3ZXVA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
475
Chain Sequence
b'KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
molecule tags Ligase
source organism Mycobacterium tuberculosis
publication title Trisubstituted Imidazoles as Mycobacterium Tuberculosis Glutamine Synthetase Inhibitors.
pubmed doi rcsb
total genus 160
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 3zxvA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3zxvA02
2GLSA 2QC8A 4RF6A 5J99A 2LGSA 3FKYA 1FPYA 1SD0A 2CRKA 3B6RA 3JQ3A 1P52A 2WGSA 4Z9MA 2D3CA 1F1HA 3ZXRA 3L2DA 2D3AA 4GW0A 2OJWA 1QK1A 3NG0A 4BAXA 1HTQA 1HTOA 1QH4A 4GVZA 2BVCA 3JPZA 3M10A 4RF8A 4S0RA 4LNFA 4GVYA 1LGRA 1BG0A 3DREA 1CRKA 1P50A 1F52A 4LNNA 4LNIA 4LNOA 4Q2RA 4XYCA 4BG4A 3JU5A 1I0EA 3L2EA 1M15A 4ACFA 2J1QA 4RF9A 4RF7A 3JU6A 4BG4B 4GW2A 4BHLA 4HPPA 3L2EB 5J9AA 2WHIA 2UU7A 4S17A 4AM1A 4LNKA 1VRPA 1U6RA 3DRBA 1RL9A 1G0WA 3ZXVA 2D3BA
chains in the Genus database with same CATH superfamily
2FIFA 1NENB 2J0KA 3SR6A 5L95C 3DPDA 2BS3B 4OVUA 2LRWA 5JHAA 3P4QB 3TCAA 1V4GA 1BG0A 4RMAA 2JF5A 2RD0A 2KMAA 3AE4B 1I4RA 2WU2B 4RF9A 4FHJA 3I9V1 5J9AA 1PDXA 2L8JA 3NVYA 5DCNA 1WWTA 4OVVA 4ITKA 2D11A 3NJTA 2W9NA 3W9CB 1FXAA 1H8CA 1XLNA 2LVOA 5G5GA 2AEHA 3PV1A 3HVZA 1K52A 1BXTA 1YOVB 2A4ZA 5AZFA 3QWZB 1XT9B 1SB3C 4A6QA 2JQRB 1EU4A 2IDYA 2GWDA 2NTTA 1PGXA 1NVID 2NS5A 3UINB 1PFDA 4CO7A 4YSZB 2WXIA 3VR9B 4ZHOA 4HLEA 2KLCA 4HPPA 4WJNA 3MC9A 1JCKB 2HDEA 3AEEB 4BFRA 1ACCA 3BVGA 4MELA 1N61A 1Z2MA 1TY2A 1KJTA 4IWPA 3NVZA 1MJDA 3ALBA 2O2VB 4DBGA 3DHHC 1FFVA 2NTSA 1V9JA 3P42A 4FBJB 2UWQA 2JUOA 2AWTA 1UNSA 4BHLA 2DYMA 2LEKA 1FCCC 2DNFA 2WHIA 2JYTA 3ZNZB 4FADA 2KT7A 3N3KB 4RGMA 5TSSA 3SFDB 1TKGA 4C56C 3A9KB 4KDIC 3DBRI 3IXSA 1YN4A 1WGKA 2DAJA 1AYFA 5HG2A 4A8XC 4BKGA 3ZDMC 3Q8FA 2GBKA 5JZEB 3GE8C 4DWFA 2R2QA 1RFKA 2OHFA 1LQBA 2WLBA 4WURA 4HCNB 1E7VA 1JWMD 2NCNA 5CX3A 2YEPF 2CHWA 5EE1A 1WGYA 3M62B 4PYZA 2O6VB 3RNAC 1NYQA 3HM6X 4MGIE 4K81A 2WWZA 2M56B 1WRIA 2BYVE 2RDBC 1YJIA 3IT4B 1CMXB 1JRUA 4NJ6A 2KDEB 2GI9A 3RNGC 1P9DU 2GBNA 4HDOA 3AEBB 2Z8LA 1NI3A 3DOWA 4FJZA 4RM8A 1CZPA 1ET9A 3TMPB 4C4VB 2JXXA 1MG4A 2J0JA 4PS7A 2DZIA 2IJ0A 1T3QA 1I0EA 2GBMA 1UGMA 1SGHA 3VH3B 4ZYSA 2JYEA 2OJRA 1F2RC 4GSWA 1J7BA 1ENFA 3RUIB 1RAXA 2KJHB 1LGRA 1ZP0B 3P4PB 4OHJA 4ANVA 3RNCC 4PK1A 2LRUA 3PLUA 3GS2A 2JRIB 3NZUA 5I4DA 2ZW1A 5IP4D 3AE9B 1SJHD 4W9HA 3T3OA 2N9PC 1RFAA 3P63A 2KKCA 2X8XX 1V8CA 5T8IA 1WR6E 3Q14C 1XEEA 2ZCCA 3JU5A 5GMVA 2R61A 3DDCB 3OWEB 4XWWA 2M4NA 4MEMA 1ZGUB 2JSVX 2K0PA 4E74A 1KRHA 2HTME 2KWDA 3KUCB 1L6VA 3Q6BA 4OW0A 2RGFA 1EM7A 1OEYJ 2TSSA 4W9KA 3L54A 2BS4B 1CJEA 4C4VA 3MHSD 4ZOHC 1J19A 3AEAB 3DBLB 3RN9C 2WDQB 2RR9A 4CYEA 1SIJA 4IM0A 2IPKD 2PLPA 2KN5A 3APDA 2QJLA 1RLFA 4RF1A 4HXDA 1P0RA 1WH3A 2GMIC 2IO3B 1VRAB 2L52A 1C1YB 4S0RA 4C7YA 3KWVA 3PRPB 3KW5B 4GDLB 2HE7A 1T0SC 1VLBA 3L4PA 3NHEB 3LXFA 2BKRB 1E0ZA 1E8XA 2C7HA 3ZKJC 2UYZB 2IYDB 5E6JA 1AWDA 4GVZA 4URKA 1I35A 1IBXB 3SD5A 3CSFA 2BB5A 4M02A 4MSQB 4BG4A 2L00B 4US9A 1TTNA 2SEBD 1VRPA 3OJ3A 4KIKA 2WXJA 2N1WA 1UWXA 2MQJA 4WAAA 1E9MA 3ZNGC 1V86A 3C8YA 1R4MB 1YQ4B 1E7PB 2Z0EB 4DHJD 1EO6A 2GBJA 4GN1A 3B2FA 4ICVA 3N1ZC 3DVNV 1L2NA 4EKUA 4GVYA 3PGEA 1WGHA 1WX7A 1UUPA 4P1CC 4H2AA 3U8ZA 4L1BA 2LGYA 1BT0A 3FILA 1OQYA 3VUWA 1I4GA 2FUG1 2M0XA 1C4CA 4ANXA 1WXQA 3B6RA 5C1ZA 3AECB 2AYOB 2MX2A 5JHBA 2ZPNA 2LWPA 4AS1A 1ZDVA 4II2B 3W1SC 3UQBA 1FO4A 3NVVA 1TKYA 4PS3A 2VZKB 3GE3C 3KYDD 3LVVA 4M8MA 5BMHA 5D6JB 2YEPB 3N30A 1FPYA 2MP2B 4YXDB 1WIAA 1WR1A 3A9JB 4KV2A 4KZ0A 1FRDA 2NVUI 2V0GA 2G9HD 4RGOS 2K5PA 4FHKA 4L23A 1P7EA 3VDZA 4NNJB 1C77A 1T0QC 2W55A 4K3BA 4K3CA 2I1KA 2ASQA 1QOAA 2JX5A 1S3SG 1WM3A 3B1LX 1UBQA 2KTRB 1AN8A 3ZW3A 1UZXB 2Y5BB 3VQIA 5CHWA 1R8GA 5JH5C 5KHQA 5BMGA 1EF1A 2EELA 2Q5WD 3L2EB 3N9YC 2KAJA 3DHGC 4II3B 2WGSA 2IZVB 2NPTB 3VR8B 3QQ8B 3A4SC 2LGXA 2V4IB 2A5UA 3T3NA 3AE7B 5D94A 3R2IA 2J7QB 4BVUC 5BYSA 1B1ZA 1L0XB 3P4RB 4NQKE 1GJZA 4IUMB 1R7SA 3BWUD 2FE8A 4MSMB 5J18A 4WJQA 2HJ8A 4MGKE 4HVBA 1D5MC 5BO4B 2KHWB 1K50A 1MHHE 4PT5A 3K9PB 1QF6A 2D5GA 5FR6A 4G3XB 2BKFA 4ZRQA 3QAQA 2DX5B 3L17A 4LNKA 3HHMA 1U6RA 2ON8A 1A5RA 1N62A 1WMHB 3QC8B 1HTQA 3QK0A 3KWLA 2KN4A 2JZZA 3I63C 2IO2B 3KH0A 2FCMA 3Q2AC 1V81A 1L4ZB 2N7EA 4I6LB 4X57B 4RM9A 1EWYC 2D33A 1KFYB 1WYGA 1JW9D 1WF9A 3V3XA 3SHQA 1PUTA 1I42A 2BF8B 3BINA 2CJNA 4NZLB 1K53A 2MBQA 3RNBC 4BOZB 2ZVOA 4HWIB 3UIOB 1EWCA 1WGGA 2IBIB 2C60A 3I57A 2CHZA 2MP2A 2K1FA 3O65B 1QZEA 4FJYA 5IKCM 1KLUD 2RMMA 4GDKA 3A9JA 2MBBB 3DWMA 3A1QA 4LNNA 3W2DA 3RMKC 3IBEA 3Q3JA 2MJDA 4GXBA 4RFBA 3ECIA 3TEXA 3T9LA 2IY1B 3UQAA 3DHIC 1SE9A 1XLPA 3V62A 1OFFA 2BPSA 2LASA 2MHJA 1F1HA 2XK5A 4ZRIA 2D2QA 2FNJB 5IN7A 2JT4B 3P1MA 2KYWA 2B3AA 3TIXA 1WJNA 2Z0DB 5H8YE 2LFIA 1VR9A 1WX8A 5KHOA 3TEYA 1JRPA 2OOBB 3JW0X 2DENB 2QDFA 4REZA 2EKEC 2LHEA 4WH4A 2DAFA 3HK0A 2JWUA 2KDFB 2PW9A 1N63A 4LNOA 4GDLA 4JQWC 1P1AA 3Q3MC 4K1RB 4A9AA 3AE8B 4MT5A 4YWGG 4PS8A 2C7MB 2N0SB 1V1PB 1N60A 2C9WB 1GOZA 1YIWA 2KJ6A 4KVGB 1FRRA 3K9OB 2BWFA 2G4DB 3J9CA 1GC7A 3QCAA 2J53A 2MRPA 1FNUA 3QX1A 1RYJA 1IBXA 1L4DB 2DWQA 3DWGC 1IP9A 3CSTA 2B76B 2RDHA 1N6ZA 1T0YA 5IOIA 2JZ3B 3DVGX 3S2AA 1Y8RC 1KF6B 2PEAA 4JWSC 1P52A 3ENEA 1SF0A 2ZCBA 3NUHB 4DHJB 1H4RA 4AUQC 1HTOA 2BVCA 1J0GA 1HZ5A 1V6EA 2D10A 2AL6A 1QOFA 2LGIA 1LFDA 4HPMB 1MHXA 4MM3A 2MCNB 3NRZA 3H7SA 3U52E 2I2YA 4KSLC 4G50A 2LD9A 3WIMA 1JWUD 1E10A 3O13A 4W9CA 1NDDA 2OEDA 2ZNVB 4GB9A 3WAMA 4EUTA 2AQ2B 4I6NB 1JWAD 3VFKA 2KFJA 5L83A 3OG5A 2NBWB 3RZWC 2QSDA 2MLBA 2V3NA 3V05A 1EU3A 4G0NB 1HZ6A 4RF6A 2EKIA 2KMCA 4A55A 2MA9B 3HM3A 4FLHA 3VTVA 1ET6A 2WXMA 4KKIA 3VRBB 3A9KA 2KACA 2LXCA 1WGRA 1V2YA 3AI5A 4EEWA 3VTWA 4A90A 2BT6A 3JSVB 3E9SA 4L2YA 3VRAB 4IM3A 2WYQA 3ABVB 3PTFC 3M95A 1C3TA 1SE4A 1SEBD 4C80A 1E8WA 2IY0B 2LJ5A 3PPAA 4ASWC 3NY5A 3ZJTA 2WXOA 2CJOA 2LI5A 1D6EC 4ARIA 4W9JA 3PRZA 3IG8A 1WFYA 2NBUA 3R8BA 5HI1A 4M00A 2N9LA 4IC7B 1QLBB 1VZ7A 3SDLC 1L7YA 1OQQA 3U2SC 1F52A 4LLGM 4AP4C 2PPHA 5DPSA 2K39A 4AQ7A 2FCQA 4K7SA 3BYYB 1K8RB 2K25A 3GOEA 3FC4A 1D4BA 1NEKB 2Y5PA 2CRKA 3AEFB 4BOSC 2KX3A 1TGZB 4JPSA 3IG3A 1WXVA 4MDKE 1Q0WB 3H6NA 1ZUD2 3NZSA 5IO9A 3X0WA 1WZ0A 1CRKA 3IHPC 5CTRC 3PHXB 2PE9A 4YT0B 5EDSA 4MGYE 3GB1A 4S17A 1VJKA 2GOWA 5J99A 4KZCA 2IGDA 3ZGZA 1D3ZA 1I4HA 2XNAC 5JXVA 1FEHA 3A1QB 4P1BC 1TBEA 1UH6A 2KQ7A 3QJZA 4NAMA 5EE9A 1P3QU 4ZRPA 1R4MI 2CKHB 3ML8A 3BIID 3ZDTA 2N4FA 1WY8A 4ZYNA 2KDIA 1JQ4A 1N5WA 3MC8A 4WQOB 1XXGA 5CHFA 4TMAB 4WJOA 3WALA 4KDLB 2ACZB 2LZ6A 2K8CA 4KKJA 1C4AA 3V6EB 4BKTA 1TZ1A 4XWTA 2E3TA 4UDUC 3AM9A 4JWUC 1T0RC 1I4QA 3D32A 1OTRB 3AULA 1TT5B 1AARA 2DZJA 4OZBA 3HRDD 4N59A 1YN5A 2M17A 3APFA 2JZPA 3Q3NC 1P7FA 3NVWA 5C2TB 5LXIB 4ZRKA 4WAFA 2D3CA 2JY6A 1ZDXA 4BAXA 3CWIA 1C9FA 2PIAA 1E8YA 5E6OA 2YLMA 1WYWB 1SJED 1WM2A 2WP9B 4HKQA 5H92C 2WXNA 1V5OA 2BYFA 3MHZA 4HDQA 3H1UA 1GB4A 3DRBA 2GLSA 1RRBA 2REXA 3L08A 4EOYA 2ZW0A 4R3DA 2LGDA 3JPZA 4JX1C 2K22A 2FUHB 1OEYA 2C5LC 1LM8B 4YTPB 1P50A 1YN3A 1JWBD 5J2RA 5DPTA 2FBWB 4RGTA 2BYEA 2D3GA 4KX6B 2BTEA 1WSPA 2KC2A 5EE0A 2G3QB 2KFKB 3VHTC 3DVNU 2KOXA 2R2OA 4XC2A 2PJHA 4BBNF 1IGDA 2ZJDA 2MJ3A 2K3UA 4IOIE 2NMQA 1SE2A 2WXQA 3LVWA 2MWSB 3B9JA 3N20C 1KM7A 3ZVVA 3IG5A 2K9XA 4NY0A 1FIQA 4K7UA 1PQSA 5E6PA 2KNBA 1JWSD 2KDBA 2I1JA 1YJJA 2DLBA 3I5JC 2NPTA 1V80A 3VUYA 1X1MA 3PZDA 1V5TA 3LJ3A 1R4NI 5C23A 4HJGE 1NYRA 1XCTL 4JLCA 2BWES 2KFKA 2KVRA 1S1QB 2MJEA 2DHZA 3SU8X 1FCLA 1UELA 2KQSA 2HJ1A 3VUXA 4ANWA 1FNWA 4EZJA 3RNFC 1E7UA 4NJ7A 2K6DB 4W9LA 3L13A 3Q69A 3LDZE 3N1XC 5TR5A 1SIFA 2WXGA 3ZTCA 1QQRA 1MI0A 1WGDA 1QT9A 3ZLZA 2L7RA 3X23A 5DPWA 2NBVB 3KUDB 3WAOA 1IUEA 3PVLA 1DOIA 1I7HA 1QK1A 3Q3OC 2INNE 5FKAC 3V6CB 5IA7A 4XDDA 4GDKB 4LDTD 1C4PA 2LJIA 2BS2B 4HPLB 4W9FA 3QARA 1AW7A 1YQ3B 1M4VA 3H8HA 4KSKC 2RPVA 1QILA 4ANUA 3ZUNA 3EGRA 3KYCD 4ZRJA 1WJUA 2L83A 1DOXA 4RH6A 1GB1A 4D2KA 3Q3FA 1T5XD 1RWSA 1JROA 5D7GA 4BZAA 3AXCA 4MJSB 2J1QA 3ZNHB 2G4SA 1TS2A 2FAZA 2N9EB 1STEA 3OAWA 2WNMA 4ZDVA 4E71A 1MFWA 4O1NA 2ZZPB 1E5WA 4KIKB 1XLQA 3JVZX 1F9JA 4XZ4A 1F0ZA 1YX6B 3N32A 3IAS1 2GWCA 2WXFA 1NI2A 2QHOA 4BKSD 4IWQA 3QHTA 3PZ7A 3R66C 2KTFA 2AQ3B 1FNVA 4ICUA 3ZRFA 4NQLB 3VAWA 3RNEC 4MH8A 4FA6A 2KWVB 5HHDG 3L2DA 4FJVB 2LUEA 2DBYA 4I6PA 1ZXIA 4FN2A 1WJ4A 5AZHA 4LNFA 2M0AA 2KC1A 3FILB 4G11A 4A3PA 2BGFA 3B0AA 3QIJA 3DBHB 3TEZA 2VH2A 2WS3B 2GRIA 2CHXA 3JSVA 3KLSX 4Q2JA 2LUMA 2ZVNA 2MBEA 3PS6A 2INDC 4B6WA 1LO5D 3DBSA 3NG0A 3NZTA 1F77A 1VD2A 2D32A 4QAYA 2LMCA 2DZMA 4GOCA 4XE0A 2YVCA 3KQ4A 2JXTA 1C78A 4JGHB 3MJWA 2DYOA 4P7IA 3Q8EA 4B0EA 4A20A 3V61A 3HUIA 4RNAA 1XF5L 1ESFA 3AN1A 3PHWB 4XDCA 4BKSA 1YMHE 2KMMA 2K8BA 3SFEB 1B9RA 5FK9C 4HRSA 4YTMB 2XN9C 3AU4A 1E8ZA 4AOFA 2FIDA 4IWOA 1Q5WB 4AJWA 1V97A 1PYWD 4US8A 2IO1B 1XLOA 4DDGD 1C79A 4TUUA 1BMLC 5IAAC 1CK1A 1L6UA 3R3MA 1WXAA 4HJKA 1FXTB 5C3JB 3PT2B 4KGSA 2L76A 2MW5A 2JPHA 4BBNC 2DYBA 3FAHA 1NBFC 1Y56A 4F7ZA 1ZE3D 2EMTA 3W5VB 3AE1B 3BZDB 3EFCA 4Z9MA 1LXDA 3AEGB 2N9XA 4GMVA 2W54A 4E3CA 4HCPB 1QKZA 3DREA 3ONSA 4CQNA 2FCNA 4DHZE 1ZOYB 2L0FA 4ZHPA 3PZ8A 5HFYA 1L0YB 4DDID 3N1YC 4DXFA 2ZEQA 3JQ3A 3IFWB 3AMZA 1VDVA 1M94A 3LYYA 3BK2A 3AV8A 1ZXHA 4WWMA 4XGAB 4AWJA 3HIZA 4AJYB 2O6VD 2SAKA 4MACA 1GG3A 1Q10A 3HVDA 4ACFA 2J52A 2KVZA 2WX0A 3BVZA 4K7WA 1QOBA 3R2TA 2K6QA 1K51A 4F8CB 1R4NB 4TQ0A 1L0VB 1ZPSA 2KD0A 1KOTA 1E90A 2ICIA 3TJPA 2W3SA 2N7JA 3WANA 2M1MA 4C7ZA 3AE6B 1WRDB 3RFZB 1FM0D 4CHKA 2KQ4X 3V60A 4W9DA 4TQ1A 1FXIA 4W9IA 4M0WA 3TEWA 2M19A 3JYUA 5LNK1 4RGNA 1UF0A 3NS8A 2PVOD 1BUIC 3UI3A 2OJWA 3WA0A 3ZTDA 1YX5B 3U4EG 1UWMA 3MP9A 2O2VA 2G45B 2J4XA 3AH7A 2H89B 3EA6A 4HKZE 4RF7A 4DXAB 2MSED 4LTUA 2BB6A 2Y3AA 1P98A 4M0WB 5EE3A 1TY0A 4B9KA 3M63B 3PSEB 3MC0B 4HK2A 1MVKA 4OVZA 2HD5B 3EHVA 2GBRA 4WWPA 2BBCA 1IYFA 1KH0A 4TSSA 3B2GA 4FULA 2AL3A 5AUIA 4OZAA 1M15A 2EMSA 1OQRA 2KANA 3BYTB 1XD3B 4WWOA 2ONQA 4FXCA 1D5ZC 2IGGA 3KVFB 2AQ1B 1TIFA 4GLSC 2V3PA 3PREA 4ARCA 1QOGA 2X38A 3BY4B 4Q2RA 1KLGD 1CQVA 2J0MA 4KGTA 1JMLA 4EZKA 1UBIA 1VZ6A 3MFGA 4BG4B 1C76A 4NAWA 2ZNVC 3EFUA 2L32A 4W9EA 3T8MA 3L10B 3W1SA 2WDRB 1SD0A 2LHDA 4NPNA 2INCC 1TKEA 1WXSA 3RT3B 1GC6A 2MBHA 1DGJA 5DPRA 2QEJC 4LJPB 2N7DA 1ZW7A 2KO3A 4DQOC 3OLMD 3JU6A 2CU1A 1FFUA 3H7PA 2LXAA 1YD8U 2XEWA 1WJ6A 3C0RB 5CHVC 5D3DA 4IG7B 2JRHA 4N58A 4EE2A 4MH0E 4RF8A 4WIPA 2WDVB 1L5PA 2QCZA 3NOBA 3BVMA 2CU3A 3AB5A 3IVFA 1KLVA 1N5XA 2RDGA 2WXRA 1J7AA 4MM3B 1WE6A 3U7DA 4P6VF 3ZQ4A 3ZXVA 3GZNB 3MTNB 3VH4B 2VZKD 3EC8A 4GW0A 2Y5CA 2PKOA 3UIPB 3RCZA 2GB1A 5FR3A 5HKHA 3B08A 1WI0A 4B0MA 5BYQA 2KZRA 4DK5A 2W82A 3APCA 1PGAA 4WWNA 2D3BA 3NZ3A 1I4XA 5E6NA 1XCQL 1EUVB 3LN6A 2WU5B 3RZFA 2WXPA 3DQVA 4YL8A 1GNUA 3QA8A 4LJOB 3NS1A 1RM6C 2RSUA 1PGBA 2D07B 4YSYB 2KWUB 3I3TB 2L3ZA 3RI7C 3L16A 1JALA 4HROA 4KGRA 3AU5A 1V1PA 4NAWB 3VXWA 3MJ5A 3E56A 4N6EB 2JVCA 5D2MB 1V49A 4IW0A 2JWZA 1XO3A 2D3AA 2QILA 4RF0A 1VA6A 2AX5A 2PE6B 1TYGB 2FCSA 1DOYA 2PMVA 4C00A 2QMTA 3ML9A 3PLVA 4GIVA 4JL9A 5AUKA 3W5UB 4GGQA 4DXGA 2L1AA 4OZCA 3H7PB 4IKGA 5D3IB 2N9KA 2LGSA 2BW2A 1ZKHA 3DBLI 3RPFC 1VCBA 2J42A 2INPE 2V4LA 4LDTB 1EF5A 1WZ3A 3CMMB 4EFOA 1ISNA 4XX5A 3Q8CA 2Z59B 1HEZE 3ZXRA 4TV3A 5MPOA 1QH4A 2XK5B 2PVGC 3AE5B 1T6BX 1FMAD 4JIOU 3CF6E 2WQYB 4LK0M 3AE2B 3Q8BA 2CS4A 1MG8A 1HQRD 2LVQA 1TJEA 3TBLD 3KUZA 4N9F4 1I4PA 1TS5A 4YTNB 1SE3A 4M01A 3ZNID 4IM2A 3A4RA 2MEKA 2KWCA 3ZYYX 1SXTA 2O6VA 1OGWA 2WDTB 3BK1A 1IGCA 1WE7A 3WCQA 1UGJA 2KK8A 4F1SA 4USAA 1RL9A 3DBRB 3A33B 2L05A 2IGHA 4WQMA 3PRMB 2C7NB 1E6EB 2BQQA 2V3SA 4P16A 4JE3B 3URYA 3TSSA 5G2NA 1TZOA 4J6IA 3ZRCA 3DCGA 5BMIA 2XBBC 2KLGA 2JU6X 2LVPA 1J7CA 3R7RA 2WXHA 3AEDB 1D5XC 4LCDE 3P4SB 1Z5SB 1F2RI 2UU7A 3EUB2 1V1OA 2DZKA 1HA5A 2KXJA 3UGBB 2H88B 2KJRA 3CIRB 5GXGB 3ZO5B 2MH7A 3W1YA 1DYQA 2RPQA 2ZPYA 2VRRB 1ROEA 3ZJVA 3M10A 1YNTE 1HXYD 4DHZB 2M8SA 3ZJUA 4MJSA 2HTHA 5G5HA 1YQBA 4GW2A 3TUOA 3U30A 4AM1A 3U7ZA 2QC8A 4A3OA 3M3JA 4IDIA 2BYTA 3RULA 1WX9A 2KX0A 4MGZE 3ETRA 3AE3B 2CR5A 3SEBA 2NR2A 3LB8C 3TL5A 3LN7A 1IPGA 4HEA1 4XYCA 1G6JA 3L2EA 2L0TA 3EECA 5LXHA 1HE8A 4GU2A 1UD7A 1TS4A 4YSXB 2WX1A 2I38A 3GZNI 3R7QA 2V1YA 4B95A 1GPXA 2W3RA 4J3OD 1A70A 3WAPA 3ZIMA 3VVWB 3DVGY 3DBHI 4NJCA 5AZGA 3P2BA 2PTLA 2IO0B 3RYTA 2KTRA 3RD2A 1YJ1A 1U4AA 1WMHA 1GUAB 4RCOA 3UF8A 4WJPA 1SSNA 3H9DA 4PYUA 5LLIA 1XQQA 5J17A 1TT4A 3Q8AA 4LNIA 5BYRA 3L0WB 1KTKA 1FD6A 1Q1OA 2E6XA 2WXKA 2VH1A 1MPEA 3GP7A 1GAQB 3FKYA 3IT6B 2K8HA 3PO0A 2G1EA 1J8CA 2KDMA 2N1VA 1WXMA 4TKNA 1VZ8A 3OJ4B 5AEKB 4W9GA 1SBBB 2MBOA 3VTUA 1TS3A 2WXLA 5G55A 4M8NA 2V9HA 3C19A 2QIEB 3IAM1 1G0WA 4EZLA
chains in the Genus database with same CATH topology
2GLSA 2QC8A 4RF6A 5J99A 2LGSA 3FKYA 1FPYA 1SD0A 2CRKA 3B6RA 3JQ3A 1P52A 2WGSA 4Z9MA 2D3CA 1F1HA 3ZXRA 3L2DA 2D3AA 4GW0A 2OJWA 1QK1A 3NG0A 4BAXA 1HTQA 1HTOA 1QH4A 4GVZA 2BVCA 3JPZA 3M10A 4RF8A 4S0RA 4LNFA 4GVYA 1LGRA 1BG0A 3DREA 1CRKA 1P50A 1F52A 4LNNA 4LNIA 4LNOA 4Q2RA 4XYCA 4BG4A 3JU5A 1I0EA 3L2EA 1M15A 4ACFA 2J1QA 4RF9A 4RF7A 3JU6A 4BG4B 4GW2A 4BHLA 4HPPA 3L2EB 5J9AA 2WHIA 2UU7A 4S17A 4AM1A 4LNKA 1VRPA 1U6RA 3DRBA 1RL9A 1G0WA 3ZXVA 2D3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLS A;  2QC8 A;  4RF6 A;  5J99 A;  2LGS A;  3FKY A;  1FPY A;  1SD0 A;  2CRK A;  3B6R A;  3JQ3 A;  1P52 A;  2WGS A;  4Z9M A;  2D3C A;  1F1H A;  3ZXR A;  3L2D A;  2D3A A;  4GW0 A;  2OJW A;  1QK1 A;  3NG0 A;  4BAX A;  1HTQ A;  1HTO A;  1QH4 A;  4GVZ A;  2BVC A;  3JPZ A;  3M10 A;  4RF8 A;  4S0R A;  4LNF A;  4GVY A;  1LGR A;  1BG0 A;  3DRE A;  1CRK A;  1P50 A;  1F52 A;  4LNN A;  4LNI A;  4LNO A;  4Q2R A;  4XYC A;  4BG4 A;  3JU5 A;  1I0E A;  3L2E A;  1M15 A;  4ACF A;  2J1Q A;  4RF9 A;  4RF7 A;  3JU6 A;  4BG4 B;  4GW2 A;  4BHL A;  4HPP A;  3L2E B;  5J9A A;  2WHI A;  2UU7 A;  4S17 A;  4AM1 A;  4LNK A;  1VRP A;  1U6R A;  3DRB A;  1RL9 A;  1G0W A;  3ZXV A;  2D3B A; 
#chains in the Genus database with same CATH topology
 2FIF A;  1NEN B;  2J0K A;  3SR6 A;  5L95 C;  3DPD A;  2BS3 B;  4OVU A;  2LRW A;  5JHA A;  3P4Q B;  3TCA A;  1V4G A;  1BG0 A;  4RMA A;  2JF5 A;  2RD0 A;  2KMA A;  3AE4 B;  1I4R A;  2WU2 B;  4RF9 A;  4FHJ A;  3I9V 1;  5J9A A;  1PDX A;  2L8J A;  3NVY A;  5DCN A;  1WWT A;  4OVV A;  4ITK A;  2D11 A;  3NJT A;  2W9N A;  3W9C B;  1FXA A;  1H8C A;  1XLN A;  2LVO A;  5G5G A;  2AEH A;  3PV1 A;  3HVZ A;  1K52 A;  1BXT A;  1YOV B;  2A4Z A;  5AZF A;  3QWZ B;  1XT9 B;  1SB3 C;  4A6Q A;  2JQR B;  1EU4 A;  2IDY A;  2GWD A;  2NTT A;  1PGX A;  1NVI D;  2NS5 A;  3UIN B;  1PFD A;  4CO7 A;  4YSZ B;  2WXI A;  3VR9 B;  4ZHO A;  4HLE A;  2KLC A;  4HPP A;  4WJN A;  3MC9 A;  1JCK B;  2HDE A;  3AEE B;  4BFR A;  1ACC A;  3BVG A;  4MEL A;  1N61 A;  1Z2M A;  1TY2 A;  1KJT A;  4IWP A;  3NVZ A;  1MJD A;  3ALB A;  2O2V B;  4DBG A;  3DHH C;  1FFV A;  2NTS A;  1V9J A;  3P42 A;  4FBJ B;  2UWQ A;  2JUO A;  2AWT A;  1UNS A;  4BHL A;  2DYM A;  2LEK A;  1FCC C;  2DNF A;  2WHI A;  2JYT A;  3ZNZ B;  4FAD A;  2KT7 A;  3N3K B;  4RGM A;  5TSS A;  3SFD B;  1TKG A;  4C56 C;  3A9K B;  4KDI C;  3DBR I;  3IXS A;  1YN4 A;  1WGK A;  2DAJ A;  1AYF A;  5HG2 A;  4A8X C;  4BKG A;  3ZDM C;  3Q8F A;  2GBK A;  5JZE B;  3GE8 C;  4DWF A;  2R2Q A;  1RFK A;  2OHF A;  1LQB A;  2WLB A;  4WUR A;  4HCN B;  1E7V A;  1JWM D;  2NCN A;  5CX3 A;  2YEP F;  2CHW A;  5EE1 A;  1WGY A;  3M62 B;  4PYZ A;  2O6V B;  3RNA C;  1NYQ A;  3HM6 X;  4MGI E;  4K81 A;  2WWZ A;  2M56 B;  1WRI A;  2BYV E;  2RDB C;  1YJI A;  3IT4 B;  1CMX B;  1JRU A;  4NJ6 A;  2KDE B;  2GI9 A;  3RNG C;  1P9D U;  2GBN A;  4HDO A;  3AEB B;  2Z8L A;  1NI3 A;  3DOW A;  4FJZ A;  4RM8 A;  1CZP A;  1ET9 A;  3TMP B;  4C4V B;  2JXX A;  1MG4 A;  2J0J A;  4PS7 A;  2DZI A;  2IJ0 A;  1T3Q A;  1I0E A;  2GBM A;  1UGM A;  1SGH A;  3VH3 B;  4ZYS A;  2JYE A;  2OJR A;  1F2R C;  4GSW A;  1J7B A;  1ENF A;  3RUI B;  1RAX A;  2KJH B;  1LGR A;  1ZP0 B;  3P4P B;  4OHJ A;  4ANV A;  3RNC C;  4PK1 A;  2LRU A;  3PLU A;  3GS2 A;  2JRI B;  3NZU A;  5I4D A;  2ZW1 A;  5IP4 D;  3AE9 B;  1SJH D;  4W9H A;  3T3O A;  2N9P C;  1RFA A;  3P63 A;  2KKC A;  2X8X X;  1V8C A;  5T8I A;  1WR6 E;  3Q14 C;  1XEE A;  2ZCC A;  3JU5 A;  5GMV A;  2R61 A;  3DDC B;  3OWE B;  4XWW A;  2M4N A;  4MEM A;  1ZGU B;  2JSV X;  2K0P A;  4E74 A;  1KRH A;  2HTM E;  2KWD A;  3KUC B;  1L6V A;  3Q6B A;  4OW0 A;  2RGF A;  1EM7 A;  1OEY J;  2TSS A;  4W9K A;  3L54 A;  2BS4 B;  1CJE A;  4C4V A;  3MHS D;  4ZOH C;  1J19 A;  3AEA B;  3DBL B;  3RN9 C;  2WDQ B;  2RR9 A;  4CYE A;  1SIJ A;  4IM0 A;  2IPK D;  2PLP A;  2KN5 A;  3APD A;  2QJL A;  1RLF A;  4RF1 A;  4HXD A;  1P0R A;  1WH3 A;  2GMI C;  2IO3 B;  1VRA B;  2L52 A;  1C1Y B;  4S0R A;  4C7Y A;  3KWV A;  3PRP B;  3KW5 B;  4GDL B;  2HE7 A;  1T0S C;  1VLB A;  3L4P A;  3NHE B;  3LXF A;  2BKR B;  1E0Z A;  1E8X A;  2C7H A;  3ZKJ C;  2UYZ B;  2IYD B;  5E6J A;  1AWD A;  4GVZ A;  4URK A;  1I35 A;  1IBX B;  3SD5 A;  3CSF A;  2BB5 A;  4M02 A;  4MSQ B;  4BG4 A;  2L00 B;  4US9 A;  1TTN A;  2SEB D;  1VRP A;  3OJ3 A;  4KIK A;  2WXJ A;  2N1W A;  1UWX A;  2MQJ A;  4WAA A;  1E9M A;  3ZNG C;  1V86 A;  3C8Y A;  1R4M B;  1YQ4 B;  1E7P B;  2Z0E B;  4DHJ D;  1EO6 A;  2GBJ A;  4GN1 A;  3B2F A;  4ICV A;  3N1Z C;  3DVN V;  1L2N A;  4EKU A;  4GVY A;  3PGE A;  1WGH A;  1WX7 A;  1UUP A;  4P1C C;  4H2A A;  3U8Z A;  4L1B A;  2LGY A;  1BT0 A;  3FIL A;  1OQY A;  3VUW A;  1I4G A;  2FUG 1;  2M0X A;  1C4C A;  4ANX A;  1WXQ A;  3B6R A;  5C1Z A;  3AEC B;  2AYO B;  2MX2 A;  5JHB A;  2ZPN A;  2LWP A;  4AS1 A;  1ZDV A;  4II2 B;  3W1S C;  3UQB A;  1FO4 A;  3NVV A;  1TKY A;  4PS3 A;  2VZK B;  3GE3 C;  3KYD D;  3LVV A;  4M8M A;  5BMH A;  5D6J B;  2YEP B;  3N30 A;  1FPY A;  2MP2 B;  4YXD B;  1WIA A;  1WR1 A;  3A9J B;  4KV2 A;  4KZ0 A;  1FRD A;  2NVU I;  2V0G A;  2G9H D;  4RGO S;  2K5P A;  4FHK A;  4L23 A;  1P7E A;  3VDZ A;  4NNJ B;  1C77 A;  1T0Q C;  2W55 A;  4K3B A;  4K3C A;  2I1K A;  2ASQ A;  1QOA A;  2JX5 A;  1S3S G;  1WM3 A;  3B1L X;  1UBQ A;  2KTR B;  1AN8 A;  3ZW3 A;  1UZX B;  2Y5B B;  3VQI A;  5CHW A;  1R8G A;  5JH5 C;  5KHQ A;  5BMG A;  1EF1 A;  2EEL A;  2Q5W D;  3L2E B;  3N9Y C;  2KAJ A;  3DHG C;  4II3 B;  2WGS A;  2IZV B;  2NPT B;  3VR8 B;  3QQ8 B;  3A4S C;  2LGX A;  2V4I B;  2A5U A;  3T3N A;  3AE7 B;  5D94 A;  3R2I A;  2J7Q B;  4BVU C;  5BYS A;  1B1Z A;  1L0X B;  3P4R B;  4NQK E;  1GJZ A;  4IUM B;  1R7S A;  3BWU D;  2FE8 A;  4MSM B;  5J18 A;  4WJQ A;  2HJ8 A;  4MGK E;  4HVB A;  1D5M C;  5BO4 B;  2KHW B;  1K50 A;  1MHH E;  4PT5 A;  3K9P B;  1QF6 A;  2D5G A;  5FR6 A;  4G3X B;  2BKF A;  4ZRQ A;  3QAQ A;  2DX5 B;  3L17 A;  4LNK A;  3HHM A;  1U6R A;  2ON8 A;  1A5R A;  1N62 A;  1WMH B;  3QC8 B;  1HTQ A;  3QK0 A;  3KWL A;  2KN4 A;  2JZZ A;  3I63 C;  2IO2 B;  3KH0 A;  2FCM A;  3Q2A C;  1V81 A;  1L4Z B;  2N7E A;  4I6L B;  4X57 B;  4RM9 A;  1EWY C;  2D33 A;  1KFY B;  1WYG A;  1JW9 D;  1WF9 A;  3V3X A;  3SHQ A;  1PUT A;  1I42 A;  2BF8 B;  3BIN A;  2CJN A;  4NZL B;  1K53 A;  2MBQ A;  3RNB C;  4BOZ B;  2ZVO A;  4HWI B;  3UIO B;  1EWC A;  1WGG A;  2IBI B;  2C60 A;  3I57 A;  2CHZ A;  2MP2 A;  2K1F A;  3O65 B;  1QZE A;  4FJY A;  5IKC M;  1KLU D;  2RMM A;  4GDK A;  3A9J A;  2MBB B;  3DWM A;  3A1Q A;  4LNN A;  3W2D A;  3RMK C;  3IBE A;  3Q3J A;  2MJD A;  4GXB A;  4RFB A;  3ECI A;  3TEX A;  3T9L A;  2IY1 B;  3UQA A;  3DHI C;  1SE9 A;  1XLP A;  3V62 A;  1OFF A;  2BPS A;  2LAS A;  2MHJ A;  1F1H A;  2XK5 A;  4ZRI A;  2D2Q A;  2FNJ B;  5IN7 A;  2JT4 B;  3P1M A;  2KYW A;  2B3A A;  3TIX A;  1WJN A;  2Z0D B;  5H8Y E;  2LFI A;  1VR9 A;  1WX8 A;  5KHO A;  3TEY A;  1JRP A;  2OOB B;  3JW0 X;  2DEN B;  2QDF A;  4REZ A;  2EKE C;  2LHE A;  4WH4 A;  2DAF A;  3HK0 A;  2JWU A;  2KDF B;  2PW9 A;  1N63 A;  4LNO A;  4GDL A;  4JQW C;  1P1A A;  3Q3M C;  4K1R B;  4A9A A;  3AE8 B;  4MT5 A;  4YWG G;  4PS8 A;  2C7M B;  2N0S B;  1V1P B;  1N60 A;  2C9W B;  1GOZ A;  1YIW A;  2KJ6 A;  4KVG B;  1FRR A;  3K9O B;  2BWF A;  2G4D B;  3J9C A;  1GC7 A;  3QCA A;  2J53 A;  2MRP A;  1FNU A;  3QX1 A;  1RYJ A;  1IBX A;  1L4D B;  2DWQ A;  3DWG C;  1IP9 A;  3CST A;  2B76 B;  2RDH A;  1N6Z A;  1T0Y A;  5IOI A;  2JZ3 B;  3DVG X;  3S2A A;  1Y8R C;  1KF6 B;  2PEA A;  4JWS C;  1P52 A;  3ENE A;  1SF0 A;  2ZCB A;  3NUH B;  4DHJ B;  1H4R A;  4AUQ C;  1HTO A;  2BVC A;  1J0G A;  1HZ5 A;  1V6E A;  2D10 A;  2AL6 A;  1QOF A;  2LGI A;  1LFD A;  4HPM B;  1MHX A;  4MM3 A;  2MCN B;  3NRZ A;  3H7S A;  3U52 E;  2I2Y A;  4KSL C;  4G50 A;  2LD9 A;  3WIM A;  1JWU D;  1E10 A;  3O13 A;  4W9C A;  1NDD A;  2OED A;  2ZNV B;  4GB9 A;  3WAM A;  4EUT A;  2AQ2 B;  4I6N B;  1JWA D;  3VFK A;  2KFJ A;  5L83 A;  3OG5 A;  2NBW B;  3RZW C;  2QSD A;  2MLB A;  2V3N A;  3V05 A;  1EU3 A;  4G0N B;  1HZ6 A;  4RF6 A;  2EKI A;  2KMC A;  4A55 A;  2MA9 B;  3HM3 A;  4FLH A;  3VTV A;  1ET6 A;  2WXM A;  4KKI A;  3VRB B;  3A9K A;  2KAC A;  2LXC A;  1WGR A;  1V2Y A;  3AI5 A;  4EEW A;  3VTW A;  4A90 A;  2BT6 A;  3JSV B;  3E9S A;  4L2Y A;  3VRA B;  4IM3 A;  2WYQ A;  3ABV B;  3PTF C;  3M95 A;  1C3T A;  1SE4 A;  1SEB D;  4C80 A;  1E8W A;  2IY0 B;  2LJ5 A;  3PPA A;  4ASW C;  3NY5 A;  3ZJT A;  2WXO A;  2CJO A;  2LI5 A;  1D6E C;  4ARI A;  4W9J A;  3PRZ A;  3IG8 A;  1WFY A;  2NBU A;  3R8B A;  5HI1 A;  4M00 A;  2N9L A;  4IC7 B;  1QLB B;  1VZ7 A;  3SDL C;  1L7Y A;  1OQQ A;  3U2S C;  1F52 A;  4LLG M;  4AP4 C;  2PPH A;  5DPS A;  2K39 A;  4AQ7 A;  2FCQ A;  4K7S A;  3BYY B;  1K8R B;  2K25 A;  3GOE A;  3FC4 A;  1D4B A;  1NEK B;  2Y5P A;  2CRK A;  3AEF B;  4BOS C;  2KX3 A;  1TGZ B;  4JPS A;  3IG3 A;  1WXV A;  4MDK E;  1Q0W B;  3H6N A;  1ZUD 2;  3NZS A;  5IO9 A;  3X0W A;  1WZ0 A;  1CRK A;  3IHP C;  5CTR C;  3PHX B;  2PE9 A;  4YT0 B;  5EDS A;  4MGY E;  3GB1 A;  4S17 A;  1VJK A;  2GOW A;  5J99 A;  4KZC A;  2IGD A;  3ZGZ A;  1D3Z A;  1I4H A;  2XNA C;  5JXV A;  1FEH A;  3A1Q B;  4P1B C;  1TBE A;  1UH6 A;  2KQ7 A;  3QJZ A;  4NAM A;  5EE9 A;  1P3Q U;  4ZRP A;  1R4M I;  2CKH B;  3ML8 A;  3BII D;  3ZDT A;  2N4F A;  1WY8 A;  4ZYN A;  2KDI A;  1JQ4 A;  1N5W A;  3MC8 A;  4WQO B;  1XXG A;  5CHF A;  4TMA B;  4WJO A;  3WAL A;  4KDL B;  2ACZ B;  2LZ6 A;  2K8C A;  4KKJ A;  1C4A A;  3V6E B;  4BKT A;  1TZ1 A;  4XWT A;  2E3T A;  4UDU C;  3AM9 A;  4JWU C;  1T0R C;  1I4Q A;  3D32 A;  1OTR B;  3AUL A;  1TT5 B;  1AAR A;  2DZJ A;  4OZB A;  3HRD D;  4N59 A;  1YN5 A;  2M17 A;  3APF A;  2JZP A;  3Q3N C;  1P7F A;  3NVW A;  5C2T B;  5LXI B;  4ZRK A;  4WAF A;  2D3C A;  2JY6 A;  1ZDX A;  4BAX A;  3CWI A;  1C9F A;  2PIA A;  1E8Y A;  5E6O A;  2YLM A;  1WYW B;  1SJE D;  1WM2 A;  2WP9 B;  4HKQ A;  5H92 C;  2WXN A;  1V5O A;  2BYF A;  3MHZ A;  4HDQ A;  3H1U A;  1GB4 A;  3DRB A;  2GLS A;  1RRB A;  2REX A;  3L08 A;  4EOY A;  2ZW0 A;  4R3D A;  2LGD A;  3JPZ A;  4JX1 C;  2K22 A;  2FUH B;  1OEY A;  2C5L C;  1LM8 B;  4YTP B;  1P50 A;  1YN3 A;  1JWB D;  5J2R A;  5DPT A;  2FBW B;  4RGT A;  2BYE A;  2D3G A;  4KX6 B;  2BTE A;  1WSP A;  2KC2 A;  5EE0 A;  2G3Q B;  2KFK B;  3VHT C;  3DVN U;  2KOX A;  2R2O A;  4XC2 A;  2PJH A;  4BBN F;  1IGD A;  2ZJD A;  2MJ3 A;  2K3U A;  4IOI E;  2NMQ A;  1SE2 A;  2WXQ A;  3LVW A;  2MWS B;  3B9J A;  3N20 C;  1KM7 A;  3ZVV A;  3IG5 A;  2K9X A;  4NY0 A;  1FIQ A;  4K7U A;  1PQS A;  5E6P A;  2KNB A;  1JWS D;  2KDB A;  2I1J A;  1YJJ A;  2DLB A;  3I5J C;  2NPT A;  1V80 A;  3VUY A;  1X1M A;  3PZD A;  1V5T A;  3LJ3 A;  1R4N I;  5C23 A;  4HJG E;  1NYR A;  1XCT L;  4JLC A;  2BWE S;  2KFK A;  2KVR A;  1S1Q B;  2MJE A;  2DHZ A;  3SU8 X;  1FCL A;  1UEL A;  2KQS A;  2HJ1 A;  3VUX A;  4ANW A;  1FNW A;  4EZJ A;  3RNF C;  1E7U A;  4NJ7 A;  2K6D B;  4W9L A;  3L13 A;  3Q69 A;  3LDZ E;  3N1X C;  5TR5 A;  1SIF A;  2WXG A;  3ZTC A;  1QQR A;  1MI0 A;  1WGD A;  1QT9 A;  3ZLZ A;  2L7R A;  3X23 A;  5DPW A;  2NBV B;  3KUD B;  3WAO A;  1IUE A;  3PVL A;  1DOI A;  1I7H A;  1QK1 A;  3Q3O C;  2INN E;  5FKA C;  3V6C B;  5IA7 A;  4XDD A;  4GDK B;  4LDT D;  1C4P A;  2LJI A;  2BS2 B;  4HPL B;  4W9F A;  3QAR A;  1AW7 A;  1YQ3 B;  1M4V A;  3H8H A;  4KSK C;  2RPV A;  1QIL A;  4ANU A;  3ZUN A;  3EGR A;  3KYC D;  4ZRJ A;  1WJU A;  2L83 A;  1DOX A;  4RH6 A;  1GB1 A;  4D2K A;  3Q3F A;  1T5X D;  1RWS A;  1JRO A;  5D7G A;  4BZA A;  3AXC A;  4MJS B;  2J1Q A;  3ZNH B;  2G4S A;  1TS2 A;  2FAZ A;  2N9E B;  1STE A;  3OAW A;  2WNM A;  4ZDV A;  4E71 A;  1MFW A;  4O1N A;  2ZZP B;  1E5W A;  4KIK B;  1XLQ A;  3JVZ X;  1F9J A;  4XZ4 A;  1F0Z A;  1YX6 B;  3N32 A;  3IAS 1;  2GWC A;  2WXF A;  1NI2 A;  2QHO A;  4BKS D;  4IWQ A;  3QHT A;  3PZ7 A;  3R66 C;  2KTF A;  2AQ3 B;  1FNV A;  4ICU A;  3ZRF A;  4NQL B;  3VAW A;  3RNE C;  4MH8 A;  4FA6 A;  2KWV B;  5HHD G;  3L2D A;  4FJV B;  2LUE A;  2DBY A;  4I6P A;  1ZXI A;  4FN2 A;  1WJ4 A;  5AZH A;  4LNF A;  2M0A A;  2KC1 A;  3FIL B;  4G11 A;  4A3P A;  2BGF A;  3B0A A;  3QIJ A;  3DBH B;  3TEZ A;  2VH2 A;  2WS3 B;  2GRI A;  2CHX A;  3JSV A;  3KLS X;  4Q2J A;  2LUM A;  2ZVN A;  2MBE A;  3PS6 A;  2IND C;  4B6W A;  1LO5 D;  3DBS A;  3NG0 A;  3NZT A;  1F77 A;  1VD2 A;  2D32 A;  4QAY A;  2LMC A;  2DZM A;  4GOC A;  4XE0 A;  2YVC A;  3KQ4 A;  2JXT A;  1C78 A;  4JGH B;  3MJW A;  2DYO A;  4P7I A;  3Q8E A;  4B0E A;  4A20 A;  3V61 A;  3HUI A;  4RNA A;  1XF5 L;  1ESF A;  3AN1 A;  3PHW B;  4XDC A;  4BKS A;  1YMH E;  2KMM A;  2K8B A;  3SFE B;  1B9R A;  5FK9 C;  4HRS A;  4YTM B;  2XN9 C;  3AU4 A;  1E8Z A;  4AOF A;  2FID A;  4IWO A;  1Q5W B;  4AJW A;  1V97 A;  1PYW D;  4US8 A;  2IO1 B;  1XLO A;  4DDG D;  1C79 A;  4TUU A;  1BML C;  5IAA C;  1CK1 A;  1L6U A;  3R3M A;  1WXA A;  4HJK A;  1FXT B;  5C3J B;  3PT2 B;  4KGS A;  2L76 A;  2MW5 A;  2JPH A;  4BBN C;  2DYB A;  3FAH A;  1NBF C;  1Y56 A;  4F7Z A;  1ZE3 D;  2EMT A;  3W5V B;  3AE1 B;  3BZD B;  3EFC A;  4Z9M A;  1LXD A;  3AEG B;  2N9X A;  4GMV A;  2W54 A;  4E3C A;  4HCP B;  1QKZ A;  3DRE A;  3ONS A;  4CQN A;  2FCN A;  4DHZ E;  1ZOY B;  2L0F A;  4ZHP A;  3PZ8 A;  5HFY A;  1L0Y B;  4DDI D;  3N1Y C;  4DXF A;  2ZEQ A;  3JQ3 A;  3IFW B;  3AMZ A;  1VDV A;  1M94 A;  3LYY A;  3BK2 A;  3AV8 A;  1ZXH A;  4WWM A;  4XGA B;  4AWJ A;  3HIZ A;  4AJY B;  2O6V D;  2SAK A;  4MAC A;  1GG3 A;  1Q10 A;  3HVD A;  4ACF A;  2J52 A;  2KVZ A;  2WX0 A;  3BVZ A;  4K7W A;  1QOB A;  3R2T A;  2K6Q A;  1K51 A;  4F8C B;  1R4N B;  4TQ0 A;  1L0V B;  1ZPS A;  2KD0 A;  1KOT A;  1E90 A;  2ICI A;  3TJP A;  2W3S A;  2N7J A;  3WAN A;  2M1M A;  4C7Z A;  3AE6 B;  1WRD B;  3RFZ B;  1FM0 D;  4CHK A;  2KQ4 X;  3V60 A;  4W9D A;  4TQ1 A;  1FXI A;  4W9I A;  4M0W A;  3TEW A;  2M19 A;  3JYU A;  5LNK 1;  4RGN A;  1UF0 A;  3NS8 A;  2PVO D;  1BUI C;  3UI3 A;  2OJW A;  3WA0 A;  3ZTD A;  1YX5 B;  3U4E G;  1UWM A;  3MP9 A;  2O2V A;  2G45 B;  2J4X A;  3AH7 A;  2H89 B;  3EA6 A;  4HKZ E;  4RF7 A;  4DXA B;  2MSE D;  4LTU A;  2BB6 A;  2Y3A A;  1P98 A;  4M0W B;  5EE3 A;  1TY0 A;  4B9K A;  3M63 B;  3PSE B;  3MC0 B;  4HK2 A;  1MVK A;  4OVZ A;  2HD5 B;  3EHV A;  2GBR A;  4WWP A;  2BBC A;  1IYF A;  1KH0 A;  4TSS A;  3B2G A;  4FUL A;  2AL3 A;  5AUI A;  4OZA A;  1M15 A;  2EMS A;  1OQR A;  2KAN A;  3BYT B;  1XD3 B;  4WWO A;  2ONQ A;  4FXC A;  1D5Z C;  2IGG A;  3KVF B;  2AQ1 B;  1TIF A;  4GLS C;  2V3P A;  3PRE A;  4ARC A;  1QOG A;  2X38 A;  3BY4 B;  4Q2R A;  1KLG D;  1CQV A;  2J0M A;  4KGT A;  1JML A;  4EZK A;  1UBI A;  1VZ6 A;  3MFG A;  4BG4 B;  1C76 A;  4NAW A;  2ZNV C;  3EFU A;  2L32 A;  4W9E A;  3T8M A;  3L10 B;  3W1S A;  2WDR B;  1SD0 A;  2LHD A;  4NPN A;  2INC C;  1TKE A;  1WXS A;  3RT3 B;  1GC6 A;  2MBH A;  1DGJ A;  5DPR A;  2QEJ C;  4LJP B;  2N7D A;  1ZW7 A;  2KO3 A;  4DQO C;  3OLM D;  3JU6 A;  2CU1 A;  1FFU A;  3H7P A;  2LXA A;  1YD8 U;  2XEW A;  1WJ6 A;  3C0R B;  5CHV C;  5D3D A;  4IG7 B;  2JRH A;  4N58 A;  4EE2 A;  4MH0 E;  4RF8 A;  4WIP A;  2WDV B;  1L5P A;  2QCZ A;  3NOB A;  3BVM A;  2CU3 A;  3AB5 A;  3IVF A;  1KLV A;  1N5X A;  2RDG A;  2WXR A;  1J7A A;  4MM3 B;  1WE6 A;  3U7D A;  4P6V F;  3ZQ4 A;  3ZXV A;  3GZN B;  3MTN B;  3VH4 B;  2VZK D;  3EC8 A;  4GW0 A;  2Y5C A;  2PKO A;  3UIP B;  3RCZ A;  2GB1 A;  5FR3 A;  5HKH A;  3B08 A;  1WI0 A;  4B0M A;  5BYQ A;  2KZR A;  4DK5 A;  2W82 A;  3APC A;  1PGA A;  4WWN A;  2D3B A;  3NZ3 A;  1I4X A;  5E6N A;  1XCQ L;  1EUV B;  3LN6 A;  2WU5 B;  3RZF A;  2WXP A;  3DQV A;  4YL8 A;  1GNU A;  3QA8 A;  4LJO B;  3NS1 A;  1RM6 C;  2RSU A;  1PGB A;  2D07 B;  4YSY B;  2KWU B;  3I3T B;  2L3Z A;  3RI7 C;  3L16 A;  1JAL A;  4HRO A;  4KGR A;  3AU5 A;  1V1P A;  4NAW B;  3VXW A;  3MJ5 A;  3E56 A;  4N6E B;  2JVC A;  5D2M B;  1V49 A;  4IW0 A;  2JWZ A;  1XO3 A;  2D3A A;  2QIL A;  4RF0 A;  1VA6 A;  2AX5 A;  2PE6 B;  1TYG B;  2FCS A;  1DOY A;  2PMV A;  4C00 A;  2QMT A;  3ML9 A;  3PLV A;  4GIV A;  4JL9 A;  5AUK A;  3W5U B;  4GGQ A;  4DXG A;  2L1A A;  4OZC A;  3H7P B;  4IKG A;  5D3I B;  2N9K A;  2LGS A;  2BW2 A;  1ZKH A;  3DBL I;  3RPF C;  1VCB A;  2J42 A;  2INP E;  2V4L A;  4LDT B;  1EF5 A;  1WZ3 A;  3CMM B;  4EFO A;  1ISN A;  4XX5 A;  3Q8C A;  2Z59 B;  1HEZ E;  3ZXR A;  4TV3 A;  5MPO A;  1QH4 A;  2XK5 B;  2PVG C;  3AE5 B;  1T6B X;  1FMA D;  4JIO U;  3CF6 E;  2WQY B;  4LK0 M;  3AE2 B;  3Q8B A;  2CS4 A;  1MG8 A;  1HQR D;  2LVQ A;  1TJE A;  3TBL D;  3KUZ A;  4N9F 4;  1I4P A;  1TS5 A;  4YTN B;  1SE3 A;  4M01 A;  3ZNI D;  4IM2 A;  3A4R A;  2MEK A;  2KWC A;  3ZYY X;  1SXT A;  2O6V A;  1OGW A;  2WDT B;  3BK1 A;  1IGC A;  1WE7 A;  3WCQ A;  1UGJ A;  2KK8 A;  4F1S A;  4USA A;  1RL9 A;  3DBR B;  3A33 B;  2L05 A;  2IGH A;  4WQM A;  3PRM B;  2C7N B;  1E6E B;  2BQQ A;  2V3S A;  4P16 A;  4JE3 B;  3URY A;  3TSS A;  5G2N A;  1TZO A;  4J6I A;  3ZRC A;  3DCG A;  5BMI A;  2XBB C;  2KLG A;  2JU6 X;  2LVP A;  1J7C A;  3R7R A;  2WXH A;  3AED B;  1D5X C;  4LCD E;  3P4S B;  1Z5S B;  1F2R I;  2UU7 A;  3EUB 2;  1V1O A;  2DZK A;  1HA5 A;  2KXJ A;  3UGB B;  2H88 B;  2KJR A;  3CIR B;  5GXG B;  3ZO5 B;  2MH7 A;  3W1Y A;  1DYQ A;  2RPQ A;  2ZPY A;  2VRR B;  1ROE A;  3ZJV A;  3M10 A;  1YNT E;  1HXY D;  4DHZ B;  2M8S A;  3ZJU A;  4MJS A;  2HTH A;  5G5H A;  1YQB A;  4GW2 A;  3TUO A;  3U30 A;  4AM1 A;  3U7Z A;  2QC8 A;  4A3O A;  3M3J A;  4IDI A;  2BYT A;  3RUL A;  1WX9 A;  2KX0 A;  4MGZ E;  3ETR A;  3AE3 B;  2CR5 A;  3SEB A;  2NR2 A;  3LB8 C;  3TL5 A;  3LN7 A;  1IPG A;  4HEA 1;  4XYC A;  1G6J A;  3L2E A;  2L0T A;  3EEC A;  5LXH A;  1HE8 A;  4GU2 A;  1UD7 A;  1TS4 A;  4YSX B;  2WX1 A;  2I38 A;  3GZN I;  3R7Q A;  2V1Y A;  4B95 A;  1GPX A;  2W3R A;  4J3O D;  1A70 A;  3WAP A;  3ZIM A;  3VVW B;  3DVG Y;  3DBH I;  4NJC A;  5AZG A;  3P2B A;  2PTL A;  2IO0 B;  3RYT A;  2KTR A;  3RD2 A;  1YJ1 A;  1U4A A;  1WMH A;  1GUA B;  4RCO A;  3UF8 A;  4WJP A;  1SSN A;  3H9D A;  4PYU A;  5LLI A;  1XQQ A;  5J17 A;  1TT4 A;  3Q8A A;  4LNI A;  5BYR A;  3L0W B;  1KTK A;  1FD6 A;  1Q1O A;  2E6X A;  2WXK A;  2VH1 A;  1MPE A;  3GP7 A;  1GAQ B;  3FKY A;  3IT6 B;  2K8H A;  3PO0 A;  2G1E A;  1J8C A;  2KDM A;  2N1V A;  1WXM A;  4TKN A;  1VZ8 A;  3OJ4 B;  5AEK B;  4W9G A;  1SBB B;  2MBO A;  3VTU A;  1TS3 A;  2WXL A;  5G55 A;  4M8N A;  2V9H A;  3C19 A;  2QIE B;  3IAM 1;  1G0W A;  4EZL A; 
#chains in the Genus database with same CATH homology
 2GLS A;  2QC8 A;  4RF6 A;  5J99 A;  2LGS A;  3FKY A;  1FPY A;  1SD0 A;  2CRK A;  3B6R A;  3JQ3 A;  1P52 A;  2WGS A;  4Z9M A;  2D3C A;  1F1H A;  3ZXR A;  3L2D A;  2D3A A;  4GW0 A;  2OJW A;  1QK1 A;  3NG0 A;  4BAX A;  1HTQ A;  1HTO A;  1QH4 A;  4GVZ A;  2BVC A;  3JPZ A;  3M10 A;  4RF8 A;  4S0R A;  4LNF A;  4GVY A;  1LGR A;  1BG0 A;  3DRE A;  1CRK A;  1P50 A;  1F52 A;  4LNN A;  4LNI A;  4LNO A;  4Q2R A;  4XYC A;  4BG4 A;  3JU5 A;  1I0E A;  3L2E A;  1M15 A;  4ACF A;  2J1Q A;  4RF9 A;  4RF7 A;  3JU6 A;  4BG4 B;  4GW2 A;  4BHL A;  4HPP A;  3L2E B;  5J9A A;  2WHI A;  2UU7 A;  4S17 A;  4AM1 A;  4LNK A;  1VRP A;  1U6R A;  3DRB A;  1RL9 A;  1G0W A;  3ZXV A;  2D3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...