3ZXHA

Mmp-13 complexed with 2-napthylsulfonamide hydroxamic acid inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
169
structure length
166
Chain Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGFMLPDDDVQGIQSLYGPGDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLLAGENASE 3
publication title Potent and Selective 2-Naphthylsulfonamide Substituted Hydroxamic Acid Inhibitors of Matrix Metalloproteinase-13.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 41
structure length 166
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3zxhA00
1SLMA 1XFUA 1FLSA 1BQQM 1HTDA 1GO7P 3MA2A 3ELMA 4R3VA 1KBCA 456CA 1XFWA 2L0RA 1GKDA 3USNA 3B2ZA 3LUNA 1ZP5A 1KUIA 2PJTA 2OXWA 1CXVA 1CGLA 1OMJA 2XS3A 1C7KA 1L6JA 4WZVA 1KUGA 5D1SA 2Y6DA 2W14A 3WV2A 1Y93A 5D2BA 4WKEA 1BUDA 4WKIA 1MMPA 1I73A 1ZTQA 2E3XA 2YIGA 3TT4A 2OXZA 1B3DA 1K7QA 3F16A 4HMAA 3LEAA 4ON1A 3LMCA 1CIZA 1ND1A 1UMSA 4A3WA 4CTHA 5L79A 3F18A 5I4OA 1PWQA 2QPJA 4IJOA 1XUCA 5D7WA 4PKUA 4PKWA 1KUFA 3EHYA 1GE6A 4J4MA 1CQRA 1HY7A 1JK3A 2DW1A 3HB2P 3LUMA 2RJQA 3KMCA 2KRJA 1ROSA 1PWPA 1HOVA 1EB6A 1YCMA 1FBLA 3L0TA 3N2VA 4GUYA 1SATA 4EFSA 830CA 4IN9A 2OY2A 3KMEA 2WO9A 3F19A 1MMRA 5D1TA 1I1IP 3Q2HA 3Q2GA 1BKCI 4GR0A 4IUWA 2DW2A 1C8TA 2K2GA 3P1VA 1IABA 3DWBA 5LABA 2ERQA 1A85A 1ZVXA 1JAPA 1QJJA 1D8FA 1BQOA 3K7NA 4FU4A 3LIRA 1BUVM 2Y6CA 1MMBA 5JMYA 3L0VA 2X3CA 3HBVP 3HDBA 3LQBA 1C3IA 2JT5A 2W0DA 1G9KA 1YQYA 2ERPA 3BA0A 2DDFA 4L63A 3TSKA 1BM6A 1J7NA 3SHIA 4AUOA 3ZUKA 3EDGA 2X3BA 1BIWA 3LE9A 1USNA 1HFSA 3F17A 1XFXA 2RJPA 2W15A 3LILA 1JAOA 2D1NA 1XUDA 3LKAA 4GR3A 4L6TA 1SU3A 1IAGA 1Z3JA 4FXYP 3B92A 3VTGA 4GF1A 4ZR5A 3DSLA 2CKIA 1B8YA 2OVZA 1ZXVA 3AIGA 4JQGA 3E8RA 1EUBA 3KWVC 1EAKA 3EWJA 1QJIA 2MZHA 4WK7A 2AYKA 3HDAP 4H84A 2POJA 5I2ZA 2XS4A 1ASTA 1XURA 3LGPA 5I3MA 1AF0A 4H49A 1K7IA 3DPFA 1OM6A 4JA1A 1BKCA 1OM8A 2W12A 3O64A 2DDYA 2EROA 2J83A 1JIWP 2JIHA 1R1IA 3RTSA 4HX3A 2X3AA 1XFZA 1WNIA 1S4BP 1RM8A 1MNCA 2WO8A 5BOTA 3I7GA 4XM6A 4JIJA 2JSDA 1Q3AA 4G9LA 1G05A 3TVCA 2JNPA 3GBOA 4H82A 3KEJA 5CZMA 4L19A 3KRYA 1SLNA 4GR8A 3NX7A 4XM8A 3LJTA 1IACA 2MZEA 1JANA 1BKCE 1Y8JA 2DW0A 4XBHA 4A7BA 5L7FA 1CGFA 1JJ9A 1CK7A 3LIKA 1HV5A 3TS4A 2OW2A 1ATLA 3HBUP 3VI1A 1O0QA 2OXUA 1QIBA 3LQ0A 1XFVA 4PKQA 2MLRA 3F1AA 4H2EA 3HY7A 4Q1LA 4DD8A 2OY4A 4JP4A 1QUAA 1OS2A 1OO9A 4DV8A 2O3EA 1YP1A 1IADA 4DPEA 2A8HA 5I43A 3F15A 2MZIA 1O0TA 2AIGP 1G4KA 4XCTA 2N8RA 3O2XA 1R1JA 4H76A 1AKLA 1RMZA 2W13A 1G12A 1R54A 5B5OA 3EHXA 5I12A 1GO8P 2X7MA 1PWUA 4JPAA 4PKTA 1KUKA 1Y0VA 1MMQA 1ZXCA 4GWMA 2K9CA 3LJGA 2YB9A 2TCLA 1R55A 1BSWA 1D8MA 1D7XA 1CGEA 2OW9A 4PKSA 1A86A 3N2UA 3LK8A 1SRPA 3P24A 1DTHA 4H3XA 3KHIA 3ZXHA 1OM7A 1SMPA 3UVCA 5BOYA 3KECA 2USNA 1JH1A 1XFYA 1KUHA 2O36A 3EDIA 2FV9A 1PWVA 1CAQA 3I7IA 5D3CA 2MLSA 966CA 1IAEA 2E2DA 2OI0A 3ZVSA 5H8XA 1K7GA 1UMTA 4PKRA 4FXQA 1DMTA 3AYKA 5BPAA 1I76A 1R1HA 4G0DA 4XM7A 4QKZA 3V96B 1QIAA 1UTZA 5I0LA 2D1OA 1GKCA 1H71P 2OVXA 4WF6A 3RTTA 2J0TA 1JAQA 1BZSA 3HY9A 5D1UA 3DPEA 3DL1A 1GXDA 4AXQA 4I03A 3KEKA 3K7LA 3CKIA 1YOUA 1KAPP 5B5PA 4PKVA 3OHLA 2OW1A 2SRTA 3U1RA 2OW0A 2WOAA 2V4BA 3DNGA 1JKYA 3G42A 1HFCA 4DF9A 2CLTA 5CXAA 3B8ZA 4AYKA 3OHOA 1OS9A 3AYUA 4I35A 1UTTA 5CUHA 4FVLA 1GE5A 2FV5A 1FM1A 1GE7A 4GWNA 3G5CA 1UEAA 3HYGA 2JT6A 3WV1A 3EDHA 1IAAA 4H30A 1QICA 1AYKA 4ILWD 1D5JA 2Z2DA 2I47A 3EDZA 1JIZA 1ZS0A 4GQLA 4H1QA 3LJZA 3WV3A 2OZRA 4AIGA 1PWWA 2HU6A 1G49A
chains in the Genus database with same CATH superfamily
1SLMA 1XFUA 1FLSA 1BQQM 1HTDA 1GO7P 3MA2A 3ELMA 4R3VA 1KBCA 3DTEA 456CA 1XFWA 2L0RA 1GKDA 3USNA 3B2ZA 3LUNA 1ZP5A 1KUIA 2PJTA 2OXWA 1CXVA 1CGLA 1OMJA 2XS3A 1XM5A 1C7KA 1L6JA 4WZVA 1KUGA 5D1SA 2Y6DA 2W14A 3WV2A 1Y93A 5D2BA 4WKEA 1BUDA 4WKIA 1MMPA 1I73A 1ZTQA 2E3XA 2YIGA 3TT4A 2OXZA 1B3DA 1K7QA 3F16A 4HMAA 3LEAA 4ON1A 3LMCA 1CIZA 1ND1A 1UMSA 4A3WA 4CTHA 5L79A 3F18A 5I4OA 1PWQA 2QPJA 4IJOA 1XUCA 5D7WA 4PKUA 4PKWA 1KUFA 3EHYA 1GE6A 4J4MA 1CQRA 1HY7A 1JK3A 2DW1A 3HB2P 3LUMA 2RJQA 3KMCA 2KRJA 1ROSA 1PWPA 1HOVA 1EB6A 1YCMA 1FBLA 3L0TA 3N2VA 4GUYA 1SATA 4EFSA 830CA 4IN9A 2OY2A 3KMEA 2WO9A 3F19A 1MMRA 5D1TA 1I1IP 3Q2HA 3Q2GA 1BKCI 4GR0A 4IUWA 2DW2A 1C8TA 2K2GA 3P1VA 1IABA 3DWBA 5LABA 2ERQA 1A85A 1ZVXA 1JAPA 1QJJA 1D8FA 1BQOA 3K7NA 4FU4A 3LIRA 1BUVM 2Y6CA 1MMBA 5JMYA 3L0VA 2X3CA 3HBVP 3HDBA 3LQBA 1C3IA 2JT5A 2W0DA 1G9KA 1YQYA 2ERPA 3BA0A 2DDFA 4L63A 3TSKA 3DTKA 1BM6A 2YUFA 1J7NA 3SHIA 4AUOA 3ZUKA 3EDGA 2X3BA 1BIWA 3LE9A 1USNA 1HFSA 3F17A 1XFXA 2RJPA 2W15A 3LILA 1JAOA 2D1NA 1XUDA 3LKAA 4GR3A 4L6TA 1SU3A 1IAGA 1Z3JA 4FXYP 3B92A 3VTGA 4GF1A 4ZR5A 3DSLA 2CKIA 1B8YA 2OVZA 1ZXVA 3AIGA 4JQGA 3E8RA 1EUBA 3KWVC 1EAKA 3EWJA 1QJIA 2MZHA 4WK7A 2AYKA 3HDAP 4H84A 2POJA 5I2ZA 2XS4A 1ASTA 1XURA 3LGPA 5I3MA 1AF0A 4H49A 1K7IA 3DPFA 1OM6A 4JA1A 1BKCA 1OM8A 2W12A 3O64A 2DDYA 2EROA 2J83A 1JIWP 2JIHA 1R1IA 1XAXA 3RTSA 4HX3A 2X3AA 1XFZA 1WNIA 1S4BP 1RM8A 1MNCA 2WO8A 5BOTA 3I7GA 4XM6A 4JIJA 2JSDA 1Q3AA 4G9LA 1G05A 3TVCA 2JNPA 3GBOA 4H82A 3KEJA 5CZMA 4L19A 3KRYA 1SLNA 4GR8A 3NX7A 4XM8A 3LJTA 1IACA 2MZEA 1JANA 1BKCE 1Y8JA 2DW0A 4XBHA 4A7BA 5L7FA 1CGFA 1JJ9A 1CK7A 3LIKA 1HV5A 3TS4A 2OW2A 1ATLA 3DTIA 3HBUP 3VI1A 1O0QA 1OZ9A 2OXUA 1QIBA 3LQ0A 1XFVA 4PKQA 2MLRA 3F1AA 4H2EA 3HY7A 4Q1LA 4DD8A 2OY4A 4JP4A 1QUAA 1OS2A 1OO9A 4DV8A 2O3EA 1YP1A 1IADA 4DPEA 2A8HA 5I43A 4L7AA 3F15A 2MZIA 1O0TA 2AIGP 1G4KA 4XCTA 2N8RA 3O2XA 1R1JA 4H76A 1AKLA 1RMZA 2W13A 1G12A 1R54A 5B5OA 3EHXA 5I12A 1GO8P 2X7MA 1PWUA 4JPAA 4PKTA 1KUKA 1Y0VA 1MMQA 1ZXCA 4GWMA 2K9CA 3LJGA 2YB9A 2TCLA 1R55A 1BSWA 1D8MA 1D7XA 1CGEA 2OW9A 4PKSA 1A86A 3N2UA 3LK8A 1SRPA 3P24A 1DTHA 4H3XA 3KHIA 3ZXHA 1OM7A 1SMPA 3UVCA 5BOYA 3KECA 2USNA 1JH1A 1XFYA 1KUHA 2O36A 3EDIA 2FV9A 1PWVA 1CAQA 3I7IA 5D3CA 2MLSA 966CA 1IAEA 2E2DA 2OI0A 3ZVSA 5H8XA 1K7GA 1UMTA 4PKRA 4FXQA 1DMTA 3AYKA 5BPAA 1I76A 1R1HA 4G0DA 4XM7A 4QKZA 3V96B 1QIAA 1UTZA 5I0LA 2D1OA 1GKCA 1H71P 2OVXA 4WF6A 3RTTA 2J0TA 1JAQA 1BZSA 3HY9A 5D1UA 3DPEA 3DL1A 1GXDA 4AXQA 4I03A 3KEKA 3K7LA 3CKIA 1YOUA 1KAPP 5B5PA 4PKVA 3OHLA 2OW1A 2SRTA 3U1RA 2OW0A 2WOAA 2V4BA 3DNGA 1TVIA 1JKYA 3G42A 1HFCA 4DF9A 2CLTA 5CXAA 3B8ZA 4AYKA 3OHOA 1OS9A 3AYUA 4I35A 1UTTA 5CUHA 4FVLA 1GE5A 2FV5A 1FM1A 1GE7A 4GWNA 3G5CA 1UEAA 3HYGA 2JT6A 3WV1A 3EDHA 1IAAA 4H30A 1QICA 1AYKA 4ILWD 1D5JA 2Z2DA 2I47A 3EDZA 1JIZA 1ZS0A 4GQLA 4H1QA 3LJZA 3WV3A 2OZRA 4AIGA 1PWWA 2HU6A 1G49A
chains in the Genus database with same CATH topology
1SLMA 1XFUA 1FLSA 1BQQM 1HTDA 1GO7P 3MA2A 3ELMA 4R3VA 1KBCA 3DTEA 456CA 1XFWA 2L0RA 1GKDA 3USNA 3B2ZA 3LUNA 1ZP5A 1KUIA 2PJTA 2OXWA 1CXVA 1CGLA 1OMJA 2XS3A 1C7KA 1L6JA 4WZVA 1KUGA 5D1SA 2Y6DA 2W14A 3WV2A 1Y93A 5D2BA 4WKEA 1BUDA 4WKIA 1MMPA 1I73A 1ZTQA 2E3XA 2YIGA 3TT4A 2OXZA 1B3DA 1K7QA 3F16A 4HMAA 3LEAA 4ON1A 3LMCA 1CIZA 1ND1A 1UMSA 4A3WA 4CTHA 5L79A 3F18A 5I4OA 1PWQA 2QPJA 4IJOA 1XUCA 5D7WA 4PKUA 4PKWA 1KUFA 3EHYA 1GE6A 4J4MA 1CQRA 1HY7A 1JK3A 2DW1A 3HB2P 3LUMA 2RJQA 3KMCA 2KRJA 1ROSA 1PWPA 1HOVA 1EB6A 1YCMA 1FBLA 3L0TA 3N2VA 4GUYA 1SATA 4EFSA 830CA 4IN9A 2OY2A 3KMEA 2WO9A 3F19A 1MMRA 5D1TA 1I1IP 3Q2HA 3Q2GA 1BKCI 4GR0A 4IUWA 2DW2A 1C8TA 2K2GA 3P1VA 1IABA 3DWBA 5LABA 2ERQA 1A85A 1ZVXA 1JAPA 1QJJA 1D8FA 1BQOA 3K7NA 4FU4A 3LIRA 1BUVM 2Y6CA 1MMBA 5JMYA 3L0VA 2X3CA 3HBVP 3HDBA 3LQBA 1C3IA 2JT5A 2W0DA 1G9KA 1YQYA 2ERPA 3BA0A 2DDFA 4L63A 3TSKA 3DTKA 1BM6A 2YUFA 1J7NA 3SHIA 4AUOA 3ZUKA 3EDGA 2X3BA 1BIWA 3LE9A 1USNA 1HFSA 3F17A 1XFXA 2RJPA 2W15A 3LILA 1JAOA 2D1NA 1XUDA 3LKAA 4GR3A 4L6TA 1SU3A 1IAGA 1Z3JA 4FXYP 3B92A 3VTGA 4GF1A 4ZR5A 3DSLA 2CKIA 1B8YA 2OVZA 1ZXVA 3AIGA 4JQGA 3E8RA 1EUBA 3KWVC 1EAKA 3EWJA 1QJIA 2MZHA 4WK7A 2AYKA 3HDAP 4H84A 2POJA 5I2ZA 2XS4A 1ASTA 1XURA 3LGPA 5I3MA 1AF0A 4H49A 1K7IA 3DPFA 1OM6A 4JA1A 1BKCA 1OM8A 2W12A 3O64A 2DDYA 2EROA 2J83A 1JIWP 2JIHA 1R1IA 3RTSA 4HX3A 2X3AA 1XFZA 1WNIA 1S4BP 1RM8A 1MNCA 2WO8A 5BOTA 3I7GA 4XM6A 4JIJA 2JSDA 1Q3AA 4G9LA 1G05A 3TVCA 2JNPA 3GBOA 4H82A 3KEJA 5CZMA 4L19A 3KRYA 1SLNA 4GR8A 3NX7A 4XM8A 3LJTA 1IACA 2MZEA 1JANA 1BKCE 1Y8JA 2DW0A 4XBHA 4A7BA 5L7FA 1CGFA 1JJ9A 1CK7A 3LIKA 1HV5A 3TS4A 2OW2A 1ATLA 3DTIA 3HBUP 3VI1A 1O0QA 2OXUA 1QIBA 3LQ0A 1XFVA 4PKQA 2MLRA 3F1AA 4H2EA 3HY7A 4Q1LA 4DD8A 2OY4A 4JP4A 1QUAA 1OS2A 1OO9A 4DV8A 2O3EA 1YP1A 1IADA 4DPEA 2A8HA 5I43A 4L7AA 3F15A 2MZIA 1O0TA 2AIGP 1G4KA 4XCTA 2N8RA 3O2XA 1R1JA 4H76A 1AKLA 1RMZA 2W13A 1G12A 1R54A 5B5OA 3EHXA 5I12A 1GO8P 2X7MA 1PWUA 4JPAA 4PKTA 1KUKA 1Y0VA 1MMQA 1ZXCA 4GWMA 2K9CA 3LJGA 2YB9A 2TCLA 1R55A 1BSWA 1D8MA 1D7XA 1CGEA 2OW9A 4PKSA 1A86A 3N2UA 3LK8A 1SRPA 3P24A 1DTHA 4H3XA 3KHIA 3ZXHA 1OM7A 1SMPA 3UVCA 5BOYA 3KECA 2USNA 1JH1A 1XFYA 1KUHA 2O36A 3EDIA 2FV9A 1PWVA 1CAQA 3I7IA 5D3CA 2MLSA 966CA 1IAEA 2E2DA 2OI0A 3ZVSA 5H8XA 1K7GA 1UMTA 4PKRA 4FXQA 1DMTA 3AYKA 5BPAA 1I76A 1R1HA 4G0DA 4XM7A 4QKZA 3V96B 1QIAA 1UTZA 5I0LA 2D1OA 1GKCA 1H71P 2OVXA 4WF6A 3RTTA 2J0TA 1JAQA 1BZSA 3HY9A 5D1UA 3DPEA 3DL1A 1GXDA 4AXQA 4I03A 3KEKA 3K7LA 3CKIA 1YOUA 1KAPP 5B5PA 4PKVA 3OHLA 2OW1A 2SRTA 3U1RA 2OW0A 2WOAA 2V4BA 3DNGA 1JKYA 3G42A 1HFCA 4DF9A 2CLTA 5CXAA 3B8ZA 4AYKA 3OHOA 1OS9A 3AYUA 4I35A 1UTTA 5CUHA 4FVLA 1GE5A 2FV5A 1FM1A 1GE7A 4GWNA 3G5CA 1UEAA 3HYGA 2JT6A 3WV1A 3EDHA 1IAAA 4H30A 1QICA 1AYKA 4ILWD 1D5JA 2Z2DA 2I47A 3EDZA 1JIZA 1ZS0A 4GQLA 4H1QA 3LJZA 3WV3A 2OZRA 4AIGA 1PWWA 2HU6A 1G49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SLM A;  1XFU A;  1FLS A;  1BQQ M;  1HTD A;  1GO7 P;  3MA2 A;  3ELM A;  4R3V A;  1KBC A;  456C A;  1XFW A;  2L0R A;  1GKD A;  3USN A;  3B2Z A;  3LUN A;  1ZP5 A;  1KUI A;  2PJT A;  2OXW A;  1CXV A;  1CGL A;  1OMJ A;  2XS3 A;  1C7K A;  1L6J A;  4WZV A;  1KUG A;  5D1S A;  2Y6D A;  2W14 A;  3WV2 A;  1Y93 A;  5D2B A;  4WKE A;  1BUD A;  4WKI A;  1MMP A;  1I73 A;  1ZTQ A;  2E3X A;  2YIG A;  3TT4 A;  2OXZ A;  1B3D A;  1K7Q A;  3F16 A;  4HMA A;  3LEA A;  4ON1 A;  3LMC A;  1CIZ A;  1ND1 A;  1UMS A;  4A3W A;  4CTH A;  5L79 A;  3F18 A;  5I4O A;  1PWQ A;  2QPJ A;  4IJO A;  1XUC A;  5D7W A;  4PKU A;  4PKW A;  1KUF A;  3EHY A;  1GE6 A;  4J4M A;  1CQR A;  1HY7 A;  1JK3 A;  2DW1 A;  3HB2 P;  3LUM A;  2RJQ A;  3KMC A;  2KRJ A;  1ROS A;  1PWP A;  1HOV A;  1EB6 A;  1YCM A;  1FBL A;  3L0T A;  3N2V A;  4GUY A;  1SAT A;  4EFS A;  830C A;  4IN9 A;  2OY2 A;  3KME A;  2WO9 A;  3F19 A;  1MMR A;  5D1T A;  1I1I P;  3Q2H A;  3Q2G A;  1BKC I;  4GR0 A;  4IUW A;  2DW2 A;  1C8T A;  2K2G A;  3P1V A;  1IAB A;  3DWB A;  5LAB A;  2ERQ A;  1A85 A;  1ZVX A;  1JAP A;  1QJJ A;  1D8F A;  1BQO A;  3K7N A;  4FU4 A;  3LIR A;  1BUV M;  2Y6C A;  1MMB A;  5JMY A;  3L0V A;  2X3C A;  3HBV P;  3HDB A;  3LQB A;  1C3I A;  2JT5 A;  2W0D A;  1G9K A;  1YQY A;  2ERP A;  3BA0 A;  2DDF A;  4L63 A;  3TSK A;  1BM6 A;  1J7N A;  3SHI A;  4AUO A;  3ZUK A;  3EDG A;  2X3B A;  1BIW A;  3LE9 A;  1USN A;  1HFS A;  3F17 A;  1XFX A;  2RJP A;  2W15 A;  3LIL A;  1JAO A;  2D1N A;  1XUD A;  3LKA A;  4GR3 A;  4L6T A;  1SU3 A;  1IAG A;  1Z3J A;  4FXY P;  3B92 A;  3VTG A;  4GF1 A;  4ZR5 A;  3DSL A;  2CKI A;  1B8Y A;  2OVZ A;  1ZXV A;  3AIG A;  4JQG A;  3E8R A;  1EUB A;  3KWV C;  1EAK A;  3EWJ A;  1QJI A;  2MZH A;  4WK7 A;  2AYK A;  3HDA P;  4H84 A;  2POJ A;  5I2Z A;  2XS4 A;  1AST A;  1XUR A;  3LGP A;  5I3M A;  1AF0 A;  4H49 A;  1K7I A;  3DPF A;  1OM6 A;  4JA1 A;  1BKC A;  1OM8 A;  2W12 A;  3O64 A;  2DDY A;  2ERO A;  2J83 A;  1JIW P;  2JIH A;  1R1I A;  3RTS A;  4HX3 A;  2X3A A;  1XFZ A;  1WNI A;  1S4B P;  1RM8 A;  1MNC A;  2WO8 A;  5BOT A;  3I7G A;  4XM6 A;  4JIJ A;  2JSD A;  1Q3A A;  4G9L A;  1G05 A;  3TVC A;  2JNP A;  3GBO A;  4H82 A;  3KEJ A;  5CZM A;  4L19 A;  3KRY A;  1SLN A;  4GR8 A;  3NX7 A;  4XM8 A;  3LJT A;  1IAC A;  2MZE A;  1JAN A;  1BKC E;  1Y8J A;  2DW0 A;  4XBH A;  4A7B A;  5L7F A;  1CGF A;  1JJ9 A;  1CK7 A;  3LIK A;  1HV5 A;  3TS4 A;  2OW2 A;  1ATL A;  3HBU P;  3VI1 A;  1O0Q A;  2OXU A;  1QIB A;  3LQ0 A;  1XFV A;  4PKQ A;  2MLR A;  3F1A A;  4H2E A;  3HY7 A;  4Q1L A;  4DD8 A;  2OY4 A;  4JP4 A;  1QUA A;  1OS2 A;  1OO9 A;  4DV8 A;  2O3E A;  1YP1 A;  1IAD A;  4DPE A;  2A8H A;  5I43 A;  3F15 A;  2MZI A;  1O0T A;  2AIG P;  1G4K A;  4XCT A;  2N8R A;  3O2X A;  1R1J A;  4H76 A;  1AKL A;  1RMZ A;  2W13 A;  1G12 A;  1R54 A;  5B5O A;  3EHX A;  5I12 A;  1GO8 P;  2X7M A;  1PWU A;  4JPA A;  4PKT A;  1KUK A;  1Y0V A;  1MMQ A;  1ZXC A;  4GWM A;  2K9C A;  3LJG A;  2YB9 A;  2TCL A;  1R55 A;  1BSW A;  1D8M A;  1D7X A;  1CGE A;  2OW9 A;  4PKS A;  1A86 A;  3N2U A;  3LK8 A;  1SRP A;  3P24 A;  1DTH A;  4H3X A;  3KHI A;  3ZXH A;  1OM7 A;  1SMP A;  3UVC A;  5BOY A;  3KEC A;  2USN A;  1JH1 A;  1XFY A;  1KUH A;  2O36 A;  3EDI A;  2FV9 A;  1PWV A;  1CAQ A;  3I7I A;  5D3C A;  2MLS A;  966C A;  1IAE A;  2E2D A;  2OI0 A;  3ZVS A;  5H8X A;  1K7G A;  1UMT A;  4PKR A;  4FXQ A;  1DMT A;  3AYK A;  5BPA A;  1I76 A;  1R1H A;  4G0D A;  4XM7 A;  4QKZ A;  3V96 B;  1QIA A;  1UTZ A;  5I0L A;  2D1O A;  1GKC A;  1H71 P;  2OVX A;  4WF6 A;  3RTT A;  2J0T A;  1JAQ A;  1BZS A;  3HY9 A;  5D1U A;  3DPE A;  3DL1 A;  1GXD A;  4AXQ A;  4I03 A;  3KEK A;  3K7L A;  3CKI A;  1YOU A;  1KAP P;  5B5P A;  4PKV A;  3OHL A;  2OW1 A;  2SRT A;  3U1R A;  2OW0 A;  2WOA A;  2V4B A;  3DNG A;  1JKY A;  3G42 A;  1HFC A;  4DF9 A;  2CLT A;  5CXA A;  3B8Z A;  4AYK A;  3OHO A;  1OS9 A;  3AYU A;  4I35 A;  1UTT A;  5CUH A;  4FVL A;  1GE5 A;  2FV5 A;  1FM1 A;  1GE7 A;  4GWN A;  3G5C A;  1UEA A;  3HYG A;  2JT6 A;  3WV1 A;  3EDH A;  1IAA A;  4H30 A;  1QIC A;  1AYK A;  4ILW D;  1D5J A;  2Z2D A;  2I47 A;  3EDZ A;  1JIZ A;  1ZS0 A;  4GQL A;  4H1Q A;  3LJZ A;  3WV3 A;  2OZR A;  4AIG A;  1PWW A;  2HU6 A;  1G49 A; 
#chains in the Genus database with same CATH topology
 1SLM A;  1XFU A;  1FLS A;  1BQQ M;  1HTD A;  1GO7 P;  3MA2 A;  3ELM A;  4R3V A;  1KBC A;  3DTE A;  456C A;  1XFW A;  2L0R A;  1GKD A;  3USN A;  3B2Z A;  3LUN A;  1ZP5 A;  1KUI A;  2PJT A;  2OXW A;  1CXV A;  1CGL A;  1OMJ A;  2XS3 A;  1XM5 A;  1C7K A;  1L6J A;  4WZV A;  1KUG A;  5D1S A;  2Y6D A;  2W14 A;  3WV2 A;  1Y93 A;  5D2B A;  4WKE A;  1BUD A;  4WKI A;  1MMP A;  1I73 A;  1ZTQ A;  2E3X A;  2YIG A;  3TT4 A;  2OXZ A;  1B3D A;  1K7Q A;  3F16 A;  4HMA A;  3LEA A;  4ON1 A;  3LMC A;  1CIZ A;  1ND1 A;  1UMS A;  4A3W A;  4CTH A;  5L79 A;  3F18 A;  5I4O A;  1PWQ A;  2QPJ A;  4IJO A;  1XUC A;  5D7W A;  4PKU A;  4PKW A;  1KUF A;  3EHY A;  1GE6 A;  4J4M A;  1CQR A;  1HY7 A;  1JK3 A;  2DW1 A;  3HB2 P;  3LUM A;  2RJQ A;  3KMC A;  2KRJ A;  1ROS A;  1PWP A;  1HOV A;  1EB6 A;  1YCM A;  1FBL A;  3L0T A;  3N2V A;  4GUY A;  1SAT A;  4EFS A;  830C A;  4IN9 A;  2OY2 A;  3KME A;  2WO9 A;  3F19 A;  1MMR A;  5D1T A;  1I1I P;  3Q2H A;  3Q2G A;  1BKC I;  4GR0 A;  4IUW A;  2DW2 A;  1C8T A;  2K2G A;  3P1V A;  1IAB A;  3DWB A;  5LAB A;  2ERQ A;  1A85 A;  1ZVX A;  1JAP A;  1QJJ A;  1D8F A;  1BQO A;  3K7N A;  4FU4 A;  3LIR A;  1BUV M;  2Y6C A;  1MMB A;  5JMY A;  3L0V A;  2X3C A;  3HBV P;  3HDB A;  3LQB A;  1C3I A;  2JT5 A;  2W0D A;  1G9K A;  1YQY A;  2ERP A;  3BA0 A;  2DDF A;  4L63 A;  3TSK A;  3DTK A;  1BM6 A;  2YUF A;  1J7N A;  3SHI A;  4AUO A;  3ZUK A;  3EDG A;  2X3B A;  1BIW A;  3LE9 A;  1USN A;  1HFS A;  3F17 A;  1XFX A;  2RJP A;  2W15 A;  3LIL A;  1JAO A;  2D1N A;  1XUD A;  3LKA A;  4GR3 A;  4L6T A;  1SU3 A;  1IAG A;  1Z3J A;  4FXY P;  3B92 A;  3VTG A;  4GF1 A;  4ZR5 A;  3DSL A;  2CKI A;  1B8Y A;  2OVZ A;  1ZXV A;  3AIG A;  4JQG A;  3E8R A;  1EUB A;  3KWV C;  1EAK A;  3EWJ A;  1QJI A;  2MZH A;  4WK7 A;  2AYK A;  3HDA P;  4H84 A;  2POJ A;  5I2Z A;  2XS4 A;  1AST A;  1XUR A;  3LGP A;  5I3M A;  1AF0 A;  4H49 A;  1K7I A;  3DPF A;  1OM6 A;  4JA1 A;  1BKC A;  1OM8 A;  2W12 A;  3O64 A;  2DDY A;  2ERO A;  2J83 A;  1JIW P;  2JIH A;  1R1I A;  1XAX A;  3RTS A;  4HX3 A;  2X3A A;  1XFZ A;  1WNI A;  1S4B P;  1RM8 A;  1MNC A;  2WO8 A;  5BOT A;  3I7G A;  4XM6 A;  4JIJ A;  2JSD A;  1Q3A A;  4G9L A;  1G05 A;  3TVC A;  2JNP A;  3GBO A;  4H82 A;  3KEJ A;  5CZM A;  4L19 A;  3KRY A;  1SLN A;  4GR8 A;  3NX7 A;  4XM8 A;  3LJT A;  1IAC A;  2MZE A;  1JAN A;  1BKC E;  1Y8J A;  2DW0 A;  4XBH A;  4A7B A;  5L7F A;  1CGF A;  1JJ9 A;  1CK7 A;  3LIK A;  1HV5 A;  3TS4 A;  2OW2 A;  1ATL A;  3DTI A;  3HBU P;  3VI1 A;  1O0Q A;  1OZ9 A;  2OXU A;  1QIB A;  3LQ0 A;  1XFV A;  4PKQ A;  2MLR A;  3F1A A;  4H2E A;  3HY7 A;  4Q1L A;  4DD8 A;  2OY4 A;  4JP4 A;  1QUA A;  1OS2 A;  1OO9 A;  4DV8 A;  2O3E A;  1YP1 A;  1IAD A;  4DPE A;  2A8H A;  5I43 A;  4L7A A;  3F15 A;  2MZI A;  1O0T A;  2AIG P;  1G4K A;  4XCT A;  2N8R A;  3O2X A;  1R1J A;  4H76 A;  1AKL A;  1RMZ A;  2W13 A;  1G12 A;  1R54 A;  5B5O A;  3EHX A;  5I12 A;  1GO8 P;  2X7M A;  1PWU A;  4JPA A;  4PKT A;  1KUK A;  1Y0V A;  1MMQ A;  1ZXC A;  4GWM A;  2K9C A;  3LJG A;  2YB9 A;  2TCL A;  1R55 A;  1BSW A;  1D8M A;  1D7X A;  1CGE A;  2OW9 A;  4PKS A;  1A86 A;  3N2U A;  3LK8 A;  1SRP A;  3P24 A;  1DTH A;  4H3X A;  3KHI A;  3ZXH A;  1OM7 A;  1SMP A;  3UVC A;  5BOY A;  3KEC A;  2USN A;  1JH1 A;  1XFY A;  1KUH A;  2O36 A;  3EDI A;  2FV9 A;  1PWV A;  1CAQ A;  3I7I A;  5D3C A;  2MLS A;  966C A;  1IAE A;  2E2D A;  2OI0 A;  3ZVS A;  5H8X A;  1K7G A;  1UMT A;  4PKR A;  4FXQ A;  1DMT A;  3AYK A;  5BPA A;  1I76 A;  1R1H A;  4G0D A;  4XM7 A;  4QKZ A;  3V96 B;  1QIA A;  1UTZ A;  5I0L A;  2D1O A;  1GKC A;  1H71 P;  2OVX A;  4WF6 A;  3RTT A;  2J0T A;  1JAQ A;  1BZS A;  3HY9 A;  5D1U A;  3DPE A;  3DL1 A;  1GXD A;  4AXQ A;  4I03 A;  3KEK A;  3K7L A;  3CKI A;  1YOU A;  1KAP P;  5B5P A;  4PKV A;  3OHL A;  2OW1 A;  2SRT A;  3U1R A;  2OW0 A;  2WOA A;  2V4B A;  3DNG A;  1TVI A;  1JKY A;  3G42 A;  1HFC A;  4DF9 A;  2CLT A;  5CXA A;  3B8Z A;  4AYK A;  3OHO A;  1OS9 A;  3AYU A;  4I35 A;  1UTT A;  5CUH A;  4FVL A;  1GE5 A;  2FV5 A;  1FM1 A;  1GE7 A;  4GWN A;  3G5C A;  1UEA A;  3HYG A;  2JT6 A;  3WV1 A;  3EDH A;  1IAA A;  4H30 A;  1QIC A;  1AYK A;  4ILW D;  1D5J A;  2Z2D A;  2I47 A;  3EDZ A;  1JIZ A;  1ZS0 A;  4GQL A;  4H1Q A;  3LJZ A;  3WV3 A;  2OZR A;  4AIG A;  1PWW A;  2HU6 A;  1G49 A; 
#chains in the Genus database with same CATH homology
 1SLM A;  1XFU A;  1FLS A;  1BQQ M;  1HTD A;  1GO7 P;  3MA2 A;  3ELM A;  4R3V A;  1KBC A;  3DTE A;  456C A;  1XFW A;  2L0R A;  1GKD A;  3USN A;  3B2Z A;  3LUN A;  1ZP5 A;  1KUI A;  2PJT A;  2OXW A;  1CXV A;  1CGL A;  1OMJ A;  2XS3 A;  1C7K A;  1L6J A;  4WZV A;  1KUG A;  5D1S A;  2Y6D A;  2W14 A;  3WV2 A;  1Y93 A;  5D2B A;  4WKE A;  1BUD A;  4WKI A;  1MMP A;  1I73 A;  1ZTQ A;  2E3X A;  2YIG A;  3TT4 A;  2OXZ A;  1B3D A;  1K7Q A;  3F16 A;  4HMA A;  3LEA A;  4ON1 A;  3LMC A;  1CIZ A;  1ND1 A;  1UMS A;  4A3W A;  4CTH A;  5L79 A;  3F18 A;  5I4O A;  1PWQ A;  2QPJ A;  4IJO A;  1XUC A;  5D7W A;  4PKU A;  4PKW A;  1KUF A;  3EHY A;  1GE6 A;  4J4M A;  1CQR A;  1HY7 A;  1JK3 A;  2DW1 A;  3HB2 P;  3LUM A;  2RJQ A;  3KMC A;  2KRJ A;  1ROS A;  1PWP A;  1HOV A;  1EB6 A;  1YCM A;  1FBL A;  3L0T A;  3N2V A;  4GUY A;  1SAT A;  4EFS A;  830C A;  4IN9 A;  2OY2 A;  3KME A;  2WO9 A;  3F19 A;  1MMR A;  5D1T A;  1I1I P;  3Q2H A;  3Q2G A;  1BKC I;  4GR0 A;  4IUW A;  2DW2 A;  1C8T A;  2K2G A;  3P1V A;  1IAB A;  3DWB A;  5LAB A;  2ERQ A;  1A85 A;  1ZVX A;  1JAP A;  1QJJ A;  1D8F A;  1BQO A;  3K7N A;  4FU4 A;  3LIR A;  1BUV M;  2Y6C A;  1MMB A;  5JMY A;  3L0V A;  2X3C A;  3HBV P;  3HDB A;  3LQB A;  1C3I A;  2JT5 A;  2W0D A;  1G9K A;  1YQY A;  2ERP A;  3BA0 A;  2DDF A;  4L63 A;  3TSK A;  3DTK A;  1BM6 A;  2YUF A;  1J7N A;  3SHI A;  4AUO A;  3ZUK A;  3EDG A;  2X3B A;  1BIW A;  3LE9 A;  1USN A;  1HFS A;  3F17 A;  1XFX A;  2RJP A;  2W15 A;  3LIL A;  1JAO A;  2D1N A;  1XUD A;  3LKA A;  4GR3 A;  4L6T A;  1SU3 A;  1IAG A;  1Z3J A;  4FXY P;  3B92 A;  3VTG A;  4GF1 A;  4ZR5 A;  3DSL A;  2CKI A;  1B8Y A;  2OVZ A;  1ZXV A;  3AIG A;  4JQG A;  3E8R A;  1EUB A;  3KWV C;  1EAK A;  3EWJ A;  1QJI A;  2MZH A;  4WK7 A;  2AYK A;  3HDA P;  4H84 A;  2POJ A;  5I2Z A;  2XS4 A;  1AST A;  1XUR A;  3LGP A;  5I3M A;  1AF0 A;  4H49 A;  1K7I A;  3DPF A;  1OM6 A;  4JA1 A;  1BKC A;  1OM8 A;  2W12 A;  3O64 A;  2DDY A;  2ERO A;  2J83 A;  1JIW P;  2JIH A;  1R1I A;  3RTS A;  4HX3 A;  2X3A A;  1XFZ A;  1WNI A;  1S4B P;  1RM8 A;  1MNC A;  2WO8 A;  5BOT A;  3I7G A;  4XM6 A;  4JIJ A;  2JSD A;  1Q3A A;  4G9L A;  1G05 A;  3TVC A;  2JNP A;  3GBO A;  4H82 A;  3KEJ A;  5CZM A;  4L19 A;  3KRY A;  1SLN A;  4GR8 A;  3NX7 A;  4XM8 A;  3LJT A;  1IAC A;  2MZE A;  1JAN A;  1BKC E;  1Y8J A;  2DW0 A;  4XBH A;  4A7B A;  5L7F A;  1CGF A;  1JJ9 A;  1CK7 A;  3LIK A;  1HV5 A;  3TS4 A;  2OW2 A;  1ATL A;  3DTI A;  3HBU P;  3VI1 A;  1O0Q A;  2OXU A;  1QIB A;  3LQ0 A;  1XFV A;  4PKQ A;  2MLR A;  3F1A A;  4H2E A;  3HY7 A;  4Q1L A;  4DD8 A;  2OY4 A;  4JP4 A;  1QUA A;  1OS2 A;  1OO9 A;  4DV8 A;  2O3E A;  1YP1 A;  1IAD A;  4DPE A;  2A8H A;  5I43 A;  4L7A A;  3F15 A;  2MZI A;  1O0T A;  2AIG P;  1G4K A;  4XCT A;  2N8R A;  3O2X A;  1R1J A;  4H76 A;  1AKL A;  1RMZ A;  2W13 A;  1G12 A;  1R54 A;  5B5O A;  3EHX A;  5I12 A;  1GO8 P;  2X7M A;  1PWU A;  4JPA A;  4PKT A;  1KUK A;  1Y0V A;  1MMQ A;  1ZXC A;  4GWM A;  2K9C A;  3LJG A;  2YB9 A;  2TCL A;  1R55 A;  1BSW A;  1D8M A;  1D7X A;  1CGE A;  2OW9 A;  4PKS A;  1A86 A;  3N2U A;  3LK8 A;  1SRP A;  3P24 A;  1DTH A;  4H3X A;  3KHI A;  3ZXH A;  1OM7 A;  1SMP A;  3UVC A;  5BOY A;  3KEC A;  2USN A;  1JH1 A;  1XFY A;  1KUH A;  2O36 A;  3EDI A;  2FV9 A;  1PWV A;  1CAQ A;  3I7I A;  5D3C A;  2MLS A;  966C A;  1IAE A;  2E2D A;  2OI0 A;  3ZVS A;  5H8X A;  1K7G A;  1UMT A;  4PKR A;  4FXQ A;  1DMT A;  3AYK A;  5BPA A;  1I76 A;  1R1H A;  4G0D A;  4XM7 A;  4QKZ A;  3V96 B;  1QIA A;  1UTZ A;  5I0L A;  2D1O A;  1GKC A;  1H71 P;  2OVX A;  4WF6 A;  3RTT A;  2J0T A;  1JAQ A;  1BZS A;  3HY9 A;  5D1U A;  3DPE A;  3DL1 A;  1GXD A;  4AXQ A;  4I03 A;  3KEK A;  3K7L A;  3CKI A;  1YOU A;  1KAP P;  5B5P A;  4PKV A;  3OHL A;  2OW1 A;  2SRT A;  3U1R A;  2OW0 A;  2WOA A;  2V4B A;  3DNG A;  1JKY A;  3G42 A;  1HFC A;  4DF9 A;  2CLT A;  5CXA A;  3B8Z A;  4AYK A;  3OHO A;  1OS9 A;  3AYU A;  4I35 A;  1UTT A;  5CUH A;  4FVL A;  1GE5 A;  2FV5 A;  1FM1 A;  1GE7 A;  4GWN A;  3G5C A;  1UEA A;  3HYG A;  2JT6 A;  3WV1 A;  3EDH A;  1IAA A;  4H30 A;  1QIC A;  1AYK A;  4ILW D;  1D5J A;  2Z2D A;  2I47 A;  3EDZ A;  1JIZ A;  1ZS0 A;  4GQL A;  4H1Q A;  3LJZ A;  3WV3 A;  2OZR A;  4AIG A;  1PWW A;  2HU6 A;  1G49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...