3ZXNA

Moorella thermoacetica rsbs s58e
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
118
structure length
117
Chain Sequence
SRVPILKVDDYWVVAIEETLDQSVIQFKEELLHNITGVAGKGLVIDISALEVVDEFVTRVLIEISRLAELLGLPFVLTGIKPAVAITLTEMGLDLRGMATALNLQKGLDKLKNLARM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-SIGMA-FACTOR ANTAGONIST (STAS) DOMAIN PROTEIN
publication title The Bacterial Stressosome: A Modular System that Has Been Adapted to Control Secondary Messenger Signaling.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Transcription
total genus 36
structure length 117
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3zxnA00
5EUSA 1SBOA 2KLNA 3LKLA 2KA5A 4HYLA 4DGFA 3ZTBA 5EUXA 2VY9A 4DGHA 3MGLA 3IF5A 1TIDB 3ZXNA 3OIRA 4XS5A 1H4ZA 3IH8A 3IHBA 5EUWA 3T6OA 3IH9A 5EUZA 1TH8B 1BUZA 5EUUA 5EZBA 1H4YA 4QTPA 1T6RA 1H4XA 1VC1A 1TILB 1THNB 1AUZA 3AGDA 3AGEA 3F43A 3LLOA 3NY7A 3OIZA 3IHAA
chains in the Genus database with same CATH superfamily
1SBOA 1K32A 2DXNA 4DMGA 5EUXA 4AE2A 3IF5A 1TIDB 3IHBA 1FC6A 1FCFA 3D03A 3C0KA 1J7XA 4HIZA 1T6RA 3DJAA 1H4XA 1VC1A 1TILB 1V0EA 3NY7A 4L1CA 1N6EA 1N6FA 1FC9A 3LKLA 2ZOAA 3D3UA 1WXXA 3V8VA 1FC7A 3K50A 3T6OA 2CWWA 5EUUA 3GK7A 4L8KA 3AGDA 3OIZA 4AEJA 2B78A 5EUSA 2KLNA 4HYLA 3ZTBA 2VY9A 3V97A 3OIRA 3GVKA 4XS5A 1H4ZA 3IH8A 2RRLA 3GVJA 5EUZA 1BUZA 3JU4A 2ZO9B 1H4YA 4QTPA 2DXLA 3DORA 1N6DA 3MOGA 1AUZA 1THNB 3AGEA 3F43A 3QDQA 3LLOA 3GMFA 1WXWA 2KA5A 4DGFA 4DGHA 3MGLA 3ZXNA 3EH7A 4GHNA 1BPLA 3DUPA 5EUWA 3IH9A 1V0FA 1TH8B 3GVLA 5EZBA 2AS0A 3GHFA 1HF2A 3VSEA 4JC0A 3IHAA 2OASA 3LDFA
chains in the Genus database with same CATH topology
5EUSA 1SBOA 2KLNA 3LKLA 2KA5A 4HYLA 4DGFA 3ZTBA 5EUXA 2VY9A 4DGHA 3MGLA 3IF5A 1TIDB 3ZXNA 3OIRA 4XS5A 1H4ZA 3IH8A 3IHBA 5EUWA 3T6OA 3IH9A 5EUZA 1TH8B 1BUZA 5EUUA 5EZBA 1H4YA 4QTPA 1T6RA 1H4XA 1VC1A 1TILB 1THNB 1AUZA 3AGDA 3AGEA 3F43A 3LLOA 3NY7A 3OIZA 3IHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EUS A;  1SBO A;  2KLN A;  3LKL A;  2KA5 A;  4HYL A;  4DGF A;  3ZTB A;  5EUX A;  2VY9 A;  4DGH A;  3MGL A;  3IF5 A;  1TID B;  3ZXN A;  3OIR A;  4XS5 A;  1H4Z A;  3IH8 A;  3IHB A;  5EUW A;  3T6O A;  3IH9 A;  5EUZ A;  1TH8 B;  1BUZ A;  5EUU A;  5EZB A;  1H4Y A;  4QTP A;  1T6R A;  1H4X A;  1VC1 A;  1TIL B;  1THN B;  1AUZ A;  3AGD A;  3AGE A;  3F43 A;  3LLO A;  3NY7 A;  3OIZ A;  3IHA A; 
#chains in the Genus database with same CATH topology
 1SBO A;  1K32 A;  2DXN A;  4DMG A;  5EUX A;  4AE2 A;  3IF5 A;  1TID B;  3IHB A;  1FC6 A;  1FCF A;  3D03 A;  3C0K A;  1J7X A;  4HIZ A;  1T6R A;  3DJA A;  1H4X A;  1VC1 A;  1TIL B;  1V0E A;  3NY7 A;  4L1C A;  1N6E A;  1N6F A;  1FC9 A;  3LKL A;  2ZOA A;  3D3U A;  1WXX A;  3V8V A;  1FC7 A;  3K50 A;  3T6O A;  2CWW A;  5EUU A;  3GK7 A;  4L8K A;  3AGD A;  3OIZ A;  4AEJ A;  2B78 A;  5EUS A;  2KLN A;  4HYL A;  3ZTB A;  2VY9 A;  3V97 A;  3OIR A;  3GVK A;  4XS5 A;  1H4Z A;  3IH8 A;  2RRL A;  3GVJ A;  5EUZ A;  1BUZ A;  3JU4 A;  2ZO9 B;  1H4Y A;  4QTP A;  2DXL A;  3DOR A;  1N6D A;  3MOG A;  1AUZ A;  1THN B;  3AGE A;  3F43 A;  3QDQ A;  3LLO A;  3GMF A;  1WXW A;  2KA5 A;  4DGF A;  4DGH A;  3MGL A;  3ZXN A;  3EH7 A;  4GHN A;  1BPL A;  3DUP A;  5EUW A;  3IH9 A;  1V0F A;  1TH8 B;  3GVL A;  5EZB A;  2AS0 A;  3GHF A;  1HF2 A;  3VSE A;  4JC0 A;  3IHA A;  2OAS A;  3LDF A; 
#chains in the Genus database with same CATH homology
 5EUS A;  1SBO A;  2KLN A;  3LKL A;  2KA5 A;  4HYL A;  4DGF A;  3ZTB A;  5EUX A;  2VY9 A;  4DGH A;  3MGL A;  3IF5 A;  1TID B;  3ZXN A;  3OIR A;  4XS5 A;  1H4Z A;  3IH8 A;  3IHB A;  5EUW A;  3T6O A;  3IH9 A;  5EUZ A;  1TH8 B;  1BUZ A;  5EUU A;  5EZB A;  1H4Y A;  4QTP A;  1T6R A;  1H4X A;  1VC1 A;  1TIL B;  1THN B;  1AUZ A;  3AGD A;  3AGE A;  3F43 A;  3LLO A;  3NY7 A;  3OIZ A;  3IHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...