 4UYPA 3QO1A 4DP5X 3I54A 4GPVA 1RIUL 2C3XA 4FNPA 3D1MC 4OVUA 5E1GA 5LAPA 2XIBA 2WXLA 3U4AA 2FJGB 4KQ4L 5A2KH 3HOGA 1JZHA 4MYEA 5TE6H 2BW8A 1HNYA 1DQ1A 4ZQKB 1JU3A 1XB3A 2A6KB 4XMLH 2BFGA 1UU6A 3CSBA 3F7LA 1UF2C 1OOPC 1MZYA 4X8PA 4JAMA 1XTLA 1JAEA 2XTJD 3AAZA 1QHDA 3GXUA 2FJUB 5IV2B 4JZOA 2ZAAA 2B59B 4LDOB 5ISZB 1Z78A 1TQTA 5IVZB 3TFBA 4F9PC 5GS1B 4DCQB 3G6DH 3MBEC 3SE6A 3QHFH 1YQ5A 4AENB 3DX8A 5A80A 1RUQL 3VBRB 4RFOL 1MWAH 3DO3A 2BOBB 4PSPA 4U7MA 4L9BA 2RIKA 3BUCA 4PREA 4AL8C 5KN5A 3VBFB 4HALA 2TRYA 3O8XC 3C8HA 3QQ3A 4IRSD 4G6KH 2IBBA 4O58H 4QHMA 2A99A 4WGVB 5C0RL 4ZG1A 5CJBA 3RBGA 3KBEA 4J3OH 5SWSD 3EXUA 1I7UB 1CICD 4O00A 1OSZB 2WLIA 1BBJA 4E9RA 2VRKA 5JMRA 4OV5B 3KYKH 1KN4L 1SDAB 3BISA 2DBIA 1BBDH 4X4XA 5K4LA 1DCLA 3S37L 2W9XA 4TPRL 3R4RA 1EV2E 4F91B 1JS4A 5DJDA 5H4ZA 3UGUA 2YA1A 1QDOA 1S9VB 3MNVB 2CRIA 1AR63 3FTZA 3W2DH 5FPBA 1ND0A 1S7XA 4FXLA 4PYGA 3IJ7A 2C9KA 3HS8A 5C9JB 3E6DA 4S1RL 5EORL 3V0IA 2XJKA 1R33A 3D39B 3KWWB 4R9BA 3OQ3B 2WVSA 1YEWA 2ERJC 1E3XA 1OZTG 3BP6B 3QZMA 4LBQB 4H20H 1CVNA 4MAUL 2FEDC 2EXKA 1T7VA 2N0MA 2OP4H 1OB1B 4BRJA 3KWVA 2ATPA 2OQJA 4N0RA 1FI2A 3V4VB 2E0PA 1XSQA 4OCSL 1ZGLM 3QCVH 1LP9F 1V9U2 3AZXA 1EEUA 3B37A 1DVTA 3RUGE 3ZDZF 4AGQA 5IVXA 3NIFE 4JFOB 4XJAA 1ES0B 2Z1KA 1EWHA 1WKYA 2Q1ZB 4P5YA 2VDNL 3UX9B 4ISQA 2YOAA 2BIQA 1QLEL 2VMDA 5AWNH 2J12B 2DUPA 4BH7A 5HGDA 3I50H 4KJWC 2BZCA 3D9AH 1ACXA 2OSLA 1HSBB 1P1ZA 2KZWA 1AX1A 1YY8A 5KXCA 4LPLA 3THCA 1N0LB 1E6JL 3L95B 3KLDA 1LENA 4AQ1B 5E4AA 5KBKA 4A2GA 3WFCH 2HRPL 1V9U1 4JEGB 4E2QA 4LL4A 3VFPB 5KXBA 2PO6A 5LCVL 4YDKL 3UYRL 1HV0A 4M7KL 1NLQA 2UY9A 1QTYT 4IW3A 2WA4A 2ZX0A 3PJSB 3FU9A 4ZDHA 1G5GA 2JLPA 1BXXA 1L0YA 2P8PA 5E6RB 5FZ0A 3WSQH 1UH3A 5I6KA 3MRQB 3EYPA 2W07A 3K77A 4L4JA 5BVJA 3OXRA 3MGAA 5EN3A 1LESA 3VMPA 2PHDA 2VIRA 1O7SA 4HMEA 1S9KC 3MGTA 3J7LA 1HAUA 2IAMB 2IH8A 3O11B 4O4YL 2X05A 3P9MA 2BNQD 4EDXB 2EDTA 5JQIB 1RIRA 4Y2OB 1AIZA 3ESVF 3CLEH 2HWE2 5EFIA 2E75C 2FQDA 2ZKNA 3MLVL 5HCFA 1K5NA 1UD4A 1AR93 3DSNB 1DJZA 1VFBB 4I5BB 3IF1A 3ACFA 3O0VA 1CVSC 4NN0A 3QUXB 4UQEA 1HRI2 2QADB 4JCMA 2X2IA 4Y24A 5J98B 3PS6A 1NSNH 4FZ8L 4OR1A 3WEXA 5JHDA 1PZ7A 1X8MA 3AWEA 3MBWB 1OFNA 3MACH 1JOJA 5BVPL 4CP1A 1AX0A 3GXPA 2R043 5E1QA 1CYWA 2XBO2 4GFTB 4BELD 1NUDA 1CX1A 4YPJA 1BG1A 1NFDB 3AROA 2B9VA 5JXHA 1AXZA 4M3CF 2NX5B 2VN4A 2HWE1 2JKWA 4G3YL 1QTPA 4OF8A 1GKOA 2C34A 4LIQL 4UDTB 4TVPL 4MNHA 3MV8E 1MHEA 4KXDA 4JO2L 5C8JB 1HRI1 4JM2F 4XVSH 4B96A 3WNMA 1GXEA 4MAYA 3OHXA 1SYVB 2D5HA 3KGZA 1YPZE 5PAZA 4QT6A 3IKCB 1UMZA 4PJ9C 2P44B 2X12A 2YQ2A 4NQXB 3EYUH 4IEPA 3QI9B 2XBO1 1RULH 5F6IC 1XT5A 4X8CA 4PJBB 3I9GL 1Z9PA 5TQ0H 5C0AE 3NCXA 4NDMA 4KJYB 5DGRA 1DGWX 3GXDA 3MLZL 1U8OB 1A9BB 3PIQB 3GSNA 4TYSA 1W91A 3WN5A 2P1YA 3F7RA 4WFFE 1JF6A 1QBAA 2H45A 3LJ3A 3QG6B 2RACA 5MP6H 3RB5A 4HEMA 4NZUL 4DUVA 1QKQA 3WFEL 4RA0A 1QHOA 1EDQA 3R8QA 1KYFA 2TSBA 5D7SH 1KBVA 4XVUD 1J5CA 5AOKA 3VDAA 3ZTJG 4RSUA 3SH4A 3WOVA 4HJUA 2XUMA 2E9BA 2EF6A 5FWRA 2DQGH 5DS1A 2OKMA 1POQA 4V11A 3WF4A 4F33B 4PJ7F 3KR3L 2MNWA 4IE0A 4JL2A 3ALPA 5AKTA 2YC0A 4H44C 1C08B 4LLUA 3NJIA 2WO2A 5FMOL 5HHME 3LXUX 1M9SA 2CAVA 4I77H 1NFIB 3S5LA 2LU7A 4YSCA 5ANMB 4MASA 3T3PE 4O9GA 2NW3A 3LD8B 4GKSA 5FM4A 4HUNB 4LR4A 4H26A 2IH9A 4F9LC 4GKNA 1G9FA 1IT9L 2WZR3 5K0UB 4N90D 3QO1B 3KYOA 2K6WA 1MIEL 2JJTC 4L8SC 3L4VA 4PBOA 3QDHA 2R49A 1OHQA 4L3FA 3ET9F 4P99A 5I26A 2ZCLL 5IT2H 4ARYA 1VRH3 4Y4HB 2Y6KA 3T3YA 1RZGA 5ESQA 1BWWA 1S7WA 5FOBB 3GXUB 2R83A 3N85L 4JZOB 4PIYA 4RX4D 4OLWL 3KEHA 3VGHA 5CLXA 1FMD2 2YS4A 4NO2B 5F9TA 3MV01 2FHFA 4SLIA 3ROUA 3FQYA 4WI4A 1TTGA 3RIKA 1S0DA 2EO7A 3K2OA 1PKOA 3DI3B 4OLUL 2G4IA 1KEMH 4GW1B 5FV2A 4K94C 3TA3C 2JH2A 3SQRA 5T1DH 4J7RA 4QHMB 4ATTA 5FGBC 1X7SA 2YC1A 2CHZA 3DX3A 3IMSA 2Z7UA 1LGNA 3CHOA 5FZ9A 2WLIB 1EP0A 3RTQB 3AX4A 4QAMB 3OZKA 1WBZA 2JB5L 4LDLB 3DUSA 3GRWH 3N1QC 4X4XB 4ZOCA 5AYUH 3TWCH 3ZYOA 1FMD1 1XCQA 1JMUB 1ZZ9A 4DSYA 5DJDB 3GLDA 4WGWB 2J1ZA 1DR9A 3ZYJA 5KYUA 5I1LA 1U6AH 1S7XB 5CCJA 4MXVE 3SLIA 1P5VA 4XVTL 5DUVA 4GJYA 5D71L 3MRJA 5FYKE 5IQ9A 4DGYL 1NJ9A 1XB6A 1ZK9A 3UZEA 1T66D 1ZDQA 5AUMA 2XDVA 4N53C 3IXTA 3EHBD 1PLCA 4LGSB 3V52L 1UEYA 4BIKA 1OCCB 2ED9A 5CLZA 4WKZA 1EXGA 1I3RA 4P57A 4DAGL 2QTWB 3VLBB 2ATPB 2OQJB 2N56A 4Y5XA 4DO6A 2GMEA 2WIMA 2J8OA 3ESUF 4HMCA 5DG2A 1A7RL 2NY7H 4ODBD 5IVXB 3QXVA 3V7AE 3VD7A 3HNYM 1MIML 5TPWL 1J8HB 3LDBC 2FCTA 4BH7B 4X5LA 3AKSA 5HGDB 2ENYA 3WO3B 4K15A 3ILQD 1LO2L 2OSLB 4YK4B 2YWZA 1P1ZB 3D2TA 1W6MA 3THTA 2P80D 3D39D 1YY8B 3FQRB 3UH8A 4LKEA 4BUQA 3V55A 3WNLA 4A6YL 4PDWC 2KI6A 1W6WA 1J8RA 4PQ9A 1F3RB 1X5LA 2R8SH 4B7KA 3MLKA 5JXEA 4LBQD 1HZKA 1LKNA 4GKYA 3DMMA 3CBJB 3NJGA 5A1FA 2NY6B 4DVRH 2PO6B 4B6ZA 4Y7OC 1NAML 2XXFA 4DNYA 1CD1B 2EP6A 2X42A 3M7FB 3KM1A 2Q3AA 3FUEA 3MXVH 3ZHNA 2IXKA 3A3YB 3M4FA 4MQXC 1YEHH 4RDBA 4XTMA 4KUCF 1K8DA 2AI0H 2VQUA 2YLKA 2FD6H 4FFVC 3AQZA 3SPHA 4GQPH 4ANUA 1QFWH 2NY1C 4HXCA 2W07B 3MPCA 4JZRA 2WXNA 4XXDA 5BVJB 5IK8A 3OXRB 4QHUA 5C08A 5I8CA 2J1VA 4COVA 5L7XH 3FFDA 2VIRB 4AQSA 2E7BA 4F7PA 1YFUA 2QQPA 2BNNA 4BB3A 1R3HA 3O81A 1E6OL 2DD8H 3VXMB 5GGVY 2JTDA 3P9MB 4BZ1H 4LHSA 4PJGF 2A3YA 4LARL 3EH1A 1F4HA 1UWEH 3RZGA 3L3OC 2BP8A 3WFHA 1DQDL 2VDOL 1O5PA 5EFIB 5FM5M 2NTSP 1T1XA 2XFXA 2EYSA 2D7QA 3M2MA 1G9ML 1K5NB 3FT1A 2Y3AA 2EIBA 5CUSL 2MQ0A 1SQ2N 4LPCA 4NHCL 2HFGL 3PTRB 4D6RA 3WEXB 2UY8A 3W57A 1FLRL 3TBWA 3MREA 2FCBA 2Y23A 4EI5D 4LO6B 2DS4A 3GO1L 1W8FA 1XH1A 2XN0A 3I75A 4X9YA 5T33H 2AGJL 2IC1A 3U10A 4PJBF 3AS1A 4AEIL 3QRGL 1E5YA 2HLEA 3Q01A 1COV2 4NP4L 1HVXA 4Q97A 1LILA 1YC8A 3RJQB 1CD3G 4KMQA 1UT9A 4P9HL 2DLFL 1TZ8A 3IU4H 2BSBA 4M8UA 1NCTA 2DM4A 2WJ7A 1BZ9A 1MHEB 4DP9X 1PW3A 1JN2P 1U93A 4Y2NA 3VBUC 4QR7A 5J3HC 4BM7A 4DGWC 2D3NA 4ADJA 4M7JH 4MAYB 3OHXB 4M61A 4OQTA 3OSVA 2FE0A 2BYVE 1T0NA 1K4CA 3QUXD 1DDHB 3IE4A 3R18A 4WV1C 3PGCA 5IBUG 5BUGA 4G83A 1X5MA 1FSKB 3GJFH 5JORA 3SE3A 1POV3 3NIGF 3ABKB 1NLDH 2IFGA 4NDMB 3U0PA 3QUGA 1COV1 4UFJA 4FL4C 4NUJA 3T3MF 3GSNB 1UWWA 3CZEA 3H53A 2F08A 4IOSA 4NGHH 3GSOA 3CFUA 5T8IA 3BZFA 3MA7A 5EXOA 1NCWL 1Q9KB 1TKWA 2EC8A 4Y9FA 4QRRE 5GJSL 3SO3B 1YNLH 3POFA 4GY4A 3G5VA 2EDQA 5K9JH 4K9EC 4ZO7A 1C5DA 5DWPA 5KTEL 1Z5YD 1QJEA 1IX2A 2W0KA 4BFIA 1E5UI 2YPVA 4ISVA 3HAEA 4GSXA 2VLKA 4JRLA 4MJ5B 5EOCL 4CN1A 4XH2B 3KXFE 4GO8A 4RGNE 5D1QE 2YHGA 5I5RA 5BXXA 5GSVA 4XMKL 5E2JA 1DQ5A 1MJUH 4Y5VC 3A4UA 4NOBA 3FO0H 2EA7A 3EYOA 3WTSA 2WO2B 2MHFA 3QQDB 3EFOA 5FYJH 3X1BA 1E65A 2FLRT 3BPCA 4JFDA 4PGCA 4U1NA 3WJJC 3S5LB 3CN2A 1XIWD 3QORC 2FWLB 2WWOA 3N41F 4GKSB 4H26B 2IOIA 2JVUA 4GKNB 3WS6A 1KQRA 1OURA 2WSPA 3W11D 3WLUA 2CTVA 3ZW3A 3M3IA 4TUUA 1J48A 1MFBH 3KYOB 2JEMA 3MRKA 2XQXA 5IVVA 4QHLB 3DXAE 1MELA 2ICEC 4U36A 2HRHA 1BQ5A 3HZ3A 5T1LA 2YD5A 3GPSA 2XWJA 4GQ9H 3QHZH 1TQSA 1I1AD 3ARDA 4KMTH 1J3RA 4JFSA 4A6OA 1ND3A 3U1PA 3PDQA 1BEV3 2JDKA 1S7WB 3VA2C 2Z5WA 1LL1A 3PL6C 3QS3A 4CXYA 5DC2A 1LHNA 5D7LE 2EKSA 3S36H 3FTVA 4KI1A 3W21A 5BS0D 4TULH 1FHNA 5AAWC 1CTOA 4X83A 2E51A 4WFGE 3MTXA 4WY7H 1MZ6A 2YKLH 3AREC 3ZK0A 1I5ZA 1NUNB 3QW9A 3DXTA 3V56A 4LBEB 4FGMA 4P06A 4DT2A 3QDGE 2E3VA 2H0VA 3NJNA 2Q30A 4Q6KA 4YZ3A 5FZCA 3RL1A 2VTXJ 1KTDA 2YC1B 1VHPA 3PG2A 3TTYA 1HYSD 3PIJA 4R8WH 1TOXA 3UKNA 2QGDA 1MLBA 1XB9A 4EBQL 4Y4HD 1WBZB 1DG6A 3DUSB 1CB4A 4J3XA 3ON7A 2BNOA 1LDSA 2VZ3A 3BUBA 1XCQB 3MRFA 4JREC 3NFPA 4KY1H 2ZYHA 4XP6L 7TAAA 3LKRA 4I09A 3ULUH 5HGHB 3C8XA 1NDGB 3LOWA 5B3JE 2ZXAA 1G43A 2H1XA 1XF2A 2BWQA 3LPFA 3UCQA 1D3CA 3ZSSA 5I1LB 5KYUB 3E6BA 4TS6A 3KPMA 2FZ1A 2EXIA 1P5VB 1PCXA 1XGRB 2V5YA 2QDVA 3OR6A 3MRJB 3K48A 4DOUA 4ET7A 1JHKL 1NJ9B 5D4QA 3D8MA 3QDJE 3UGXA 4TSCH 5AUMB 3TN0C 2NT0A 3IXTB 3VXRE 4PJ5B 3ZUNC 1V6KA 3S34H 2BU9A 3V0JA 1HB1A 3UPCA 3JWNC 2CKBH 3IN2A 4U6HA 4AQEA 2KKQA 4WKZB 2JX9A 1BVNP 4WWPA 2CPCA 4Y5XB 3RTQD 3GHMA 1WZ1L 3TONA 4DPCX 1HWWA 2WQ4A 1G7LA 4ATEA 2W1UA 5A40E 5IESL 4ZAKD 1RXGA 3Q2WA 2Z35A 4FQZA 4DPBX 2CLZA 1E2WA 1GIGL 3VQ1C 2WUCL 1TLKA 3MCYA 1JZDC 4HH9A 5F70A 1N1YA 4QY8A 1INDH 2TBVA 3B4NA 2NY3D 1O4TA 5L9DH 2ZKLA 2C9QA 5FYCA 2VYRE 3ZXGA 4D0CA 1W6MB 1UURA 1W3VA 5E9NA 2R1YA 3L3IA 1GSLA 4G9DA 1FZJA 1JS9A 3UAEA 4Y1ZA 1N3OA 3QWOA 3VQ2C 5IQNA 3EXLA 3DMMB 1KCVH 4BQ6A 3V9CA 3NABH 4KKAD 1PKQA 1XNAA 4G6AC 3HC3H 4ZTEA 1MEC2 3SQOA 5IFJA 2F5AH 2N0KA 2OYZA 4FOMA 4YFZA 4HGWB 3V64A 5KW9H 2OMZA 2DYPD 4AG4L 1K8DB 1KLGA 1VEMA 1J8HD 2NLJA 4S0SD 3NRPA 3UKTA 3SGEH 4YM3A 4XXDB 5IBTH 2R56L 3GF8A 4QHUB 1ZV9A 5I8CB 2B15A 3DOHA 3FFDB 3FQTA 3GYRA 4ZSOA 3V95A 2DB8A 4IIQC 1JXFA 1OGAD 2J22A 3CLWA 1MCSA 4XMPH 1R3HB 3HI5H 4OFVA 3NJHA 1LP9E 5KVFE 1W2AX 1P7BA 3NSTA 5A3UA 1ETA1 3FUOA 3ZDZE 2W52A 1JIBA 2WBJC 4NPLA 5D1XE 1MEC1 2BFUS 3O9WA 4R7LA 3WFHB 1H5BA 5C2BL 4D9RE 2CO4A 1POV0 3N0AA 4YGEA 2XFXB 4NM4H 4XHBA 3BWUC 3T8VA 4M62H 4Z7IA 3DROA 4M1GH 1OP9A 5F7LB 2KD7A 1ZLWH 3GBLA 2UU8A 3VD2A 3MFAA 1ZT1A 3VDBA 4EJ1C 2IMNA 1E67A 3B1TA 4QKXB 3F00A 4XRCA 4CSWA 3H6JA 1CXKA 4M5YL 4FO9A 1GAFL 2ITEA 3UADA 4MGZE 4Q0PA 1AJ7L 4E9YA 2MEJB 2VZTA 4MJIE 3ARFC 2VR8A 3VG0L 3WNJA 4NI6A 2DLGA 4ZMZA 2VLRA 2Y0OA 3C5SA 5JHLL 1KDMA 3Q6GH 4M8RA 2F4LA 4V2WA 5FCUH 4YZ1A 4ZXBC 4KGJA 3VXMD 4LCYA 3RWDA 5IJVA 3V4VL 2HLEB 4F9PA 5IM7A 1QH6A 3QCTH 5LCWL 1IGCL 4DXSA 4NC2B 2CO6A 1BZ9B 5DRZA 3ZIXA 5DQ9A 1JPSH 1U93B 5C0JB 1W9YA 1FGVL 1MDAA 3O8XA 1Z0NA 2HVJB 4M61B 4CUAA 4EJRA 1J05A 3D3VD 4H88L 1T0NB 1DQJA 3K81A 1K4CB 1KY6A 1OSEA 3EH2A 3ZPDA 3S4SA 2R69A 1WUVA 3N3HA 2GSMB 2VXQL 5MEQA 1KDIA 5JORB 1CGPA 5EZIL 2HEVF 3U82B 1FBIL 2V2XB 4LSRL 3WQ0A 4B60A 3U0PB 1QWHA 2OK0L 4MS8D 3S35X 4NUJB 1BKZA 4BIFA 1YCSA 3E3QC 2DUOA 5F8QC 2WVVB 3GSOB 4NYLA 1EMTH 3BZFB 2Y5QA 3SNMA 1G0YR 4XMUA 2B1AH 4WI3A 2R23A 1RYYA 4NHMA 3KWUA 3G5VB 4NHXA 4M00A 1C5DB 3EYVB 2CKNA 4XO4A 5GRVK 4DK6A 3WLWD 4OFYD 1WD4A 4BFIB 1N0XL 1ODUA 3HAEB 3CXFA 2VLKB 4NLAA 1KY7A 4NE9A 1AR73 5FOJA 2NXYD 5C2UB 2DVFA 1ZLSH 4IEXA 2XWBA 1ET5A 3OD0A 4WM8C 4QX2A 2L3BA 5GSVB 4XXAA 2GABA 1J9RA 3VXPA 1JMXA 3EYOB 4X80H 1Q43A 3EFOB 3IU3A 4JFDB 4CVUA 4U1NB 1B9KA 4PS7A 3ZTNL 5HYJD 1ASQA 1C7SA 1SACA 1WCDJ 4PS4H 4P5HA 5AB9A 1X9UA 3PV7A 3DSFL 5CEXA 3JT0A 3WKYA 3GNML 4OLYH 4YE4H 3JTSA 4UAHA 3PVOA 4AGRA 1PG7W 3VXUA 5IMMA 2JIJA 3C6EA 2B1HH 2VWEC 4LPUA 3VHRA 5T1LB 2GMPA 2XWJB 2AZUA 3RWCA 2J72A 5DVNA 1B0RA 2WSVA 3ARDB 5CFDC 4PU2A 1CXFA 2HJIA 5APAA 2DI7A 1MRDL 4FPCA 1KELH 2EIMB 2JQZA 2ATKA 2VLJA 1URXA 1AGEB 4IBYA 2NQYA 2IH3A 5CFHA 1QNIA 2EKSB 3WIIH 3CFDA 2DQEL 1YEIH 2EEFA 2HYXA 1E4WL 1XWVA 2IG2L 5I8KH 3APFA 3WFZA 4Y5TA 2CUMA 2XUWA 1CXLA 1DDTA 2WD0A 1IBHA 3C2AL 5BNPC 3RL1B 5FUPA 2XV0A 1I1RA 4PJ7E 2EC9U 4NRXA 4B9CA 1U12A 3QEGH 3S6CA 1UMHA 5F6HJ 3VZMA 1MLBB 3AFKA 5CNAA 4XQDA 2DBJA 5ADOL 4Q9RL 4NPJA 3TFKD 1JTOA 1U42A 3NFPB 1X5HA 1OOAA 3LKRB 3G5ZA 2VL4A 2YR3A 4UQAA 1K45A 1PM4A 3LZZA 4DTGL 1ZTMA 2HUHA 1XF2B 2YZ4A 7PAZA 3R05A 2X9WA 5FMOS 4N8CL 3OR6B 4PY8I 3RWGB 5DABA 1ASPA 1K8IA 5A16A 3D6EA 4N2IA 1WCSA 5DMKA 3NGBB 2E9GA 4J3SA 3TO4C 1SBSH 4MX3A 4U6HB 1DJIA 4K7PL 5GGQH 4FLHA 4AQEB 4P9ML 4LXFA 1F3JA 3SH5A 3OPZH 2FD8A 3ULVD 5SX4H 2D97A 1PX3A 2VMEA 5I0ZA 2OXGA 1NUFA 1EJ6A 3VQLA 4QX0A 1G9NH 1TJMA 1GGCL 1WW6A 4YXKH 4LASL 1XL4A 4IEFB 1QA9A 1TZIA 2CLZB 1QRNB 4PJXA 4OM0L 1Q1PA 1ZVFA 1G9AA 4HH9B 3E6CC 4QY8B 3QZPA 3RZHA 4C55A 3FFZA 2JDPA 3KCYA 2HKHL 4PJ9A 1JJUA 2DLHA 1TJHL 3IFPA 4HUCA 4D0CB 2X1WL 4DS0A 5CR1A 3L5HA 4NJ9H 7FABH 4NN7C 3L3IB 5I0DA 4G9DB 1REEA 1FZJB 1UXZA 3WF0A 2QHLA 3I84A 4PJ5D 1MLCA 3O6FC 2OW4A 3L4ZA 3QWOB 2H0JA 3O1OA 3U6XA 4YNIA 4GB9A 3RZCD 1W9FA 2I32A 2JI2A 4JQIH 2QQKA 4D0DB 3GJBA 1J59A 4WZ9A 1J9TA 2OMZB 4PWGA 1NKRA 3LYRA 3BE1L 2NLJB 4RGMC 1MQKL 2Y24A 1AYOA 4S2GA 1WFNA 1QWRA 1CBVL 4GALA 2GALA 5IHUL 1HXS3 2XLGA 2WZ6A 4S1SL 1QO3B 4CDUB 1F5JA 3SKVA 1L9PA 5C0EA 2ILLA 3FE5A 2IXHA 2J5LB 2VQ0A 4GO6B 5F7YC 4BHPA 2WKOF 4X0KB 5FO7A 4HK8A 4J39A 4JFFA 3KL5A 3MRBA 4ZS6D 2OZNA 5F7BA 3KCXA 3AQYA 1A7OL 3ARXA 3O9WB 1A6UH 5KSBB 1H5BB 1A1MB 5E8PA 1MCPL 1FF5A 3KHCA 4RR3C 4LSQH 2OL3A 3ML8A 2OR9L 4OZXA 3D18A 3C5XA 2FX8L 4KMLB 3DROB 3RIAF 4MB1A 3QAQA 1F4WH 2QZ2A 5GS0L 1U33A 1QIQA 1ZT1B 1Q9WA 2Y5TA 3PABB 3ARSA 2K6YA 5CIPH 3UDWC 2JJTA 4L8SA 4F7CA 1U58A 3D0AA 2FZ2A 4XRCB 3EJKA 3WNIA 4K7JA 4HF5L 4LK7A 1OA4A 5AOIA 5LN4A 2WNOA 4WSGA 4RFEB 2VLRB 5LWYH 3C5SB 5GGTH 1BXHA 4D7BA 1OOPB 2FEEI 1Z0HA 1BV8A 3AMMA 4TKWA 1DGWA 4R7NB 2XKSA 1QMJA 4OUMA 3CJIC 3D06A 4LCYB 5IM7B 3RWDB 5IJVB 3MIEA 4OB5H 1FNFA 4BGDA 1X7NA 3MBEB 3BDXA 4R4ND 1PYWB 3DRQA 2FECL 2ED6A 4FFZA 2CO6B 2P9RA 5DRZB 1IM3B 5DQ9B 2Q1EA 1EK3A 3G6JA 4ORFA 1RUOA 3O8XB 2ZX6A 4CKQA 2J1KA 1GY1A 4ICXA 1J05B 5CP3A 1CURA 1NCRA 1PIV3 5FGBA 1DQJB 3KDPB 2OMWA 1NCQC 3S4SB 4WFEE 5EZJA 4AT6B 1BYPA 2ZUQC 4PJ8C 4KBPA 4AYBA 4PJGE 1LNSA 1RJYA 2ZCHH 1U8QA 1ET8A 1SXCA 1TETH 4W81A 4HVOA 3CFKA 5CMAA 2AABH 4AYMC 5FDWA 4B8EA 5FUZH 2WLYA 2TEPA 3KCWA 3RHWK 2EDDA 5DZEA 2R23B 1AO7A 4L29B 5E70A 1PTZA 3NMBA 2R0HA 3IPVA 1UD5A 2OCFD 3S5QA 1UYWL 1UEMA 1Y43B 2DWRA 2WO4A 4XNQA 2ERJB 1JRHL 3L5XL 4JKNA 5AVVB 1O7FA 2P2KA 4BH9A 5FOJB 1IM9A 2YDEA 1J5HA 4PJBE 3UP1A 3NZSA 2VNGA 5EB9A 1V54B 4M5TA 3QXTA 5J13C 2HYKA 4EYUA 5KC5A 1WS8A 2X4SB 4PJAA 3ESNA 4U7SA 1XQ4A 1OE1A 4PJEA 4UOW0 3K6DA 5JO5A 3T77A 4IQPA 4NC1E 5T52A 1FWXA 1RK0B 4YDVA 1NAKL 2NY5L 4HETA 5KC6A 5FZKA 3IU3B 3CIAA 5IATA 3ROOA 3N9GL 4JKPL 1TVDA 1LWRA 1KJ3L 2HKFH 5DFVD 4CN4A 1CS6A 4WNQA 5E00A 3E0GA 1VFAA 3ABGA 5CEXB 1FL6B 3JTSB 1BGXL 4NN6C 3IFLH 3UIZA 2WC2A 3FBYA 2FSDA 3ZYBA 3VXUB 3H8XA 2AJZA 1N59A 3II2A 3RVTC 1QJX3 1IQWH 3LS5H 3NIGE 3RWCB 4PDWA 4LE4A 3USUA 3INUH 1SXAA 3ZE0B 1PZ2A 2P24A 3T3ME 2DM2A 5FY9A 1DBAH 4LHUG 4RGOH 3VFUA 4PF5A 4QOKE 4UT6H 3ACGA 5KYXA 2VLJB 3DI2B 2ATKB 1V10A 3ASNB 3MAWA 2IH3B 4OQ1A 5J09A 3CFDB 5TFSH 5GZNA 3UBXG 3TOJA 3N7LA 1ZV5A 1CK0H 2XQYG 4AHYA 2HH0H 2OR8A 3SYPA 5FXZA 2X28A 1QUNA 1TDQA 4CCEA 4Z0BL 1RMFL 3UJJL 4A68A 2BWCA 3UOAB 1RERA 3AXDA 3SJVA 1B4JH 5HY9A 4Y1AA 5I1HH 1HJFA 4NRXB 5CBEA 4CEYA 3TB0A 4AQAA 5T50A 5FZ7A 2W94A 1G1CA 4I4WA 4BQ4A 3CN4A 4QB2A 4RFNC 2CNAA 5GRYA 4RMVA 1A78A 3G5ZB 3L3OA 2YRLA 2HVKB 3GSNL 2CGRH 3ZSEA 5KHJA 3BKCL 3RGVD 3ZDXB 4HCRH 4MXWH 4DVBA 4FD0A 4QJ4B 3H9SA 3OUHA 3R4SA 4G2AA 5LBCA 1P7KA 3M3OA 2R1DA 5BMFH 1SNRA 3NK3A 4PJIF 4RN5A 5DLMH 2CH8A 3QZWG 5CXPA 1HQ4B 2F58L 3NMEA 5A16B 4ZW8A 1CGSL 1RUJ2 5DMKB 8CGTA 2W39A 2EAEA 5EU7C 4QWNA 3QPXL 4FQ1L 1R6VA 2Z64C 3REVA 4Z8BA 2A6DB 2GK0A 4WU5A 3T1MA 2EZ0D 1DJXA 5EC1A 3QWQB 4JRFA 4KQ0A 4IIZA 1F3JB 1HXKA 4RDQG 5AVQB 3B2VL 3B9CA 1R19A 3TYFA 4OI2A 1MCQA 4WJ5B 2E6VA 4I0PA 2VE1A 1Q9LA 1QA9B 4PJXB 1G7PA 1EEQA 1QUPA 2D7TH 2Y4SA 1RZPA 4HUKB 4N1CA 4UQ2A 3VBUA 4RIRA 4NROA 1E30A 1HKDA 1LOFA 4EPSA 1RUJ1 4CA4A 4IEYA 4PJ9B 5I9QC 3TAYA 1XXFC 3IFPB 4PHZA 4WV1A 3O1TA 2HN7A 5D8AA 1KNOA 1FOD3 5J57B 5M95B 3BVNB 1FJ1A 5F6IB 4QXBA 1S7RA 1NLBH 3HAGA 3QIUC 4L1BA 4AVJA 1IZKA 3KJ6H 1T0PB 4LCWB 2X4UA 1FDLH 2XR4A 3QIWC 3A24A 5A3WA 4MNGA 4GEIA 3EO1A 2ET1A 3T4VA 4D8PA 2ED8A 3LIZA 1MVEA 3DRTA 3AGVA 3R7QA 2BGPA 5E6UB 1CR9H 4L97A 1KULA 4G4FA 3FN3A 1PZBA 1T6WA 2EJ1A 5C0CB 1W28A 2O93L 5D2LA 1OT2A 1FPTH 3MJGX 3ZYPA 3DX6B 4XP5H 5FRAA 1DEEA 3CSPA 1KS5A 2ZGUA 2ZHMA 1DLCA 1MZEA 3TNQA 1S46A 1ZA6A 2VVEA 2G0KA 1QATA 4NAMA 1TENA 4XC9A 3KH4A 3ISRA 3UTTE 4RAHA 5B3SB 1RUG2 1UT1A 4CMMA 3IRPX 2AH2A 4Q9QL 3O0WA 5IYYA 2ZXQA 5ELIA 3WDVA 2W9DH 4Y16D 1UT2A 1SVZA 3AG3B 1OAXH 3BHBA 3H54A 4B53A 3ULVL 5FO7B 2Y33A 4X6FA 4JFFB 1U91A 3MRBB 5I8EA 3RFRA 1B09A 1UH4A 4LNRB 1VDGA 4G82A 3L5IA 4Z18A 1NGPH 5E8PB 1NEZA 4H1LA 4M3HA 3WJJA 4XFCA 2OL3B 3BKYH 2D6MA 3OEAA 3D18B 1CJYA 3QORA 4ZXKA 5JA8B 2NNFA 1E4XI 3WMQA 1MAKA 1KN2L 3D4YA 4ZBJA 4GKOA 2QHRL 1Q9WB 2Y5TB 2RM22 3ULSB 1S4CA 4F7CB 4L8SB 1U58B 4AM0A 2ICEA 5FCCA 4BOWA 1E28A 5F96L 4A7ZA 1RUG1 2VMIA 4XHXA 5IB4A 1U0AA 2XLLA 1TMQA 4NMIA 2UUDK 2IADA 1YEEH 3MLYH 4NEHB 3PL6A 4FG6C 4V2BA 5CS7A 1PK6C 2VR4A 4KX7A 1LWJA 3HW7A 4RCAA 1YJLA 5E8OA 4Q5OA 2R0WH 1S8DB 4NC0B 2COVD 4FFTA 3AZUA 3CN0A 4ORZC 1IAIM 3DRQB 1RIHL 1N6QH 5TE7H 3M88A 4F8PA 3AREA 3TA3B 1WCBA 4R0LC 5IW6A 1CQYA 2A74C 5E5UB 3G6JB 2RM21 1KEXA 3NTCH 3D5OA 2CBOA 4RMBA 2X4PA 5JHDE 1WK0A 4LPVA 1QSEE 4CNIA 4IBLT 3T4HB 1ID2A 1BQRA 4Q6YA 5F3HA 4YM0A 2OMWB 1HL5A 5C6WH 2DVGA 4XCFH 4HSCX 3HBPA 5JR1L 5EZJB 4GXLA 1I3UA 4C8DA 3G5XA 3MIFA 3V7AG 5C0BA 2ZGSA 1DSYA 2Y7MA 2X5IC 2P3YA 4AIXA 2XYBA 1U8QB 4OLXL 2ATFA 2GI7A 3KG5A 4XNUH 4M1DL 5A3NA 5TF1H 1IGIH 3IPFA 3KPSE 5CMAB 2B14A 5FDWB 1N19A 3C6SB 2XWCA 3F01A 4FQ4A 3SHRA 5C3OA 3D09A 2NUTB 3MBED 5JTWA 1AO7B 4GAJH 5FIEA 5BOZG 3RVXD 2EUXA 3ATAA 1P84J 3TEUA 2H1PH 2I5YH 3QPQD 1EV12 1LAJA 2OPCA 1KGCE 4NWTL 5TGBB 3NWKA 4TSVA 4XNQB 5FZBA 4ONGL 4N53B 3TN0A 1JPST 2V3FA 3TXAA 2NQCA 4QXGL 1IM9B 3HPJA 3FONB 4PLJC 2TSAA 5FUOH 1EO5A 4FI7A 4GAGL 4QPGC 5AYQA 1O7DE 3ZE0F 1WUZA 2RB8A 4PJAB 3LEIA 4PJEB 3D85D 1EZLA 5ES4B 5JO5B 3T77B 1SYSA 1GGBL 2PCXA 3FO9B 3HMXA 4AEHL 3DUHA 4LTAA 4YDVB 1QKZH 3ROOB 1Y4WA 3LDBB 4GP5B 5AZEL 3FQWB 1WQVT 3MQIA 5E00B 1VFAB 5I1GL 4Y9CA 3K91A 4OCRL 5JSOA 1EV11 4LSSL 5DWUL 4M3JA 2ZIDA 3CDYA 4R4BA 1V7ML 4LSUL 4R8HA 1MZZA 2AJZB 2WQWA 3OJ2C 2YO3A 3WMSA 8FABA 1NIEA 2F7QA 4PDWB 3USUB 5B8CC 2CLVA 2P24B 3NAPC 2B2XH 4J3WA 1MEXH 3VFUB 1HOEA 4E36A 1KB9J 4HS8L 1IFGA 3G7TA 3D33A 5KYXB 2DM7A 4JZJC 3Q5YA 2MHAA 2W65A 4FABH 5ESVA 3GRBA 3LH8A 1SPPA 1QUNB 4UMSA 1KPVA 2RDQA 2WO3A 3ZXJA 2D4FA 5AB2A 2NY1B 3ELAT 2JKTM 3GHEL 3QAZC 3QXAA 4KJWD 3SJVB 1FNZA 4EMZA 3WENA 4Y1AB 4IEWA 1N2RA 2YBRB 3KDMB 4IIQA 5CBEB 2A70A 1OAUL 4JVAA 5F1IA 1OVZA 4YDIH 2XQYK 3HZKA 5HI4C 4Z9KB 3TBSA 4D8OA 4GUQA 5KWRA 4A7KA 2WBJA 4I4WB 4R52A 4PY8J 1LJMA 4DGVH 4CZSA 3WEBA 2K46A 4EZHA 2JELL 3IFNL 4AI9A 3L3OB 4GB31 1WVZA 5FZ3A 1ZANL 1D2PA 3BCFA 3H9SB 2OPKA 4LLFA 5KXDA 5EA0H 4PJXF 4NKDB 2DN7A 3SDYH 5L6YL 3PP4L 1RU9H 4KITB 4DKFL 3JTTB 1AZZC 1YQ2A 3A47A 4QYOA 1M6UA 3DO4A 3BWSA 4I8DA 4WHYG 3V4PA 1LHUA 4COYA 3ARFA 3OZLA 4BE5A 2WGXA 4RSYA 1QWNA 4TLSA 4W93A 1UGKA 3REVB 2GK0B 4GXUM 2AMUA 2X09A 5E2UL 5EC1B 5KVGH 4XZUG 4QXWA 1EAJA 5I8TA 3TYFB 1BXAA 4NQCB 1VGEL 1XR9A 1MREH 4KO7A 1J0YA 3RDJA 3TIEB 2ITFA 4FF9A 5LJYH 1CD9B 4LBAA 5D7IE 4TXWA 1Q9LB 1G7PB 3MOBH 4KGQA 2XXMB 2H6BA 25C8L 3VBUB 5C3RA 1VLNA 2OZ4H 3NACH 5GS2D 4MMZC 4ALAC 4H40A 2F6AA 3R4DA 3DECA 3ARUA 5JUVA 4WV1B 4QB6A 2E46A 1AZUA 3CIHA 1KNOB 4L9LA 3JWOH 5JYLA 1FJ1B 1ITCA 1S7RB 1YECH 4G8AC 1UADC 2CMRL 2Y2WA 4URTB 4MNGB 3FXIC 3EO1B 2FZ3A 2IOMA 4FL4B 4D8PB 3OBZA 4TNWF 1QQDA 1KENH 1O3TA 5IQ7L 1UXWB 2Q8EA 1AYM3 2EH8L 3K1DA 1OSGA 1HZHL 3EYFA 3FO2A 3K72A 2EXSA 1JYTA 5FYKU 1AQMA 2QVSB 1XZ0A 5HVWA 1KYDA 2EXHA 4N8VG 5G05L 2CRMA 3BFWA 4Q8LA 2VDPB 1OTSC 3APCA 4XC1H 3FU7A 1RUF2 3NL1A 2WFF2 2G0LA 3PAYA 2WXIA 2NLRA 5SV4A 1ZA6B 4ZMLA 3V0EA 2GSGA 4P3CH 1T21A 5J7CC 4R4ZA 1PSKL 1CMOA 4UUJA 4CMMB 5J1AB 3MRLA 2ZMKA 3WW2A 3HG1B 1KJ2A 2ZX8A 4P2AA 4GT0A 2P5BA 3BHBB 4Y5VB 1DBML 4F7TA 5ALCH 4JFQA 5LATA 4MRBA 2E7DA 3DLQR 3MJ9L 5I8EB 5KAQF 4P49A 1BF8A 5EEVA 3DV6A 3N1FC 1NEZB 1BLNA 4H1LB 1RUE3 2CWRA 3Q05A 1UXXX 3QORB 3GBNL 1W2NA 3P2BA 3AMHA 4U31A 1FVCB 4NQUA 3X11A 3FHQA 5C0CD 4M02A 3V6ZA 1RUF1 4G1MA 3G6JF 5C08E 2WFF1 4NIAA 5BUPA 1P4IH 4AM0B 1ZSHA 4NAOA 2ICEB 4YHMH 1E28B 2ARXA 4EDWL 3NVQA 1KWKA 1DGRN 2BVTA 4B5ZA 3QJOA 5IB4B 4WTZG 3CDZA 1LODA 4I0WB 5CFDA 4AGVA 3CFCL 3X3FL 3M1CA 1I31A 4FQIH 2NDGA 2IADB 3PQYB 2E27L 2NDFA 3SBRA 1QPKA 2VNOA 2WYSA 3PL6B 5E6YA 1O5LA 2ZEWA 4MQTB 1RZKC 3P3NA 3A67L 2WJ5A 3QUML 1DVXA 2UXFA 4PRNA 1MFCL 3HIZA 4L92A 1FV3A 3RAJL 3M70A 4F1SA 1A3LL 3D4CA 4QDGA 3TBBA 4BSVA 3POWA 1WMEA 1T1ZA 3AREB 1WCBB 4YSSA 5IW6B 1RGSA 5IVBA 3D51A 1STMA 4H8PA 2V8LA 4UNVA 1NC4D 2OW7A 1AVBA 2K9ZA 2ENQA 4CNIB 3P3PA 5BNPA 4KNCA 1OXCA 1GRWA 1F35A 4Q1PA 4UOZA 3LRKA 4KO9A 4GKXA 4KZCA 1DFBL 3G5XB 4WUUA 4BFBD 2R0ZL 4OFKA 5C0BB 4Z95H 3S5ZA 4FAAB 5EEYA 4OD1L 2R0LH 1HL8A 1RIVL 2DWDB 4JREB 3VTAA 4PJAF 3UGEA 4PJEF 2I7SA 1ULEA 5D1IA 4IBWA 1KT2A 4IQHA 2P6CA 5EOTA 5MEPA 4BLJA 4IRJD 5KUKA 2AQNA 2W0FA 3CDCA 3SQOL 1CL7L 3FRPA 4WEEA 5DO2C 1ZZCA 5DJ0A 5EEUA 3B9KA 4FOYA 3I3EA 1EHNA 2H9GA 1JFHA 1RIUH 1BFTA 2JV6A 3HLKA 3TA3D 1A7PH 5IHZA 4KQ4H 1C1FA 1XH2A 1M05A 3TN0B 1ST8A 1IKPA 1GGYA 1KGXA 4S1DD 3TBYB 3TO4A 4LF3A 4Y33A 1KRIA 1W0OA 3CH1A 2XX1A 5E2VH 2ZX2A 2BSED 2XQBL 4EROA 3W1ZA 3QWRA 4GUOA 4BJ0A 4XGZB 4I18C 4ILDA 3BP4A 3ZX1A 1IG3A 4ENEC 1TZGL 1GMIA 1SYSB 2X7LA 3FQUB 3I02B 2C9XA 2I26N 4LGRB 5AALA 5F7HA 1N5YL 1CIWA 2ZHKA 4QQ2A 4XXPA 1S0FA 3VACA 4Y20A 5I66B 4YGCA 4RFOH 3W3BA 3C7EA 1RUAL 2CUHA 3BVUA 5FKAA 4OZIA 3LE0A 5C97A 1IGMH 4KJPC 1KUMA 1QMUA 3QH3B 4EZLA 2APWA 3KPRA 1YG9A 4IGBC 3U14A 3EDDA 1A47A 4R4BB 4UM9D 2BRTA 5JPNA 5C0RH 4GXVL 4JPSA 1U3HC 3FO1B 1L9NA 4FQ2L 3EF7A 1JVLA 3D7PA 1ZRIA 4HUWA 3CVCA 4JBSA 2GNMA 2D73A 8FABB 1P4LA 2F68X 3FBKA 1AMXA 4LP4A 1F58L 2EDEA 3TN92 2DQMA 1KN4H 5I1KL 2BHUA 3LCPA 3O6FA 4LRNL 3S37H 2FBEA 3JWDC 2B08A 2I7OA 1OALA 2MHAB 2W65B 3L17A 2XOMA 3QFJA 4YSFA 1EAH3 4U3SA 5ESVB 4JR9L 3S3PA 3POBA 3NEXA 1SPPB 4KXAA 1ZWIA 2WO3B 1KPVB 4S1RH 4BFKA 5EORH 3H0TA 4XCNA 1HL9A 4AL8L 4ZX4A 3QXAB 2YUVA 2RV9A 1CVRA 4HLTA 1AIFB 2Z7WA 1N2RB 4IIQB 4HOXA 3TN91 5AOZA 2N3JA 2RR3A 2FDKA 1R47A 2DMHA 3LN9A 4I1NB 4MAUH 2R69L 5CEZH 5F1IB 3TBSB 4ZX3A 1I1YB 3ZYRA 4E8DA 2VXUH 3IEAA 4YO0A 3WF2A 2WBJB 5CZXD 4OCSH 4PB0H 1HE7A 1UCTA 3NESA 4JPIA 3IRCA 4GBXD 2F15A 2V7NA 2VDNH 4LFHD 4TLUA 5IROC 4OLLA 5E6ID 4BCZA 4RR3A 4J23A 4KI5M 2ADFL 4DO4A 2VDRB 4M6ML 4Q4W3 2JG8C 1S0JA 3HIFA 2VL5A 3OHMB 4NQDD 4FFVD 1M7UA 3GTNA 3ZDSA 5F8RC 5DD5L 4XN2A 5H37A 3V4PB 5FYMA 1I3HA 3ARFB 1E6JH 1TUPA 2KR2A 2LW3A 2C8NA 4LBLA 4L3EB 1IQAA 3IN9A 1S3RA 2XN9A 1A6WL 1IKOP 1EVUA 2HRPH 4X6EA 4ZXBB 3K3OA 1PY0A 1SUHA 4FYRA 1CDBA 1MCLA 5LCVH 3UYRH 5FYLE 2PCFB 3CJIA 5FXWA 4QGLA 1XR9B 2G4EA 3RVUD 1JNLL 4M7KH 1IEAA 4U3XA 1OO2A 3VSTA 3JBG7 1RUD3 5GZDA 1OA3A 2Y34A 3MZHA 4XXCC 1YJDC 5BRZD 3UFIA 4E41A 3GK8L 5D2LF 2CXKA 4XBEL 5EOQH 5HP5A 3NCEB 2VN3A 2J1RA 1FHGA 5DEFA 3CFJB 3MRCA 3WW1A 2X9XA 1UHVA 1W03A 3CX5K 4PJ8A 1D2SA 4F1ZA 2DQHL 3H7BA 3N1GC 1URLA 3EFDL 2E8ZA 2CBPA 1TEIA 1GYUA 4OCMC 1L3NA 2RCSH 4WEMB 5DHDA 1LGCA 3BZ5A 5HGAB 2FZ3B 2YSSA 1QQDB 2ZE0A 4AVTA 3ZZ1A 4X0NA 2QFRA 5IR1B 1SFDA 4NQCD 2ZXWB 3S0MA 3MLVH 3EYFB 3FO2B 3FN9A 4E27A 2EUVA 4PJIE 4D6SA 3HVNA 1XZ0B 4J5VA 4NFCA 1P2CB 3WKQA 2NSMA 5KHIA 3FF8A 3A4AA 4FZ8H 4XN4A 2J1EA 4NWVA 5KVEE 4IRZA 1FIGL 3NCYP 3EW3B 2IDQA 3MVSA 4L4VA 5FFLA 1NBYA 1VSCA 2GSGB 5BVPH 1T21B 2FGZA 4P4KC 4LLYA 3F04A 4TNVK 2PYTA 2QMJA 4UUJB 3X14A 3MRLB 4WM8B 3NNFA 3PWPD 1KIUA 1KJ2B 4GQ7A 2BCMA 2A6ZA 4UILH 1TLMA 3RWHA 3V0FA 4YQXL 1PKQE 4JFQB 4OIIH 4ACTA 4G3YH 3MA9L 3CLPA 5AZ2L 1ZVSA 5FFGA 5ACZA 1U8LB 1Q4NX 2LLNA 3DV6B 4LIQH 4HX1A 3UTSA 1BLNB 2ID5A 1OAJA 4TVPH 4UQ9A 3AZVA 2DQFA 1Q56A 3ROLA 2ZF8A 4JO2H 3X11B 4B9IA 3FLTA 1LDPL 4OGYH 4YSQA 4GMTL 1AUYA 3MF6A 3D5OF 4ZSOE 2E8YA 1B4LA 2RGSA 5ERWB 5CN1A 4MBOA 5EMYA 4Y22A 4QPWA 5INCA 3CDZB 5CFDB 2BSRA 5BRQA 3I9GH 1IS4A 1SLWA 5DEGA 5EHFA 4RWYL 1UWGL 4KROC 3HG1D 3KPOB 3MLZH 3CC1A 5B4MC 4PRNB 4XNYL 3VM5A 3CZFA 3O3DA 3U9PL 1P6FA 2AQ3A 15C8L 3IS1X 1WAEA 2F6BA 1AOZA 3WFEH 4FG2A 4Y9GA 5D7EA 1OTTC 3JYBA 4KTDL 4E9LA 2A6JB 2BY1A 3A22A 5C7ZA 2Q7YB 1UXMA 1JZ8A 1UYYA 4LSDA 3V0WL 5BNPB 3W37A 1J8KA 5TK4A 1SY6A 3SCMA 2VJXA 2VLRE 3UAFA 1KACB 2QPUA 4COUA 3T04D 2BC4A 1H6XA 3KR3H 1HC1A 2CDGA 5FYBA 3CMOL 3MLSH 1UFUA 3DKHA 2PHRA 4RGKA 2RDSA 1N5AA 2AXFB 3PQYD 4J12A 4AIOA 1KT2B 4GUCA 4MD5A 5C9KA 2FJSA 2GY5A 2JB6A 5EOTB 1W8HA 3RNQB 2IBZY 2I2SA 2QQKL 3V5HA 5DJ0B 2H2SD 1IT9H 1WZAA 3I9PA 3T71A 2JDMA 1JXKA 1EXHA 2PUQT 5I18L 1VZIA 5AW6B 4JVUA 5IHZB 4QHNA 4X7TB 4LEJA 5B22A 1M05B 4MMYA 4M5SA 3SD2A 4C4KO 2D9QB 2ZCLH 3K5RA 2X1QA 3NG5A 2LU4A 3QHTC 5EOCJ 4TN9A 4LF3B 5CJOH 1EZVX 4UZUA 4WENB 1ZAGA 3CH1B 3TO4B 3BGFC 3CQPA 5B1JC 5FFOC 4UIMA 3P4LA 2EVXA 2VBDA 5KBPA 4L5FL 2ZCWA 3ECBA 4W9ZA 3SOBH 5FPVA 3MIGA 3BP4B 4OLWH 3NP4A 4MGQA 1Z7S2 2X7LB 2YBPA 4DKAA 1JYVA 2IALA 2YXWA 1WZLA 3PWUA 5F72S 5A6MA 1OQ1A 4YPGB 1YQ8A 5LA2A 4RD7A 1FXZA 4OLUH 4Y20B 1QJY2 1EFQA 3EH3B 4DZ8A 4OZIB 3L2HA 1T6BX 4GP4B 2OL3L 5IB3A 1YI7A 1MS9A 1NZIA 1BM3L 1JWUA 3KPRB 2AEIT 2VDKB 4LL1A 1NM4A 4ELKA 2C3VA 3KVBA 4AYSA 3BWAA 4NWUL 4KOBA 3P73A 2ZGLA 2I85A 5F1OB 1TZHB 2NR6C 4NN7B 1P4LB 1P4BL 1IBGL 3QQ9C 3QIUA 1MCOH 2Y36L 2JB5H 3O6FB 3QIWA 1Z7S1 4PRPA 1K5MA 5FLVA 2ZPKL 4OI4A 1KFXL 4JGZC 4MD0A 3T8MA 4MJ4A 2YD6A 1P5UA 3PNWB 3QFJB 1G6RA 3LRLA 1QJY1 1RL3A 2RMU2 3ZX7A 1GZHC 1MPAL 4PCSA 4XVTH 3U7WL 1DQQB 5D71H 4RGMB 4K94L 4XCNB 4DGYH 3J9SA 4RGGA 4J3OD 4OLVL 2Y5EA 4Z07A 4AQ6A 3GJAA 4N2BA 4ZONA 1GC1L 3V52H 3ZE0E 1N26A 4ZRGA 1XRUA 5CP7A 5KBLA 4FTVA 4DAGH 3FT3A 5JUEH 2VSMB 1IPSA 3N9PA 2VLJE 2OULB 5A6YA 4DNLA 1TO4A 3ZKSD 1DIWA 1A7RH 3K71A 2DF7A 2GN7A 3ILPA 4JPIB 3KMDA 2RMU1 2V7NB 4RR3B 2KS0A 5TPWH 4X6QB 2ZYIA 5TDPA 2RS12 2VZQA 2GIXA 5JR7B 5KJRL 1D2QA 1KGYA 2ZX9A 2XG4A 4C4KT 1R082 2BXYA 2VL5B 4M43L 5T3XL 1LO2H 2QSCH 3FUHA 2X88A 4Y19E 2W46A 3TGXA 3LFMA 3BEVB 4IM8A 3B2DC 3LKQA 3KB5A 1CF8L 2V9UA 4G72B 1CZVA 4FQLL 2IQAA 2YROA 2XN9B 3JB8A 1MI5A 5T5PA 5DMGC 4QMEA 4JDOA 1NAMH 2DEYX 3CJIB 4HFSA 2QPDB 3L4CA 1IEAB 2IXJA 4EVNA 5JDJA 2WXQA 3BXNA 4Z7UA 1IE5A 2RS11 3K7UA 2ID4A 2XIDA 3PGDA 4GRWB 4R0LA 1DQTA 2A74A 3DIFA 1R081 5DUBA 5HJ3A 3SDDC 4RL7A 1P6WA 5ITFB 3WT3A 2D7FA 3I8TA 5J56B 4PR5A 1K5WA 3O2WL 3SPJA 3MRCB 2XG3A 3VHNA 1NCQB 5JIIA 1KB5A 1E4XH 2ZUQB 4PJ8B 1E6OH 1E5CA 1BW8A 4MB3A 4RFRB 1AR82 2X5IA 3P30L 1PQZA 2IH1A 4LARH 3UV9A 2IXQA 1DO5A 2YSSB 5DA4A 1DQDH 1WFIA 2VDOH 3Q7JA 2C3WA 1W8WA 3BPSA 5HYQA 3X1NA 3NIDB 1G9MH 3T2QA 3RA7H 4AW4A 2DMGA 2O0OA 2RHEA 1OIOA 5CUSH 4Z7AA 1ZM1A 2J71A 2GKIA 4RMTA 3VVWA 5JA9A 3S48A 3O4OC 4MFHA 2AEYA 2Z42A 2IPTL 4JFXB 1FLRH 3BLPX 3ZBMA 2HJLB 4BFNA 4L4VB 5CCKL 5ICYA 2ZJSL 1O4YA 1ZOXA 1AR81 3GO1H 3X14B 1FC2D 1XNBA 5L7OA 5J13B 4KUZL 1KIUB 2AGJH 1SHSA 4K3HA 1ZLWK 3D3AA 4QPGA 5AW3B 1Z3GL 3RWHB 2I07A 1LB2A 3ZZSA 4AEIH 3QRGH 4DIXA 3G9AB 5IJKA 5DQJB 4NP4H 1T2QL 2XTJE 1D9KC 5JXGA 1ZE3C 4ANXA 4PJDA 4P9HH 4HX1B 2DLFH 3UTSB 2F8XC 5FZFA 4D7TA 4TUOA 2DQFB 1ZBA3 2Y6LA 3ROLB 4N43C 2P47B 2ZOWA 1RHFA 4LQ1A 4FOVA 3UBHA 3RJRA 1AE6L 4NN6B 4AE0A 5E9AA 3N44B 5JVVA 2N1TE 4JX0A 5E6HA 5A6IA 1MCBA 5IHRA 4YHKL 2LAAA 5INCB 1OT1A 5B8CA 2XLAA 4XFHA 5SWSE 1GR7A 2YD0A 4JFFE 5DEGB 1YEJL 4AWJC 1J0JA 4JZJA 1S0CA 4TUJA 3CQQA 4MKMA 4NQVA 2PTTA 4DW2H 4NPYA 2E9JA 5I0YA 1NCWH 3CZFB 3O3DB 5BQ7A 2FHRA 1RUI3 4IHOA 5A2IH 1TVGA 4GMP1 1NGZB 1JYCA 5KTEH 4AFAA 5HDRA 3TH4T 1ONAA 3KSCA 4G6JL 5K59F 2D7OA 4LIUA 5H4YA 3OBTA 1BPLB 4FPFA 4HOWA 3LQMA 5H9QA 3A4FA 5AVTB 5HHQB 3L7FA 5EOCH 1OPGH 3JB4C 3EH4B 4PJFA 3QARA 1BFOA 1AKJD 4NUQA 3ILRA 5DUPL 5F0PB 3VGBA 1JYWA 4AXOA 2BC4B 4XMKH 4ZNEA 2N01B 5FYIA 2CDGB 5I0TA 2DURA 3CK0H 4X9BA 2FO4A 4RFNB 3VWKD 1GMMA 1N5AB 4ODSL 5CYYA 2JG9A 2AANA 2BX5A 2P5EA 4MD5B 3LIZL 1PJ9A 1LE5A 4I3SL 2I74A 5FY4A 4OQ9A 2J1WA 2JB6B 1MPXA 2MNGA 1SJEA 4LGPB 5FP7A 4POZC 3G6JE 1AI1L 3I2CH 3UC0L 3CZGA 3V5HB 2JDHA 4OZIF 4NPMA 1U8CA 2ZOUA 1GV9A 4KL1A 1CGYA 3POYA 4K9EL 3AJ7A 3E9TA 4WO4C 4ZW3A 4QHNB 2VDPL 4MMYB 3BTYA 5F7DA 3LN4A 3UTPE 4WWKC 3KBPA 4XFIA 2MCG1 3H1MA 3PPSA 1HEZA 2HB0A 3LNGA 4UIMB 4EZ4A 3ECBB 4AK1A 3UROR 1A4CA 3V8CA 4XN7A 2NN8A 1AHWA 2IALB 3PWUB 4X7SL 2XBTA 4ETQA 3AY2A 5HPMA 4FSJA 1AO7E 1JGLL 2NY2D 3PU3A 3DUUB 3VKFC 5ICZA 2RJKA 2X89D 1IVTA 1CT8A 4PG2C 1IGJB 4PMFA 1X9TA 4MMZA 1JWUB 1AQ8A 1QI4A 1ILUA 2BY2A 2ZZUT 2C3VB 4ELKB 2FO1A 3BWAB 5I9QB 3P73B 2EUZA 1G7MA 5DHXB 1FE8L 5DTFA 3GBWA 2BWDA 2GIYA 4MA3A 4XCBA 1T2XA 3QIUB 4PJAE 2VKWA 4PJEE 3O1VA 2V2TA 3QIWB 4XP6H 4HWBA 4PRPB 4RVBA 4JB9H 4HXBL 2GUOA 1RPQA 3S3DB 2BNQE 1YAZA 4PG9A 5HHNA 3BAEL 4AJ0A 4GIOA 3DGCR 4P3WA 2E47A 3BP7A 4U6XB 1N4XL 1G6RB 4HAGA 4CP0A 2YJLA 1IAIL 1HESA 3O3EA 1YFYA 5EZPA 2ZWLT 5HI5C 4ZU4A 2O4EA 1JHKH 2R6QA 2DEXX 3BZDA 4HBCL 1E27A 4P23D 2IANA 5J8OA 1DFQA 3VZLA 4LO7A 3QJHA 4Y4KD 1Q3EA 5HV4A 3H85A 1PL3A 3POHA 4CSSA 2J5WA 1S7QA 4JRXA 2G2PA 5FBZA 1BZ8A 3R0NA 2WANA 4ZPVB 1H8VA 5CP7B 3B7TA 5D70L 1LK3L 4FTVB 5I1JL 3GIVA 1TTFA 5C33A 3LOBA 2XTSA 1U8IA 4PRIB 1YZZA 4JFHE 3ATEA 1RFDH 1WEJL 1WZ1H 3MRMA 1L7TL 3K71B 4FPGA 4YM2A 5F7WC 3ILPB 4K1ZA 2IUWA 3B94A 3NJVA 3WXVH 5IESH 1IGFL 5TDPB 2I24N 4ZO9A 2WUCH 2Y6SD 3AQXA 3EUUA 4NN5C 3MLTA 1J0HA 4HUMB 3D87B 5HSFA 4PTUA 1BJMA 3SJVE 1OQXA 4CCNA 1ZXKA 4M93C 4RAUA 1PZCA 1NKGA 1U8HA 3RRQA 4BQ3A 1Y0LA 3LKQB 1PO13 1YMHA 1E3ZA 2IQAB 4N6QA 5DJYA 5KANI 2P5PA 2ICWA 1PK6B 1MI5B 1SN0A 1MW3A 4GXUN 3H3ZA 4XVJL 4K9JA 1W16A 3N43B 2R063 4BQBA 5F7EL 4WSKA 4EVNB 3D85A 3HMXL 2VTFA 3H9SE 4Z7UB 4U0QB 5H35A 2F4PA 4OCLC 3WD5A 3PGDB 2WT1A 4R0LB 2A74B 1VADA 4NIHA 5LVEA 5HJ3B 3HI1B 4EN8B 4KI5D 4FPEA 4N0YL 1URIA 4XF9A 2R56H 4JPQA 5IAXA 4PR5B 2DQCL 4XT1C 3WUWG 3WTUA 4QMAA 3RYRA 2OIIA 2AEQL 1UJ3C 2WC7A 1M4KA 3FH8A 1KB5B 3BT0A 4QQHA 2G9GA 1W9XA 2ZOEB 2WWMD 1LEGA 3B2PA 3LHPL 4QGMA 5IOKA 2Y7SA 2ZTBA 1PMJX 5FECA 2X5IB 4J25A 1PQZB 1YFWA 1VPHA 2IXQB 2JQAA 2FYYB 1O91A 2XX0A 5E95B 2AK4B 2E7CA 4FQQA 5C2BH 4MJ2A 5HYQB 3NAAL 5JDSA 1W6PA 3DX7A 3MYJA 5KHGA 1QSFD 3S7GA 4YS4A 1JE6A 4HQQL 1MJ8L 4AI0A 4N90E 2G5RA 3Q8FA 5LWBA 1AJ7H 3MRIB 3ATDA 3N44F 3IK2A 5DD6A 5I0WA 2XT1B 5ICYB 3BZ4A 3VG0H 5DFTA 3EF4A 4D9QE 4AWDA 3OTTA 1HINL 3WF1A 1P6AB 4MNGE 4NO0D 4P2OC 5JHLH 2ILMA 1CLCA 1EJOH 1RUML 2VUYA 3C8KA 2IVJA 4N8MA 3ZZLA 2WOBA 1FL5B 4I18A 1DQLL 2H5UA 3LQAL 5HD8D 1TCRA 2ZX5A 2X4NB 4LKSA 5KBMA 4PJDB 1LOBA 1IGCH 2UZYA 1W8TA 5D2LE 5JMCA 4AHXA 3OKDA 4TUOB 2GK2A 2LFEA 5DXDA 3BH4A 1OF4A 1PNDA 2VDRL 1YMMD 2G3MA 1U4EA 3T6XA 2XPYA 4JY5L 3U9UA 2GTWA 3CX2A 4GI9A 1U3HA 3UL4A 2YUXA 3UGGA 3VDDC 3EDJA 3IETA 5AW8B 2VXQH 3GBML 3EHKA 3V4PL 5EZIH 2FJHA 3T1FA 5B8CB 2W5PA 1OAQH 3I3BA 1FBIH 4IU2A 4LCVA 5HYEA 3NAPB 4IE6A 2L7EA 3PJYA 3V79C 3HC2A 1MCHA 3TS8A 2OK0H 3V6OC 5HVHC 4JZJB 2BFVL 4TUJB 4K3JL 3U79A 2PTTB 4NENA 3MFGB 1WWAX 3QZNA 4NPYB 1RAMA 1OT5A 2CJUL 4AGMA 1NMAL 5BQ7B 1AS6A 3MMEA 4FHKA 2IMMA 4IHOB 2FX9L 1XBRA 4AK2A 2ERFA 5FDBA 1ORQA 4JFED 2FWUA 3QAZB 4NXKA 4P04A 1KPRA 5I6OA 1N0XH 1O59A 5DJ2A 3ZMNA 1KYOJ 2YBGA 1YJKA 2WQVA 3L7FB 4UW6A 3B2XA 5LAXA 4WFHD 3VI4A 1KZQA 3VXSA 3BUDA 4MGXA 5CADA 3WMPA 1HOCB 1E9PA 1OPMA 2EE0A 2WO1A 4JZNA 3PUHA 3FH7A 1Q0XH 4NVPA 4XVHA 3FPXA 5FGCB 1NE4A 5CLWA 3NT0A 5DSCB 3H2PA 1DTUA 1JU4A 1XD0A 2P5EB 1LE5B 4PP1C 3HG0A 4B9JA 1I9EA 3ESMA 3LIGA 3WCRA 1Z5LA 5IROA 5I17A 3ZTNH 1W2UA 3RQ0A 4NRZB 5A7EA 3DSFH 4UI2A 1AJOA 5CD3A 2JG8A 1I1CA 3GNMH 5C3TA 1T7YA 5LGYA 5KZCB 3GMOA 3I97A 3LEYL 5EIIG 1OSPL 1JZGA 3LN4B 2QEJA 2H3XC 2WZPA 5C0BE 3CXHJ 4YGDA 4YDJA 4Q58C 5D1ZD 4C56A 1MRDH 4OSUL 3OKLA 5EU6D 5HYIA 3VZOA 4RNRB 1KJ2L 1AZVA 3B1UA 4CW1A 3G6AB 1S7SA 2DQEH 4ETQB 2APBA 1E4WH 1G1OA 3KPQB 4A2FA 2O6FA 4XXCA 2IG2H 4IS6B 3VG9C 4U4BA 1C7TA 2YLHA 3TYGH 5ICZB 4TN7A 2BPA2 4MMZB 1RITA 2LT9A 3C2AH 5F1NA 3VTTA 1R4XA 1I8LC 3PE9A 5AW4B 3MDPA 2RTTA 4DEQA 3AT0A 3E8UL 1ZGLP 5DTFB 1GCFA 4MA3B 1RHI2 1XCTA 5KHKA 3VRIB 5SWZB 2XBZA 3DHUA 1IARB 3S98A 2V2TB 3RZMA 1N1TA 4F7KA 1L0QA 3KV9A 3U7YL 4Q9RH 5D96C 3OGGA 1XXDC 3OGCA 1ZMYA 3Q06A 1WLCA 4PG9B 3SBPA 5HHNB 3S35L 1IEHA 2A1WL 2HYMA 1O5DT 3FCUB 1RXLA 3PP3H 5C0DA 1MN4A 2UXVA 4L37B 3KWTA 1E8WA 4DTGH 3EGSA 3HLAA 1AHSA 2CO7A 3FDWA 5C5TA 4XWOD 3DOSA 5EQUA 4J6RH 2PHWA 1MAJA 3ZKND 3GHPA 4E4HA 1G7IA 2NZ9D 3U6XS 4Q56A 3WDTA 2IANB 3HS0A 4UBDD 3SYQA 3QJHB 2R2HB 4PGDB 3RDTD 2PNDA 1S0IA 1JGUL 4HZLB 1J5OL 1RHI1 1S7QB 4JRXB 2H32A 4P4KA 3W56A 1YN7A 5IEHA 1ZTXH 3H42B 2XDHA 3UL2A 4K7PH 1KV7A 3L5JA 3GIVB 4P9MH 2ZYSA 5JLZA 3VW3H 1MFUA 1E4KC 1U8IB 4JDVA 4YSUA 3MRMB 1OF2A 3C7OA 4CSTA 2J8UA 4ZS2A 2G3XA 2MNJB 4W1TA 1VA9A 1GGCH 1RUH3 1SLTA 4QHBA 4XUQA 1XAUA 2ICWI 2YKKA 4LASH 4Z7UF 2BP0A 2WQZC 3ARBC 1BM7A 3MLTB 4D0QA 4YBQC 5SV8A 4PTUB 1OOWA 3E6FA 3BPOC 4HS6A 3MV9A 2MCMA 2HKHH 5CKGA 4RAUB 4YE0A 1QFUL 4KPHL 2HTLC 1TJHH 1W0VB 5K69A 4JLRA 4OY9A 3WYRA 2A0LC 2ADIA 2OJZL 4RGNC 5D1QC 1SCRA 3VRLF 1EO8H 1Y0LB 4X7CC 1BQSA 4X6BB 1TNRA 1YHFA 1YMHB 1F8TH 2D0FA 3C09C 3GXIA 2BLFA 3VGAC 5HXVA 4DMIA 5IBUB 4WM7B 4BXFA 4W6YA 1J1PH 1J9SA 3RPBA 1OAYL 1LXMA 1CAVA 2ZSWA 4PRID 3WP4A 4MGIE 1OL0A 1OARL 3ZFGC 3VU2A 1BBT3 4OZHE 5H35B 1MHPL 2YC4A 3DTXB 3GMPA 4XNDA 1ZVNA 5H9SA 4MZ2A 4IBVA 1TXKA 2A9NL 1BWMA 1VADB 3BE1H 5IVCA 1XGYH 1MQKH 2OTWB 4C1XA 1YEKL 3JD73 3GLZA 1CBVH 5DD1L 2VDKL 3NSDA 4K5PA 5IHUH 4EQ2A 3KLSA 3IAGC 4S1SH 3X1GA 2WHVA 1JW6A 1OLMA 2VMCA 5EN2A 5EBLA 4JO3L 2UWAA 3BDBA 3OF1A 1UUNA 1KBGL 2XV3A 5FPIA 5I24A 1VCBC 1RUKL 1DVFA 3HR6A 4JO1L 5B1BB 4F58L 1APNA 1OW0C 3P0GB 5DD3L 3WDJA 4WK4B 5E89A 5B1CA 4WTWA 4FQQB 4HPHA 1MCPH 4C0BA 3BKJL 2OR9H 3A4DA 5JDSB 1W6PB 3DX7B 1C28A 5CGYC 3MYJB 1KCWA 5GS0H 3L3DA 2E7QA 2BNRB 1TJIL 1FYTB 2EXWC 2HT3C 3FK3A 4KK9C 1UIJA 1RJLB 4XW3A 2H6UA 4HUXA 4S0HA 3RNKA 4HF5H 4AGGA 3T30A 5DD6B 5DK0B 1RI8A 2DIBA 4G9FA 3LF7A 3MICA 4G8GD 4UV7L 5B1JA 4YHNA 5JLVA 3GYDA 3T0AA 3VMNA 4H25A 3NCBB 5EF0A 3C8KB 4QXUH 3DTUB 5F9AC 1A3QA 4I18B 1QR1B 4KGLA 5PCYA 3VMOA 4OZGA 5FV3A 4OI0A 1J5IA 2VW7A 3J26N 1Z9MA 3DARA 1U5YA 5FB8A 2ZP8A 2AK4D 4M03A 4KDTC 1NMBL 5J06A 2W5FA 4XE9A 3S96A 4PLKC 3MFFA 4IGBB 4J27A 2F18A 4N2MA 2OA9A 4R96B 3UZQA 5DQDL 5L2JB 2WB1A 3BGAA 3O2DH 5KVDL 4KO5A 1U3HB 3V5KA 4XO8A 4NSKA 3CDFA 4O65A 1AZRA 3IETB 2CLRB 2NR6A 3OWEA 1JZ6A 3EJRA 3GZOA 4JDEA 4PJFF 1A21A 1JF1A 3FHIB 2FJHB 4JL1A 2DDQL 3T1FB 2WS93 2BDNH 3CQFA 3N1MC 1KCUL 1Y07A 2J1AA 2J6EA 4Z7VA 4XQWA 3QDMA 4KKLC 4JGZA 2YMOA 4HPYL 4NENB 3ZSMA 3B43A 2KC0A 2EE6A 3L2YA 1W2KT 5A7NA 1EEYB 3MMEB 2FNBA 1I9JL 3BQUC 5BOPA 4N25A 5TF0A 2CGOA 4KHTL 4KKBC 1ORQB 3CFQA 3QPKA 3PWLA 4RAVA 1UYWH 3VJ6A 1HB2A 2JXAA 4M5ZL 4Z6AT 1JRHH 4LLMB 2WJSA 2WLLA 3KT1A 4FZEH 4J4PC 4LHNA 4MHUA 2L4OA 1XBDA 5CU9A 5LAXB 3VI4B 4BIOA 3VXSB 1RSFA 4Q4V2 4EN3C 5A1LA 4FFWC 4JZNB 1G94A 2CE6A 2F53B 2D44A 2ALAA 2PCYA 3ECUA 3QG7L 2SLIA 1IZJA 2Z79A 3IDJA 2CCLA 3FU5A 2YRZA 4XI5D 3FBMA 1NAKH 3FC0A 5H2BA 3N9GH 4JKPH 1KJ3H 3DWTA 1PZ8A 4HJ0D 1OGTA 2YMTA 2ZGPA 2WYIA 2RJLA 2WQAA 3ESPA 5CD3B 2JG8B 4FPLA 4QKDA 1IOAA 1MQ8A 1BGXH 3GMOB 2XJLA 4Z7NB 1HW5A 3MRGB 4N20A 4Q4V1 4G5ZL 2J88H 4KOCA 4J2XA 4WUUE 3FUNA 1PMIA 3GLAA 2B9UA 5EO1A 4YDJB 4C56B 2CHHA 1DYKA 1KXTB 5D1XC 1INQA 1ZK5A 5CZVL 4HIIA 3OKLB 4ICWA 1CTMA 4MNQB 2A7AA 4CW1B 5D7JD 2O61B 3FT9A 3TM6A 1XC6A 3P1IA 1JCVA 1GOFA 1S7SB 3ULUC 3TU6A 3QRFM 3LXAA 4U4IA 5LASA 3RMXA 2GSIA 5K59E 3Q9OA 3U1XA 5J0BA 3FFCD 4Z0BH 3MJ6A 3UJJH 1NOAA 3SDDA 2Y7OA 4KVNL 3SPIA 3ZTCC 4YEFA 3DIVA 2IV9A 4QRAA 1ZRUA 1XAKA 4I2OA 2XICA 2Q8AH 2VMJA 5ABZA 4MCZA 1WT5C 5IFAH 1IBZA 3WNPA 1XCTB 1LEIA 1PM7A 4HKLA 2V4LA 3CVHH 3LPPA 5HI3C 1OGAE 2BS8A 2D0GA 5DI8B 3ZQXA 3K3NA 5JZGC 5L8JB 5GRZA 1UA6L 4XB3A 2NUPB 3OGCB 3OF6A 4M8QA 5JOEA 3B9AA 3MFCA 4LJHA 1HCFX 4X4YB 1C4RA 2JLLA 2X3BA 3BKCH 3J8F7 4OZIE 5LBSL 2X4QA 3EGSB 3HLAB 2JNZA 2TUNA 4RA3A 3FX3A 3K80A 2ADDA 4FFGA 4YW1A 2E32A 1R46A 4CXXA 3DOSB 1CI3M 3MKKA 2EO1A 4GOSA 1G7IB 2RR13 1F41A 2EXYC 2F58H 2DJMA 3BFOA 2ZGTA 4FAGA 1DE4A 1FNEB 4FQ1H 5FZAA 4YUEL 3K2UL 2H32B 4P4KB 5IEHB 1YN7B 1CN4A 3VRJB 1D4VB 2VVDA 3BVDB 3QIBC 3UTZA 5JLZB 5E1RA 3B2VH 4JKMA 3CFEA 1MS3A 5SWZD 3VGFA 1OF2B 1R3KA 2VDLB 4GW5A 1FAKT 3QFJE 4U05A 5F0JB 1BXUA 3QC5X 1OD3A 2AERT 5HXMA 1KC5L 4M9PA 5AVWB 2BP0B 4L11A 3CLFL 3X1FA 3N9NA 3U4BL 3PAZA 5IHLB 2R072 3MPBA 2YGPA 4N43A 3WCSA 3AXHA 3E6FB 5BRPA 1W9SA 3MV9B 2ZZJA 3MPPG 1FQ9C 2O5XL 4L4TD 2JKBA 5TSWA 1UY1A 1JCKA 4OVVA 4P2QD 2NY0D 4HU8A 2ADIB 4FFFA 3D3VE 5T3ZD 1IAOA 2UV3A 1UWYA 4HKZA 3SHSA 4DEPC 2HMID 3NV2A 2PWFA 1KXVA 4PMEA 1UW8A 1V8HA 3I2OA 3ASOB 4KROB 3VI3B 1EANA 1CAVB 2ICES 4JDMA 1BFVL 5A7OA 3E2HC 3QNFA 2ZSWB 4NO5B 4JM2C 3ZSLA 1A8DA 5IK5A 4OIAA 2R071 4LBMA 1AP2B 5FCSH 3T0EC 4MADA 1SXBA 4HLJA 3MGOA 3BJ91 3UAJC 2E33A 1LO4H 1R34A 3EYQD 3AK0A 1TZOA 3CO2A 3RWEA 5CGMA 2E4TA 3GM8A 3QYCA 1BEXA 3NDYE 5EWIL 4Q9QH 1FFPA 1A9EA 1N8ZA 2XN9E 5EBLB 5EN2B 5DAQA 1EHLL 2C1FA 2DTML 3LXBA 4BHUA 3ULVH 3WIHA 2LTNA 3WG4A 2FO8A 3POJA 4BD4A 2EDNA 3KYAA 3AU0A 3IDMA 2EXTA 3C12A