3ZXVA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
publication title Trisubstituted Imidazoles as Mycobacterium Tuberculosis Glutamine Synthetase Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 160
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 3zxvA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3zxvA02
4XYCA 4GVZA 2CRKA 4BG4A 3DREA 2QC8A 4RF9A 4ACFA 2LGSA 2D3CA 4LNIA 2UU7A 4S0RA 4GVYA 4RF8A 1P50A 4LNFA 4BG4B 1F52A 3L2EA 2WHIA 1U6RA 4S17A 3FKYA 4LNOA 1RL9A 1SD0A 5J99A 3L2DA 4LNNA 3DRBA 3B6RA 1HTQA 1CRKA 1LGRA 2GLSA 2J1QA 2D3BA 3JU5A 1M15A 3L2EB 4RF6A 4BHLA 3JPZA 3NG0A 1HTOA 4GW0A 1VRPA 4HPPA 4RF7A 3ZXRA 3M10A 1BG0A 2OJWA 3JQ3A 2WGSA 4LNKA 3ZXVA 4BAXA 1QK1A 4GW2A 5J9AA 1G0WA 1QH4A 2BVCA 4Z9MA 1FPYA 4Q2RA 1F1HA 3JU6A 4AM1A 2D3AA 1I0EA 1P52A
chains in the Genus database with same CATH superfamily
5KHQA 2LXCA 2QC8A 2RDHA 1KH0A 3PGEA 3DBSA 4BG4B 4GDKB 2Z8LA 5HKHA 2HTHA 4I6NB 2BYEA 3P42A 3KUDB 4AUQC 2NTTA 5G5HA 3HHMA 4P16A 1VJKA 1WYGA 1RWSA 4ICUA 1CZPA 3L08A 2KQ7A 2WXHA 4MEMA 4TQ1A 3JVZX 1QF6A 2ICIA 2TSSA 2G4SA 1MPEA 2XN9C 2L83A 3AN1A 2J1QA 3JU5A 2XK5A 3UQBA 2LMCA 1TS2A 3UGBB 1JQ4A 3W5VB 2KO3A 1LO5D 4B0MA 2N1WA 4GOCA 1CK1A 1I42A 4WJNA 2KANA 2IO1B 4RM9A 1L5PA 2VZKD 3UF8A 4AJYB 3PRPB 2K1FA 2RDBC 3RD2A 4KDLB 1JWAD 3L2DA 2DX5B 3PLUA 3RCZA 3OJ3A 1AARA 2LVPA 1C1YB 3Q8AA 4MJSB 2KWDA 2GMIC 3AU4A 2CRKA 3PS6A 1I4GA 2VH2A 1E8WA 1G6JA 4WAFA 2ZCCA 1NDDA 2MBBB 2VZKB 4K3BA 2REXA 3BVGA 2JZPA 4RGOS 1T6BX 1NYRA 2M17A 4M8MA 1T3QA 4KVGB 2MBHA 4LCDE 2NCNA 3KVFB 4E74A 5C23A 3HRDD 1JRPA 5KHOA 5FKAC 2RMMA 2N9XA 4NAWA 1NBFC 2NBWB 2W9NA 4L2YA 1FRRA 1VDVA 2I38A 5BYQA 2JXTA 2JXXA 3B08A 1ZKHA 3RFZB 3HM6X 4WJPA 3RNCC 1KLVA 3P2BA 4N6EB 4CYEA 2MW5A 3R8BA 2C9WB 2M19A 3V6CB 3IHPC 1UELA 3Q69A 1ESFA 3ZKJC 2M56B 5JZEB 3VAWA 3PRZA 4XE0A 1ZP0B 2DAJA 4KZCA 4ZRPA 1Z5SB 2L52A 1E5WA 3DVGX 4HPLB 4CO7A 2D11A 1ZW7A 1TKYA 5TR5A 5J17A 2NR2A 3DBRB 4IWPA 1L4ZB 2UYZB 5D94A 1OGWA 3OLMD 3WAPA 3MC8A 2FIFA 1EF5A 1SIFA 1SE4A 2BWES 4J3OD 3HM3A 3B9JA 3WIMA 2KT7A 4DXAB 2QJLA 1K8RB 1JWBD 2Z59B 1MHXA 1R4MI 1MFWA 2D3AA 1QT9A 3EHVA 2IO2B 4LK0M 5G55A 2LGSA 4GSWA 2LUMA 4RGNA 3H7PA 2WHIA 1V9JA 4JE3B 3NVWA 1WZ0A 4IM3A 4HWIB 3WAOA 4Q2JA 1T0YA 1IUEA 2IPKD 1YJJA 4AOFA 3V05A 3U2SC 2AQ3B 4XYCA 3ALBA 3ZRCA 2ZZPB 1L7YA 3LVVA 1IPGA 3I5JC 1JWMD 1Y56A 2KN4A 1T0QC 1Q5WB 4IM2A 1OFFA 2FIDA 1HZ6A 4RMAA 3KYDD 3O13A 1NI2A 4G3XB 1QH4A 2INCC 1RRBA 2WDQB 4FN2A 4B0EA 1YIWA 3KQ4A 2LGYA 1HA5A 1JMLA 2BW2A 1K51A 4II3B 3C19A 3GZNI 3ZYYX 1MJDA 4KIKB 2KFKA 1TZ1A 3APDA 2YVCA 4K7UA 2FAZA 2WP9B 4FJZA 3L13A 4LTUA 2O2VB 2KWUB 2JYTA 2W55A 4W9LA 1WRIA 3VTUA 3N32A 2R2QA 1HZ5A 3AI5A 3Q3NC 1D5MC 4ZHPA 5AEKB 4HEA1 3NVVA 1E90A 3T9LA 1C4AA 3B0AA 2PLPA 1WJ6A 4BKTA 2OHFA 4G0NB 2D07B 2JZZA 3BY4B 5AZHA 4L1BA 2Z0DB 3WALA 2K8BA 4AQ7A 5LXHA 5E6PA 4M0WA 2MP2B 1A5RA 1E7VA 2ASQA 4RM8A 4QAYA 1FXAA 3H7SA 3A9KA 2BKFA 4LJPB 3A9JB 2WXMA 2LEKA 4CQNA 4W9JA 4ASWC 4WQOB 3M62B 2ZNVB 2OOBB 4TQ0A 4NPNA 2BS4B 3AE2B 3UINB 2D10A 1YOVB 2RGFA 3HVDA 3K9PB 1WM3A 2QDFA 3QC8B 4A6QA 2MCNB 1XCTL 2SAKA 2KQSA 3FKYA 3LN6A 2WU5B 2I1KA 2KWCA 3AEEB 3VFKA 1V5OA 3LVWA 3FAHA 2WGSA 4PYZA 1IBXB 3H9DA 3V61A 2M4NA 4JWUC 3P4PB 3K9OB 3SDLC 1HQRD 2L05A 1V80A 3EUB2 4OZBA 4W9KA 2WWZA 3NVZA 2KTFA 3AE9B 2G9HD 2L8JA 4RF0A 1EO6A 1GNUA 3RN9C 4YTNB 4ZRJA 1WGGA 1FCLA 3ZJUA 2LWPA 3BYYB 1BT0A 4GW2A 2XEWA 2MA9B 2KAJA 3CIRB 3JW0X 1NVID 1TGZB 5JHBA 3V3XA 2ZCBA 3TEWA 1M94A 3R7RA 4X57B 1GAQB 2RPQA 2WXPA 3TSSA 3QWZB 3DPDA 4EFOA 5GMVA 3W1SA 2C7MB 3VTWA 1MG4A 4EEWA 1V8CA 3ZTDA 4K7SA 3ABVB 1TY0A 2WNMA 3VRBB 3A1QB 3UIOB 1TIFA 3EGRA 4AWJA 1GB1A 3U4EG 3ZVVA 1TTNA 2IY0B 2J0JA 2LRUA 3PHXB 3JQ3A 2O6VA 2KOXA 2K22A 1XO3A 5TSSA 4YT0B 2GBJA 4GVZA 1E8XA 3KUZA 3B2GA 1C79A 2MBEA 2D33A 1XEEA 4LNNA 3R7QA 4IWOA 1N5WA 4GW0A 4P1CC 3ZXRA 1TKGA 4YTMB 4ZRIA 3U8ZA 3DQVA 4P7IA 2HE7A 3TEZA 3L17A 2WXIA 2BKRB 5H92C 2PJHA 3QX1A 2V1YA 3S2AA 1C77A 2NTSA 1D4BA 1RL9A 1UZXB 1ISNA 4ZHOA 2MBQA 2WXGA 2I2YA 1IGCA 5EE1A 1V86A 2ZEQA 3LYYA 1IGDA 2LUEA 4BKSD 2RD0A 4DHZE 1UF0A 4H2AA 1EU3A 1DOXA 1X1MA 3DWMA 4F8CB 5L83A 4RGTA 4JL9A 2HDEA 3AXCA 2HD5B 4GDLA 1T0SC 2ONQA 3Q6BA 3VH3B 2C7HA 2WYQA 4FJVB 3KW5B 4DDGD 4MH8A 3U7DA 1V49A 3V62A 4EOYA 1V1PB 2BS2B 1TS5A 5LLIA 3RPFC 1RFAA 2GRIA 4GIVA 1YQ4B 3APCA 1N61A 1NYQA 5MPOA 2BWFA 2Z0EB 5FK9C 3VRAB 2BYTA 2MEKA 1F52A 2GI9A 4HK2A 2PEAA 2DBYA 1HXYD 1FMAD 1T5XD 2MX2A 3NG0A 3SR6A 4DXFA 5DPTA 3ZNZB 1Z2MA 1LQBA 4KSLC 3NS8A 4KKJA 4C4VA 1FEHA 2IO0B 1E8YA 2N9PC 2LI5A 1WJNA 2ZW0A 4KGSA 2J0KA 3ML9A 2BF8B 1WR6E 4YTPB 2B3AA 2NBUA 4MELA 5AUIA 1HEZE 4W9FA 3UIPB 2CS4A 4WWOA 1HTQA 2GBNA 4BOZB 1U4AA 2BB6A 4N58A 4JX1C 1ET9A 1YN3A 2K8CA 3SEBA 2GB1A 4PYUA 3NHEB 4WJQA 1OQYA 1JWUD 3N1ZC 1UD7A 4JPSA 4N59A 1FIQA 1YMHE 3ZO5B 1AWDA 1SE3A 3MFGA 2JU6X 1WY8A 1KLGD 4BAXA 1JALA 4C7ZA 3J9CA 4HCNB 1WSPA 4XC2A 1ZUD2 3AMZA 5FR3A 3IFWB 2MWSB 3Q3MC 1XLPA 4WWNA 3BK1A 4EZJA 5BMIA 3QJZA 1P9DU 4LDTD 1AYFA 4BVUC 5CX3A 1PFDA 1I4XA 3DBLI 1VD2A 3FILA 4XDDA 5H8YE 2D32A 3QK0A 3C8YA 3IAS1 3TCAA 3QA8A 5IKCM 1N62A 5C1ZA 4DHJD 4A20A 3QARA 2ZW1A 4DXGA 2KHWB 1GUAB 5DPWA 2KVRA 3LB8C 4M8NA 3TUOA 2QILA 4YL8A 4MM3B 2E3TA 1SE2A 2PVOD 3JPZA 1WM2A 1FO4A 1SXTA 1L0VB 2M0XA 3BZDB 1F2RC 5IP4D 4BG4A 3DREA 4GDKA 1UUPA 3IXSA 4E3CA 1UWMA 3TMPB 4YSZB 1KLUD 5CHVC 2WLBA 3MC0B 4OHJA 2MRPA 4ANUA 2SEBD 3V60A 3N20C 2KMAA 1KFYB 1IP9A 2C60A 3AE8B 2BT6A 1ZE3D 2KC1A 3OG5A 2KC2A 5E6JA 1ACCA 5CHFA 1QQRA 4ACFA 4DK5A 3Q8FA 5JH5C 2JY6A 4C80A 1RAXA 3KLSX 2AWTA 3CSFA 3E9SA 3ONSA 1FXIA 2VRRB 1L0XB 2N0SB 4W9EA 3QHTA 2RPVA 3BVZA 4BFRA 5JHAA 3QIJA 1WMHB 2IGDA 4WWMA 2N7DA 2J0MA 4RH6A 4OVUA 1I7HA 3ZTCA 3L10B 3M3JA 2M8SA 4O1NA 4NNJB 4MJSA 4G50A 1F9JA 2DZIA 1R4MB 5CHWA 2JRIB 1IYFA 1Q1OA 3PZDA 2NVUI 3VQIA 5G2NA 2N7JA 4F7ZA 5JXVA 1QOBA 3ZDMC 3PO0A 2L0FA 1SB3C 3PZ8A 1WXMA 2K39A 2LHDA 4RGMA 3TL5A 4LJOB 3HIZA 1F2RI 1XLQA 3Q8BA 1I4QA 1E10A 1FPYA 1QOGA 4KGTA 3LXFA 4PT5A 4JWSC 3MJ5A 2KYWA 3QAQA 4EE2A 1QOFA 3IT4B 3IAM1 3KWLA 1XT9B 4JIOU 4RCOA 1P98A 4TMAB 2K0PA 1V4GA 4P1BC 4OW0A 1V81A 4US9A 1H8CA 2QCZA 2AL3A 3GZNB 2N9KA 2V3SA 2NBVB 4S0RA 1P50A 4MH0E 4C7YA 1V1OA 2VH1A 3Q3JA 3U7ZA 3HVZA 3NY5A 3DVGY 3RT3B 1C3TA 3TEYA 1D3ZA 1MHHE 4Z9MA 2CU1A 1TS3A 2G4DB 3LDZE 1PGAA 4YSYB 3AV8A 1FNUA 2DLBA 3MTNB 4FULA 4A55A 1Y8RC 2FCSA 4ZYSA 2V0GA 2L0TA 4BZAA 4RF1A 4M02A 1H4RA 5J18A 1FFVA 1OTRB 2OJWA 4K7WA 5AZGA 1Q10A 2K25A 4XWWA 2WU2B 2DYOA 4PS7A 2C5LC 3TIXA 2X8XX 1GG3A 2WX0A 3NZSA 3W1SC 2K6QA 2QIEB 3EC8A 3PSEB 3RNGC 1I4RA 2N9EB 3R2TA 3L2EB 1UWXA 4II2B 2KX3A 1OEYA 3I9V1 4I6LB 3RYTA 3L54A 2MJDA 1V5TA 5IAAC 2KNBA 4TSSA 2IZVB 3AE7B 2DWQA 2MBOA 1PUTA 1BUIC 4HDOA 3O65B 1YN4A 2WXNA 4IM0A 4ANVA 3KH0A 3AU5A 3P63A 2D3BA 2H88B 2XNAC 3X23A 1QLBB 4RF7A 1VLBA 2MJEA 2IY1B 2LHEA 4IDIA 5G5GA 3U52E 5J9AA 2N7EA 4KIKA 1WIAA 1E6EB 4TKNA 1L6VA 2KN5A 2KDMA 3Q8CA 4EZKA 2O2VA 3PLVA 4URKA 2PTLA 3RMKC 2INNE 2M1MA 1VCBA 2OEDA 1J7BA 2J42A 1L0YB 3PTFC 3N1YC 1E7UA 2KFJA 2N9LA 1P52A 1FXTB 1E8ZA 1SEBD 2KD0A 1XLNA 2PE9A 4HLEA 2DYMA 2EMTA 2KWVB 2V4LA 1TBEA 4LNOA 3RUIB 4FHKA 5AUKA 1DOYA 1VRPA 2MP2A 2FE8A 3JSVB 2NS5A 1YX6B 4CHKA 2BTEA 5BYRA 5E6OA 4XDCA 1WGDA 3AE3B 2KDFB 2WDRB 3ETRA 3DVNV 3A9JA 1P3QU 2ZVOA 3ZNGC 2KQ4X 4IC7B 1EWCA 4DWFA 4IUMB 2LGDA 2WXOA 4M00A 4FBJB 1F77A 4I6PA 2D5GA 4MT5A 2L76A 2G1EA 1KTKA 2XBBC 2WXLA 2G3QB 4W9GA 1KF6B 1GPXA 2WXRA 4JLCA 1UBIA 1WX9A 4GB9A 3SFDB 4HJGE 2LJIA 1FRDA 1IBXA 1TT4A 4HKZE 1YNTE 1E7PB 2L32A 4PS3A 3VVWB 2IYDB 4FA6A 2IBIB 4LLGM 1MI0A 3ECIA 1WJUA 1KM7A 4MGKE 4OVZA 4DHZB 2HTME 2LVQA 4G11A 1OEYJ 4BOSC 2GBMA 4OZAA 4MACA 4IG7B 2V4IB 4MGYE 4W9DA 1R8GA 1R7SA 4A9AA 2PKOA 2KX0A 1V2YA 2ZPNA 2AYOB 4AP4C 5IN7A 3PV1A 2ON8A 2Y5BB 1WGKA 1D5ZC 1Q0WB 1WXQA 4ANWA 3B1LX 2G45B 2JF5A 1SJHD 2NPTB 4MGZE 4S17A 1E0ZA 4NJCA 4NJ7A 2FBWB 2JWUA 2PE6B 4KKIA 2JZ3B 3APFA 4HRSA 3QCAA 1KJTA 4HROA 4KSKC 5E6NA 3Q14C 2RR9A 3VDZA 1OQQA 3I57A 2JUOA 4OVVA 4EZLA 3A1QA 4DBGA 2JT4B 1TY2A 3GB1A 3PZ7A 4US8A 2Y5PA 2ACZB 1I4PA 2QMTA 1D5XC 1WGYA 1WH3A 4GU2A 1STEA 2KZRA 3RNBC 1I35A 3L4PA 3EFCA 2A5UA 2BB5A 1UH6A 1YJIA 1NEKB 4HXDA 4WH4A 2JQRB 5D3DA 1RYJA 3L16A 3MC9A 1FFUA 3NZTA 1WWTA 3ML8A 1QZEA 4GVYA 2CHXA 4LNFA 3DHGC 3JYUA 1B1ZA 2GWDA 1SD0A 2AX5A 4FXCA 1GOZA 2DENB 1CJEA 4HKQA 2RSUA 3NVYA 2W54A 1PYWD 1WXSA 4ZOHC 1UNSA 1WE7A 2BS3B 2KJ6A 3DBHI 3H1UA 4J6IA 3MHZA 1I0EA 1VRAB 4TUUA 2X38A 4DDID 1JRUA 1GJZA 2NMQA 4PK1A 4F1SA 3MHSD 3OWEB 2KACA 3Q8EA 1UBQA 3WA0A 5L95C 1VZ7A 3N1XC 3SHQA 2KMCA 2XK5B 5EE9A 2LVOA 3HUIA 3RNFC 2LGIA 1AW7A 2N1VA 4R3DA 2WXKA 1ZPSA 2FCNA 2LFIA 1U6RA 3DBLB 3VXWA 2INDC 4ITKA 2KJHB 3PRMB 1CRKA 3RZFA 1V1PA 2K3UA 4BKSA 4BBNC 1PGXA 4ARCA 4FLHA 2W3RA 1SGHA 2KDEB 3AE4B 2MLBA 1RM6C 3CWIA 4AM1A 1S1QB 1P7FA 5D7GA 1WJ4A 2D3CA 3SFEB 2K9XA 4WIPA 3ZIMA 2N4FA 3AEGB 4XGAB 1EUVB 3R2IA 5EE3A 3MJWA 4KV2A 1VZ8A 2JRHA 4ZRQA 3FC4A 1N60A 2BBCA 3RI7C 3PHWB 1ET6A 4WAAA 1K50A 1GC6A 1GC7A 1XD3B 3AEAB 2DNFA 1PQSA 3DHIC 1D6EC 2H89B 3VUXA 5FR6A 3DRBA 1WF9A 4NAWB 1C4CA 2CHWA 1KRHA 4LDTB 1XF5L 2V9HA 5D3IB 2BYFA 1G0WA 1JCKB 1LM8B 3Q3OC 2LGXA 1WYWB 4BKGA 1VR9A 4DHJB 3NZ3A 2JVCA 3C0RB 5J99A 1LGRA 4WJOA 1FCCC 4GXBA 2EELA 2J4XA 2PW9A 3LJ3A 5LNK1 2DHZA 2ZVNA 1SSNA 1WFYA 3BK2A 2IJ0A 3AECB 4BBNF 2WXJA 1VZ6A 3GOEA 1WI0A 2V3NA 2R2OA 3ZJTA 4W9HA 1WRDB 5EDSA 3IT6B 2DZMA 2V3PA 4GGQA 1EM7A 3H6NA 2IDYA 3NS1A 3D32A 5T8IA 2FCQA 2MJ3A 3WAMA 1L6UA 1R4NB 1SE9A 4ZYNA 2W3SA 4YSXB 2KDIA 5DPSA 5IA7A 1LFDA 2LD9A 4MM3A 4A90A 2PPHA 1WZ3A 1T0RC 3KYCD 4XWTA 1A70A 3ZGZA 1PDXA 3H7PB 4UDUC 1M15A 3M95A 1FNVA 3I3TB 1V97A 3X0WA 1P0RA 5LXIB 1P7EA 4B95A 2LRWA 1HE8A 2JX5A 2QSDA 3PPAA 5C2TB 4Q2RA 1R4NI 3OJ4B 5GXGB 3T8MA 2RDGA 1YQBA 2BYVE 4HVBA 1C4PA 2C7NB 3TJPA 3RZWC 5BMGA 4NJ6A 4HPPA 3ENEA 1ZXHA 2D3GA 1YX5B 1UGMA 2HJ1A 1J8CA 4ZRKA 4AJWA 3DWGC 4NQLB 2JWZA 3PVLA 1EF1A 3AE5B 2AQ1B 1WGRA 3AEDB 4DQOC 1K53A 3R3MA 4REZA 2KFKB 3P1MA 1YN5A 1MG8A 3B2FA 1WX7A 2E6XA 3ZNHB 4EKUA 2CHZA 2K5PA 4USAA 2FUG1 2MQJA 1WXAA 3NZUA 1WMHA 4A8XC 2L3ZA 3DBRI 3A4SC 2JSVX 4FHJA 2GBRA 3VR9B 4IW0A 4ZDVA 3AE1B 2CR5A 2WXFA 4KGRA 2IGGA 1F0ZA 4E71A 3A33B 1MVKA 1QK1A 4WQMA 3NOBA 4OZCA 4N9F4 3VUWA 4D2KA 2IGHA 3VHTC 5D2MB 4NQKE 4M0WB 2L00B 3DDCB 1QKZA 3M63B 4IWQA 3PT2B 5AZFA 3BINA 4XX5A 3ZNID 1XXGA 4HPMB 3A9KB 3AM9A 3IG8A 3DHHC 3AE6B 4ANXA 3W1YA 1VA6A 4HJKA 1EU4A 3Q3FA 3SU8X 2ZNVC 1XQQA 1L4DB 3DCGA 1OQRA 4GMVA 1B9RA 4RF6A 1WR1A 2KJRA 2IO3B 3VR8B 3HK0A 3MP9A 4GLSC 2CJNA 3RULA 5J2RA 1BXTA 4BHLA 3GP7A 1BMLC 1SBBB 2MH7A 2KXJA 1N6ZA 3VTVA 4HDQA 2PIAA 4P6VF 1NENB 2A4ZA 4B6WA 2DYBA 3RNAC 1LXDA 5I4DA 1TJEA 5BMHA 3BVMA 1WX8A 3BWUD 2KVZA 2FCMA 3W2DA 2DAFA 1P1AA 2BQQA 1KOTA 4FJYA 2MHJA 3IG5A 4KDIC 1FM0D 1C78A 2O6VD 1EWYC 3PREA 1DOIA 5IO9A 1AN8A 4JQWC 3T3OA 2KK8A 1J0GA 5EE0A 2WDVB 2ZPYA 2J52A 4HCPB 2KMMA 1PGBA 2UU7A 3ZDTA 2J53A 3L2EA 2KKCA 3TEXA 1C9FA 1TS4A 4RNAA 3AH7A 3IVFA 2FUHB 3W9CB 1N5XA 3ZQ4A 2EMSA 3ZRFA 3CMMB 5D6JB 4K81A 3LN7A 2O6VB 2PMVA 1YQ3B 3QQ8B 1J7CA 3WANA 2LXAA 3I63C 2WS3B 4EUTA 2JYEA 4B9KA 1ZDXA 2OJRA 2Q5WD 1CQVA 1S3SG 1ROEA 2GWCA 1XLOA 4YXDB 1ZGUB 3NUHB 3R66C 1JWSD 5HG2A 3ZLZA 2M0AA 2KTRB 1TZOA 5HI1A 3JU6A 4YWGG 1N63A 3N3KB 3GS2A 1RFKA 2KLCA 4RF8A 1FD6A 1L2NA 2EKEC 2WQYB 2GLSA 5CTRC 1JROA 1XCQL 3E56A 3V6EB 3P4QB 2INPE 4M01A 2CKHB 2R61A 4NAMA 2Y5CA 2EKIA 3A4RA 1ENFA 2UWQA 3AEBB 4JGHB 1UGJA 4GN1A 3T3NA 1K52A 3ZW3A 4GDLB 3JSVA 3W5UB 2DZJA 3KWVA 3RNEC 1ZOYB 4K1RB 3ZJVA 3EA6A 2CJOA 3DVNU 3NJTA 2ZJDA 1M4VA 4PS8A 4TV3A 1WGHA 4MSQB 1GB4A 5HHDG 3OAWA 3B6RA 2L7RA 2YLMA 2Y3AA 2KTRA 3M10A 3ZXVA 3UI3A 3UQAA 3NRZA 2HJ8A 2L1AA 2MSED 4ICVA 1ZXIA 2LZ6A 4WURA 3Q2AC 2K6DB 4NZLB 4C4VB 3TBLD 3DOWA 4ARIA 1QOAA 1TYGB 1DYQA 1YD8U 2LJ5A 5BYSA 4WWPA 4MSMB 4IKGA 3N9YC 4RFBA 3BYTB 4IOIE 2JPHA 2GBKA 2YEPB 4K3CA 5DPRA 4FADA 3DBHB 3URYA 4KX6B 3EECA 1I4HA 2WDTB 4L23A 2WX1A 3H8HA 1FNWA 1WE6A 2I1JA 4NY0A 2YEPF 5BO4B 3AB5A 4MGIE 3IG3A 4A3OA 4W9CA 4XZ4A 1WXVA 2BGFA 3AULA 3ZUNA 2GOWA 1BG0A 3P4SB 4LNKA 1JW9D 4MDKE 2BVCA 1C76A 3WCQA 2CU3A 1V6EA 2NPTA 2AEHA 1ZDVA 1J19A 1SJED 1SIJA 3GE8C 3L0WB 1RLFA 1SF0A 2K8HA 2D2QA 3CF6E 3P4RB 3U30A 1HTOA 3EFUA 3FILB 1DGJA 2AL6A 2B76B 5C3JB 3KUCB 3BIID 3AEFB 1F1HA 2WXQA 2DZKA 2QEJC 5DCNA 1J7AA 1TT5B 4RF9A 1E9MA 2PVGC 3CSTA 2FNJB 4LNIA 4C56C 2KDBA 3IBEA 2KLGA 4KZ0A 3VH4B 4A3PA 4C00A 1TKEA 2AQ2B 3VUYA 1CMXB 1QILA 2J7QB 5IOIA 4W9IA 2W82A 4AS1A 2BPSA 3SD5A 3GE3C 1YJ1A 2LASA 5HFYA 3N30A 1NI3A 2QHOA
chains in the Genus database with same CATH topology
4XYCA 4GVZA 2CRKA 4BG4A 3DREA 2QC8A 4RF9A 4ACFA 2LGSA 2D3CA 4LNIA 2UU7A 4S0RA 4GVYA 4RF8A 1P50A 4LNFA 4BG4B 1F52A 3L2EA 2WHIA 1U6RA 4S17A 3FKYA 4LNOA 1RL9A 1SD0A 5J99A 3L2DA 4LNNA 3DRBA 3B6RA 1HTQA 1CRKA 1LGRA 2GLSA 2J1QA 2D3BA 3JU5A 1M15A 3L2EB 4RF6A 4BHLA 3JPZA 3NG0A 1HTOA 4GW0A 1VRPA 4HPPA 4RF7A 3ZXRA 3M10A 1BG0A 2OJWA 3JQ3A 2WGSA 4LNKA 3ZXVA 4BAXA 1QK1A 4GW2A 5J9AA 1G0WA 1QH4A 2BVCA 4Z9MA 1FPYA 4Q2RA 1F1HA 3JU6A 4AM1A 2D3AA 1I0EA 1P52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYC A;  4GVZ A;  2CRK A;  4BG4 A;  3DRE A;  2QC8 A;  4RF9 A;  4ACF A;  2LGS A;  2D3C A;  4LNI A;  2UU7 A;  4S0R A;  4GVY A;  4RF8 A;  1P50 A;  4LNF A;  4BG4 B;  1F52 A;  3L2E A;  2WHI A;  1U6R A;  4S17 A;  3FKY A;  4LNO A;  1RL9 A;  1SD0 A;  5J99 A;  3L2D A;  4LNN A;  3DRB A;  3B6R A;  1HTQ A;  1CRK A;  1LGR A;  2GLS A;  2J1Q A;  2D3B A;  3JU5 A;  1M15 A;  3L2E B;  4RF6 A;  4BHL A;  3JPZ A;  3NG0 A;  1HTO A;  4GW0 A;  1VRP A;  4HPP A;  4RF7 A;  3ZXR A;  3M10 A;  1BG0 A;  2OJW A;  3JQ3 A;  2WGS A;  4LNK A;  3ZXV A;  4BAX A;  1QK1 A;  4GW2 A;  5J9A A;  1G0W A;  1QH4 A;  2BVC A;  4Z9M A;  1FPY A;  4Q2R A;  1F1H A;  3JU6 A;  4AM1 A;  2D3A A;  1I0E A;  1P52 A; 
#chains in the Genus database with same CATH topology
 5KHQ A;  2LXC A;  2QC8 A;  2RDH A;  1KH0 A;  3PGE A;  3DBS A;  4BG4 B;  4GDK B;  2Z8L A;  5HKH A;  2HTH A;  4I6N B;  2BYE A;  3P42 A;  3KUD B;  4AUQ C;  2NTT A;  5G5H A;  3HHM A;  4P16 A;  1VJK A;  1WYG A;  1RWS A;  4ICU A;  1CZP A;  3L08 A;  2KQ7 A;  2WXH A;  4MEM A;  4TQ1 A;  3JVZ X;  1QF6 A;  2ICI A;  2TSS A;  2G4S A;  1MPE A;  2XN9 C;  2L83 A;  3AN1 A;  2J1Q A;  3JU5 A;  2XK5 A;  3UQB A;  2LMC A;  1TS2 A;  3UGB B;  1JQ4 A;  3W5V B;  2KO3 A;  1LO5 D;  4B0M A;  2N1W A;  4GOC A;  1CK1 A;  1I42 A;  4WJN A;  2KAN A;  2IO1 B;  4RM9 A;  1L5P A;  2VZK D;  3UF8 A;  4AJY B;  3PRP B;  2K1F A;  2RDB C;  3RD2 A;  4KDL B;  1JWA D;  3L2D A;  2DX5 B;  3PLU A;  3RCZ A;  3OJ3 A;  1AAR A;  2LVP A;  1C1Y B;  3Q8A A;  4MJS B;  2KWD A;  2GMI C;  3AU4 A;  2CRK A;  3PS6 A;  1I4G A;  2VH2 A;  1E8W A;  1G6J A;  4WAF A;  2ZCC A;  1NDD A;  2MBB B;  2VZK B;  4K3B A;  2REX A;  3BVG A;  2JZP A;  4RGO S;  1T6B X;  1NYR A;  2M17 A;  4M8M A;  1T3Q A;  4KVG B;  2MBH A;  4LCD E;  2NCN A;  3KVF B;  4E74 A;  5C23 A;  3HRD D;  1JRP A;  5KHO A;  5FKA C;  2RMM A;  2N9X A;  4NAW A;  1NBF C;  2NBW B;  2W9N A;  4L2Y A;  1FRR A;  1VDV A;  2I38 A;  5BYQ A;  2JXT A;  2JXX A;  3B08 A;  1ZKH A;  3RFZ B;  3HM6 X;  4WJP A;  3RNC C;  1KLV A;  3P2B A;  4N6E B;  4CYE A;  2MW5 A;  3R8B A;  2C9W B;  2M19 A;  3V6C B;  3IHP C;  1UEL A;  3Q69 A;  1ESF A;  3ZKJ C;  2M56 B;  5JZE B;  3VAW A;  3PRZ A;  4XE0 A;  1ZP0 B;  2DAJ A;  4KZC A;  4ZRP A;  1Z5S B;  2L52 A;  1E5W A;  3DVG X;  4HPL B;  4CO7 A;  2D11 A;  1ZW7 A;  1TKY A;  5TR5 A;  5J17 A;  2NR2 A;  3DBR B;  4IWP A;  1L4Z B;  2UYZ B;  5D94 A;  1OGW A;  3OLM D;  3WAP A;  3MC8 A;  2FIF A;  1EF5 A;  1SIF A;  1SE4 A;  2BWE S;  4J3O D;  3HM3 A;  3B9J A;  3WIM A;  2KT7 A;  4DXA B;  2QJL A;  1K8R B;  1JWB D;  2Z59 B;  1MHX A;  1R4M I;  1MFW A;  2D3A A;  1QT9 A;  3EHV A;  2IO2 B;  4LK0 M;  5G55 A;  2LGS A;  4GSW A;  2LUM A;  4RGN A;  3H7P A;  2WHI A;  1V9J A;  4JE3 B;  3NVW A;  1WZ0 A;  4IM3 A;  4HWI B;  3WAO A;  4Q2J A;  1T0Y A;  1IUE A;  2IPK D;  1YJJ A;  4AOF A;  3V05 A;  3U2S C;  2AQ3 B;  4XYC A;  3ALB A;  3ZRC A;  2ZZP B;  1L7Y A;  3LVV A;  1IPG A;  3I5J C;  1JWM D;  1Y56 A;  2KN4 A;  1T0Q C;  1Q5W B;  4IM2 A;  1OFF A;  2FID A;  1HZ6 A;  4RMA A;  3KYD D;  3O13 A;  1NI2 A;  4G3X B;  1QH4 A;  2INC C;  1RRB A;  2WDQ B;  4FN2 A;  4B0E A;  1YIW A;  3KQ4 A;  2LGY A;  1HA5 A;  1JML A;  2BW2 A;  1K51 A;  4II3 B;  3C19 A;  3GZN I;  3ZYY X;  1MJD A;  4KIK B;  2KFK A;  1TZ1 A;  3APD A;  2YVC A;  4K7U A;  2FAZ A;  2WP9 B;  4FJZ A;  3L13 A;  4LTU A;  2O2V B;  2KWU B;  2JYT A;  2W55 A;  4W9L A;  1WRI A;  3VTU A;  3N32 A;  2R2Q A;  1HZ5 A;  3AI5 A;  3Q3N C;  1D5M C;  4ZHP A;  5AEK B;  4HEA 1;  3NVV A;  1E90 A;  3T9L A;  1C4A A;  3B0A A;  2PLP A;  1WJ6 A;  4BKT A;  2OHF A;  4G0N B;  2D07 B;  2JZZ A;  3BY4 B;  5AZH A;  4L1B A;  2Z0D B;  3WAL A;  2K8B A;  4AQ7 A;  5LXH A;  5E6P A;  4M0W A;  2MP2 B;  1A5R A;  1E7V A;  2ASQ A;  4RM8 A;  4QAY A;  1FXA A;  3H7S A;  3A9K A;  2BKF A;  4LJP B;  3A9J B;  2WXM A;  2LEK A;  4CQN A;  4W9J A;  4ASW C;  4WQO B;  3M62 B;  2ZNV B;  2OOB B;  4TQ0 A;  4NPN A;  2BS4 B;  3AE2 B;  3UIN B;  2D10 A;  1YOV B;  2RGF A;  3HVD A;  3K9P B;  1WM3 A;  2QDF A;  3QC8 B;  4A6Q A;  2MCN B;  1XCT L;  2SAK A;  2KQS A;  3FKY A;  3LN6 A;  2WU5 B;  2I1K A;  2KWC A;  3AEE B;  3VFK A;  1V5O A;  3LVW A;  3FAH A;  2WGS A;  4PYZ A;  1IBX B;  3H9D A;  3V61 A;  2M4N A;  4JWU C;  3P4P B;  3K9O B;  3SDL C;  1HQR D;  2L05 A;  1V80 A;  3EUB 2;  4OZB A;  4W9K A;  2WWZ A;  3NVZ A;  2KTF A;  3AE9 B;  2G9H D;  2L8J A;  4RF0 A;  1EO6 A;  1GNU A;  3RN9 C;  4YTN B;  4ZRJ A;  1WGG A;  1FCL A;  3ZJU A;  2LWP A;  3BYY B;  1BT0 A;  4GW2 A;  2XEW A;  2MA9 B;  2KAJ A;  3CIR B;  3JW0 X;  1NVI D;  1TGZ B;  5JHB A;  3V3X A;  2ZCB A;  3TEW A;  1M94 A;  3R7R A;  4X57 B;  1GAQ B;  2RPQ A;  2WXP A;  3TSS A;  3QWZ B;  3DPD A;  4EFO A;  5GMV A;  3W1S A;  2C7M B;  3VTW A;  1MG4 A;  4EEW A;  1V8C A;  3ZTD A;  4K7S A;  3ABV B;  1TY0 A;  2WNM A;  3VRB B;  3A1Q B;  3UIO B;  1TIF A;  3EGR A;  4AWJ A;  1GB1 A;  3U4E G;  3ZVV A;  1TTN A;  2IY0 B;  2J0J A;  2LRU A;  3PHX B;  3JQ3 A;  2O6V A;  2KOX A;  2K22 A;  1XO3 A;  5TSS A;  4YT0 B;  2GBJ A;  4GVZ A;  1E8X A;  3KUZ A;  3B2G A;  1C79 A;  2MBE A;  2D33 A;  1XEE A;  4LNN A;  3R7Q A;  4IWO A;  1N5W A;  4GW0 A;  4P1C C;  3ZXR A;  1TKG A;  4YTM B;  4ZRI A;  3U8Z A;  3DQV A;  4P7I A;  2HE7 A;  3TEZ A;  3L17 A;  2WXI A;  2BKR B;  5H92 C;  2PJH A;  3QX1 A;  2V1Y A;  3S2A A;  1C77 A;  2NTS A;  1D4B A;  1RL9 A;  1UZX B;  1ISN A;  4ZHO A;  2MBQ A;  2WXG A;  2I2Y A;  1IGC A;  5EE1 A;  1V86 A;  2ZEQ A;  3LYY A;  1IGD A;  2LUE A;  4BKS D;  2RD0 A;  4DHZ E;  1UF0 A;  4H2A A;  1EU3 A;  1DOX A;  1X1M A;  3DWM A;  4F8C B;  5L83 A;  4RGT A;  4JL9 A;  2HDE A;  3AXC A;  2HD5 B;  4GDL A;  1T0S C;  2ONQ A;  3Q6B A;  3VH3 B;  2C7H A;  2WYQ A;  4FJV B;  3KW5 B;  4DDG D;  4MH8 A;  3U7D A;  1V49 A;  3V62 A;  4EOY A;  1V1P B;  2BS2 B;  1TS5 A;  5LLI A;  3RPF C;  1RFA A;  2GRI A;  4GIV A;  1YQ4 B;  3APC A;  1N61 A;  1NYQ A;  5MPO A;  2BWF A;  2Z0E B;  5FK9 C;  3VRA B;  2BYT A;  2MEK A;  1F52 A;  2GI9 A;  4HK2 A;  2PEA A;  2DBY A;  1HXY D;  1FMA D;  1T5X D;  2MX2 A;  3NG0 A;  3SR6 A;  4DXF A;  5DPT A;  3ZNZ B;  1Z2M A;  1LQB A;  4KSL C;  3NS8 A;  4KKJ A;  4C4V A;  1FEH A;  2IO0 B;  1E8Y A;  2N9P C;  2LI5 A;  1WJN A;  2ZW0 A;  4KGS A;  2J0K A;  3ML9 A;  2BF8 B;  1WR6 E;  4YTP B;  2B3A A;  2NBU A;  4MEL A;  5AUI A;  1HEZ E;  4W9F A;  3UIP B;  2CS4 A;  4WWO A;  1HTQ A;  2GBN A;  4BOZ B;  1U4A A;  2BB6 A;  4N58 A;  4JX1 C;  1ET9 A;  1YN3 A;  2K8C A;  3SEB A;  2GB1 A;  4PYU A;  3NHE B;  4WJQ A;  1OQY A;  1JWU D;  3N1Z C;  1UD7 A;  4JPS A;  4N59 A;  1FIQ A;  1YMH E;  3ZO5 B;  1AWD A;  1SE3 A;  3MFG A;  2JU6 X;  1WY8 A;  1KLG D;  4BAX A;  1JAL A;  4C7Z A;  3J9C A;  4HCN B;  1WSP A;  4XC2 A;  1ZUD 2;  3AMZ A;  5FR3 A;  3IFW B;  2MWS B;  3Q3M C;  1XLP A;  4WWN A;  3BK1 A;  4EZJ A;  5BMI A;  3QJZ A;  1P9D U;  4LDT D;  1AYF A;  4BVU C;  5CX3 A;  1PFD A;  1I4X A;  3DBL I;  1VD2 A;  3FIL A;  4XDD A;  5H8Y E;  2D32 A;  3QK0 A;  3C8Y A;  3IAS 1;  3TCA A;  3QA8 A;  5IKC M;  1N62 A;  5C1Z A;  4DHJ D;  4A20 A;  3QAR A;  2ZW1 A;  4DXG A;  2KHW B;  1GUA B;  5DPW A;  2KVR A;  3LB8 C;  4M8N A;  3TUO A;  2QIL A;  4YL8 A;  4MM3 B;  2E3T A;  1SE2 A;  2PVO D;  3JPZ A;  1WM2 A;  1FO4 A;  1SXT A;  1L0V B;  2M0X A;  3BZD B;  1F2R C;  5IP4 D;  4BG4 A;  3DRE A;  4GDK A;  1UUP A;  3IXS A;  4E3C A;  1UWM A;  3TMP B;  4YSZ B;  1KLU D;  5CHV C;  2WLB A;  3MC0 B;  4OHJ A;  2MRP A;  4ANU A;  2SEB D;  3V60 A;  3N20 C;  2KMA A;  1KFY B;  1IP9 A;  2C60 A;  3AE8 B;  2BT6 A;  1ZE3 D;  2KC1 A;  3OG5 A;  2KC2 A;  5E6J A;  1ACC A;  5CHF A;  1QQR A;  4ACF A;  4DK5 A;  3Q8F A;  5JH5 C;  2JY6 A;  4C80 A;  1RAX A;  3KLS X;  2AWT A;  3CSF A;  3E9S A;  3ONS A;  1FXI A;  2VRR B;  1L0X B;  2N0S B;  4W9E A;  3QHT A;  2RPV A;  3BVZ A;  4BFR A;  5JHA A;  3QIJ A;  1WMH B;  2IGD A;  4WWM A;  2N7D A;  2J0M A;  4RH6 A;  4OVU A;  1I7H A;  3ZTC A;  3L10 B;  3M3J A;  2M8S A;  4O1N A;  4NNJ B;  4MJS A;  4G50 A;  1F9J A;  2DZI A;  1R4M B;  5CHW A;  2JRI B;  1IYF A;  1Q1O A;  3PZD A;  2NVU I;  3VQI A;  5G2N A;  2N7J A;  4F7Z A;  5JXV A;  1QOB A;  3ZDM C;  3PO0 A;  2L0F A;  1SB3 C;  3PZ8 A;  1WXM A;  2K39 A;  2LHD A;  4RGM A;  3TL5 A;  4LJO B;  3HIZ A;  1F2R I;  1XLQ A;  3Q8B A;  1I4Q A;  1E10 A;  1FPY A;  1QOG A;  4KGT A;  3LXF A;  4PT5 A;  4JWS C;  3MJ5 A;  2KYW A;  3QAQ A;  4EE2 A;  1QOF A;  3IT4 B;  3IAM 1;  3KWL A;  1XT9 B;  4JIO U;  4RCO A;  1P98 A;  4TMA B;  2K0P A;  1V4G A;  4P1B C;  4OW0 A;  1V81 A;  4US9 A;  1H8C A;  2QCZ A;  2AL3 A;  3GZN B;  2N9K A;  2V3S A;  2NBV B;  4S0R A;  1P50 A;  4MH0 E;  4C7Y A;  1V1O A;  2VH1 A;  3Q3J A;  3U7Z A;  3HVZ A;  3NY5 A;  3DVG Y;  3RT3 B;  1C3T A;  3TEY A;  1D3Z A;  1MHH E;  4Z9M A;  2CU1 A;  1TS3 A;  2G4D B;  3LDZ E;  1PGA A;  4YSY B;  3AV8 A;  1FNU A;  2DLB A;  3MTN B;  4FUL A;  4A55 A;  1Y8R C;  2FCS A;  4ZYS A;  2V0G A;  2L0T A;  4BZA A;  4RF1 A;  4M02 A;  1H4R A;  5J18 A;  1FFV A;  1OTR B;  2OJW A;  4K7W A;  5AZG A;  1Q10 A;  2K25 A;  4XWW A;  2WU2 B;  2DYO A;  4PS7 A;  2C5L C;  3TIX A;  2X8X X;  1GG3 A;  2WX0 A;  3NZS A;  3W1S C;  2K6Q A;  2QIE B;  3EC8 A;  3PSE B;  3RNG C;  1I4R A;  2N9E B;  3R2T A;  3L2E B;  1UWX A;  4II2 B;  2KX3 A;  1OEY A;  3I9V 1;  4I6L B;  3RYT A;  3L54 A;  2MJD A;  1V5T A;  5IAA C;  2KNB A;  4TSS A;  2IZV B;  3AE7 B;  2DWQ A;  2MBO A;  1PUT A;  1BUI C;  4HDO A;  3O65 B;  1YN4 A;  2WXN A;  4IM0 A;  4ANV A;  3KH0 A;  3AU5 A;  3P63 A;  2D3B A;  2H88 B;  2XNA C;  3X23 A;  1QLB B;  4RF7 A;  1VLB A;  2MJE A;  2IY1 B;  2LHE A;  4IDI A;  5G5G A;  3U52 E;  5J9A A;  2N7E A;  4KIK A;  1WIA A;  1E6E B;  4TKN A;  1L6V A;  2KN5 A;  2KDM A;  3Q8C A;  4EZK A;  2O2V A;  3PLV A;  4URK A;  2PTL A;  3RMK C;  2INN E;  2M1M A;  1VCB A;  2OED A;  1J7B A;  2J42 A;  1L0Y B;  3PTF C;  3N1Y C;  1E7U A;  2KFJ A;  2N9L A;  1P52 A;  1FXT B;  1E8Z A;  1SEB D;  2KD0 A;  1XLN A;  2PE9 A;  4HLE A;  2DYM A;  2EMT A;  2KWV B;  2V4L A;  1TBE A;  4LNO A;  3RUI B;  4FHK A;  5AUK A;  1DOY A;  1VRP A;  2MP2 A;  2FE8 A;  3JSV B;  2NS5 A;  1YX6 B;  4CHK A;  2BTE A;  5BYR A;  5E6O A;  4XDC A;  1WGD A;  3AE3 B;  2KDF B;  2WDR B;  3ETR A;  3DVN V;  3A9J A;  1P3Q U;  2ZVO A;  3ZNG C;  2KQ4 X;  4IC7 B;  1EWC A;  4DWF A;  4IUM B;  2LGD A;  2WXO A;  4M00 A;  4FBJ B;  1F77 A;  4I6P A;  2D5G A;  4MT5 A;  2L76 A;  2G1E A;  1KTK A;  2XBB C;  2WXL A;  2G3Q B;  4W9G A;  1KF6 B;  1GPX A;  2WXR A;  4JLC A;  1UBI A;  1WX9 A;  4GB9 A;  3SFD B;  4HJG E;  2LJI A;  1FRD A;  1IBX A;  1TT4 A;  4HKZ E;  1YNT E;  1E7P B;  2L32 A;  4PS3 A;  3VVW B;  2IYD B;  4FA6 A;  2IBI B;  4LLG M;  1MI0 A;  3ECI A;  1WJU A;  1KM7 A;  4MGK E;  4OVZ A;  4DHZ B;  2HTM E;  2LVQ A;  4G11 A;  1OEY J;  4BOS C;  2GBM A;  4OZA A;  4MAC A;  4IG7 B;  2V4I B;  4MGY E;  4W9D A;  1R8G A;  1R7S A;  4A9A A;  2PKO A;  2KX0 A;  1V2Y A;  2ZPN A;  2AYO B;  4AP4 C;  5IN7 A;  3PV1 A;  2ON8 A;  2Y5B B;  1WGK A;  1D5Z C;  1Q0W B;  1WXQ A;  4ANW A;  3B1L X;  2G45 B;  2JF5 A;  1SJH D;  2NPT B;  4MGZ E;  4S17 A;  1E0Z A;  4NJC A;  4NJ7 A;  2FBW B;  2JWU A;  2PE6 B;  4KKI A;  2JZ3 B;  3APF A;  4HRS A;  3QCA A;  1KJT A;  4HRO A;  4KSK C;  5E6N A;  3Q14 C;  2RR9 A;  3VDZ A;  1OQQ A;  3I57 A;  2JUO A;  4OVV A;  4EZL A;  3A1Q A;  4DBG A;  2JT4 B;  1TY2 A;  3GB1 A;  3PZ7 A;  4US8 A;  2Y5P A;  2ACZ B;  1I4P A;  2QMT A;  1D5X C;  1WGY A;  1WH3 A;  4GU2 A;  1STE A;  2KZR A;  3RNB C;  1I35 A;  3L4P A;  3EFC A;  2A5U A;  2BB5 A;  1UH6 A;  1YJI A;  1NEK B;  4HXD A;  4WH4 A;  2JQR B;  5D3D A;  1RYJ A;  3L16 A;  3MC9 A;  1FFU A;  3NZT A;  1WWT A;  3ML8 A;  1QZE A;  4GVY A;  2CHX A;  4LNF A;  3DHG C;  3JYU A;  1B1Z A;  2GWD A;  1SD0 A;  2AX5 A;  4FXC A;  1GOZ A;  2DEN B;  1CJE A;  4HKQ A;  2RSU A;  3NVY A;  2W54 A;  1PYW D;  1WXS A;  4ZOH C;  1UNS A;  1WE7 A;  2BS3 B;  2KJ6 A;  3DBH I;  3H1U A;  4J6I A;  3MHZ A;  1I0E A;  1VRA B;  4TUU A;  2X38 A;  4DDI D;  1JRU A;  1GJZ A;  2NMQ A;  4PK1 A;  4F1S A;  3MHS D;  3OWE B;  2KAC A;  3Q8E A;  1UBQ A;  3WA0 A;  5L95 C;  1VZ7 A;  3N1X C;  3SHQ A;  2KMC A;  2XK5 B;  5EE9 A;  2LVO A;  3HUI A;  3RNF C;  2LGI A;  1AW7 A;  2N1V A;  4R3D A;  2WXK A;  1ZPS A;  2FCN A;  2LFI A;  1U6R A;  3DBL B;  3VXW A;  2IND C;  4ITK A;  2KJH B;  3PRM B;  1CRK A;  3RZF A;  1V1P A;  2K3U A;  4BKS A;  4BBN C;  1PGX A;  4ARC A;  4FLH A;  2W3R A;  1SGH A;  2KDE B;  3AE4 B;  2MLB A;  1RM6 C;  3CWI A;  4AM1 A;  1S1Q B;  1P7F A;  5D7G A;  1WJ4 A;  2D3C A;  3SFE B;  2K9X A;  4WIP A;  3ZIM A;  2N4F A;  3AEG B;  4XGA B;  1EUV B;  3R2I A;  5EE3 A;  3MJW A;  4KV2 A;  1VZ8 A;  2JRH A;  4ZRQ A;  3FC4 A;  1N60 A;  2BBC A;  3RI7 C;  3PHW B;  1ET6 A;  4WAA A;  1K50 A;  1GC6 A;  1GC7 A;  1XD3 B;  3AEA B;  2DNF A;  1PQS A;  3DHI C;  1D6E C;  2H89 B;  3VUX A;  5FR6 A;  3DRB A;  1WF9 A;  4NAW B;  1C4C A;  2CHW A;  1KRH A;  4LDT B;  1XF5 L;  2V9H A;  5D3I B;  2BYF A;  1G0W A;  1JCK B;  1LM8 B;  3Q3O C;  2LGX A;  1WYW B;  4BKG A;  1VR9 A;  4DHJ B;  3NZ3 A;  2JVC A;  3C0R B;  5J99 A;  1LGR A;  4WJO A;  1FCC C;  4GXB A;  2EEL A;  2J4X A;  2PW9 A;  3LJ3 A;  5LNK 1;  2DHZ A;  2ZVN A;  1SSN A;  1WFY A;  3BK2 A;  2IJ0 A;  3AEC B;  4BBN F;  2WXJ A;  1VZ6 A;  3GOE A;  1WI0 A;  2V3N A;  2R2O A;  3ZJT A;  4W9H A;  1WRD B;  5EDS A;  3IT6 B;  2DZM A;  2V3P A;  4GGQ A;  1EM7 A;  3H6N A;  2IDY A;  3NS1 A;  3D32 A;  5T8I A;  2FCQ A;  2MJ3 A;  3WAM A;  1L6U A;  1R4N B;  1SE9 A;  4ZYN A;  2W3S A;  4YSX B;  2KDI A;  5DPS A;  5IA7 A;  1LFD A;  2LD9 A;  4MM3 A;  4A90 A;  2PPH A;  1WZ3 A;  1T0R C;  3KYC D;  4XWT A;  1A70 A;  3ZGZ A;  1PDX A;  3H7P B;  4UDU C;  1M15 A;  3M95 A;  1FNV A;  3I3T B;  1V97 A;  3X0W A;  1P0R A;  5LXI B;  1P7E A;  4B95 A;  2LRW A;  1HE8 A;  2JX5 A;  2QSD A;  3PPA A;  5C2T B;  4Q2R A;  1R4N I;  3OJ4 B;  5GXG B;  3T8M A;  2RDG A;  1YQB A;  2BYV E;  4HVB A;  1C4P A;  2C7N B;  3TJP A;  3RZW C;  5BMG A;  4NJ6 A;  4HPP A;  3ENE A;  1ZXH A;  2D3G A;  1YX5 B;  1UGM A;  2HJ1 A;  1J8C A;  4ZRK A;  4AJW A;  3DWG C;  4NQL B;  2JWZ A;  3PVL A;  1EF1 A;  3AE5 B;  2AQ1 B;  1WGR A;  3AED B;  4DQO C;  1K53 A;  3R3M A;  4REZ A;  2KFK B;  3P1M A;  1YN5 A;  1MG8 A;  3B2F A;  1WX7 A;  2E6X A;  3ZNH B;  4EKU A;  2CHZ A;  2K5P A;  4USA A;  2FUG 1;  2MQJ A;  1WXA A;  3NZU A;  1WMH A;  4A8X C;  2L3Z A;  3DBR I;  3A4S C;  2JSV X;  4FHJ A;  2GBR A;  3VR9 B;  4IW0 A;  4ZDV A;  3AE1 B;  2CR5 A;  2WXF A;  4KGR A;  2IGG A;  1F0Z A;  4E71 A;  3A33 B;  1MVK A;  1QK1 A;  4WQM A;  3NOB A;  4OZC A;  4N9F 4;  3VUW A;  4D2K A;  2IGH A;  3VHT C;  5D2M B;  4NQK E;  4M0W B;  2L00 B;  3DDC B;  1QKZ A;  3M63 B;  4IWQ A;  3PT2 B;  5AZF A;  3BIN A;  4XX5 A;  3ZNI D;  1XXG A;  4HPM B;  3A9K B;  3AM9 A;  3IG8 A;  3DHH C;  3AE6 B;  4ANX A;  3W1Y A;  1VA6 A;  4HJK A;  1EU4 A;  3Q3F A;  3SU8 X;  2ZNV C;  1XQQ A;  1L4D B;  3DCG A;  1OQR A;  4GMV A;  1B9R A;  4RF6 A;  1WR1 A;  2KJR A;  2IO3 B;  3VR8 B;  3HK0 A;  3MP9 A;  4GLS C;  2CJN A;  3RUL A;  5J2R A;  1BXT A;  4BHL A;  3GP7 A;  1BML C;  1SBB B;  2MH7 A;  2KXJ A;  1N6Z A;  3VTV A;  4HDQ A;  2PIA A;  4P6V F;  1NEN B;  2A4Z A;  4B6W A;  2DYB A;  3RNA C;  1LXD A;  5I4D A;  1TJE A;  5BMH A;  3BVM A;  1WX8 A;  3BWU D;  2KVZ A;  2FCM A;  3W2D A;  2DAF A;  1P1A A;  2BQQ A;  1KOT A;  4FJY A;  2MHJ A;  3IG5 A;  4KDI C;  1FM0 D;  1C78 A;  2O6V D;  1EWY C;  3PRE A;  1DOI A;  5IO9 A;  1AN8 A;  4JQW C;  3T3O A;  2KK8 A;  1J0G A;  5EE0 A;  2WDV B;  2ZPY A;  2J52 A;  4HCP B;  2KMM A;  1PGB A;  2UU7 A;  3ZDT A;  2J53 A;  3L2E A;  2KKC A;  3TEX A;  1C9F A;  1TS4 A;  4RNA A;  3AH7 A;  3IVF A;  2FUH B;  3W9C B;  1N5X A;  3ZQ4 A;  2EMS A;  3ZRF A;  3CMM B;  5D6J B;  4K81 A;  3LN7 A;  2O6V B;  2PMV A;  1YQ3 B;  3QQ8 B;  1J7C A;  3WAN A;  2LXA A;  3I63 C;  2WS3 B;  4EUT A;  2JYE A;  4B9K A;  1ZDX A;  2OJR A;  2Q5W D;  1CQV A;  1S3S G;  1ROE A;  2GWC A;  1XLO A;  4YXD B;  1ZGU B;  3NUH B;  3R66 C;  1JWS D;  5HG2 A;  3ZLZ A;  2M0A A;  2KTR B;  1TZO A;  5HI1 A;  3JU6 A;  4YWG G;  1N63 A;  3N3K B;  3GS2 A;  1RFK A;  2KLC A;  4RF8 A;  1FD6 A;  1L2N A;  2EKE C;  2WQY B;  2GLS A;  5CTR C;  1JRO A;  1XCQ L;  3E56 A;  3V6E B;  3P4Q B;  2INP E;  4M01 A;  2CKH B;  2R61 A;  4NAM A;  2Y5C A;  2EKI A;  3A4R A;  1ENF A;  2UWQ A;  3AEB B;  4JGH B;  1UGJ A;  4GN1 A;  3T3N A;  1K52 A;  3ZW3 A;  4GDL B;  3JSV A;  3W5U B;  2DZJ A;  3KWV A;  3RNE C;  1ZOY B;  4K1R B;  3ZJV A;  3EA6 A;  2CJO A;  3DVN U;  3NJT A;  2ZJD A;  1M4V A;  4PS8 A;  4TV3 A;  1WGH A;  4MSQ B;  1GB4 A;  5HHD G;  3OAW A;  3B6R A;  2L7R A;  2YLM A;  2Y3A A;  2KTR A;  3M10 A;  3ZXV A;  3UI3 A;  3UQA A;  3NRZ A;  2HJ8 A;  2L1A A;  2MSE D;  4ICV A;  1ZXI A;  2LZ6 A;  4WUR A;  3Q2A C;  2K6D B;  4NZL B;  4C4V B;  3TBL D;  3DOW A;  4ARI A;  1QOA A;  1TYG B;  1DYQ A;  1YD8 U;  2LJ5 A;  5BYS A;  4WWP A;  4MSM B;  4IKG A;  3N9Y C;  4RFB A;  3BYT B;  4IOI E;  2JPH A;  2GBK A;  2YEP B;  4K3C A;  5DPR A;  4FAD A;  3DBH B;  3URY A;  4KX6 B;  3EEC A;  1I4H A;  2WDT B;  4L23 A;  2WX1 A;  3H8H A;  1FNW A;  1WE6 A;  2I1J A;  4NY0 A;  2YEP F;  5BO4 B;  3AB5 A;  4MGI E;  3IG3 A;  4A3O A;  4W9C A;  4XZ4 A;  1WXV A;  2BGF A;  3AUL A;  3ZUN A;  2GOW A;  1BG0 A;  3P4S B;  4LNK A;  1JW9 D;  4MDK E;  2BVC A;  1C76 A;  3WCQ A;  2CU3 A;  1V6E A;  2NPT A;  2AEH A;  1ZDV A;  1J19 A;  1SJE D;  1SIJ A;  3GE8 C;  3L0W B;  1RLF A;  1SF0 A;  2K8H A;  2D2Q A;  3CF6 E;  3P4R B;  3U30 A;  1HTO A;  3EFU A;  3FIL B;  1DGJ A;  2AL6 A;  2B76 B;  5C3J B;  3KUC B;  3BII D;  3AEF B;  1F1H A;  2WXQ A;  2DZK A;  2QEJ C;  5DCN A;  1J7A A;  1TT5 B;  4RF9 A;  1E9M A;  2PVG C;  3CST A;  2FNJ B;  4LNI A;  4C56 C;  2KDB A;  3IBE A;  2KLG A;  4KZ0 A;  3VH4 B;  4A3P A;  4C00 A;  1TKE A;  2AQ2 B;  3VUY A;  1CMX B;  1QIL A;  2J7Q B;  5IOI A;  4W9I A;  2W82 A;  4AS1 A;  2BPS A;  3SD5 A;  3GE3 C;  1YJ1 A;  2LAS A;  5HFY A;  3N30 A;  1NI3 A;  2QHO A; 
#chains in the Genus database with same CATH homology
 4XYC A;  4GVZ A;  2CRK A;  4BG4 A;  3DRE A;  2QC8 A;  4RF9 A;  4ACF A;  2LGS A;  2D3C A;  4LNI A;  2UU7 A;  4S0R A;  4GVY A;  4RF8 A;  1P50 A;  4LNF A;  4BG4 B;  1F52 A;  3L2E A;  2WHI A;  1U6R A;  4S17 A;  3FKY A;  4LNO A;  1RL9 A;  1SD0 A;  5J99 A;  3L2D A;  4LNN A;  3DRB A;  3B6R A;  1HTQ A;  1CRK A;  1LGR A;  2GLS A;  2J1Q A;  2D3B A;  3JU5 A;  1M15 A;  3L2E B;  4RF6 A;  4BHL A;  3JPZ A;  3NG0 A;  1HTO A;  4GW0 A;  1VRP A;  4HPP A;  4RF7 A;  3ZXR A;  3M10 A;  1BG0 A;  2OJW A;  3JQ3 A;  2WGS A;  4LNK A;  3ZXV A;  4BAX A;  1QK1 A;  4GW2 A;  5J9A A;  1G0W A;  1QH4 A;  2BVC A;  4Z9M A;  1FPY A;  4Q2R A;  1F1H A;  3JU6 A;  4AM1 A;  2D3A A;  1I0E A;  1P52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...