3ZY7A

Crystal structure of computationally redesigned gamma-adaptin appendage domain forming a symmetric homodimer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
116
Chain Sequence
b'MIPSITAYDALGLKIEFTFERSSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTFNWNGYKVQSEAEVNNFPPQSWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-1 COMPLEX SUBUNIT GAMMA-1
publication title Computational Design of a Symmetric Homodimer Using Beta-Strand Assembly.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 23
structure length 116
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zy7A00
5CN1A 1B9KA 1QTPA 1GYVA 1OM9A 1KYFA 1KYDA 1KY7A 1P4UA 2A7BA 1W80A 3ZY7A 3ZHFA 2DWYA 2YMTA 5CN2A 1KYUA 1NA8A 4BCXA 3HS8A 1GYWA 1QTSA 2E9GA 1KY6A 2DWXA 1IU1A 3MNMA 2VJ0A 1GYUA
chains in the Genus database with same CATH superfamily
2EINB 2RD0A 1BVLB 1T4WA 4HWBH 3N0PB 4WLCA 1NUDA 4G6FD 1FAIH 2JKLA 4RLDA 2I85A 1EEQA 4LLWA 5G4OA 5TK4A 3J8F7 4DUXA 5E6IA 4KHTL 4JG5A 4OKVB 3DUUA 1BREA 2FBJL 2K3TA 4M62L 2AJ3B 2FT7A 1L9NA 3N41B 1M9WA 1T6WA 2QVMA 4JY5H 4Y4HC 3SPVA 1FV1B 1SYSA 5JIKA 3PAYA 1I9RH 3OAYH 1NANI 3QFJB 3S88H 1FGNH 4Z7VE 3DX4A 1DUZB 1M6OB 1T04A 4FLHA 4LEEA 4EXPX 1UH2A 1SN2A 5HHOE 2DDQL 1YMMA 3TH4T 3GXNA 1UCBL 4CVXA 4F80A 3RHWF 2F2HA 5B3SB 4YLCA 5I5IA 1RIHH 5B3JE 4DZBB 5KSUB 3MRLA 1EDQA 4UB0H 4F2MB 1H6EA 2BVTA 1BDYA 3BYYA 2PW2B 2JH2A 4MZIA 3GMRA 3DSNA 3L2NA 3QR1A 4PG2A 2DJ4A 5TQ0L 5EF3A 3V4PH 4XP6L 3UG5A 3UYRH 5CFHA 4M8UA 3E38A 1EHAA 3IM1A 1EAOA 3KVDD 4IBSA 2RACA 2AJSL 3MACL 4NZTL 4DKDC 4TUOB 1G4RA 3RYMA 4KJPC 2IWEA 3IDIB 5GRYA 2ZJSL 1PQZB 4WGWB 4JFHD 5DZ9A 3IKCA 1H3WM 3U9PL 3L3OC 3WMQA 2MRYA 3GO1H 1DVFD 1SLWA 4PWJA 4NAQA 5C08E 2I07A 1MVUA 1R24A 4QO1A 1FWXA 4YH6A 2QLYA 1NOFA 3SEPA 4D0DA 3VD2A 3RY6C 1RP8A 1FAKT 2PETA 4K4KA 3D2UD 4UNTA 3WSQH 1P53A 1N6QL 3NP4A 4H88L 4GI6A 2VABB 3JVFC 4RZCB 3WJLA 2WMPB 2X4QB 1IGFL 1VF5C 4X7SL 3WFCH 1JD9A 4H44C 3T1FA 4AGLA 4WGKA 4WI5A 3WEMA 1N4XL 4ZO8A 3RVWC 1Q9KB 4ZZFA 3FFDB 4Q2ZA 2J2ZB 2VITA 4LQFL 3U2SB 1FIGL 2VZVA 1E4XH 4JCWA 2NY5H 3A4EA 3BEVB 3PWPA 1S5HA 2J4WH 4IRSA 2B15A 3RPIB 3KWWB 4QMEA 2ESVD 2EDBA 2F7OA 2QADD 4K9EH 5BXFB 3A5VA 1UT2A 1T3FA 2P44B 1SMAA 4I0PD 4BHUI 2O4EA 3SDYL 2NXZD 2QVIA 3VFTB 3IJYB 4DP1X 2NT0A 2WNGA 2QL1A 1A8ZA 1UD6A 4FFYH 3EDKA 4WWID 3GF8A 1BF2A 1W15A 2Z8WC 1OARL 4Q4IA 3G6AA 3Q6GH 1YECL 5GZND 1FUNA 1NSNH 2D3JA 3V0GA 4MJ4A 2AXGB 2AK1H 2N01B 2WO3B 5KG9A 1ZCRA 2CO7A 2X4NB 3MV8E 3VGFA 2V3EA 3OMAB 1ULVA 1HE7A 1IM3D 5HHQA 4L18A 3DURA 4HS3B 2ZSWB 4LF3A 4OFPA 3VMPA 3NDZE 3JT2A 5HHMB 3SYAA 4UAOC 4MLSA 4AQAA 2BFVH 2OMTB 1I85A 4G8GE 3I3DA 1JWMB 2VAAB 5C92A 4W9FC 4YDMA 3U7WL 2PR4L 1HZHH 4G8IB 5EEUA 3DARA 3PDGA 4XWGL 1E9PB 5D7SL 1FA4A 3JWNH 3KZ8A 3C8DA 3N41F 3FN3A 3UO1L 1C5BL 4LL1A 3OG4B 3MO1B 4JFYA 1XH3A 1DJHA 5AWNL 3HBPA 3QEQA 4N1EA 2EC8A 1PYWA 2FX8L 1FL5B 1IAIL 4FFTA 1P9MC 4RSVA 1VCBC 3SDDD 4GOSA 3QAQA 2CXKA 3SDCA 3C5SA 2EYTA 1MCWM 1LEIA 4CU7A 2IAMB 4NQSB 3PXLA 5MEOA 1O9ZA 4Y19E 3BSZL 2DIJA 4QCIB 3VQLA 2M8XA 1Z5YD 2YO3A 2XXFA 1SHXA 4CMHC 2WUCL 3IPEA 5BVJB 4ISVB 5IEHA 5L2KA 1AGFB 5CGTA 1H5BB 1BBJA 5EORL 2NT1A 4XVTL 2OZ4L 2O5YL 4LBEB 2W9DH 4TULL 2ZOOA 5AVTB 3L1GA 3VXUE 3UBGA 5IHBA 2H8PA 3T6WA 2WWOA 4NNPL 3UYPB 2Q8AL 3G5VA 5JXAL 1A9EB 1C08B 4AZUA 1IEHA 1BEYH 3MUZ1 4N0UA 1YEDA 4ZUVB 3MFFB 2IGFL 3UIZA 5CAYB 4BKSC 4I77H 4GI8A 3B37A 4N3TA 4I5BB 1IFRA 4G9FD 3RPKA 4IJTA 2YXWA 2N3JA 1KC5H 4XGZA 3VFPB 4BYHA 1BD2A 1Q0XH 1Z9MA 2P47B 3UPRA 3QUGA 3O6LH 4MAZA 1Z5LB 1LDSA 4E36A 5C6TL 3BWAA 5E4EB 3AREA 5BZDA 3LN4B 2IXQA 2A3TA 1SXBA 4MNGA 3QUYA 3L4CA 4N8VA 3JV4B 3SY0B 3C09B 4X6BA 2HTKC 4LP5A 5FYLE 4DQOL 2CWRA 4OKVA 3ABZA 4F7TB 3KWTA 4ODWB 2VDMB 3ISWA 3AB0C 1R3IH 2YMXH 4UIKL 1RK1B 1WS8A 1JPTL 1AJ7H 3OR7B 4FI8A 3QRFM 2IG2H 3L6FB 4YPGB 3EYUL 3S36X 3SKMA 3WE6A 2WLKA 4BZ1A 3T6ZA 4KTDL 1TZIB 2AV7A 5F3BA 3MUUA 2WUBL 2H2PD 3TA3D 5IV2A 1V5JA 2QGEA 4C56A 1M6OA 4QI3A 2OXGB 5JW3L 3AS1A 1Z32X 5C0CE 5I71C 3Q3GB 2HXAA 4XMPH 3KPRE 5E2WH 3QDJB 3V7AE 4XX1E 4FC3E 2JB5L 5T1KD 5EV7A 3RIAK 1MI5A 2OS7A 3FO2B 3REWA 1RZKH 4N0CD 3KLQA 3SDXB 3QDGD 2GY7B 3OKYA 4K3EH 3GHEH 4HIQA 1AIFB 1Q94A 1ZHNA 2NX5A 4IKJA 4QIRA 4OLUH 5AZEH 3TIDB 1AE6L 2D9QB 2MCPL 3KPLA 3VXOA 5KSAB 4GINA 3PGCB 4Z76A 5KYWB 4L1DA 1P6WA 3FQ4A 2FWUA 5KUKA 5JHLA 1Q9LA 1ZVHA 2F8VA 2IANB 5FO7B 4RWYL 3OAZK 4X5LA 4U1JA 3AWEA 3O0LA 3RIKA 3RWJA 1UZGA 3INOA 2F18A 3DVFA 3P4MB 2HT3C 3LEVH 2BDNH 3CFKA 3HLKA 3MV9E 1OP5H 3OKMB 1L0YA 2COQA 3NH7L 1H6FA 2WZ5A 3MROA 4ZMWA 5B8CA 1VEPA 1TITA 1J18A 1FVDA 3PL6D 2XCMC 4PW9A 3L4WA 4NPJA 4IIQA 4OT1L 3CVHH 3C08L 1NGZB 3TGXA 1A6TA 1D5IL 1NCTA 1IZJA 4NKIH 1A8JH 3D09A 5JZ7C 4LHUD 3OB0H 1RUMH 4U2YA 2IALA 3UH8A 1QSFE 1JZHA 1J5IA 3L4XA 1AH1A 2VR5A 1DL7L 3MRGA 3NK3A 1BQRA 5KW9L 4JB9H 1EJFA 3F7VA 4OD3H 3QIUB 3VG9C 4ZXBC 2EDEA 3KWWA 4OQTA 4QRRA 3EYOA 3GIVA 1SJMA 3EH2A 3MYJB 5H37G 1QFWL 3CZJA 5DFVC 3C60C 3JTTA 3X1GA 1AS7A 2WXGA 3HLAA 2YAHA 3NA4A 1L9MA 3VD5A 4CU8A 2VN6A 2DBLH 4NNXA 1OWRM 1U33A 4HKJB 1IC5L 3VI4A 3RI5K 2J5LC 3HZ3A 3HZVA 1Y07A 4IMLB 1J1PH 3BN9D 4PAZA 4ZUTB 2IPKB 2OV0A 1KXQA 2P5WB 1A9BA 2O6EA 1PTZA 3EJPA 1KOAA 4P5SA 5GS2D 5IT2L 4HQQH 2CM6A 1MHPL 1YN7B 5D1XC 3ZT5A 5BJTB 1N5AA 2Z35B 5KEZA 2JVUA 5CLTA 4J3OD 3C9NA 2AXGA 3WNNA 1L7IL 2VYRE 5GS3A 1JDCA 3FU3A 2A73A 3GI8H 5HPMB 5CN2A 4F5CE 1MPAL 3NA9H 1YNLL 4RFNB 1V3JA 2WOYA 3QJVB 5DYFA 5LDSA 4NKDA 5DJ6A 1RXLA 2GUYA 5F89B 2X0WA 3I6LD 5TE4L 1ZHLA 4JJ5B 4S0SD 3IWUA 2ZCKH 1A1NB 3DV6A 3QXVA 4PJ7B 1TJIL 1YPZA 1Q9OB 4MRBA 5C09D 3HTLX 5D96B 2AAAA 3TN0D 4CW1A 3GIZL 1A2YB 3SB3A 4JPVL 1BYOA 2UY6A 2UUDH 1Y0LB 4HJIA 3DX8A 5ITFA 4N9OB 2WBJA 3S97C 3LIZH 4WWPA 5E24E 4Q74A 3O0RH 3AGVA 1ROCA 4NHCH 4Z3EA 4A2MA 1NCDL 4Y16A 3IJ9A 4TPRL 1DLFH 3INUH 3QULA 3BLPX 4UTAL 4HK0B 5DT1H 4N87A 4AQOA 3KLAA 2AQTA 1VRSA 5EU4A 3B1UA 5LGHL 4R6UA 3KGSA 3G04A 5EU3A 4KDWA 3V0VA 3TJHD 3HE6B 2BZCA 3Q1EA 4AV0A 1XMEB 1U30A 2LU7A 2JKWA 3QA3B 1VFAA 1ZTMA 1WT5C 2E9WA 2NNFA 5L6YH 2IV8A 2V8LA 4K8RH 3RGVA 4TVPE 4DO5A 3N9GL 3DX2A 4GQ9L 3HE7B 3NFNB 4Q7DA 5I26A 4AQ8C 5SV3A 5E08H 2O1AA 1IC0A 1SZNA 3PPSA 4EKJA 2K78A 2B4CH 2SEBB 3VWKD 3DVNA 1PY9A 1IC7H 2PPDA 2UWEF 3BVWA 4B3VA 2DD8H 1WBYB 3DPDA 5AW3B 4KOBA 4FEMA 4JJOA 2DQHL 5JIPA 1NCCL 3EFDL 3H3KA 2EJ1A 5CHNA 3BESR 3ULVC 4I2XA 2NY6B 3MI6A 2F1EA 4R0LA 5KYYA 3DX7B 3WN5B 4HK3J 3KBFA 3I6SA 2OL3A 4NQQA 1BGXH 1KYFA 1L0XA 4YR6A 4YDLB 1EHLL 5D1XE 1CFQA 1SYVB 3ARFA 3L6FA 4KHTH 3ZL2A 5HYSA 1OAYH 2BY3A 2BC4B 1U8CB 1KEGL 2EEBA 3DX3A 4M62H 4GP4B 2WQWA 3BWUC 4UDTB 5JOEA 4R4FH 4BE6A 2APWA 3F62A 1NDTA 1LL1A 1PJ9A 4LSRL 3O45B 1IAII 5B38G 5BRPA 3Q2LA 1NL0H 3D06A 3A6BH 4G6JL 5HGGS 2PYEA 3HRZC 3QQ4B 5E56A 2ZOLB 2CPUA 2DDQH 3HPJA 5EO1A 3ABGA 1LO5B 2WXFA 4L1TA 4AT6A 5MERB 5GS0L 4UT9L 4PSPA 3PGCA 2LTQC 4JR9H 5TQ0H 2WXPA 4A6YH 1U3HA 3P9LB 4KK6C 3JWDC 4MA3A 3DTDA 3CFCL 5F7HA 3F6IA 4JHWL 4RA0C 1QBBA 4YWGL 5FYJD 2GJPA 4WWOA 3DDGA 4PIRF 1KPUA 2EP6A 3KGTA 2G5BA 3O81A 4NZTH 3U25A 5C1MB 2UZPA 5IMKB 3G6JB 2QKSA 4JFOB 3PJSA 3SY6A 2NSXA 3CC5B 2OTWA 5A2CA 1WAAF 4JRXA 2ZJSH 5EF1A 5C3TA 2I5YL 3LH9A 1ETZA 3QJFB 1AQDB 5F93C 3U1PA 4KJWC 5I75C 3E80A 3V8OA 4PJ7F 2KBGA 5D2LE 3U9PH 4M00A 4GMSL 1UKSA 1BZ9B 3AG1B 1TEFA 1N5YH 2Y3NA 4IRJD 1QUPA 2G0KA 2Z91A 2XYCA 3QBTB 5LB1A 3GKWL 1XO8A 1Z9PA 1JWSB 2VIRB 3CBKB 4I4WB 4FXKA 5HYJD 5K9QG 4C58B 1QFOA 1R1CA 2LU3A 4LCYA 4HFUH 4ORGA 4X7SH 1IGFH 3MCLL 2IDSA 3OV6A 4GQZA 5CP7B 1I75A 3ZR5A 5KS9B 2VLJE 3K81A 4UIMA 5IW3A 3VNZA 2H3KA 3FFCA 1ZLUK 4PJIA 1CBVH 1PLBA 2AABL 3S36L 4G43A 5D2NA 3SGJC 3O11A 2O93L 1ETJA 4HALA 4MMZC 2VDPL 1FIGH 3L3HA 3DGCR 3FHQA 1A14H 3ULVE 2DMBA 4GYBA 1B4TA 4LSTL 3DMMA 3OKDB 3D33A 1LMIA 3C6LB 3FSAA 4UCFA 2IPKA 1Z9SA 1FGVL 3LQZB 3PQYA 1XGQB 4FE9A 3C6SA 3FS9A 1I7RA 2AK4B 5AG8A 4N20A 1OGAB 3G9VA 3HN5A 4W9ZA 4E41A 4MNQD 2VSCA 4WAFA 4NAMA 4YXLL 4JVUA 1JPFA 1JZEA 4FNSA 1OARH 4PJ8D 2DQTL 4HDIB 4K2UL 2OYPA 1KV7A 1G7JB 3HI5L 2ZUTA 1AXIB 1D5MA 1YECH 7FABL 1MJ7L 1H6TA 2R29L 4WI7A 4F9LC 4KITB 3P3SA 4PRHA 4U1SB 2GKIA 5F1NB 1INEH 3SZ6A 5BW7A 4PRAB 4H0GA 3F7QA 2JSFA 3D9AL 2A6DB 3TYFA 3VWJD 4FA6A 1FFRA 4YNYA 4LPUA 5DJ2B 4M6AA 3BUYA 5IQMA 3KG5A 3VG0L 5C9JA 2EDRA 4BZYA 4A67A 1QNIA 2QSTA 2X6MA 3QK0A 2IH1A 4NN6C 4PRBA 2HT2C 1WG3A 3B3IB 4FQXA 5F7EL 5F9JA 4GW1A 2HUHA 2IV9A 4CN1A 2RHEA 5ANME 1F56A 4E0RB 3U7WH 2PR4H 1DE4A 3FT0A 3OVUB 4OUOA 4X4XB 4XWGH 4MQ7A 1RU9L 5D7SH 3HFML 2ARJA 3UO1H 1C5BH 1EEUA 1UOWA 4P2OD 5AWNH 2IIJA 4RAHA 4ZUUB 2C1PB 3HZYA 5AVZB 4MQXC 2ADFH 4UT7H 1GC1C 1OM9A 2Y1AA 1KXHA 2FX8H 2LFGA 2AQQA 1VFBA 3GSQB 1KY7A 4PJEA 5E8PA 2GQHA 1Q9WA 1G1YA 3WEXB 1A02N 1E43A 1KTCA 2CDGA 4D9LL 3CFJA 3ALXA 1N7MH 5J13C 1ZXQA 2OTUA 3BSZH 5D93B 3VFGH 2AZAA 1BJ8A 1P69B 2WLHA 3EUDA 4WWKA 2J1WA 1T83C 3CQPA 4XNXL 3QORA 1LP9B 1QFWI 2WUCH 3QA3A 2P8MB 3WS6C 4RETB 1JV2A 5EORH 1IAKA 1Z9OA 3HW7A 2VN4A 4FLRA 3A0OA 2OZ4H 2O5YH 1PD0A 4P5RA 4TULH 1THAA 4XVTH 5DD0H 5IVZA 3E2HC 1WBXA 2VXQA 1JNNL 5DD6B 2ATPB 2J1ZA 4NNPH 2YRPA 3UC2A 2YJQA 3BJ91 2SEBA 5JXAH 1QMUA 5D6DC 3TF4A 2GSGA 2IGFH 2XV6B 1DQVA 2FWLB 2FGZA 2Z31D 5C3LD 1KLFB 1KT2B 1UOKA 2F1AA 3QEUB 3FT2A 3KLDA 5E2VL 3B83A 1MDAA 3PDOB 3FK3A 2E76C 4HCGA 5ABZA 5C6TH 1MCWW 3FTVA 2F61A 4PJXB 2FO1A 3BSHA 4XP9L 5GSVB 4YE0A 2JIXA 3FRPA 3QIBD 2PLTA 2WWMD 2JNZA 3BXNA 4DQOH 5FF6A 5DF0A 4F15C 5KS9F 4PJ6A 2V9TA 3S7GA 1BLNA 4PJ5D 2DQGL 3M6DA 1FZJA 2R9HC 4UIKH 4ETQB 4IU2B 3H7LA 2DJUA 5F6HI 2DYPB 3EYUH 4KKRA 3DOSA 2P26A 1V05A 1O7VA 3EBHA 1E4HA 4KTDH 4OAWA 4B50A 5J4MA 1B2YA 4OZGB 3Q8EA 2GJRA 2MNUA 4AC4A 1S7UB 5GQBA 3DO3A 5C3IA 2Z7UA 2C3HA 2YEZA 3IXAB 3U36A 3KYKL 2J3SA 4NDMA 4FFZL 5ESAB 2BOLA 1QR4A 2JB5H 4PWKA 2W59A 4HF5H 1KCBA 4HPYH 3J27A 4X4ME 5A3IC 4AYSA 5DD1H 2C3WA 5GGTA 3FB6A 1K5NB 1N6UA 1DBAH 2JJSC 1MIEL 4LVNB 4PTUA 1AKPA 2NNXA 1YYLL 2MCPH 4WO4A 4F93B 2FUQA 1L9OA 4LCVA 1J88A 1WO2A 4PP2B 5EBMB 4XRCB 3T3PB 2VLRE 4P99A 4BINA 4DHLA 5KJRL 5DQDL 4PV9A 1L9SA 2EYRB 4UNIA 4PVLA 4PJCF 4TNGA 4AWJC 4RDQF 4HETA 5GGUA 5IQOA 4IK7A 4G5ZL 5C86A 4R2GB 3ABMB 2BPBA 3ARDC 4U6VL 5IVXA 3GXIA 3DHUA 1V55B 4HT1L 3RUGE 5TTRA 4KO5A 1AHWA 3MLUL 2UXTA 1AP2A 3ALWA 1LO4H 1QFPA 4QRPE 3QE5A 2BS8A 3L3GB 3P4NB 1D5XB 1CL7L 4LPYA 2ZSVA 3AFLA 2TRHA 3CVBA 1YYML 3BHBA 1H3GA 2P24B 3T0AA 3C08H 4HPHA 1AC6A 2MTPA 4FZ8H 2V7NA 1D5IH 4MMXC 4PREA 3TZVC 4O02L 2BP3A 1QLRA 2HFEB 1KYUA 3IFPB 3L95A 5KYUB 3WKPA 4AGMA 1OAKH 4Y2DC 3FAWA 2W0LA 4OZIF 1DL7H 1WHOA 1JPEA 2NNAA 3NABL 5EOQH 5JNYA 1JGLL 3QUMH 1IBGL 3RWHA 2ID5A 3AY4A 4XN7A 1MG2C 4BXVA 5MP6L 4XNZC 3P2TA 4NI6A 3IF1B 2R83A 2AKRA 3E8UL 3D4GA 1ZS8B 2VLLB 2Y7OA 4MJIA 4NN5B 3CZSA 4ELKA 2CO6B 2FNWA 4H8WL 1IC5H 1XGQA 4F33A 5CN3A 5I1AB 4ACTA 4I7ZC 4ONFL 1AZZC 1QBML 2PO6B 1IM3A 3RZCC 4F3FA 4DUVA 5DMJB 3QSKB 2WO4A 4BK5C 1PGRB 3R8QA 2I60L 4F9PA 4X6DB 5H2BA 3MKGA 3FU9A 1MHPH 1NBZB 2CE6A 4PRNB 1ED3B 1BQHG 2G0LA 4OZHA 5E6IC 2UYLA 3ULUH 4H8UA 5FA4B 4U1SA 2WO2B 4FADA 4TTDC 2X9ZA 5C0FA 5D70L 3CXDL 4JDVA 1PCXA 1D6EB 3LSOA 4KKLD 1PZUB 3FTXA 2YSTA 4JRLA 5FGBA 2Y69B 4LCWE 3MJ7B 3GMPA 2E7CA 2GC7C 4CBPA 3FYIB 1XF2B 4LPWA 3MOQA 4JM2F 3GI9L 3VFVA 5I2IB 1HYSC 5EEWA 2N0MA 5TGBB 3L4VA 1YEFL 3SGDI 1TJIH 3ESUF 4EQ2A 5DK0A 3VXSE 1I9EA 1OANA 4JG9A 4JFVA 1U6AL 1RMFL 5CJBA 1IJ9A 3GIZH 4JPVH 5LLIC 1HH6A 5ERWB 5DHXB 4LEOB 1HSAB 1TOXA 1VLXA 5ID0A 3EH4B 2F5BL 2KC0A 4PG2C 1W80A 1HESA 2C7UA 5HHMD 1FYTA 4I18B 5C71A 3QI9A 4YO0A 3ZRSA 2BNRA 4W4NA 2V5RA 4OF8A 2ATKB 3RWFB 2I7SA 3WNPA 2QSQA 3EJQA 4UTAH 6FABH 4Z7WA 2KL6A 4FERA 2V7HB 2E7DA 1EA9C 1OSZA 3QQ3B 4K7FA 5F7MC 1PY0A 2GI0A 4BA8A 2R8SL 3MJGX 4AL8H 4KVNL 5ICUA 5LGHH 4Y5YB 3NCEB 4JZOB 1F5WA 3NIDE 4DGUA 4AYBA 1QLEL 4B95C 3REVA 4X7TA 4OIAA 1TTUA 1JWUB 4X8XA 1BZEA 2ZT9C 1G7IA 2ATPA 2GI7A 3HZKA 5CD5D 4YHYC 4XNDA 5KJ7E 3N9GH 4GO6B 5GIRA 4OF0A 3D1MC 4GG8A 3UL4A 5HYFA 3CDFA 5CZXC 4YBQC 2Y9RT 2BVUA 3W1ZA 3LVTA 3JUYA 4DVRH 5E0QA 4KQ0A 3BIBX 5DTFA 2ERJC 2A4EA 3TURA 1NCHA 1Z3GL 1I7TB 3GXTA 4NO5A 3GSNA 4LEBA 3ZKMC 4A7GF 2DQHH 4WTQA 4XN8A 3L8QA 4L3EE 4ZFOL 1CD1B 4YHLL 1NCCH 3EFDH 4QHMB 4V1DB 4DETA 3PNWB 5F6IB 1MIML 4GXUN 1WPCA 1XTLA 1JXDA 4IRSC 4KJQD 3KCPB 3HAEA 3HNVL 1YUKB 5BNXD 1ZLWH 3TA3A 2GJ6E 1I31A 3V0EA 4G5AA 1JMXA 5FECB 4WTZA 1KLGA 4TKWA 4C4KT 3Q9PA 4WFHE 4RA3A 4DGIL 4ZPTA 5E95B 5IOKA 1ZEAH 1C12A 3LMJL 4ANVA 5ANHA 1THCA 3A6CH 3EOBA 2JJUA 4ZTOH 1AANA 3AUWB 1L9RA 4HJGB 3PGFL 5TE7L 4U6HB 4U7SA 3VX1A 4JPIB 3HI1B 4H1LG 5A6IA 4RSYA 1JGDB 1N3NB 1DSFL 2XX1A 3L7FB 4FZEH 4PU2A 5DQ9B 2XC8A 5I8EA 5K1VA 2M83A 4BWUA 1RJYA 3TIEB 4NN7C 5GPRA 3B9VA 4NZUH 3IMBA 3WLWD 2XTLA 2QDVA 4FKKA 3ZZ1A 4ZFFB 3SKNB 2YD3A 3FB5B 1DDHA 1O75A 3QH3B 3ARVA 5JW4M 5DJ8B 5EB9A 1UD4A 3DHMA 3CC1A 3ZE2E 2ZG2A 5T5FL 4PG9B 1MHHB 4X6DF 4A38A 2CJ3A 1KYDA 5GS0H 4UT9H 4FQ2L 3CZEA 1F4WL 3HHMA 3QO1A 2BSBA 1OW0A 3T4AB 5M95B 5B7MA 5J6HB 4NUGL 3KYAA 4ZTEA 2KZWA 4DTGL 3OC8A 4O02B 1MAML 3QZWG 5IIEA 3CFCH 4MDJB 4E2OA 1VFOA 4R97B 3QDJD 1KNOB 4TQHA 2FZ3B 1PW3A 1X5IA 2P4AB 4N2LA 3ZDYE 3CFDB 4QTHB 4N90D 2WHVA 1X5GA 3HG1B 5A7EA 3ZPDA 3SHSA 4JJHA 1P7KA 5B4MC 2DQFB 1M7XA 1T1WB 1I1FA 3SDCC 3UADA 3UZQB 4GMSH 5DGQA 2PP8A 4GI9A 2GPZA 2RAMA 2P5PA 1RVFL 2IAND 2MTAA 4HXAL 2P5EB 4WV1A 4JKLA 2VXSL 1I3GL 3E7JA 1P7HL 2E74C 1SY6A 1DTUA 2P3YA 3QFDA 3BRDA 3LKOB 4FNLL 3UDWA 3QUZB 5A6LA 3NCXA 4N2KA 3H9SD 4RRPA 2C9PA 1D6VH 1AS8A 3FT4B 1HOCB 1M71A 5TDNB 5MEQB 3TS8A 5IQ9A 4GQQA 4X98A 5KYUA 5EIIB 2EE3A 4CRPA 2GAZA 5CXPA 3BPCA 3ARBB 4G1EB 5BO1L 3MCLH 4IS6B 2G2NA 3GUFA 5CBAA 4L8CA 1M1SA 2LU4A 1FC2D 1UGKA 4Y1SA 2BSRA 1KCVL 2XQBL 3EHBB 2AABH 5IQNA 1GGCL 2Y1ZA 4JS7A 1DQJB 2CNZA 2VR8A 4ZAKB 4QT5A 3QHFL 3K6NA 4R96B 3MLTB 2VDPH 5GGSB 1CXKA 3GJEB 2DIAA 2L8AA 4OLXL 1WIPA 2M26A 2OI9C 4RGMB 4MAYC 5IB5A 1TVDA 3RWIB 1E4JA 1H3VA 3D18A 3WJMB 3LVEA 3ESNA 4HKXA 2W65B 4LSTH 1XAKA 3GUTA 1ERNA 5DJCB 3HG4A 3ZO0A 1EGJA 1G6RL 1ZMYA 3EDDA 2FLRT 3O3DA 4J28A 1FGVH 4MYPA 5H94B 3QIUD 1RZ8B 1ACZA 4HIEB 12E8L 1W0VB 5EUKA 4ELMB 1ED3A 2D4DA 4YXLH 1MF2H 4YFLI 1GZPA 5AAMA 3ZT7A 2DQTH 5F1OB 4QJ5B 1YEEL 5IMOB 1BPVA 3KS0J 4TNFA 5IESL 1D6EA 4J27A 5J1SC 2R29H 1UACH 2ZOKA 3H4HA 2BCKA 4GRWF 2H5UA 4FQQA 1NH6A 1NGQL 4KDVA 1LLAA 1NMCC 4BSJA 3CV5A 4KNSA 1HKLL 3C75A 5EF0A 1B9KA 1N8ZA 4NT6A 2V2XA 4L9LB 4HJ1A 3NEOA 4BK4A 3ELQA 4MZRA 3G5YB 4X8JA 2WKGA 5FA3B 2L0DA 1PAZA 4YFLF 3TFKD 3IGFA 5F7EH 1QLEB 1RP9A 3KW8A 3LD8B 3S5YA 3W39B 4MQSB 4CSPA 1PKQB 4HJJL 1TJHH 5IUCA 4NQCA 4UMGA 3VXME 3VH8B 5JHDD 4EAEA 4MD5B 3B4NA 4LDLB 5IEKB 1QO3B 2J71A 1RU9H 4OD2B 3KYNB 1NCAH 1IAOB 2Q3ZA 3H56A 4U6YB 1OOWA 2WKLA 1A65A 2J21A 4I18A 2CKBA 4GSUA 4ZUSB 4PVBA 1DFBH 4HUXA 4MA8L 2P8PA 4I1RA 4QHKJ 3FB7B 3IGAB 1RKRA 4X6CB 4KKAC 4Z0XB 3WMPA 2CGYA 1NCJA 2XKNA 3A4DA 4X5RA 3TBWB 2VDQB 1Y7VA 4F2FA 2ZUSA 3IPBA 4ZFOB 2FT6A 2Y7QA 3EGXA 4W9GC 4D9LH 4CVZB 2W95A 2EVHA 3BQUB 5I1JH 4OKDA 5FHBL 5JHAA 4OBSA 4IYKA 1YEKL 2PABA 4HC1H 3O2WL 3H0TB 5B8CC 5IY5B 3S3JA 3FQXA 2VXVL 4YXHH 2ZE0A 2PCFB 5DQJA 1BMGA 4IIQC 4UDUB 4PWEA 2EUXA 1JBJA 3JV0A 1FFPA 2X4SB 2GJJA 1O6TA 1RI8A 2R15A 3SODB 1QSEB 2ZWKA 5J6GB 1OXYA 4KK9D 3HE6D 2YEQA 3HI6H 4HSCX 4HZLB 4HKZB 2CKNA 3U9UA 4AUYA 2GBAA 1IGJB 4HBQA 4BCXA 1DVXA 3EO1A 4LKCA 3ZKXB 4EI0A 1SVCP 4GMTL 3VMOA 3KL3A 4E9YA 4H5SA 3VA2C 3HE7D 1PNCA 5FV1L 2HLFD 5BS0D 1S9WA 3GMQA 3D39A 3EFFA 4UTBL 5DZPA 4NQXA 2DM4A 2NTFA 4WTWA 1XB6A 3EH3B 2AQ2A 1KEMH 3RL1B 2JKJA 3LB6D 3SO5A 4V33A 5IWLA 4HULB 3CK0L 3O3EB 3V4PA 1E5UI 1MFMA 4Z7OE 3X14A 1K6QL 5C0RH 1U8HB 2EYSA 4FQLL 2RJMA 4N9GB 2NY6D 2NY4C 3LN9A 5E9DD 2YKLH 4PJBA 3FU7B 5ACLA 1XEUA 4UM9B 5J3HC 1MCSA 1O6SA 5EUOB 3VUAA 4AGOA 1OCZB 4QRUB 3CSGA 1S7XB 3DVGA 2HN7A 2F54B 2AEQH 4PB9H 4GRWH 3KYKH 5CEZH 1E9QB 5B39A 4I3SL 4FFZH 5EO0B 4LVOB 4OLZL 4PRIB 1OP3K 4OGZA 2NY7L 1MQKH 2CGZA 3F7YB 2C9RA 3RDTB 2WYHA 3MNDA 3HR6A 4B0MM 2V37A 4ELMF 1BFTA 4KKZA 4WFEE 3HNTL 5DJ0B 3SYCA 1UM6H 4JL2A 1BVOA 3IDMB 4PWFA 2NX5E 1MIEH 1CUOA 1MWAL 1YYLH 3ESMA 3U4KA 4MDJA 4UU9B 1EXHA 2APSA 2IFFL 5HVWA 1HH9B 1I3RB 1UD5A 3IN2A 2ZONA 2BSED 5KJRH 3QNZB 1K2DB 3B5TA 1YG9A 4IRJA 4OIFA 3UTPE 3QVAA 2X4RA 2H9GB 5K1NA 2CJTA 3QO0B 1PFCA 2X12A 4B27A 1T1WA 4NRZA 3QG7H 5F9WC 5GSRB 2RMNA 3TU6A 3UJJL 4Z78B 1FO0H 4G5ZH 4Y16C 4R7NA 3SDAB 5GGQH 1CDIA 4UQBA 1T4KB 3UZQA 4JHAH 5DZNA 3BKCL 4F20A 1YO4A 1OSPL 3OKNA 1XXDC 4HT1H 3E9TA 2ZQKA 4JAMA 4XTRD 5T3ZL 1K72A 3WE1A 5IFJB 1G7MA 5EU6E 5I9QC 4MJ6B 2A6KB 2R4RL 5I30L 4WI6A 4F8NA 4H26A 3WS3A 1CL7H 1R5IA 5LAPA 2HRHA 4Z7AA 1Y1DA 3L48A 1L9TA 1YYMH 3QIWB 1G43A 5JDSA 1R0AL 5T1LA 5EIIA 4XC3L 5EBLA 2YUXA 4KH9A 3MOBL 3ARBA 3NRFA 1HHHB 3V6OA 3UBHA 4Q6IB 4U33A 2AJZB 2E27H 1OQXA 3MNWB 3NZUA 1QRNB 3M1BA 4P9MH 4ZPVA 3WNMA 4CUCA 1FZKA 2UV3A 1H6UA 1QBLL 3NABH 4DK3A 3B34A 1MQ8A 1JGLH 1IBGH 5E5MA 3JTBA 3UGEA 3D34A 3MRRB 4JGJA 3I6GA 4WTXA 3NCFB 5MP6H 3LQAH 3JZYA 5D7IB 3E8UH 4JFPB 1RJZA 1F3DH 4RZKA 1OGTB 4BWTA 5DEFB 3F05A 3WNKA 1UWGL 4FHKA 3ULSB 5HGAB 4PJDB 3CN4A 4ONFH 3VI4E 1HIML 1QBMH 4R0LC 1YNTA 3SE3A 4HIHA 3O3BA 4PMEA 1G9MC 2I60H 1KXQE 5DJZA 3PABA 2VLME 4XODA 4GAGL 1SM3L 1BM7A 3RDJA 3ZYZA 3ES6B 3MA7B 3DTXB 4W81A 1F41A 1ADQL 4DGWC 3BZDA 5DK2A 3GB7A 3E3QC 3C6LD 4BSWA 2GK0A 3MBXL 4HIPA 2HFGH 5D70H 4Z0BL 4ZS6D 3CXDH 3HB3C 1NCBL 4JQXC 4NBXB 3BFOA 4ADGA 3ZMRA 2ADJB 1OGAD 2XWBA 2FX9L 4OIIL 4GAYA 5D55A 3VSQA 5BRZA 5C7XL 4PGCA 2ZWLT 4HUVB 3ZKNC 5FLUA 1NEPA 3QCUL 3MV7E 2P49B 1YEFH 1EAPB 2BVQB 1PY4A 4TN9A 5ICYB 1PG7X 4YC2C 5F72S 2BX5A 1DN0A 1U6AH 3K80A 1RMFH 3MLXL 3CBRA 5DRZA 3BGFB 3L2LA 1IAOA 1ZLSL 5DSCA 3X1NA 3K72A 5FB8A 3JSSA 3IDYB 1B6UA 2FBOJ 4Y89A 3ZE1E 4OCYL 4YQXH 5B1BB 3ZTCC 4V2BA 1J8HB 1KLUA 2B14A 4LNRB 4F8TA 5HYEA 1DN2A 2F5BH 3MGAA 4M5ZL 2VDKL 3BEWB 4G1MA 5EUOF 1I1AB 2UZIL 4NRXA 3U2JA 4JNXA 4KRNA 2DPKA 4TVPH 3TVMC 4X8GA 5EU5A 1X3DA 5I1KL 1G7QA 2R2EA 4R7LA 5FKAB 3KPPA 2H0PA 2I32A 1HHKA 2R8SH 4KVNH 1AYRA 2H6PB 3NMEA 4RGND 5DHDA 4ZMZA 1AHMA 1OL0A 1V8HA 5AW8B 3KR3L 4JFED 5ICXA 3RILA 4NCC1 5F7NC 3HMXL 4K71B 4AYID 4ES9A 3RVUD 2ICES 2CHNA 5HI3D 3LRSA 2DM3A 2QGDA 3DBXB 1BG1A 1FZOB 4YX2L 2YAEA 3QWNA 3EXLA 3VFMB 3OAWA 1G7HA 5F2FA 3TO4B 2CUIA 5KVDE 1II4E 4HKZA 4XOBA 3BH9B 4NCC2 1XGPB 3VFOA 1DBBL 1R33A 4WNQA 2VAJA 1AZUA 2VN7A 5C6PB 2WINA 4ZSOE 1FBIL 1EZLA 1FL3A 1TUPA 1AD9B 4NO0A 2YC1B 3L08A 2OJZL 1JPGB 3WNIA 2G9HA 3S35X 4YHLH 2DLFL 2G3NA 1MIMH 4ENED 3FTYA 5BMFL 5JLZB 3OJDA 3HNVH 3VXRB 4X7FC 3DTUB 1XCXA 5CILH 1S78C 1CTNA 4NUJB 1JZ8A 2H2SC 2PPEA 4GG6B 4XN1A 3AU0A 1BFOA 3JTSA 4NERA 3IDJB 3APMA 5I8CA 4KJYA 3QXTA 3X17A 1XZ0A 4J12A 4L3FA 2E86A 4DGIH 2NY0B 3FHEA 4OZ4A 4XPAL 1VGKB 3LMJH 5DMGC 5BZZA 1MFNA 1TTGA 4LKXB 1Z5HA 3E3QE 3D50A 2EE2A 3QG6A 3PGFH 1DCLA 1DJYA 2WQSA 2BOCB 4ZX3A 2DQMA 4JM2D 4JK0D 1DSFH 1UXMA 1A3RL 1HCFX 1PF3A 5GS0D 3ECBB 2F54A 1PKOA 3RLSA 4D94A 2QKIB 4FXGA 1GAFL 4IGBA 4P57B 2HG5A 3WFEH 3WO3B 3FUMA 4LBAA 4N2NA 5BUPA 5JPNB 2PXYB 2PYEE 1O5DT 4MS8D 5DVMA 1T21A 1TFHA 4N8VG 5CJOL 4BXSV 3BE1L 2X42A 2YQ3A 4JDZA 5T5FH 3CVHA 2ED6A 1IQWL 3WIHH 4JFZL 4FQ2H 1H0DA 4LMQI 1GOGA 3CIAA 1M9SA 4HFWB 5HHPB 3BCFA 1IKNC 2NR6A 4NUGH 2BIPA 3IJSB 3CVIL 4FX5A 4UQEA 2V0AA 2X3CA 1MAMH 2QGBA 1F3JB 1E67A 2VOTA 3VRLF 4YS4A 4KAQL 4L3CB 5F9DC 4J8RA 1S7VA 4UI2A 2PCXA 3O8XB 1J8RA 2R7EB 3FU8A 2FLBT 3R06A 3DV4A 1JZJA 3K3QA 5E6SB 4AM0Q 2H26B 3SDAA 5JW4R 1XR9A 4JRXE 2CCWA 4Z7QB 4Y2OB 5DRNA 3HNSH 1EXUB 5J12B 2NXYD 3PWUB 4B9ZA 1YQ2A 2WCPA 5SWSA 1K85A 5C70A 3U2IA 4HXAH 2QR0B 1YJDL 2VXSH 4WWKC 4ZUWA 3QPQC 2J73A 3SQBA 2MHAA 4K5NA 4FNLH 3EYQC 4RAVB 5KBMA 4A04A 4BCYA 3ARPA 4Y5XB 1H3TA 1VKXB 1CFTA 3NG5A 4YZWA 1UENA 2A74B 4GEJA 4R2GD 4O9HH 5INCA 3FPXA 3MNWA 2HJFA 4L4VE 2XWDA 1SUJA 3RWCB 4TNWK 1QRNA 2X28A 3NZ8A 1ECYA 5BO1H 1XCQB 2GCYB 1MLCA 4UV4L 1AXSA 2DKUA 5ESVA 1LQBC 2N7SA 4NQDB 1CF8L 1SJHB 1KCVH 2XQBH 3N44F 1D2PA 3FFCE 4AQ1A 1GGCH 4PJIE 2DF3A 3EGDB 7PCYA 2YKKA 2GEQA 4QYOA 3LZFL 3P30H 4UV7H 3QHFH 2HVJB 2X4OA 4OLXH 3U1QA 5D7IA 1XAUA 1A6AA 1OGTA 1KV3A 1YY8A 1NFDF 2BY2A 3BIKB 2CIIA 3OX8B 1CFNA 1FZMA 3NSYA 1ZLVH 3GD1C 2X6UA 3GPSA 2WN3A 3F6JA 4NHUA 3HS0A 5KVFL 5L8LB 2H32H 1J1OL 4QF1A 5E4IA 1CBJA 1G6RH 2J88L 3MRPB 3PQYE 4Y4FB 4P2QD 1NDGA 1U91B 1JNHA 2FWOB 2Y06L 2BNQB 4M29A 3LIZA 4PD4K 5ILTL 3PU7A 4EZLA 1KENL 3TO2B 1GGIH 5CJXA 4KRMB 2VDKB 2RQEA 2QQKL 1YEEH 2WV3A 4K23H 1WD8A 4R3SB 5E51A 5IESH 2KDGA 4KK8D 3NPSC 5CSZA 1NTDA 1F6AB 1WFIA 4GSQA 3TCTA 2PO6D 4OCMC 1NGQH 4NO2B 5C0JA 5KVEE 4NBYB 4OM0L 4C57C 4CJ0A 4E9TA 5LXGL 4N2FA 2Y3AA 5BOJA 4M5TA 4OJAA 4M9OA 5FDWA 6CGTA 5HDQL 1IV8A 3T2NH 4GG6F 2OXHB 3U6XS 4PS4L 1RURL 4HSQA 5LBSL 5IJKC 2FIKB 2FR4B 2FATL 2GTWA 4HJJH 3D05A 5CO1A 3AXHA 3CZFA 4YSUA 2R69L 5I74B 2PPAA 1U36A 4LNRA 1UB6B 4JFQA 4Z3IA 3VJ6B 1U8LB 3N06B 2BS71 1I1AA 4PV1C 1QI5A 2DRUA 1KGCD 3MA9H 3D8MA 2X53A 1PEWA 3BCDA 4Z7UB 1UD3A 3QJSB 2ZYRA 3WIIH 2CR0A 4MA8H 1AKJA 2X3BA 1FC1A 4WRLA 3QQDA 4PJEE 1I1YB 3D7PA 4BQ6A 5F7LB 1QTPA 5I0ZA 1G0XA 2MOQA 2NUTA 5GGVY 5DA4A 4YVUA 1HVXA 3VFSB 4QXTB 43CAA 3O4OC 1XSIA 3E6FA 3F2LA 4PRPA 2Y22A 1BV8A 1L0QA 3II1A 1OPGL 1A6UL 5G5DA 4BWWA 5KBKA 5FHBH 5DRWA 2YS4A 2WNKA 4L05A 4OCXL 5C0GA 1AHWC 1OIOA 3IJEB 4WKZB 4ZX6A 4IKIA 1KPRA 3QXDB 4A2LA 3GSXB 2WB1A 3HC3L 4HHGA 5JHMA 2YFOA 2R1YB 3R0NA 4GRMB 2F7RA 4G70B 1X7QB 4M03A 1YMHA 2VR7A 2QADC 3EBGA 5EZLA 1GKOA 1M05A 4E9SA 4MVBD 1T5WA 3N40P 3OF6D 4XE5B 1AZVA 2VQ4A 2XZAL 4U1IA 4F92B 3GDBA 5IMMA 3MLWL 3QHTC 1JCKA 2VQ1B 2NXZC 3B9KB 4ZO9A 3IFOA 2PP9A 4GMTH 1AQHA 1ID5I 5KOMC 3LY6A 5CF3A 4HUWB 3WKYA 3AY4C 4A2DA 4AYDC 2O6FA 1FFQA 1CLYL 2CALA 2CBPA 1UGNA 2GTQA 4S1SL 3WEOA 4MBRA 2WQAA 5GZNC 1OHZA 2HPOA 1GA2A 2E3VA 1OEZW 3BVUA 3FOLB 1P84K 1PG7L 4IBYA 2FJHB 3RNKA 3MKKA 3CK0H 2WZPD 4A6YA 4POYA 2XN9B 3MVSA 4LKXA 4QLWA 1K6QH 4V1DD 4F9PC 4FQLH 4NIKB 1MJJB 2BOCA 1MRCH 4GBXB 1ZGLB 1URIA 5CINL 2BSTA 1CR9H 5HDWA 3ECBA 1NMAH 2DH3A 3DO7A 1MCCA 4H25A 1GRWA 2R23B 5I0DA 2D0FA 5IMLB 5B1CA 4XP4L 3J07A 4BZ2L 2CQVA 3MLRH 1JZ5A 5FGBC 4RH4A 1ZA3B 4UINL 4FNTA 1MUJB 4I3SH 1PJWA 4OLZH 5E00B 4KVCL 4YVNA 3BAEL 2NY7H 3CPLA 3LXUX 2EIZB 3ZRCC 3KPNA 3U0TA 4M1CD 3SDDC 3HNTH 5F7AA 4LLQB 4JFHE 4PB0H 1KJMA 2LOEA 4G6AD 1C8QA 3ZYOA 1MWAH 1OF2A 5AW0B 1T1XB 1J87A 1QNZL 3QGVA 2IFFH 3SCMB 3ZIMA 3T8MA 2XLLA 3WHXA 4FQCL 4I1PA 4NC2B 4X80L 3H9SA 2AQRA 5I6LA 4Z3FA 5BO0D 4PRDA 1H8LA 3QI9C 4R90L 1VACA 2UWEA 2A6JA 1SOQA 2W07A 2WBXA 5D1QA 1MCOH 3T4YA 1BXVA 4RQQA 4QTFA 1ES0A 3DOHA 1WFNA 4Q0XL 4ZDHA 5T3ZH 1B0GB 4KV5F 1PNDA 2A0LD 3PAUA 1KIRA 2R4RH 3UMTA 5I30H 1UM4L 4BFJA 1JGIA 2D03L 5HGBA 4E42A 5AW9B 2R1WB 5ISZB 1R0AH 3U4BL 4J3UA 2CLZB 4L1SA 3MOBH 3VFWB 2L7JA 2C9UA 2ESVE 1FJ1B 4IOSD 5IROA 1O7SA 5KSBF 3UZVB 4A66A 4O2EB 1I8IA 2AEIT 2P5ED 5FK9A 1NC2D 1P6FA 4PTTB 4EI5A 1QVOB 1FN4A 4S1QL 2CHXA 4XI5D 3MUJA 5EEXA 1QBLH 2ED9A 3QUZD 4NJ9H 3W5NA 1DVZA 1HQ4B 3BPLC 3S8GB 2OW6A 1YC8A 1C5DA 3C5ZA 4NM4L 2HRLA 3GXUB 3ERXA 4G3YL 4XXWA 2KERA 4P46A 3LDBC 5E8NB 4PY7B 2YAOA 1T2QL 5IUSA 4PI2A 1UWGH 3OMZA 1DO6A 1N9PA 3PP3K 4DPBX 1A3QA 3F7LA 1C1EH 2Z4QA 4Y4FA 3EHBD 2O72A 1HIMH 3GMNB 3ISYA 4JRYA 2ZXEB 2H2PC 3TA3C 4ZAKD 2BNQA 4E9LA 4MDIA 1HAUA 1PX4A 3WTVA 4P5MA 3AROA 3EOYG 4GAGH 1FNEB 1MHCB 4NSKB 3W38A 4M6ML 2CG9X 1TT6A 4KHXL 1LGVA 2DMCA 3H53A 1PBYA 4PLJD 3CFTA 2E7LA 4Z0BH 1NCBH 2VL4A 4HSAC 4RRPM 4UAHA 2HKHL 4BJLA 4JFFA 2LV4A 1MG3C 3D08A 5J9PA 3Q8BA 4OIIH 2FX9H 3LZLA 5C7XH 4AW7A 3C6EA 4P05A 4OGAC 3E6HA 3QCUH 5K93A 3CZNA 1CICB 2V5MA 3EJRA 3G6DH 1PZCA 3OL2A 5GISL 4YXKL 2DQCH 3AU1B 4FQHA 5LGYA 3G5XB 3SSGA 3ISRA 5L8KB 1ZLSH 1QA9B 3L7EA 1U8LA 4P4KA 1S9XA 4YDJB 1NKOA 4ZYKB 3I84A 4JY4B 1MNNA 4NZJA 3CH1B 2ZYIA 1A0QL 1YC7A 3QNXA 3FU5A 2W60A 2VDKH 3ZTDC 3PDDA 3K91A 4KWUA 2ODIA 4ZODA 4XPTL 1FYTE 3TJEL 3SPJA 1W91A 2BNRE 2CO3A 1DHKA 2HFFA 3MXVL 3NDYE 1ETA1 3GBEA 5I1KH 4AVIA 4XPGL 4Y4KD 3VFSA 1O6VA 1P5UA 4Z7WE 3EAKA 4AJ0A 2D3NA 4PCSA 3CSYB 3HJ0A 5GRXG 3W0WD 4F7MB 5TF0A 2X9YA 2C4XA 3KR3H 3OBAA 1AXTL 4QXUL 5I8KH 5ALBH 3GSXA 4FXTA 4WV1C 3HMXH 3KS0H 4GUQA 3KWVA 4G9FE 2WBKA 4Z7VB 1I1RA 3S34L 3KWUA 2KLRA 2WZ6A 3SKJH 4PGDB 1SQ2N 1T2JA 1TJXA 5KVGL 4QWWD 4I48B 4EKXA 4YX2H 5M7QA 5BS0A 4EEEA 2HTLC 3KPOB 3WY3A 2GFBB 3GINA 3BQUD 1WAPA 2QPSA 3OR6B 4NKMB 2WGNB 1P5VB 1PFOA 3TPKA 1DBBH 2X4TA 3TWCL 3V2AR 4AENB 1KIQB 3NIGE 3BH8B 3MV11 4QHLA 2JKIS 1FBIH 1AHKA 3WKQA 1XGTB 3AABA 1UA7A 4EN2A 2YD0A 4L5FL 1Z0MA 3MNMA 3QUXB 3A24A 1U8IB 2VWEC 3CUPB 3BX7C 1T1YB 1XH1A 4G7SB 3QJRB 4HUNB 5E9DA 1T0OA 2HX9A 4YSOA 2JCCF 3DX6B 1QSED 3TEUA 4MGXA 3AT0A 4D8PB 1RIUH 2CXGA 1ACYL 3D4YA 5CIPB 5C08B 4D9RD 1RUAL 5AUMA 1W9XA 1OP9A 5F7UA 2FQGA 4LRNL 2J8UF 4MHHG 1KG0B 4KKQA 4WNJA 3T0WA 5D7HA 5IFHL 4WJ5B 1B0IA 4IKKA 4FQJH 3ZHLA 3QDGE 4UM8B 4NM8L 2R23A 4QRQB 1UJ3A 1Q4NX 1A3RH 4TRPH 3O9WA 3UABA 1ZA3A 3BP7B 1QW8A 1QRKA 1YEJL 1FVEB 2BSEA 3OGCB 2YD2A 1V27A 1YQVH 1TQUA 4CU6A 3UPRB 5IJCC 3OKOB 1LTXA 1XD0A 3CD4A 2FH6A 1QR1A 3FRPG 5F0LB 3ZDWA 2V5TA 4NENB 2BRQA 3N3EA 1SNRA 5JOFB 1ZJAA 1RD6A 4QD2E 2DWXA 4UM9D 3BUPA 2Y2YA 2PCPA 4CAGA 2ALWA 2XN2A 2VJXA 5IOPA 1BX2B 1MAKA 3I02A 1AGBA 2FVNA 3N55A 2WVUA 5IB3B 2XA8L 3VD0A 4W6XB 4KAQH 1S7TB 3TJHC 3NUKA 4PRID 3VI3E 4WUKL 2JTYA 3IMSA 3RDTD 1EPFA 2IGLA 5F7BA 3QUMA 2LLLA 4M1GH 4YGVB 3DK2A 5IW6B 1CI5A 2BLFA 4M8QA 3TBBA 1A25A 3ZXAC 2XN0A 1RZIA 4XC1L 3H2QA 4PGJA 5MEPA 4Y4HB 3MLYL 3C2SA 1UXSB 4HOWA 4A2EA 4AYGA 5L4JA 2WBWB 2CDFA 1YJDH 5DHVH 5E8EA 2B2XL 3MV8B 4N24A 3KLHD 3W2DL 1CLVA 1AO7A 3ARGB 4P5KA 2VGLM 5DVPA 1T5XB 3EOTL 4M4RB 4KPHL 3SPGA 3UZVA 3FO9A 3FPYA 2F0CA 4P9HL 4BCZA 5JW4Q 1JOIA 1QFHA 5D71H 2GTZA 2LE9A 4UV4H 4RX4D 5AD0A 3SPHA 4JFDA 2FYYB 1PDKA 2QSCL 2MQCA 1CF8H 5ICZB 3D25A 3RX8A 3S3BB 1KBKA 2F7IA 1KJ2A 3V0JA 1ZPUA 3VVWA 3LZFH 4EOWL 3QIWD 2VWEE 2YEVB 3BC9A 5JMOC 3CDZB 1LHZA 4Y1AA 4ZO7A 2RIKA 4JZNA 1G7PA 1SEBA 3WHE0 2J6EH 2YN3A 1FFOA 2VUYA 3TOPA 3BI9X 2Y7MA 4CDHA 1IUZA 4H20L 3PGDB 3ARYA 5AYTA 3T65A 1F86A 3VU1A 1J1OH 2B9AA 1DLHB 4BFIA 4QOKA 1XR8B 2J88H 4ZQKA 5EIQA 3ZUNC 4AOFA 5FUCC 3B6SA 1HWWA 1I7UA 3JQOB 2XWTB 3DSFL 4N3UA 1MJUL 1A4KB 5ADOH 2Y06H 3KBEA 1FNEA 3WOVA 5B7FA 5C2BH 1KYOK 5IWLC 3PWNA 5IB2A 4X9HA 1KGXA 4D3CL 2A83B 2QQKH 4D7BA 1KJVB 4XZUA 3OLIA 2XFGB 2AQ3A 3IU3A 4NZRL 2N4IA 3LTVA 5C09E 5I73C 4R7DB 2FAUA 1NLDL 1NUGA 1ZSDA 1WDAA 2DEYX 4PJCA 4W9LC 5I6KA 5JW5B 5C8JA 4OM0H 5LXGH 2VLKA 3MJ8A 1U8PB 4NAJA 1UZ8A 4E5XA 3PAZA 2ROYA 3BJLA 3QYCA 1U9KA 2J43A 5HDQH 1E4WH 3QZMA 1RURH 3Q5YA 1NAML 1TENA 4GFTB 1X5HA 3AUVA 3KGUA 4S1DD 4DN4L 2H4EA 4EI6A 1DR9A 1EEYA 1L6ZA 3EO9L 2IOIA 2R69H 4NQCE 1CYXA 1U8JB 4JQVC 4WHYH 4F37K 1ZOXA 5B38B 1FNGB 2CHZA 1JK8A 3IDNA 4BDVB 3F5WB 3ALPA 4L9DA 4F7CA 2FQEA 3KBHE 3T77B 5ES4B 4GUOA 3L5JA 3FSVA 3CSPA 1V10A 3O2DL 1SVBA 3MGTA 4NXKA 4X0KB 2AEPL 2OMZB 4U1GC 5K9JH 4KK5C 4IRJC 3S4SA 4J4PA 1MFBL 4G71B 1QPXA 4A7SA 1JF1A 1R46A 1JRHL 1T20B 1U2CA 3T0EA 5KANG 3ZOAA 1JHKL 2NY5C 1GJUA 1LD9B 3PPEA 2OMUB 2P80A 4Q4EA 1OPGH 1E6JL 3QZBA 1JD7A 1ITBB 4HJ0C 4K9EC 4HMCA 3ZZLA 3QJXA 5HGDB 3DECA 5I76B 5SWQB 1ND0B 4PEEA 4PGDA 4FFVD 2IPTH 3GGWA 3KPMA 5I1HL 5C0CB 4ZMXA 4M6NL 3HC3H 4YIQA 4UAOB 5E6UB 5HHOA 2YD5A 5BZXA 4NUQA 3SGEI 3HZMB 2BVOA 4GRLD 4JZJA 4NKMA 2DWEA 4CMMB 5CLWA 1INQA 3B9AA 1EZVX 1A47A 1KIQA 3HHSA 3V6OC 3AG4B 5AB0A 4QRTB 5JUEL 4YHML 1FRGL 5BOPA 2BRRH 1KIUB 3DRTB 1JN6B 3V79C 3MLWH 3QEHB 2WXIA 1GMIA 2NRDA 2ARWA 3ZDZE 3BGMA 3MRQB 5D7EA 2Q6WB 2J72A 3SJVA 5AFAA 3TBYB 3DETD 4G59C 3DJSA 1NFAA 1MLBB 3Q2NA 4JKKA 4NWUL 5DJAB 3SD5A 1ZA6B 5I1GL 4LLYB 5LGJB 4KX8A 4PJ8C 1D9KA 1CLYH 3TO4D 3UZEA 2OPCA 1N68A 4HJTA 4S1SH 3VXNA 1KYOJ 1OGPA 3M1OA 4JM2A 4TQEH 3NJKA 5EA0L 5DJXA 1BBDL 1BVKB 3D39E 3MV9B 3T5WA 5FUCE 3TBTA 1S7RA 5CIPA 4G8EA 5DJDA 5EOTA 3EXJA 2JK5B 5HDBE 3ZDXF 3SE3C 2XQYA 3P69A 4Q52A 3OKKA 3VWJC 2EDLA 3JWNC 4YFDB 2QT6A 3SYQA 2XETA 1KWGA 1QEXA 3VXRD 5FFOA 4APQD 2G2PA 4ODUA 4GKZB 3IYLW 1CG9B 3LYRA 4PJBE 1TF4A 4WO0A 1OVZA 3IE4A 3OAYK 4YDNA 1KFAH 3MNVA 3KXFB 4NIYE 5AL8A 4XP4H 3FQRB 4BZ2H 4L0PB 3V6FA 1OB1B 4UANA 4WFGD 1DO5A 3NAAL 4X5WA 5LQBH 1GL4B 3HAEG 4P2OC 2NY0D 1EH9A 1UH3A 4UINH 1ZE3H 3TBSB 2YRBA 1V7NL 3UTSA 4F7PA 4DF9A 3IAPA 3BAEH 2JB6A 4WTZG 1QOKA 1IM9A 3OGOE 3IFLL 2EH8L 5G55A 3HR5A 2E7HA 4FA8A 2Y7SA 3O6FA 2HLAA 5L8JB 1BX2A 3L4UA 4OFYA 5C0AB 5ADPH 4QHNB 4JUTA 3WHE1 2J5WA 1LE5A 4N2BA 4RMVA 4L3AA 4U49A 3DGGB 4K7PY 5CJQL 3MODH 3EKCA 3DHJA 1W8NA 5T3ZD 2BS9A 4FQCH 3RWEB 1FG2A 4X80H 3I75A 1HI6A 3KAAA 4KZCA 2Y2WA 1RHHA 2YBRA 3AB0B 1QW9A 4U1NB 1X9RA 4R90H 5HYJE 1B9ZA 1HILA 2WPGA 5E94B 2P8LB 4X83A 3FBQA 5DI8B 4A1RA 5SV4A 4LFHG 1T0NA 1M7IB 1HT6A 5AW7B 4E9VA 1AGCB 3QXAB 4N2AA 4H13C 3NEEA 1UM4H 1UQSB 2D03H 3O8XD 5CEXB 1T5XA 2FD6L 5I71B 2G3MA 3RIAF 4WUUB 2E9IA 2Z31C 2BZ7A 1X7TA 1RPKA 1TEGA 4AXWB 1HWHB 2VQUA 4Z1PA 2KHAA 1GW0A 3BW9A 4JN1L 3U46A 3KJ6L 4G8GA 1MFAL 3VTTA 2MKWA 4TNVK 2YSSA 1HSBB 5AOMA 5I8OH 3V6OE 5KN5A 3ULAB 4IJ3B 1T7XA 2NZ9C 5ICZA 1J5HA 4AX3A 4BFEA 2P7TA 1CFSB 5E23A 4JQIL 1N18A 3LKNB 1D5BB 3PWLB 4A63A 4KQ3L 1NLBL 3FRUB 1EUUA 1D2OA 3FZUC 3RPBA 2Q10A 3Q2WA 5C0EB 2CLRA 3BDYL 1IC1A 3L4TA 3DXAB 4MNQE 1JL8A 2ENPA 2MNWA 2WXHA 4NM4H 3D3VB 3ZT6A 2ZUYA 4G3YH 2KPNA 4XCYB 5K9QI 1HCZA 1R5VA 4RBPH 1W6LA 1IQDA 1T2QH 3OJVC 1DLHA 1F11B 1NAMB 1ZWIB 3IXTA 3L3OA 3VGAC 4Y19A 1S4IA 4NQDD 1RZKC 1U95B 3DX9B 4YHPA 4ZTPL 1TZOA 4DW2L 3P54A 3VAEA 3GRWL 4OCWL 2VDNB 2Y24A 1TJGL 3JWNE 5DZJA 3RY6A 3ETTA 1A7NL 4MZ2A 3VXUA 1JZ6A 5F8QC 2ZUVA 3HKFA 4OCSL 2YA1A 1KB3A 2VB5A 5BQ7A 4M6MH 1K4DB 4JHZA 3MMEA 4OV5A 1I8KB 4KHXH 5E2JA 1WWBX 1MN4A 1WIUA 1BXAA 2YOCA 2F15A 1IBYA 3P2BA 1MH5A 4ABVA 5IR1B 2HKHH 3BWSA 4N6QA 1JCVA 5IW1A 4JKPL 2VXUL 3L3DB 4FJYA 1H9VA 5HD8D 4HVBA 4GKOA 4XBGA 1BCIA 4LOEA 4PCTA 4NQTA 3VG9B 4CSTA 4IGBC 1FI8C 5GRJL 4FQIH 5D7LD 4ZXBB 4HC1A 2EDFA 5GISH 3FDWA 4HIJA 4C8XA 3KLLA 4WZ9A 1FNGA 4PGEB 3F5WA 3Q5OA 3MUGA 4D0CA 3ZHNA 1SHWA 5FGCE 2YRLA 1X5AA 2EQDA 1A0QH 3U6RA 2BP0B 1U2HA 2J5LB 2NR6C 4JFSA 2Z7WA 4HAFA 3F12B 2IQAA 2WTRA 3CLFL 4HIXH 5JIIA 1LK3L 2HX8A 5CN1A 4JPKL 2F58L 3BAJA 3BZ4A 5ELIA 2GABA 3LKRB 1H3UA 1T20A 2CCLA 2IDQA 1ZD6A 3MRBA 4P3DA 1IBFA 4XPGH 3W9DB 1BPLB 2WXLA 4J1UB 5KVDH 4U1KB 3MRNA 2YPLD 3T8XA 1GCYA 2V5YA 4ZNCD 2LR4A 2O6CA 4OJYA 1X9UA 4KKCC 5CGBA 3V0AC 3MAWA 2X3AA 2XPGB 1AXTH 4G42A 4QXUH 3DROB 4X6EA 5JPMA 3MJWA 3SJVD 4X9YA 1M3JA 2CRYA 2XWZA 3KPRA 3S34H 1A7RL 2ITCB 3M45A 5KVGH 5J5EA 3DUSA 4A7VA 1DYZA 1GGUA 1O0VA 1ZTXL 1WICA 5F3HB 3MLVL 4MJ5B 4GW4A 4PJFF 5IVOA 1S3RA 1C16B 3QQXA 4NP4H 1I3UA 1J9QA 1IBHA 3SN6N 3TWCH 1TR7A 3DIFA 3BDBA 3O2VL 5C0NC 3VD1A 4WHDA 2F8XC 5FWQA 4LAQL 3QNYB 4AQ1C 1XGRB 4L5FH 4PJ5E 5LG1A 2Y7NA 3ILPB 5EPMA 2JWYA 1K9TA 2CA4A 3CTTA 1R5WA 2FL5A 3LS5H 4FFZA 4TVSa 3GSWB 4N25A 2VJ0A 5IREA 1NBYA 3VFNA 2AC0A 3MV9A 4PBVC 3EJYC 3G9AB 2GITA 2JK5A 1IGTA 3WG7B 3TA4D 1X5FA 4LSPH 2MPAL 3AQDA 3NCYP 4U1MB 5DUPH 4H8QA 1ACYH 1XIWB 3B9KD 4MX7A 1XFPA 5I15H 1RUAH 3MLPA 2A6IA 4LRNH 2VKWA 3V6BR 1AC0A 5IFHH 2E8ZA 4UZUA 5DEGA 4NM8H 1CXIA 1ZVYA 4XVOA 5CJXC 5D8JL 1ZANL 3UTTB 3LPFA 1FO0A 1MFVA 3V10A 1V54B 1QSFA 2D0HA 2O26U 5FO9A 4MKTA 1TETL 2VLJB 1VADB 1JRHI 3CFEA 4ODSH 5HY9B 2QQNH 1EEZA 2XHNA 3QS3A 1B88A 2GEEA 4PW3A 1JI1A 1BQKA 1P4LA 1BFSA 5KSVB 3JT0A 4CSSA 5CLXA 2ARJQ 2W5PA 4K8RC 2F7QA 2NLJB 1TTAA 2FO4B 4P2AA 4XP1H 2VISA 4Y9GA 4RAUA 3GXPA 4MMYB 4BM7A 3MRKB 1I7ZA 2Y2TA 4PJAF 5GRWA 2CZNA 4MAUL 2B4CC 3WAKA 4WUKH 1T03L 3VQMA 4G80B 3MZGB 3QQNA 4UQ2A 4X8CA 2R0ZL 5F70A 4FJ6A 3VFRA 1F2QA 3FTGB 2X88A 2FEEL 4LCUA 4XC1H 2XNAB 5CLZA 1LO2L 1OP5K 5FM5O 5IG7B 5CD5C 5B39G 3QHZL 2DMKA 4N5UA 4WJG3 4JN2B 3QXAA 4AIZA 1NC2A 4HH9B 4X4YB 3G08A 3X13B 4F5CA 5MENB 3CZGA 4DSYA 2DWDA 2ITDB 1GYUA 2AXFA 4IU3B 3HRZB 3EOTH 3G5ZB 3IMWA 4YL9A 4P3CL 2O30A 2Z93B 1HSBA 2N7BA 3ZYIA 4KPHH 4M7JL 1OCRB 3H4FA 3OB0K 2WJ7A 1KGJA 3QCTL 5MHSD 1P0SE 3DOIA 3UTQA 5K69A 4KJQC 3UCRA 5JMRA 1P2CA 1BYNA 1MY7A 3TCLA 3QXUA 5C0EA 1ACCA 3GHPA 1LE9A 1PAMA 3WDIA 5DLLA 43C9A 4RFEA 2XPZA 4EOWH 2FO8A 3ARSA 2XVGA 5ISZD 3VSUA 3PIQA 4NOFA 4M8VA 5GZOA 2J57A 2ZUQC 1U8QB 3K2UH 2D7MA 2VNCA 1F11A 1NIFA 5B3NA 1E8YA 1EHXA 2EXTA 2Q8BL 5IVNA 5AAWA 2B39A 2OMYB 4RNRB 4H20H 3EJZD 3HC0A 4QTIL 5I75B 5EIIG 4AM0B 1QLFA 4WW1A 4ALAL 4LLDB 2OCJA 4IIZA 3DX0A 4Q8BA 1NGWB 1RUPL 2UZXB 2YXMA 4WI4A 4ODTL 3S8WA 1E90A 3DSFH 5C2UB 1MJUH 3CDCA 3EBIA 2R2CA 1DJXA 2WVVB 3W9EB 3WLWC 4D3CH 4LEXL 4OZFH 1UA3A 5I5RA 5E5LA 5TDOA 2YFNA 4NC1C 2YUWA 2OSLB 3B43A 2C9AA 1BJ1H 2VR3A 4OVVA 4DVBB 3W11D 4FJZA 3OQRA 1QUNB 4HP5A 1HWGB 4XNAA 5INDB 4OI7A 3FYEB 1NEZA 4MXQD 5FYKL 3S2CA 5FO8B 5IB1A 3V0WL 2GT9A 3LRGA 2WLLA 3S3PA 5HHME 1SDDA 2KI6A 1CGYA 4NKQB 2K1MA 2OP4H 3K2KA 3FCSA 4MMZB 4XZ4A 2ADYA 3C60A 5C07A 2ZX6A 4J3BA 1Q72L 4P2RB 4Y4KA 4DN4H 4H1LB 2YJLA 3B7TA 3WJJC 3EO9H 1U8MA 1KGWA 2WP3O 4IHOB 5LXVA 3N04A 2GSIA 4JY6B 2YGVA 5B1AB 2ICWB 3W0WA 2UUDK 1HJBC 5CBEA 2GJZA 5BQDA 3KDMB 2G4EA 3KM1A 3MC0A 5D1XA 3T6VA 3CMOL 1CICD 4LHQB 4N5ED 2UY7B 4LGSB 2PWFA 3DBSA 4P06A 2B1AH 1ITCA 3TBVA 4AE0A 1MFBH 1NICA 4LCIH 1RZFL 1JRHH 3FQTA 3VCLA 1L6XA 1JHKH 3K7UA 1A1OA 4PYGA 2CK0L 2Q3XA 5D1QC 2EICA 5AVUB 1BIIA 4NQVA 1YEGL 3QZWB 1E6JH 4PRPE 3EJUA 3FQWA 3LPGA 5K9OB 2P48B 4FN0A 4IW4C 4WU5B 2EKSB 4LLVB 4I89A 5MI0C 1WISA 4WHCA 4Q9QL 2RQ8A 2WM0A 4M6NH 1DJSA 2E5EA 5EC2B 5DUJA 3VD7A 1IGML 2K4WA 4GQRA 1IZKA 4NN6B 3KNBB 1J1XL 1WAEA 1CD9B 1LEGB 2WOBA 3A3YB 2V3FA 5ETUA 5IROC 2ZXGA 1HQRB 3PNRB 4LGPB 2HH0L 4YHMH 4ZJ9A 3BWUF 3SOTA 4EI5C 2QMKA 1IKOP 4FEIA 4CADB 2APBA 4ZNEE 3QIUC 4KTGA 2VLRB 1RERA 4TLTA 3TC9A 2ZOWA 2G3ZA 4NWUH 5DHYB 4DKFL 3MRFA 3BUIA 3RGBA 2G5RA 35C8H 5SWZB 2BP8A 1CDGA 2FX7L 4XXWC 5T5FA 4P46C 4Z95L 3WIHA 5EA0H 1BBDH 4L1HA 1D5ZA 1TZGL 5D2LA 5J13B 3B2MA 3ZMNA 3V5DA 4EDXB 2NZIA 3FF8A 1VZHA 4GSXA 1GMEA 1XL6A 3RUGB 5IF0B 4XAWL 5FYJL 1NUFA 1S9VB 4N2CA 3QUXD 1K8IA 1FFNB 4OFKA 4YDVA 4JRFA 2JJVA 4NC1E 5JTWA 2Z34A 1XB3A 3UTZB 3L3IB 1BG9A 5LAXA 3S9DB 3L3KA 4AQ8A 3E2HB 1J10A 5DS8B 4BH8B 4X9FA 3TFKC 3PXJA 4U7MA 4JKMA 3QUKB 1DSYA 1WUNT 4P4RB 1FL6A 1QFUL 4I9XA 8PAZA 4OJDH 3H7BA 5D4IA 3BUTA 3VRJB 2VLJA 1VADA 3A47A 2E7LC 4XMXA 5C08D 3NAAH 5TF1L 1PZ3A 4POUB 1FNHA 4U1HB 4I8DA 4LNVA 1RFDL 4JRWA 1HHIB 2Y5TA 5KSVA 3BVVA 3IFLH 2EH8H 2Q2EB 1MCPL 5T1DL 3JWOL 5D96C 2NUTB 5D1ZI 5DEZA 4DT2A 4FHJA 2EIJB 1EO7A 2X87A 1OAXL 3NT0A 3DRQB 5FCSH 4P4KC 2IANE 3OWEA 4WU7B 4N8CH 5CJQH 2F8IA 2ICWI 5F71A 4QY8A 3CQQA 4F15B 5I66B 3T3MF 5JDJA 4F8QA 3H9SE 4HKBB 4PP1C 3GTNA 2FSEB 2VUKA 3D6GA 1XCTB 4HGWA 1KY6A 1OAQH 3EBAA 4CNIB 4FTVA 2UWEE 2VW4A 4JN2A 2K6ZA 1NKRA 2E56A 4QXGL 1LNUA 1P5UC 1WD9A 2HT4D 1TQBC 4AW4A 5FLVA 4BD4A 1BHGA 4MD4B 2ITDA 3U48A 3RNQB 2H32A 1XGYH 3QJHA 1G6RA 2AJUL 5B1JC 4NYLA 4U1LA 2ZX5A 4PJGB 3WFHA 2FD6H 2HMID 4OUUA 3SQOL 4K3JL 1A21A 4U3SB 5HHNB 2X9XA 1X5JA 2GIYA 4LLUB 4I0KA 4JN1H 2VC2L 5GGRA 3HUJB 5I1IH 1FVCB 3KJ6H 4EN3D 4Y4HD 3MGOA 1TZ8A 1F4YL 1PZ5B 2CLVB 5ID1B 3VE0A 5ANMA 1EDYA 3VXSB 3FUHA 3OHMB 3R1GL 3ZZQA 5DFAA 3L45A 1WCBA 1XQ4A 1NC4D 1HXMB 2CMRL 2G4GA 1CIUA 2PTTA 4MYWB 3ARGD 3WEBA 3ROLB 32C2A 1J5DA 3LB6C 2XIBA 3BDYH 3Q9QA 4NPYB 4JDEA 5A16A 1UFGA 1ZT4B 4LPVA 4WY7L 3UP1A 4N2OA 1A3LL 1JHLL 4G7VL 4RWHA 3GRBA 3OKLB 3MRCB 2YAQA 4AM0A 5EBWB 3ZUCA 5HXMA 2K9UA 2E7MA 3ARDB 3D12B 4GSDH 5E1AA 3WN5C 5DXWA 2VZ1A 4HPOL 4DW2H 5JIQA 2CBOA 4JRYE 5FM4A 3FB8A 3GRWH 4JG0L 4OCWH 4XBEH 4QEGA 3EGSB 1TJGH 4DEUA 4YBHA 4N6RB 3ML8A 3UAJA 2NDFA 1J05A 5EDXA 2FHCA 2Z1PA 3GLDA 1EFXB 5I6XC 3O3AB 2B1OA 3S2AA 1S9KC 2X1XR 5BPPA 4YAQA 5I1DA 3SKOB 4MMXB 4X4KA 4J23A 3TZVB 2ZG3A 2OQJA 4P23D 5JHDE 4OF7A 1A6ZA 2G3XA 1A4JA 2XFXA 4Y2DB 2EVIA 4JFFE 3K8LA 2VXUH 2XWEA 2D4FA 1UYWH 5CUSL 3O9WC 3WD5H 3BP4A 1AOHA 1WAAE 3K0YA 4FNUA 3MTXA 4G7QB 2OMWB 2CHWA 2FJGA 5GRJH 1J11A 3C5JA 5CGMA 3DA0A 4PJ7E 3ESOA 4IHOA 1DBMH 2CD0A 3IJ7A 1IB5A 2VE6B 4XNZB 3OAUL 1CGXA 3CHQA 3KPSB 4B60A 4O51A 3UOAB 1RIVH 1WIOA 3HS9A 3RJOA 2ZP8A 3RE0A 1JNLL 1ORSA 1SXAA 1YLBB 3RZCB 4XTRC 1IC4H 3CLFH 1R17A 1IEBA 2E9GA 4JPKH 2F58H 2QFRA 2P46B 1JVOA 3K6SA 4LLWB 4JX0A 3BD5A 1QHQA 5E6IB 2WQRA 4F9LA 3DUUB 3OLGA 4XOAA 3WUWA 4WW2F 1KACB 2K6WA 3MQIA 3SPVB 3ZE0F 1W72L 2I25N 1M56B 4WU5A 5GJSH 4M61A 1SYSB 1A6VL 2G9KA 5FYLD 1K4CA 3VM5A 3CVDA 4U6XB 1A7RH 3IVKA 2VR9A 5JHBA 1JXKA 1T04B 4LU5H 3GTVA 4X4MA 1ZTXH 4AKOA 3MLVH 1G5GA 4QPEA 4WWNA 1U8OA 3ZE2B 2F8OA 1YMMB 2IGTA 5BS0E 1Q1JL 1OE2A 4NJAL 4MXWH 5HGHA 1G0YR 4CVXB 2ORBL 5LNDA 3VYOA 1J9TA 1H3XA 2DQEH 3MRLB 3BZEA 3O2VH 3GJFH 3ARQA 1OLLA 2JV6A 1VFUA 5C0CD 3GMRB 4LAQH 3DSNB 1Z1WA 5LG6A 1VGEL 4XPFL 5IJDC 4HUMB 2WIIA 4FABH 4PJGF 4BZ1L 2MMXA 3PFUA 4APQA 5E9DE 4N1CA 4MLIA 1T83A 3HUJF 2EVFA 3VSVA 3EW3B 1MOEA 2MPAH 4ZS6C 1BWWA 1MWAA 3IKCB 4QRPA 5E8DL 4LIQL 1VJSA 1CE6A 1CFVH 5IBTL 3UTZA 1BQ5A 1CDCA 2I07B 2JI3A 4BH8A 5DS8A 2YR3A 1MVUB 1R24B 3EFOA 4QO1B 4B9CA 4NB7A 3KBPA 1KXTA 5FC9A 4WENB 2VO5A 1MXGA 4D0DB 4YHYB 3SE6A 5D8JH 1ZANH 1UJTA 1LEKA 1A3ZA 1P1ZA 4YSSA 5CKGA 2PNDA 1PLGL 4PJHF 1SDAB 3OXSA 3P73A 4H8PA 4HUUA 2V6HA 2OSWA 2ERJB 3RIFF 1QZ1A 2WXKA 3LPWA 3T1FB 4AL8C 2LAGB 1HHIA 3KPQA 4BBWA 1RPQA 1L0PA 4UQAA 2XZCL 3K0WA 4Q2ZB 2VITB 2N59A 3PHQA 1KN2L 4OR1A 2ZCLH 3BLBA 1E9OB 3EYSL 1QX1A 3PWPB 3Q8CA 4GO8A 1P1VA 3VO0A 3KXFD 4IRSB 2HJLA 2JKNA 2VC2B 3ARXA 3D52A 3MLZH 5DA0B 5I19L 4ILDA 3VYNA 5I66A 4RGNC 1T22B 2W0FA 3FUDA 5DC0A 2YIHA 1M3IA 4QLRA 5TE6H 4MAUH 1DUYA 1T03H 2VMDA 4HUCA 2R0ZH 3RVUC 5SX5K 4BH7A 5E8OA 1SBBA 1ZAGA 2AVFA 4QRAA 2Y6SD 5C0AD 1GZQA 3X3FL 3S5LB 1UEMA 4NBZB 1M57B 3G6AB 3ASNB 3WLBA 3T0EC 3MX0A 2X9WA 2ZNWA 5KG9B 1N64L 4LCWA 4NN7B 6TAAA 1RH8A 2CO7B 4HCRH 2V2TA 3NP3A 2CJUL 4BKTC 1NGYA 4KOCA 4J3OH 2QPUA 4P3CH 3DURB 4MRCA 1LMKA 4LF3B 4FLOA 4IEFA 2JJSA 4AQAB 4RGOL 5KS9E 3QCTH 3D0AA 4ENEC 1JPSL 1AZNA 3ATDA 3U0WL 4JFDE 3GS7A 3NJHA 1YN6A 2XA3A 3CN0A 5JOPD 3A4AA 1N6VA 4HLZH 4PJ9D 4OF5A 4WUUD 1N70A 5I1EL 2UVFA 1XH3B 3THML 4I3GA 4B9KC 3FCTA 1E3XA 3HCVA 5HDLA 1PYWB 2AXHA 3ZTEA 1R19A 4TTGA 1WBZA 3TT1L 5BUAA 5IHZA 1QKZL 4QTIH 3UMNA 3SDCB 3UZEC 1U93A 3C5SB 1BQSA 4XO8A 2EYTB 4ALAH 4JM2C 1LEIB 1JF5A 1RUPH 4AC2A 5GS0C 5MEOB 5FUOH 1OGAE 1A6WH 3MBEA 3NEXA 4P2YA 5JIDA 3DXAD 5EZPA 3GBML 1JS4A 3TTSA 3D3VD 1Q38A 1A64A 2QTEA 5D7LA 3VB9A 1KGUA 3V52L 4MA1C 4PSRA 5IEHB 3UG3A 5L2KB 2QZ5A 1BBJB 2HT3D 4KBPA 4OFQA 2Q7AA 1MCDA 2A99A 1F0LA 3NPZB 4V11A 5HJGA 3T8VA 2WGXA 1DSWA 4NKOA 2H8PB 2WWKT 1GGBL 3PV6A 1S7QA 4EO5A 4PJCE 2I9LA 3MRIA 3AAZA 3TYGL 4XCNA 3V0WH 2OMWA 5AKTA 4EVNA 1JFHA 1LWRA 4JG1H 2C9SA 2QV2A 4N0UB 4Q58C 2ZAHA 4ZX5A 2F53D 4DP7X 5IB4A 1KN4L 2D31A 4L3EA 4MAYB 3WKML 4MFHA 4X9BA 4I9WE 1MFCL 4XGZB 4TNEA 2YPLA 5I6MA 2X0VA 1BD2B 1GVIA 3D0LA 1HZKA 1KGIA 3O6FC 2GJ6A 4X2UA 4RGNE 3WNOA 2AP2A 4RFOH 4WI9A 4BK5A 2NXYC 3BWAB 3AREB 5BZDB 2YPKA 4D0BA 2IXQB 4JFEE 1PZDA 3CLWA 3QUYB 1E28A 4MNGB 3CMOH 4N8VB 1NGPH 3KPTA 4ZXBD 4X6BB 5KSBA 1IIKA 1W0WA 3PY9A 5TDPA 3FO0L 3OKEA 5FM5M 2O6DA 3QXWA 4G72B 4KH2A 1U92B 4Z7OB 1EWHA 4OZIE 3V4VB 4K5MA 3KGRA 3TEZA 2P45B 2PPCA 3H3PL 3PLYA 4R2GC 5LCVA 4BFRA 5ECGA 4NWTL 1NOLA 4ESKA 1P4IH 5E2TL 3T0EE 2CK0H 5K9KA 2OA9A 1OAZL 1YDPA 2X70A 3HBQA 3SKMB 3WE6B 4DAGL 1R47A 4APXA 2AV7B 5F3BB 5B7EA 1NMCB 2EC9T 4B9FA 3P77A 3Q06A 1ZDQA 4X5XA 4U6XA 2ZXBA 5IV2B 1TCMA 4C56B 1N8OE 1DBJH 1XTMA 2EECA 4GSRA 5TK2A 4N4YB 4ZG1A 1P4BL 2Z92A 1XWVA 1IGMH 2DYRB 1ZHKA 1AR2A 4B5EA 1MI5B 2M1KA 3REWB 4UMSA 3VDCA 8FABA 1RK7A 4UQ9A 1WFUA 3PE9A 1Q94B 1ZHNB 2NX5B 2VDML 3PP4L 1KCLA 4AE1A 1A7QH 2OMVA 4NQED 3KPLB 3VXOB 1UASA 4Z76B 1Q9LB 1TXKA 1GYAA 1GYVA 4NXSA 3WUZA 4LARL 3U4AA 1BAFH 4U0QB 4U1JB 3V0DA 4OLYH 3Q13A 4Z95H 1MEXH 2MCAA 3RWJB 1B3IA 3WI9A 1ZLWK 1RZPA 2HWZL 3ESPA 3K4ZA 3B3BA 1S3KH 3ARTA 3CFKB 3QUHA 1UXWA 2PO6C 3ENEA 4DGVL 3NN8A 1IGCL 5FYJH 3H42L 5CMAA 3I74A 2WKOF 5C9KA 2D0GA 3MROB 4Z7NF 5B8CB 4JO3H 2B0SL 1FVDB 2DW5A 4G8FA 4YHKL 4CGTA 4JHUA 3U82B 2ENQA 4KZEL 5IKCA 1T2XA 4FGMA 1HOEA 4IIQB 3FOMA 4LOUC 5C0DB 3K5RA 3KMDA 1A6TB 2X5PA 1KCRL 1XIWD 4DGYL 1PEZA 5FOBA 4ENZA 3JXAA 1SXZA 2FJFB 2IALB 3Q6FA 5HDOA 5TF1H 1XGUA 4OLWL 1T0MA 5DHVA 3M7FB 1JUFB 1URZA 2BNUA 4HOXA 5JA8B 5F6HJ 3MRGB 4UOQA 3UTSE 3ECQA 5F7YC 1RFDH 3F7VB 3CFQA 1E9OA 1NFIA 3NFPA 3CN1A 4KQ4L 5F0JB 3UTTD 4QRRB 5T1DH 3JWOH 3EYOB 3GIVB 4ZFQA 4G2AA 2YMOA 4Z77A 3CHPA 3JTTB 4ZQTA 3ESVF 4P2CG 4U0RC 1BECA 1OAXH 1MJ8L 1T22A 3HLAB 1L5GA 2IO5A 2XQYK 1YUHA 5EMYA 4AUJA 1JVKA 4HMEA 4NNXB 4ECNA 3VI4B 4BFNA 3B2XA 3HZVB 5IJVA 1I4FA 4LHJB 1S5IL 5C7ZA 4Y0GA 2BHUA 1A9BB 4UWQB 3GHBL 4A55A 3S5LA 1JK9A 3ULVD 3F7PC 2NY4B 1N5AB 2J6EA 2ZP0T 3C9NB 2OKMA 2FUTA 2VN3A 1HNFA 4H0LC 4R7XA 4TUJA 4XNMA 2A73B 2AJUH 2ZOUA 3ZKSD 2JCCA 1ZV5A 4K3JH 3SQOH 3ZW3A 5JPMC 4F8PA 4UQ3A 4ZMLA 4BFGA 4NKDB 5DJ6B 5KYXB 2C4FT 4GW5A 2Q76A 1IJNA 2VDLL 1ZHLB 4DQAA 3OLDA 4KRLB 4J3XA 4MD0A 3DV6B 3K6FA 3VXMA 1YPZB 2DIEA 2XBTA 2W9EH 1MFEL 3R1GH 2FEDC 1TJMA 5MEND 2J8UA 4K94L 4CW1B 2CMRH 2Q0ZX 5I28A 4P2QE 4O2FB 2ZWSA 1DQKA 2UY6B 5DUML 4ZMVA 3DX8B 5ITFB 4BFKA 1B90A 1B0RA 2WBJB 2AEOA 5IZ7A 1ZRUA 1A3LH 1NBCA 1NANH 1Z2KA 4KKBC 5F9WB 3K6IA 3N43B 4Y16B 4HCFA 3QULB 2H47C 4HGKC 3B8SA 5I1CL 2R69A 3R19A 4HS6A 1QWUA 2R2HA 4ZS7L 4N2EA 3KLAB 1HXKA 1MZYA 4KY1L 3S96A 5I9QB 5CCHE 2CAKA 1T7ZA 1R9FA 4X6DE 5EU4B 3G04B 5EU3B 3O4LA 3V0VB 1TKWA 4FMFA 1HINL 3M88A 2L3BA 3GQFA 3DYOA 3STBA 3VD3A 3IT8D 1VFAB 5BOZG 4F7EB 3BWZA 2JI2A 6PAZA 4KJWD 4PLOB 1CXHA 3RGVB 2WN2A 3IN0A 3WKNA 1B6DA 4G6AC 5DO2D 3ZK0A 2JKTM 1KGCE 2P42B 2ZX7A 2EEXA 4XO5A 1FCCA 2CRMA 3DVNB 2X05A 2GVYA 4MAYA 3STLA 2UZYA 4B0MB 1EVUA 2K4AA 1DJW