3ZY7A

Crystal structure of computationally redesigned gamma-adaptin appendage domain forming a symmetric homodimer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
116
Chain Sequence
MIPSITAYDALGLKIEFTFERSSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTFNWNGYKVQSEAEVNNFPPQSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-1 COMPLEX SUBUNIT GAMMA-1
publication title Computational Design of a Symmetric Homodimer Using Beta-Strand Assembly.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 23
structure length 116
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zy7A00
1NA8A 1W80A 1KYDA 3ZY7A 5CN2A 1IU1A 1GYUA 2A7BA 2VJ0A 1P4UA 5CN1A 1KYFA 1QTSA 4BCXA 2DWYA 3HS8A 3ZHFA 1KYUA 1GYWA 1QTPA 3MNMA 1KY7A 1B9KA 2E9GA 1GYVA 1KY6A 2DWXA 2YMTA 1OM9A
chains in the Genus database with same CATH superfamily
4GT7A 1S7SB 5FO8A 4PV8B 4JPQA 5I24A 2YD2A 3SE3A 3ZT7A 4HK0B 1NFAA 2YC1A 1ZRUA 1HFUA 2WWKO 4OM0L 4Y8DC 2C1PB 3MV9E 2WQUA 3D0LB 1JTPA 1NCBH 1NOFA 4NSKB 4DFIA 3OJMB 3MUUA 1PDKB 5CJBA 1I85A 2KZBA 1JYWA 3ZMEA 2WNKA 2F53D 2R7EB 4Q6IA 3MU3A 5J1TC 4KTEH 3KZ8A 2PO6C 3UPRB 4JKWA 3CDCA 4JY4B 5J6HA 4LPXA 1U41A 5I2IB 4O2EA 4MNHB 1BF2A 3GM8A 2FX9L 4TRPL 1E27B 4KROC 4PS4L 3B3IB 3KEHA 2JI3A 1KYOJ 2YBRA 1JGEB 4XO3A 2EVJA 3SDDC 2J5LB 1VPOH 3VG9C 2EDQA 2W9EL 3GMRA 4V1DB 3O4LB 3LPWA 1G6RH 4JRXE 1AS6A 1L9OA 4U2ZA 4HX1B 1QBAA 3C8KB 2KKQA 2Q1EA 2P44B 4ZAKC 1H8SA 4DOHE 1JPSH 1QSFA 3RVUC 4DAGL 4IMLB 3V7AE 4PS4H 4PV1C 4X9HA 1OCWL 4PTUB 3CHSA 1OAYL 4JN1H 1I7ZA 4CSSA 3WTWA 3SE9L 3LPGA 3LKSB 4QHPA 1CFTA 1TJMA 4DCQA 4DP0X 4AYFB 1NDMB 3B5TA 5I5JA 5I1DB 4RBPH 3NPSB 1J1PL 5EU6A 2ZKXA 1GMIA 1IBZA 2VL5B 4JFOB 1HHJA 1LVEA 3H3KA 4JW3A 5HI3D 4UOW1 3F5WA 3C5SA 4PW3A 2NUTB 1CLVA 4PJXA 4ODWA 2H8PB 1Z0NA 1NGZB 4FLRA 1NCJA 3F62A 1QSFD 3U4EB 3QPXL 2EXWD 3BH8A 4AYGA 3H4HA 3OZLA 1ZV9A 2DKSA 2X7LB 3WSQL 4DN4H 2FWOB 4MKTA 5H94A 2WCPA 5F9JB 4JLRB 5E6ID 1AO7B 1YPZB 1L9RA 5EU6D 1M7DA 1MFVA 4KNUA 1BYPA 3MODL 3SPIA 4TULL 5ITFB 1PL3A 3RB5A 4OLYH 2NTFB 1TFHA 4JFYB 4NJ9H 1YEWA 3L13A 3G5YA 5KTEL 2BRRL 3LPFA 3VXRD 1Y0LB 5EORH 2AS5M 3SDXB 4GXFA 5GRZA 4M00A 1KTJA 2Q3AA 2JLLA 1TSRA 1U8JB 4MD0B 1Q1PA 3C5XA 3MNDA 4E41B 5CNHA 2R2HA 4DTGL 2ATPA 2WXGA 5D7LB 1KTLA 5EOTB 4Z3TA 5J3HD 4PREA 1KLGB 2GFBB 2GY5A 2YPKB 4WUKL 3TESA 4PJEA 4OAWB 5KTEH 3IPBA 5D6DC 2BRRH 1P7KB 5L2KE 4FI8A 4YEEA 1T7VA 5HYFA 4PGZA 2OZ4H 3GEWB 3BVTA 3ARVA 2WQVA 4OCYL 3U2SA 5HHNB 3AU1A 1TXKA 4LPTA 4YHPB 1GZHA 4P2RB 1I1YA 4W6XB 2JNZA 3PE9A 1JZGA 2OYPA 3ETTA 4Y2NA 2PR4H 3GSOB 1HU8A 3GHPA 4WUKH 4JDVA 5B8CB 4H26B 4NRYA 4XCEA 1XO8A 4M7ZC 2JKWA 3RDTB 3WI9A 3AM8C 4I1NB 3V0DA 3TOPA 1HSAA 3UTSD 3ZKXB 1BF8A 5I0DA 2GYSA 4JM2C 4OCYH 5FUOH 2A9MH 3UXFA 1X7TA 1YZZA 2NW2A 4MJ6A 4O9HL 2XBZA 2WQWA 1TT6A 4L9LB 2DQTL 1PD1A 3AG3B 3SQOL 1WWBX 1SXAA 1UZGA 2N7AA 3PWNB 2BWQA 1AGCB 2TSAA 3KHOA 3PGCA 4HIJA 5IUCA 5A40E 3UC2A 5F7HA 4TSAL 5AB0A 5AKSA 1U58A 2IBBA 2HX9A 4JPIB 2K78A 4M5ZL 2BM3A 2VSMB 4I88A 5I76A 2VDNL 2XWJA 1X3DA 5LCVA 4BSWA 4HV8B 4NO0A 2VDNB 1YPZF 5KANG 3KPSA 2H7WA 4PCKA 3MO1A 1S7UA 2MIZA 4YH6A 5MENA 1P6WA 1PLBA 3CVBA 5I6MA 3IJ8A 3H9YA 5CD3B 3NABH 2R59A 1U8IA 3U36A 3E7JA 3ROOA 2W9DH 4TSAH 2AJVH 3I6SA 1A1NB 4YBLB 5EPMB 2P43B 4L5FL 4HBQA 2VDNH 1XSJA 2F74B 3KYMA 1ZA6A 4XBEL 3F7QA 2A4ZA 5FGSA 5FO9B 3MRKA 2FIKB 1BJ1J 4I3GA 4K9EC 4M7LT 1XSOA 5L2JB 1YA5A 4JB9L 2V5RA 1VEPA 4NO0D 3EOBA 5FW6A 3KPSD 1ZVNA 2AXFA 5C0BE 2KERA 3T08A 2F54A 2UZIH 2OCJA 2I7SA 5C08E 3KYAA 3VU2A 4L5FH 4JPSA 1USQA 2A0LC 1CICC 4N8VA 2DD8H 1U93A 4U1HB 5E1QA 6CGTA 3LXCA 2K9FB 1DVFA 2YXVA 5DJYA 1I7UA 2OXGB 3JTTA 4JB9H 4OF8A 3BIKB 4X2UA 1S7RA 1C5DB 2PO6B 3K6OA 1MCSA 3KPRE 4TQEH 3GK8H 4LCUA 2AAAA 2O5XL 5IT2L 1UWFA 3WLWC 3KPLB 3D3VA 4D0CA 4FG6D 2FLRT 2BVOA 2ICEC 3UERA 4KROB 2WZPA 3UZVA 2WMPB 4YHML 4XX1E 3GLZA 3VD2A 2X9ZA 3SDDB 1IE4A 1XL4A 3MRLA 4HVBA 3VG9B 3APFA 4XCYB 4LLYA 5I8KH 4YFLF 4MBOA 4QTHA 5DK0A 3GI9L 4CGUB 5KAQF 3N40F 3KBHE 1UD3A 4ORZC 4WFFE 4LSQL 4WDIA 3GINA 3MGOA 5IT2H 2NXZB 2PTTA 3W39B 4CGTA 3B9VA 3FT4B 4LCWD 5C09D 2AQSA 5ISZE 2E7MA 5JTWA 4YHMH 2OSLA 3LVTA 1KBBA 4G7RB 1BW8A 5E8NA 3FCTA 3VXMA 3D3VD 1KIUA 5A2IH 4DH2A 3J27A 4A39A 1ET8A 1XMWA 4WGVB 5D9SA 1XGQA 3QEQD 1XD1A 1IKOP 4KUZL 1NEZB 4M7LL 3SBWA 2DDQL 1NSNH 3QIUC 1CR9H 2VXSL 1IC0A 3CFNA 1IC4L 4GQRA 1G7LA 4QHMB 2E8YA 1FNGB 1KJ2H 4X5QA 4FQJL 4A7GA 3NCYP 3L3JB 3NZ8A 2DMBA 4S1SH 3SKUD 5ALBL 3WAKA 5C0DA 4AKQA 1G1CA 4NM8H 2XYBA 2WNXA 3CC5A 4PJHE 2O61B 1AKJD 4RDQG 3O41A 5E9DA 1CE6A 1PG7X 3I6LE 4M7LH 2DDQH 3CSPA 2TRYA 2LU3A 2VXSH 1JF6A 3NSYA 1HZKA 4WI7A 4X9YA 2EIJB 1WK0A 3MKKA 1ZA3B 3BE1H 2HJLB 3MTXA 4U49A 4F8LA 1AQMA 2Z93A 1ZWIB 4S0TD 4CNIB 2BMKA 2AP2A 1BVZA 3RX8A 2AQQA 1INQB 3Q8FA 4UOJA 1WDAA 4HS3B 2VC2L 5KOVC 1H3UA 3ULUD 1C7SA 3WAJA 2VC2B 2YPLE 2NZIA 3D4ZA 5CJ8A 2D2OA 4WFGD 4XPGH 2X38A 4IJTA 3ZIYA 4I5BA 5TDNB 1E2WA 1KBWA 2FWUA 5E8OA 4DESA 3K46A 2BHUA 1A14H 1C12A 3GZQA 1WLHA 2LLNA 4K8RD 5E8EB 4EI5C 5C07D 1IGFH 1BLIA 5FYKE 1KB5A 5CINL 3NA9L 3SKMB 3L3DA 5T3XD 2YEVB 2Z35A 1CYGA 3WDHA 4NT6A 4O00A 3GYRA 3OZ9L 1A4JA 1G7PA 5T5NF 1YNTA 4FOMA 5CMAB 4K7FB 1ZS8B 4IU2B 1KN4H 2PCPA 3ZKNC 3CHOA 1N18A 5AZUA 5C71A 4LRIA 4FNSA 4PJ7A 4PAZA 1OPOA 4HJ1A 4ICWA 2OYLA 5TGBB 4ACPA 3II3A 4AGLA 4L8CA 4OVUA 3Q3GA 1T89C 3UC0H 1N0LA 4JS7A 4M7ZB 3O2VH 3OZ9H 2WK2A 4J6IA 1TNNA 5HVHC 4MMXA 3CSBA 3SZKC 2HKHL 4JM2B 4G43B 4WNJA 4B9IA 3MI6A 3L2NA 2R1XA 4K3JH 3CXFA 4ZOAA 4V2CB 4YFEA 2RALA 3VFSB 4OCXL 1CDJA 4X9IA 1N6QL 4D94A 1NAMH 3PNWB 4NHUB 2C7UA 5ID0A 2WVUA 4X42A 4A2EA 1GKEA 1W15A 1TDQA 1OALA 1NCIA 3S96B 2UVEA 4KO7A 4DEPC 1BGXL 3LKOA 4XP5H 5KVDL 3BVNB 5DRWA 4ANKA 4PY7A 3CD4A 2KLSA 4MAUH 1EAPA 3QDJB 3ZTNH 5FHBH 1WS8A 3VXUB 3ZHLA 5C2BL 3IBOA 3GS4A 2OR7A 3LN9A 1KCKA 2KLRA 3QI9A 4ELMA 2H0EA 1HOCA 1OLZA 4G9DA 3BXNA 3VE0B 1CLCA 3SYCA 4M03A 4JO2L 2AQPA 4RLDA 1A6ZA 3CFJA 2F1BA 1L7TH 5IQMA 5MEQA 5AOJA 1BGXH 3OJ2C 4QHLB 5HY9A 1IEBA 4YDIH 1LO2L 2X2HA 4K9EL 1QVOA 2LQRA 3OKDA 1HHIB 3PREA 2ZOWA 4C8XA 5J6GA 4S0HA 4PRNA 5C2BH 1W0WB 2X70A 3LNIA 3EJYC 2NZ1A 4TLKA 3PV7A 1RXLA 3QJRB 3KCWA 1OAQL 3LCYA 3TYFA 5L4JA 3EAKA 4JO2H 5A2AA 1B0IA 1JDAA 3MRIA 3NEOA 4WNSA 4ODSH 1U3HA 5H2BA 1C8PA 4KXDA 5KZCB 3QI9D 1ERNA 4EZKA 2C3WA 4K9EH 1TZOA 5DGQA 3ARYA 3CQPA 4PWJA 5DRNA 1ASOA 3LS4L 1R0AH 2V8MA 3V2AR 5JHAA 2D03L 4XVTH 5LB1A 2CJTA 2UY7A 3CV5A 4U1IA 2J6EL 3MLPA 2DLEA 3GXUB 1OAKL 1X5HA 3CX5J 1OAQH 1YEEL 5DI8A 5JIMA 3FT0A 3AABA 1GOHA 5IB5B 5JUEL 2ICEB 4CDGC 1IC5L 4I4WB 1VB9A 4AM0Q 4JM2F 3MNMA 3LS4H 3NJFA 3LEXB 1U3HD 3FPXA 1S8DA 5DA4A 3ZVVA 1TQTA 2WXJA 3REVA 5BJTA 4ZS6C 1IM9A 1DYZA 2H6PB 2ZXBA 3IMUA 4HFWA 5CEZL 3D12B 3BUPA 4ZOBA 1OAKH 3DXAA 5KVFL 3C5ZD 4OCNC 3MXVL 2JCWA 1I4FA 2XPGA 5A2KH 4ZW5A 1UKSA 1XH2A 3EHBD 3JWNC 3KJ4B 5ABAA 2CMRL 4M6OL 5TF1L 4Q9RH 4Q97A 4NZUH 3HKFA 3QIUB 5E2VL 4Z8FL 4L48A 4FAAB 1RK7A 4M7KH 4CADB 4TM9A 4LFHD 3MXVH 3IDJB 2O30A 1M9WA 5KG9B 2GJ6A 1QRNA 4KK5C 5GSRA 3VRJA 1IL1A 2HLAA 1IM9D 1KUMA 3AS2A 3HNSL 1JNLL 1YUHB 4IBZA 2YK1H 5I1EL 3ZTCC 3FB7A 3WUWA 2BVQB 2P8PA 1YY9C 1YVLA 3FHQA 3NJHA 2DM3A 1ONQA 4F3FA 2CMRH 4M6OH 4D8PB 5GS1B 1CGVA 4PRPA 1IV8A 4F8NA 5E2VH 4Q9BA 5HJDA 3LZQA 3DX6A 2P8LB 5EC1B 3NJVA 1EHNA 1YY8A 5I6LA 1HI6B 4M1CC 4YQXH 3VU1A 3QNXA 3KLAB 3HNSH 4AVIA 5JIHA 4OI7A 5I1EH 4JDTL 3ZSTA 3PF2A 1CI5A 3SPGA 1DEEB 3VFOA 3IMTA 1QRND 1J9TA 2C3VB 3EFFB 1R33A 2X40A 4FQQA 4RGOH 3RY6A 2J73A 3N44B 4L1TA 4DP9X 1T0OA 3LPPA 3JVFC 4AEIL 2I9TB 4X9FA 3US0A 3BP6B 2VTFA 5I73C 1JZEA 3BT2H 3L3OA 1CG9A 3VFMB 2VR6A 3JT2A 4HUUA 2R0ZL 3U6RB 1PZ2A 4FI7A 3LKRB 3ULAB 2YQBA 4WSGA 3FTSA 3MLYH 4JDZB 3WXWL 4EI5B 1FCCA 4HXAH 2FQEA 3NRPA 2IEPA 4XMVA 2O26U 3TJHD 3CFIC 3UJJL 4LF3B 3WFCH 3F7VA 4W9JC 4MMZC 5KN5B 3WEOA 2WXIA 2BVPB 2AXGB 5SWSB 2BSRB 2NCMA 3QJVB 4HCRL 4PV9B 1Q0YL 1HDMA 1KOAA 1WD8A 2L7EA 3NP3A 4FXGC 5B3SB 4NYLA 4TF4A 3FTVA 2C7FA 5C7XL 4BYHA 3HUJB 3WXWH 5DJCB 2F8IA 4U2YA 4AENB 5B39B 1KB9K 5HYJD 2XN9D 5FOBB 5HGAA 3UJJH 1PZUB 4LEXH 2JB5H 5JQIB 4PLOB 1I7RB 2NRDA 2K4AA 2WXFA 3VD0A 4L1HA 1CQKA 2VR4A 4L23A 3VQMA 5DRXB 3V79C 5IQ7L 3SDCA 4QR7A 5HVHB 1B4TA 5E1HB 1X5KA 3DV4B 5C7XH 3SO3C 3W0WA 4KXZI 5JQ6L 4QRSA 4YE4H 5HHXL 3GO1H 3ROLA 4E9TA 1G9MC 4I85A 1ADWA 3DECA 3EIFA 1G1OA 2J55A 4BFGA 1XF3A 4XO8A 3WD5L 1K5WA 3TA4D 4JY5L 1E42A 2FX7L 4F58L 2G2NA 3RWCB 3V0FA 2ZAHA 1VF5C 2K3HA 4ZSOA 1VGKA 1KZQA 2WBKA 4HIHB 2BHFA 3SE6A 1JVOA 3INUL 4IHOA 4DEPB 4XNUL 2K1MA 1FFPB 5JQ6H 1CLZH 5F93C 3N1MC 1QSZA 4S1DC 1DP0A 1DHKA 2DQIH 2RCSL 3SDCD 1OP3K 2OW6A 4PRDB 2YQ3A 1WUNT 5E95B 4LP4A 3UTQA 5HHQB 3WIFB 4LCCA 4GINA 4F33A 1Q1JL 3FRPB 4JY5H 3W0WD 5IW6A 3PQYD 4M1GL 1FL6A 5DC4B 4F58H 3EYUH 4K5OA 4BCXA 4E2OA 5JHLA 5T1JA 5K9QG 1J10A 1K8IA 5EC2B 1AR1C 2VXTH 4J3OG 4KNTA 1A7RL 1XH3B 2ZOLB 5BZDA 1MW2A 2Y72A 3AROA 3IDYB 2RCSH 4RMUA 1MFMA 1Y18B 1IZKA 3D06A 2VDKL 2JELH 1GYCA 2VDKB 1RZ8B 3QUYD 1Q1JH 4LZKA 1E8YA 3O3DB 4OGAC 5DK2B 3V4VB 2VLRE 1EFQA 3QUHA 3QJHB 5DVKA 2EEDA 4AQAB 3NCCB 3U30C 1PSKH 1PKQA 1OK0A 4AIXA 3GQFA 3ILQC 5HDWA 2UZXB 3MRHB 1A7RH 1UM5H 2B1HH 2GIXA 2WLMA 3HUJF 4OTXH 1EXUA 4UZUA 3QXTA 3PP4H 1Q38A 3VXPB 2R69A 4ABWA 1K8DB 4N0RA 3QPQD 5D4HA 4J3BA 5BZXA 1ACZA 2NZ9D 1WCBB 2A9CA 4K3EL 1A3ZA 3MJ9A 4GMTH 1HINL 4J27A 4EUPA 1JK9A 3ZO0A 1QACA 4DO4A 2WZ0A 4HJGA 4N0FA 2IGLA 1I9RL 4Z76A 1JRHH 1TTRA 5B38A 5T1MA 4DQAA 1JTTA 1T2JA 2ARJB 3R19A 3PRZA 4WTZG 1X5YA 1IAKA 2WP3O 4QXVA 4GFTB 4FFZA 4P2QA 3VFGL 3BZ4A 2HTLC 4K3EH 3BKYL 3VGAC 4WUUE 1HINH 1CT8B 5GZND 1HEZA 3QRGH 5E6ZA 2XWZA 3P2DA 2PYFA 1I9RH 1OWWA 4NAMA 1ETJA 4W81A 4AV0A 2P5EB 1XSIA 4NQCA 4PJ8C 1JAEA 4YZWA 2WINA 2Y1VA 3EW3B 3KS0H 1OV8A 3OLIA 4B7IA 4FQHB 4BDVB 4WRLA 2VZVA 4A7SA 2AC0A 4XNMA 5C0RH 4RRPG 4AK1A 3LRSA 1IBDA 2PCFB 1YUKB 2DWSA 2Y7QA 32C2B 3BKYH 3AT9A 3IT8D 1A1MA 3D18B 1QFUL 4C4KO 3D39B 4XHJD 3C6SB 3PPEA 4PD4K 2J2ZB 2BP8B 2ZX9A 3TVMC 1YHPA 3HNVL 3W3BA 2AJUH 4Y19A 1BQHA 3ZT6A 2FGWL 3JWNH 5G5DB 4JVUA 1B2WH 3LEYH 1XEDA 4L37A 3RWIB 5MERA 4OM1L 4QYOB 1CXIA 1QFUH 3JBG7 3L5HA 1SY6L 1Z3GL 2HUHA 2HJFB 1LNUA 1YAZA 2EDNA 3QHFH 4JJ5B 4YSAA 5CEXA 3HBQA 4EKXA 3HNVH 3DOSA 2D0FA 4X80L 3TJEL 3DSNA 2YEQA 3PG2A 3S35X 4XPAL 2FGWH 4H0HB 1HXYB 2Y6SC 3VFTB 1PCSA 2MCG1 1ILUA 2D73A 4LKXB 2Q10A 4ZMXA 2OS7A 1U2HA 4RQQB 4LPYA 1GIGL 4OM1H 3VTAA 4WI0B 4X6EB 1IAMA 2IBZX 2VABB 4IRZL 2NX5A 2Y7SA 5I73B 4UWQB 1SY6H 1Z3GH 3QIBC 2YAEA 4GAJH 5FKAB 1ORSA 1ZIAA 3HMXA 2QR0A 2MTPA 5CIPA 3EADA 3TJEH 3DWTA 2XKNA 4G9FD 2XBTA 1UGKA 5JPNA 2XV6B 3CZLA 3HBZA 1CI3M 3HVDA 1U8PB 2H9GB 2NY0D 4ATWA 5DMGD 4DT2A 4ZO8A 3WY1A 5I1LB 4K55A 4KKAD 3CFTA 3Q5TA 1MI5B 2Z0UA 2DQCL 1EX0A 4MMZB 4PSRA 4ETYA 3FU6A 5GJSL 2A74C 4WK0B 2FZ3B 4MS6A 4DZBB 4Z7VB 3RZWA 4A63A 5EF1A 2F0CA 1CU4H 1MJJB 5EFIA 5J7CC 5I0VA 1HIML 1PX8A 1EEYB 4FXGB 3AWFA 3II2A 2EDTA 3D2UB 1B0GB 1BXUA 1KACB 3FOMA 4U6XA 2D0HA 2K7QA 2CR0A 3V7AG 4YS4A 3FUMA 2OJZH 5JOFB 3N43B 1IX2A 1F6AB 3L08A 5TE4H 3KPNB 4O2CB 2DQCH 5E6RB 5IROC 5AYUL 3VNZA 1EFXB 4G6FB 3WNKA 2IALB 2Y22A 3LRMA 3OQRA 4YX2H 1F3RB 4ONFL 1I1AA 3F12A 1P6FA 3T8XB 2IWKA 3EXLA 4D0DB 4J3UA 5TK4A 4KZEL 2PCXA 4PJBE 4KDTC 1KYAA 2B4CL 3SO3B 3SY0A 3R06A 1PY0A 3BPCB 1F3DJ 1G9ML 2IO5A 3MACL 2HA1A 3WNOA 3T2OA 3ARBD 5SX5K 1J8SA 2B5IC 1TTFA 3A6CL 4A67A 3R7RA 1X5GA 5AYUH 4A37A 1NC2A 1CFMA 3A47A 2B15A 3WJLA 1UJ3C 4NO2B 5AW4B 4LLWA 1MIEH 1DLFL 3GKZA 5JIQA 4AQEB 4NUQA 1D5XB 2HFFB 1MFAL 5K69A 3CPLB 2VYRE 3D48R 3DURB 3HC3L 1I1AD 1MJ8H 1F3JB 1D3CA 5C8JB 1G9MH 4PGEB 2E9IA 1SJHA 2MNUA 3BWUF 2XFXB 3GJFA 3GMOB 3VXTA 3QNZA 5ECJE 4UILL 4N0CD 2X1PA 1FVDB 3OWEA 1DLFH 1HWHB 3J2PA 4UNTA 5EO0B 4CKQA 1HQRB 1QOKA 3MA7B 2UY6B 3QWOB 5DLML 4QHNB 3TU6A 4JCWA 4F2ME 4HISA 3HC3H 4KQ4L 1Z5LA 1VEMA 2XQYG 3QDGB 4FFYH 4CC4C 5JW3L 4F57H 1FAIH 1SF3A 2XCMC 2KQMA 4ZUWB 5EIIB 4EN2A 3IJHA 3BWAA 4PCSA 1CGYA 3FQNA 4UILH 3DVGB 5HGHB 2Z7ZA 5FLUA 3DIFB 3QDGE 1N8OE 4NQQA 4Z7VF 2E0PA 4ZODA 3U30B 1G87A 5I17A 1NDGB 3NZHH 4HPYH 4AQZA 1KG0B 4KQ4H 3PHQA 4N8PA 4MMYA 4AYBA 3O81A 4YAQA 4N2FA 1HKLH 3RL1B 2C9PA 2EH8H 4GY4A 1SLVA 4ZNEA 3L3IB 4FLSA 1EJ8A 2IV8A 3TJPA 4PJBF 5I16A 1N10A 4PJIB 4G6ML 4MXWL 4P59H 3IJEB 4F8TA 5EEVA 3VX0A 3QUKA 2MOQA 3P02A 7PAZA 1BEYL 4KRPD 1OSZB 2FIRT 4UT6L 4FKHA 3G08B 1BM3L 3FTGB 3EO9H 3GMNB 3KCPA 5DZOA 3NA4A 2WKOF 3O3AB 4HK3N 4QO1A 3V0WH 4AQOA 2LVEA 2ZG3A 3UTTE 1GJIA 3NOIA 3VGHA 3STLA 2QQLL 2H1XA 3MNVB 5IGXL 1N64L 5IB2A 3VGAB 4WEBH 4G6MH 3B9DA 3WTYA 3R4DA 1TQUA 1MG3C 3C60D 2HH0L 4OQTA 4EZLA 2EC9T 5CILL 1PYWB 2IGTA 1UWGL 2OJEA 2QFPA 1BM3H 1UWEL 1WVZA 4TQ8A 4YSOA 1MW0A 5I15H 4OZHA 2WUBH 4M5YH 5KAQG 4TSCH 2GSGB 5C0EA 1ZSHA 3S5ZA 1RJLA 1IC7H 2QQLH 4A04A 2XG4A 2BSSA 3FF8A 4GAYA 3EF7A 1N64H 1FG9C 4AE1A 3HG1E 4M8VA 2ITCA 3U2JA 1F58L 1OF2B 3BWSA 3KM2A 2VMFA 4GIAA 3VD4A 1H3XA 3TVMB 5IOKA 5BRQA 4NZDA 3H3PL 3IJSB 2VXUL 2EUZA 2UWEE 4NDMA 5ICUA 2BNRE 3QP3A 4X5WB 5C0FB 4UQ9A 3PJSA 2R23A 4LOEA 2BJMH 4U1MA 1ZE3C 2IAMC 3MLRH 1SN2A 5GRUL 3BAIA 4ADIA 4POYA 2F58L 5EA0L 3HAEB 1AAJA 3HC4H 2HTKD 1F58H 2NW3A 2RQEA 1R3LA 1GRWA 4V2BA 5IW1B 3CFQA 1JZJA 3VXQB 4D8OA 1P2CA 1SVBA 2A6KB 2VXUH 3HS0A 1OD7A 1C08B 4MS8D 2ZYSA 3N91A 4P5RA 3GXTA 2OLDA 3BRDA 3U7YL 4L3AA 4JNXA 1TITA 5JZ7C 2F58H 4I87A 5EA0H 4X9GA 2E3VA 1TQSA 2Y69B 1QD0A 1XF5A 3PUUA 4PB9L 2NY2C 5EUOB 43CAA 2WCGA 2YD4A 2Y06L 1RU9L 4PJIF 4K3HA 3QIBB 4BKLB 5DS8B 3ZTEA 4XHQA 4ELKB 4CC0A 3RGVC 1ITBB 5J12C 4TOYH 2EUVA 1A3LL 2H6OA 3O11A 2OJ1A 1UB6B 3NESA 1ESOA 4XX1G 3PWLA 3OB0H 1G4RA 4X98A 5BVJB 2HJKA 1FDLL 2ID5A 2XYCA 4YJZL 1LXMA 3JSSA 4HZ1A 4HT1L 2E86A 4PB9H 2YD7A 4P0DA 1HHKA 2A74B 4Q6YA 4BZ2A 2QEJA 2VXVH 3QT2A 3VCLB 5BOPA 3NCJL 1E9OB 1QX1A 4DN3L 5FLVA 4FYRA 3BDXA 4RISL 4ZFOL 4LHQB 4XXCC 1K3IA 3V4VL 2J1XA 4ZFOB 4BQBA 1KB9J 5EBLB 2WZAA 4XNQB 1QRKA 2IXQB 3FQWB 1NFDB 1FDLH 1M05A 4LVOB 5T5NG 2W8CA 1EJ6A 2XRAH 3VWJA 4GRLB 1C5CL 1ZT1B 1H9VA 3U7WH 1UWYA 1IU1A 5FKPB 2EKSA 2R2EA 1FO0L 5B1AB 3WEXA 1MUJA 4DN3H 1FO0B 3IU4L 4X6FB 3QGVA 1K2DB 2KDGA 1TJGL 2N4IA 3MROB 4FA6A 3IXAB 5IM7B 2F7QA 4YDJA 4WWNA 2DQHL 2EDDA 2JF1A 3IB4A 4ZPVA 1ZLWH 2QQKL 3SYAA 2ED7A 3P0VH 3V0EA 1UJ3B 4MJ5B 1OZTG 2OMYA 3E8VA 4ZT1A 3MV11 3TA3A 4BHUA 1ZMYA 3BDYL 4ZDHB 1TJGH 5D7JC 3VFWA 2X4SB 4CMHC 2YKLH 2B1OA 1FL5B 4OJDH 3VDBA 2BP0A 3TCLB 1NMAL 2DQHH 3JTSB 4WI4A 5DJXB 4QHUA 2N0MA 3AY2A 3FFCE 2CHZA 3Q2NA 1IGIL 3TN0A 4LKCA 3TNMB 1FAKT 2Z3FA 2LW3A 4QRRB 4OH2A 2A9NL 3RWDB 2JK5A 5D71L 5EBMB 5EDXA 1G84A 2YZ1A 5I5IA 1OK8A 4X6CB 2OP4L 4C59B 1WGVA 3FH5A 3NSCA 3PWUA 5E99H 2CK2A 1BFSA 3NYKA 1NMAH 3EJJX 1LYQA 2AV1B 1RK1A 4CVWA 4N4YB 2ZP0T 5DMIL 5IQ9B 3ASOB 1IGIH 2W07B 3JV5A 1Z6JT 3GIVA 3GSUA 4AQ1A 3EYQC 2C4FU 2IH8A 2A6IA 3PIQA 4HK3J 3RGBA 5CGBA 4BZYA 4UTAL 3K6SB 2A9NH 3AAZA 3G6AA 3O45A 2IOIA 1UH4A 1FFNA 5KVGL 4GAGL 2AV7A 4LCYA 4AGMA 2OP4H 5C0NC 4X6DB 5KBPA 1EEQA 4MQTB 5GS0C 4RA3A 3GD1C 3HLAA 2VITA 1GPOL 3DUHA 4OFQA 4IOIB 5DMIH 5F7KC 2PYEB 3UEZA 3IMVA 3KPOA 4G83A 4YPGA 4NN5C 2SODB 2XETA 1GC1C 2ZG1A 5KVGH 2JWYA 4HC1A 2YMOA 4X7TB 2Y2WA 4OFKA 5ESQB 4H7VA 4HZLB 3UGXA 3PXHA 1HESA 1RZGA 1JPGB 4KMQA 4RFEA 5EU5B 1G7IA 4ZS7H 4N8UA 4M4RB 5AL8A 3I9IA 5F3HB 2Y5QA 1MF2H 3QEUB 4XCFH 1MCBA 4F5CA 4F7PA 2YS4A 5F7EL 1ACYL 2VW4A 5I8EA 1O7DE 3SPCA 4CN6A 3OAUL 3E1ZA 4RAUA 2PR9A 4NKIL 3TT3H 3U46A 4OZFA 5I8CA 5IZ7A 2JTDA 2HWZL 4LLUA 3V6FB 1ZJBA 5T3ZD 1GGIH 1E40A 1ZEAL 5J1AB 2YOAA 4MJID 4JL1A 4WTWA 3M46A 3CFMA 4YHIA 2AQTA 4IBLT 5F7EH 4RZCA 4XC1L 4OGZA 1ACYH 2H1PL 3IJYA 4YSQA 5IMKB 3RDJA 3IETB 3PL6D 3OAUH 3WHXB 1G9NC 4GBXB 2FJGB 3DYOA 4G3YH 2EE9A 4L1BA 2ZUYA 4NKIH 2F5AL 3WHE1 1FFOB 1N59B 1I7TB 3ETSA 3PUCA 3X1BA 2HWZH 1I8KB 4F92B 2WIMA 1AD0B 1LD9B 3MRCB 2A99A 2W60A 1LGVA 4QXWA 2X4PA 1A22B 3RVVC 5GSVA 5FYLH 4AT6A 5BS0E 2YEZA 2NDGA 4XC1H 2H1PH 3A4EA 1GOFA 3MCG1 4FG4A 4YOKA 4HLZH 4PFEA 3AVEA 2V17L 5I1JL 1H5BA 2F5AH 2FEDD 3A21A 3DK2A 2NY2B 2ITDB 2IADB 1FHGA 4K5PA 4XP1L 1E90A 1TIUA 4LSDA 2CGRL 4WI5A 3QCVL 1ED3A 4BZ1A 5AVWB 1BJ1H 2OTWA 3GZPA 2D7PA 3HS8A 2VT0A 4CJ0A 3WMQA 1C8QA 4MD5A 3QW9A 3MTRA 1S78C 4G7VL 3UX9B 5CSBA 3E9UA 2Y5TB 2V17H 2EKJA 3L3HA 1D5MA 4JQXC 4NZJA 1MQ8A 4HF5H 4XP1H 4BRVA 1FA4A 3MLXL 1UB5B 5LBGA 5DZNA 2RACA 1XCQB 1ASPA 2MQCA 3UCRA 3H6AA 1RPUA 2V3EA 4LPUA 2LOEA 4LMQI 5E1IA 1UOVA 2AFNA 1KMGA 5I1CL 3L4TA 1T1WB 2EEAA 3ISYA 2OMWA 4GUPB 2ZNXA 4G7VH 5HJGA 1FC2D 3O3EA 1AQDA 4J8QA 5IHLB 1CK0H 2CLVA 2WYZA 1HCVA 1XEUA 1QWHA 2HRPH 3ZDZB 1KLUB 5G4NA 1AMYA 1OSPH 3EGSA 2OYMA 4FADA 2QLYA 1WT5C 4WWKA 4DZ8A 1UZ8A 1BQ5A 4P4RB 3ES6B 5CS7A 5CZVL 1Z9OA 5CJOL 1ID2A 2CG9X 1CXKA 5I1CH 2A38A 4J4PC 3FCSB 3K71A 1IJ9A 2DWDA 2YPVH 1MCKA 3RPBA 4JFFA 1NMCB 5JW4R 3VTMA 1HCZA 1VFBB 4U1KA 1I8LA 4F1SA 3IGLA 3WBDA 3SDAD 4EOWL 4X50A 4MAYB 4QY8A 1DO6A 3VG0L 4DP6X 1HZLA 1AFVL 2J71A 3FOLB 3WNLA 5I26A 4L1LA 5CZVH 5CJOH 5CD5C 5B1JC 1ZY9A 3ZE0B 4NQEA 4TVPE 3TFBA 3KLHC 1TZHB 4HUWB 4G8EB 1DBKH 2DOCA 3ZZSA 2XTSA 1LO4H 4E9QA 2EYSA 2WIIB 2Z92A 1MHPL 1JZIA 2FSDA 3VD9A 1UH3A 4FE9A 2B0SH 3T4AB 4DQOH 1IFHL 1VGEL 2GBUA 2YSSB 1WHOA 2HVKB 3L9YA 4QT5A 3U0WL 1KXVA 2ZWKA 2F53E 1VFOA 3H53A 3O6FD 1CPUA 4Z7OE 1KLFA 3QYMA 1WFMA 4TNWF 3AGWA 1XVSA 2OMXB 1LEKB 3EBHA 1D6VL 3T0EA 2KL6A 2HVJA 2IWGA 6TAAA 4D7BA 4CSPA 2WXNA 3MRGA 5KYYB 2ZICA 3ECBB 1FNFA 4ZX6A 2G4EA 1N0XL 1E4KA 2FK9A 4I2XB 4PBXA 5DEFB 4LAJH 2BSTB 2GJRA 3GJEA 1E2ZA 5GS0L 3UBGA 5EWIL 3D34A 3UZQB 1UACL 3IN2A 1D6VH 1AZCA 1HL9A 4L3EB 4RNRB 5J89A 3BQUA 3EJZC 5DQJB 3PDOB 4QCIB 2EVGA 3KJ6L 3ZDZF 2CE6A 4G80A 2R9HC 3K8KA 1OM9A 3SE8L 1WP6A 1XIWC 4POUB 4WJKB 1X4ZA 1NBQA 4HHWA 4X5LA 5EU7E 3HE6A 1BIHA 4NN5B 4P5MB 2QBWA 4DVBB 4L8BA 2ZQKA 3MFGB 2OW7A 5HVWA 1TEFA 1LILA 4JM4L 2GTWB 5IVOA 1NIDA 4Z78A 4R7NA 5GS0H 3OLDA 4TNVK 1BPVA 4NO5B 4U7KA 5E56A 1FIGL 4OT1H 2OCCB 2FECI 2VGLM 3L17A 5D2NC 3J8F7 3DJRA 4PBDA 2Q86B 3WKML 5GIRB 3SE8H 3MRDA 2C5DC 3GPEA 1BM7A 3B9KA 3HJ0A 3VSQA 4AZUA 4JANB 1GC1H 1QSFE 3QXAA 5KVEL 4E9SA 5KW9H 4MGXA 3BQUD 4Z7WA 1QP1A 1PGRB 1X5MA 2BIHA 3FHEA 1XCTA 1RUPL 3ZE0F 3TPKA 3FQYA 5DVMA 1UVQA 3MRPB 1JWUB 1NCCL 2CO4A 1NJ9B 3EG9A 3GSWB 1YNLH 3IDMB 3OVUB 4TKWA 5DFVC 5GGSB 3ZY7A 3HBGA 3HE6D 3LQAC 4AJWA 4PMEA 4ES9A 3P3YA 4JFVA 1ZIBA 3OX8B 2ZJSL 4K3DL 4LP8A 2YARA 1BIIA 3PGFH 2CGYA 5EU6E 3GXNA 1IBYA 3WKMH 5C3LD 2CHNA 4MQ7B 4PJDB 1BVNP 4W9LC 4ABQA 3Q06A 5E23A 1DSFL 2G9HB 1RH8A 1SGKA 1JF1A 3W9EA 3VXNB 1J5CA 1HQ4B 1RUPH 1TPXB 4PJXE 1G9NL 1P5VA 5DJ6A 1NCCH 1U8HA 2QPEB 3FRPG 3ILPB 3KH4A 3SYPA 4G1MA 2AJ3A 3MV8A 2YQ2A 4M3JA 4ZO9A 4YL9A 5AKTA 3TL5A 5DD0H 1V3MA 1D7CA 1D7FA 1QLRB 2L3BA 2H2SD 3FT3B 5IOPA 5TQ0H 5CWSA 1RLWA 3QFJA 3ZGIA 1DSFH 4NENA 8FABA 1U8QB 5I1KH 3I85A 5EZPA 5I6XC 4L3CA 4IBQA 5C9JA 3KHQA 1G9NH 1T4KA 3TH2T 2ADJB 4NPJA 1CDCA 1NIFA 2Q7YA 3K0YA 4JRLA 5JNYA 2FD6L 2UX7A 3DA0A 3UYOD 3VAEA 2BCKA 4OBRA 1R17A 4NOFA 4A6YA 1CUOA 3MV8D 1MZZA 1EVUA 2DLTA 4JL2A 4N87A 1W91A 2A6JA 2WXKA 3NIGE 2X4TB 3I3BA 3NH7L 3QULA 1KXTA 4PREB 1Z3RA 1HL8A 2FO4A 4C83B 3QFJD 3CLEL 3DUUA 1PIFA 1JGLL 4JKNA 2DV6A 5H4YA 1IZJA 3GI8L 3TCTA 5GGVY 3LS5L 4KZ0A 1OP5H 1HL4A 4PJEE 4UF7C 4N6RA 3SB3A 4U0RC 1U8OB 1MCRA 3IMRA 1W16A 3RJQB 1W8NA 3FAWA 3QORB 1MFBH 3NH7H 3WFDH 4HUKB 3VNYA 3LKNA 1RI8A 1SBSL 2F8VA 4XCEB 5D7HA 3CLEH 1GZPB 2HT3D 3DPBB 5AW2B 1RIUH 4CN1A 4NKDA 3UBHA 1BCIA 5HDBE 1O5DT 2CKNA 3ESMA 4H5SB 1DVQA 2OV0A 3W2DL 1D5BA 1EZLA 4PJXF 2VMJA 4NQDB 2FAUA 3ISRA 3SPVB 1JYXA 1Z9SA 5CP3A 4XP9H 1B2YA 4XE0A 4ZO7A 3TZVA 4UTBA 4BBWA 1UA6L 4UINH 3CFCL 4UQ3B 3BUIA 1S9VB 5CCGE 5D4QA 1ZLSL 1T3FA 3OR7A 3L1OL 1KCRH 3QUXC 2D0GA 2V2XA 4ZTOL 1F1AA 3CSYA 5TPWL 4NM4L 3OLGA 4KK8C 5IHWA 3IVKB 5JDSA 1RY7B 3QUMA 3W2DH 2QV4A 3CWGA 3QRBA 1AI1L 3T3PB 4TUKL 1I75A 3HG4A 2CR6A 4CVXB 5MENB 1WWCA 2DF3A 1MCWM 4E68A 3RNQB 1UFGA 1Q9KB 2DQGH 3KPSE 4FQXA 4G11A 3EDJA 2ALAA 5ICZA 2M26A 3TZVD 4ZTOH 3NK4A 1E9QB 3NUKA 3UJIH 4DP7X 5CR1A 4M61A 3NIGF 3EGXB 5I71B 1KFAH 3BGMA 4JDEB 2CBQA 4JHZA 1JSYA 5D1XC 5I0ZA 2J6WA 3VFPB 1AI1H 4WI8A 2AJXL 1LEGA 2XTJE 5C7ZA 3GBDA 3Q8BA 3R8BB 3H9SA 2MQGA 5CLTA 5EUKA 1OD9A 3IDIB 4TNFA 2VKWA 3IKCB 5FYJL 4DP4X 1RCYA 5IP4A 1KV3A 1NFIB 2RAMA 2VMEA 1XB6A 2F54B 3S5YA 1ACXA 1AP2A 4QXGL 4HWBL 3RQ3A 3VFUA 3U6XS 4GKNA 2C1OA 2ZKMX 3IPFA 3RJOA 4FQXD 3S5LA 2FSEA 2VLJD 5DSCA 1OY3B 2GHZA 2F54E 1WAPA 4XNZC 1DVFB 3BMVA 4H44C 2IV9A 2C9RA 3LOWA 3VWKB 3L16A 1FGNL 3ZN6A 2ZTBA 4QI3A 5FYJH 2AQ3A 4OBSA 5HDBF 4ANXA 4LCUB 2V3FA 5DO8A 3TCXA 4L4TB 4AZ8A 3WIHA 1A9VA 3DUSB 1QSED 2H2PD 4HWBH 4QXGH 4R4ND 4W9KC 4F7MB 3K91A 2JCCA 4XCNA 5C0CA 3L5WB 4M6ML 5ALCL 5FYKH 4KXZH 1IFRA 5BRZA 1AKPA 1N2RA 3D3VE 1XIWB 2D31A 1KPUA 4UZSA 2EDKA 3B8SA 3IDNA 1FGNH 5DZPA 2V9QA 2VXQA 3ZTJG 4YHNB 1PJWA 3GBLA 1Q0EA 3LIZA 1R24A 1TJXA 2GSIB 2Y3AA 2QKIA 3WV0A 2OSXA 1E6OL 1WS7A 5D2NB 1LP9A 5ALCH 5FW8A 5KJRL 1BP3B 5DO2D 5EBWA 2K8MA 5SWZB 2JJSA 2MFNA 3KW7A 1RAMA 1GAFL 4CW1B 1XZ0B 1MLCB 5C0CD 5CSGA 1FORH 2FB4L 3SKJL 1HILA 1BZQK 3VXME 3NIDE 1G7LB 3KEDA 3LQAL 4MXQC 2DI9A 3KVPA 2MQ0A 1GOGA 3U9PH 4JY6A 2LTQC 1E6OH 1UM6H 1WFOA 3BSZA 4DGVL 3LQMA 2IIJA 1Q72L 4FMFA 2DLHA 2ZUWA 5KJRH 2ESVB 3BKML 4S1RH 3H7BB 4QWWC 4OZGA 4P3CH 2OA9A 3VH8G 3ULUE 2WY3B 1BD2B 1F86A 2UZPA 2P5WB 3M7OA 3CIQA 2XG5B 4Q8BA 5E9DB 4ES8A 1R5IA 1JXFA 1ZHKA 4LGRB 4PGCA 4P5TC 3SKJH 1FLRH 2EINB 1CC3A 3LQAH 2B1AL 4OJEH 7PCYA 4DGVH 3K2IA 1A2YB 4YSTA 1KGXA 3BKMH 3Q13A 2HFGH 5ACZB 3SZ6A 1WFUA 4IRSC 3G5XB 3P4NB 2XC8A 4YR6B 5I6XB 5HJBA 2CLZB 4XBPA 5EIIG 5HHOD 2P28B 1JS4A 3VRIB 5T3XE 3FQTA 3SE4A 3U0PB 4FXKC 2H0JA 4GSXA 4P99A 2WXOA 2B1AH 5E8OB 1E43A 2XWEA 4MRCA 5D8JH 1C12B 5AZ2L 3UAJA 2X41A 4E0RA 3L3KB 1J9SA 5FO2A 5IF0B 2YFOA 3CQQA 1A02N 1NCGA 1GXEA 3VXSA 1CURA 4HMCA 2DLFL 3GSQB 2J21A 4FYSA 5F97E 4ZUVB 2APXA 1I8UA 1U30A 4A2MA 1TU2B 2WVSA 4KVCH 3I9PA 2CIIA 4UDTA 5D1ZA 2Z35B 1EXHA 3QDMB 5DEJA 2F08A 1ZLUK 2BIOA 3BAYA 1RFDH 4Z7NB 1IARB 3E2HC 2KYIA 1EAOA 3ARWA 3WS6C 4FTVD 4PGDA 4IIQA 4P8QA 5CLWA 4U0RB 3ARFA 4MRBA 5FGCB 2G60H 2CJUL 4NQXA 4DP1X 2ZSVA 3CZEA 3V6ZB 5ECGA 2X12A 2W0KA 1YECL 3UTZB 1Z5YD 3VXSD 3NJXA 2H26A 2WCSA 3HG3A 1OTSD 1MHCA 3VSTA 2CO7A 5F7NC 4PJ7E 2OXHB 2QMKA 4L29B 2FBOJ 4P46A 4LSRH 4APQC 4L0YA 4X99A 2KI6A 2XZCH 4A7GF 2D9QB 1MH5B 3SCMC 3DX1A 4IKNA 2R1WA 4FCHA 2LLGA 5KSAA 5HHPA 3MV7B 5HPMA 1JZ4A 2WN3A 1FE8L 1NDTA 1S7WA 2Y7OA 3FO0H 4RMVA 3WELA 3ARFD 2IH3B 3HZMB 3QUXB 2QGDA 3FUFA 2WB7A 1GTFA 3GMPB 2X0VA 1JFHA 2GAZA 4RIRA 4YO0A 2OMVA 2J88L 3L9RA 1RSFA 4QIRA 5D7KD 1X44A 1A9BA 4RRPA 5DMKB 3UMNA 1RZ7H 5F88A 3WNPA 3S3CB 4J3TA 3T3ME 1B4LA 2CKBA 1YMMD 2BHZA 4N2LA 3WTUA 2D2CC 1CJYA 1PNDA 3RVTD 1FE8H 1GJUA 1E28B 3HNTL 1T0NB 3HAEG 4H8WC 4QRPA 4L2LA 4N20A 5KSAD 3RRQA 2VE6B 2NY4C 3M1BB 3CFJB 3MNWA 3CSFA 4OIBA 4O58H 5BXFA 2V7HB 3DC0A 1AHWA 5EU4B 4ELME 5D1XB 1A4AA 3U25A 3CZUB 1T7ZA 4HUXA 3L6FB 4NFDA 4HKXB 2QSTA 3WUZA 5J6GB 3FO9B 1HC1A 1HWWA 4KHTH 4OSUL 2L7JA 4ETQB 2YD6A 1RMFL 3K7UA 4ZK8A 4DUWA 1HT6A 2CHDA 1OAXL 2M8XA 1NCHA 2AQ1A 3DVNB 3DHUA 1ZT4B 5GGVL 1S7VA 3C2SA 2XICA 4FC3E 5MEPA 3E3QE 1S7SA 4PV8A 4QRPD 3RI5F 4Z7NF 4HK0A 4KV5E 1CLYH 4WK2B 1E3XA 3D0LA 1BZ7A 5FA3B 5LO7A 3I84A 4DFHA 4PJ7F 4NSKA 3SY6A 1YEKL 2YHGA 2MCAA 5D1QC 3QQDB 4F37F 3IMBA 2UY7B 1PDKA 5DQDL 1OAXH 1UXSB 1L0PA 4KJQC 2R7EA 5FUZL 3UPRA 2D7MA 4JY4A 3KE0A 1YN6B 4XVSH 5I2IA 2ZOUA 1ASQA 1U3YA 1FGVH 4MNHA 1KC5L 4KK9D 2WWMD 2ICES 2BOBA 3B3IA 2VR9A 2Z8VC 3KBFA 4F24A 2JKJA 2F61A 1JGEA 5CAYB 4M43L 5DQDH 2B39A 4R5TA 4WKXA 2BZ7A 3P77B 4GLRI 3ML8A 4V1DA 3O4LA 3SOTA 2BK8A 5FUZH 1T1XB 4R3SB 1CL7I 3KVQA 1K4CB 4HX1A 1IBBA 4DO5A 1BVNT 4ODVL 3RU8L 4JFWA 3C8KA 3DXAE 1AIFB 2DM2A 4IMLA 1Q9OB 5DJ0B 4BA8A 1SNRA 4PTUA 2YAHA 5AZEH 3DGGB 5BV7H 4M43H 2VQUA 3OLEA 3PV6B 3LKSA 2GEQA 2VH5L 4MA7L 4A2GA 4AYFA 1NDMA 4WTQA 1QTPA 2LTQB 4EN3D 5I1DA 3B2MA 4F2EA 1YN7B 3RU8H 4ODVH 3ULVL 3DRTB 2VL5A 3Q8AA 4JFOA 4KKBD 5I1IH 4IBVA 4URKA 4ZZKA 3O4LD 1F3DH 2BIQA 1F0LA 2WHVA 3HG0A 1ZJAA 2GJ6E 1QRNE 2NUTA 9PCYA 3GSNL 4QTFA 3D0VB 2H8PA 3B5GA 3GSNB 2IH9A 1IGML 1NGZA 2EEXA 4P5TB 5HHME 3WDJA 4DGYH 3MZTA 1HH9B 3U4EA 3QWNA 3KM1A 5CGYC 1V7MH 2DLIA 3BH4A 4HFUL 2WV3A 4JFDB 2JI1A 1JIBA 4PRPE 1P4BL 3WJMB 3FU0A 1CGSL 3ESOA 4HDIB 4OKDA 2FWOA 2FH8A 4YIQB 5F9JA 4JLRA 2ZCLL 3H3BC 1AO7A 1YPZA 3HC2A 3GSNH 2WAHA 5AW8B 4K7PY 2VAAB 4FXKB 5ITFA 2ICWJ 3L3OB 4X8CA 4G7YL 4UT7L 4HFUH 1VADB 4NZRL 3WYRA 2NTFA 4JFYA 3ARDC 1DJGA 3E9TA 1P4BH 1UOWA 1SRDA 1ORQB 3EXJA 1CGSH 3AB0C 1XD0A 1Y0LA 4UU9B 5LGKA 1NM9A 1OCCB 1QFHA 2GHWB 2ZCLH 1A6PA 3SDXA 4KKLC 1EJOL 1X6LA 2X6MA 3MJGX 4PWFA 2BNQB 5IJBC 1U8JA 4MD0A 1K6QL 2AJYH 1J1OH 1BXXA 1MWAH 1AO7D 3BN9D 3MBEB 5EOTA 5D7LA 1KIPB 1KLGA 2GFBA 5TK2A 4OAWA 3DSFL 5IR1B 5LWYL 4AC2A 1P7KA 1X5FA 3ABGA 2EIDA 4YXHL 4A7VA 4CAGA 1FVCB 2F7IA 4Z3FA 2WYHA 1EJOH 3DRQB 1S5HB 1KV7A 4XMPL 5HHNA 4HGWB 4YHPA 3QC5X 4Q9QL 3KGRA 1CZ8H 4P2RA 4NAJA 1K6QH 4WHDA 2ICWI 2QPUA 4NERA 4JZOA 1VZHA 4APQB 5M7QA 2KPNA 3GSOA 5ETUB 5B8CA 1M9SA 4H26A 5LWYH 2XFGB 1RUAH 1JZ5A 2VNCA 4E41D 3RDTA 3ULVF 3CZNA 2DIBA 5ITBH 5D7LD 1OW0C 3V9CA 4Z3EA 4MCMA 4OLZH 4DETA 4JZJB 3H2PA 4X4MA 4RMRA 3COOA 5IJCC 1ZT7B 3VI3B 3W0WE 1EVTC 1MIML 4AG4L 5DWUL 4L9LA 1NUNB 5CCKL 1DN2A 2YUWA 3PWNA 1AGCA 3RB7A 2H3XC 3PNRB 3VGGA 4P2RD 2XX1A 4JPIA 3EYVA 1MCHA 4Y2OB 4ZSOE 3JZ7A 3F7RA 2CXGA 3PFUA 4HV8A 1XTMA 3IS1X 1U2CA 4BFIA 3LMJL 3RDTD 1OGAB 1MIMH 2DM4A 2V5SA 3GJFK 4CC1A 1V5JA 1IAII 4LSPH 4P04A 5AW7B 5AEAA 1QWUA 3CUPA 5CD3A 1RD6A 3UAAA 1A1NA 3C9NB 3FN0L 5EPMA 5F3BB 1ULVA 1CVRA 3ASWA 1S4IA 4IEFB 2F74A 5FO9A 1D5IL 4ZMLA 2GG1A 1EZVY 1KIQB 3LDBC 4FQ2L 4H8WH 3KLSA 2FIKA 2DIJA 4MHHI 5L2JA 4ZMZA 3QXUA 2G30A 3GGWB 1MFUA 5D4IA 4XNDA 3U6XA 1PKQB 5AVYB 2W38A 1I3GL 4PLKD 2Z31C 5HYSG 2V3DA 3FN0H 1EGJL 1QMUA 3DJZA 4K94C 5B1CA 3A67L 1J1XH 4O02L 3WXVL 5EDSA 1INEH 4O02B 2BY2A 1D9KC 1PKQE 2DJSA 5D1QB 4UTCA 2DW5A 4FQ2H 4U1HA 2GUYA 5I6NA 5K9OB 1TZIB 2WO4A 1PZCA 1A8ZA 4BQ8A 2EZ0D 2OXGA 4QRUB 3BIKA 1C5DA 2PO6A 1T66C 2DKUA 2E4TA 2DJMA 5DZAA 3RZCB 4AOFA 2OX5B 3KPLA 5C08D 5I75C 1RUKH 1KYDA 2FBJL 1DANT 1SMAA 2K45A 1FIEA 4K23H 3SDDA 1LLAA 1B3IA 2MHAB 3VI3F 2IANA 1CDUA 3O0RL 4Y5VC 4XCYA 1T83C 2XA3A 2E7HA 4P2QE 4RZKA 5I6OA 5F71A 1KNOB 4I18C 1EZUA 2ZCZA 2FYYB 3W39A 3FT4A 1L9MA 4UT9H 4EDWL 2PO6D 1KJ2A 3QJOA 3D8MA 3SKNB 1JG9A 4NQCE 3PPSA 1BVLB 3CN3A 2MRYA 3GRWL 3KBEA 3ZTJH 4KROD 3UYPA 4IYKA 1NEZA 4GG8B 3ML9A 3SDDD 1QW9A 2EVFA 2YD1A 4QHMA 3RY5A 5KYWB 3QJZA 1MN4A 1FNGA 3O9WC 3IFLL 2BRQA 2DYPB 4EDWH 3L3JA 1TJHH 3HN8A 3WN6A 2E5EA 3U83A 1ET7A 4Y19E 1AC0A 4KK6C 2NXZD 1IQWH 4Y5XC 2O61A 2R0WH 3BGFB 3GRWH 3DV6B 4KKQA 1I3UA 5DVOA 3D05A 1IM3D 3ZO9A 4KJWD 5AB1A 3L2MA 1SJMA 1OP3H 2TSBA 1AD9B 1EUUA 1ZA3A 4FQ1L 2HJLA 5FUCC 1XR8B 1ZWIA 2YD5A 3O3BB 4CNIA 4XNYH 4ZRGA 1INQA 4HS3A 1OTUD 3H7LA 5JW4M 1KJVB 1DQTA 2NY1B 4X7SL 3HMXL 2Y1ZA 4F8OA 1JZ2A 4WHYH 3I6LD 3FYEB 4JK0D 1NKGA 3HCVB 2J8OA 2NX5E 5TDNA 5TQ2L 2APTA 4G5ZL 3QZOA 2IPTH 2WKLA 2EECA 2F8OA 3WTSA 3CN4A 1MXDA 4OLUH 2HKAA 3C8DA 2OL3H 2NNRA 1KJ3H 1RUML 1RURL 4UOQA 2DIAA 3L4VA 3SKMA 3QQ3B 2VZTA 3IDXL 4XE5B 2K6WA 4P9HC 4UMGA 5D6DA 2FUQA 3U0TB 5TQ2H 3ZE2B 4Y4KC 3RVXC 5CMAA 3PYCA 4K7FA 2YRPA 1ZS8A 4IU2A 3VDCA 1VIWA 5BO0D 1YCSA 3ATDA 1ZV5A 2O6FA 1WV7T 4FDWA 3V4PH 2A9AA 3QR1A 5I5MA 1Z0MA 5DJDB 4JFTA 3BAKA 4I3SH 5TGBA 4G8GB 1MREL 5EU3B 3X14B 1PD6A 3IDUA 1O7DC 1E8XA 3BVDB 4WI2A 1GH7A 3N2JA 2AAVA 3AM8A 2IOOA 2X9YA 2FHFA 2X28A 4JO3H 4ZMOA 5IESL 4YBQD 4HIXL 4R97C 4JM2A 3IE9A 4G43A 4ZMTA 3BWZA 3HB3C 3D50A 4X4YB 1M7IB 3P4MB 5KS9B 2ED9A 2JVUA 3CX2A 3VFSA 3S36L 5F9WC 2HRLA 1MREH 3CBKB 3WFBH 1MCIA 4ODUB 1P7HL 3PNWA 1WE5A 4NHUA 2UUDK 3QS3A 1UQSB 3II1A 4M9PA 3ARXA 3WEBA 4K7PL 4HULB 4MFHA 4RVBA 1PY9A 5IESH 3BVNA 3Q9QA 1RZIB 3NQIA 1IIKA 3QDJA 4IMKC 4R83A 1XGRB 2YD9A 3VXUA 3S36H 4JM2D 1NC4B 4ZUSB 3V95A 2EIKB 3EKCA 43C9B 1AQKH 1IKFL 1TJIL 4U3XA 4G8AC 1CLOH 1MFEH 3VE0A 2NDFA 4H1LB 1SZNA 4Y9EA 4QHLA 3QCUH 4GO8A 3LDBB 2P4AB 4JKLA 1WQVT 4JR9H 1HHIA 4WWID 5DUML 2CCWA 4M3KB 1J86A 1O6SB 3IAQA 1W0WA 3UACA 3WMSA 1UGNA 4HJEA 4WU7B 1MHEB 2Z31B 1TJIH 3C09C 3PHQB 3FSWA 3M07A 3KYNA 3OGOE 3ZE2F 2ENJA 4A2DA 1MSPA 1EUTA 4AIZA 4A7TA 3WNNA 3HE7D 1DQIA 4MAZA 3HI6L 3FQ1A 1YRKA 2VDQL 1WBYB 3CE1A 4GSQA 1XGZA 2VDQB 2AVFA 4ZNEE 1W2KT 4OGYL 3FQRB 2EVHA 2J6EA 3FFDB 4K94H 4OFYD 4F91B 5I75B 5A2FA 5IB5A 3MLUH 2ICEA 2NY3C 3BZFA 4I4WA 4XO4A 2JSFA 4Y16C 1JHLL 2JJVA 4G1EB 3P3RA 3LEXA 4Y5VB 4N90D 5KZCD 1U91B 2VDQH 3BUDA 1YEDA 2JQAA 4TV3A 2H6PA 3E1F1 3ECVA 1F6LL 4N2GA 3HHRB 5DCCA 4BFFA 2FO1A 2FQFA 1CIUA 4YZFE 5C0EB 1WITA 3P3TA 1KGWA 1J5DA 2HUEA 5IV2B 5K9JL 5J56B 2FBRA 2GI7A 5C0IB 4U1NA 4OZHE 3G6DL 2CBTA 4NNYB 3L4UA 1F8TL 4ONOA 2COVD 1CTOA 5IW3A 3G5VB 3X12B 5AW0B 3CFEB 3W9DB 4YHLH 4HIIB 1G94A 1KTCA 1T4WA 3QIUA 5AFAA 3S9DB 1WC7A 4XVJL 3CFKB 3HR5B 5CN2A 4CADA 3BC9A 3O9WB 3IDJA 2PNDA 5KG9A 2CHXA 5SX5H 1JGUL 5KVMC 3X3FL 2DQDL 3TBTB 3VGFA 1YUHA 3DTUB 4MSWB 5CEZD 5AOZA 2BVQA 2GB2A 4Z7QE 3ZHNA 4KH2A 3AQYA 3RBGA 2G5BB 1CDGA 5TE7L 4D8PA 3G04B 4LLMB 3NEEA 5GS1A 2XWDA 2EYRB 4FMKA 2ZT9C 5IFAL 1RIVL 4XVJH 2APVA 5D7SL 1A7PL 2AHIA 2P8LA 5EC1A 2YMTA 5B1BB 2YUZA 4NC1E 1HI6A 3HI5H 2DQDH 3KLAA 4XMWA 1EJFA 3WKQA 5LUMA 2BWDA 1XF5B 1L5GA 1CXLA 1DEEA 4ZZFA 3EFFA 2C3VA 2ZKHL 2DTML 4ZO6A 2FEEI 2JQZA 3TLRA 3FSOA 3WN5C 2I9TA 2ZUTA 3LN5B 1OQOA 3BP6A 4N1EA 2W0LA 5D7SH 1A7PH 3VFMA 2Y5EA 3U6RA 2ZYRA 2HJKB 2EDFA 4YSSA 3LKRA 4OV5B 1F5WA 4R84A 3EBIA 4A2FA 3ZMNA 3C6LC 4JDZA 4EI5A 4OLXL 2E7LC 1HHKB 2N56A 3L7EB 3ZXAC 4K07A 4GXUN 4PS7A 2ZKHH 4YC2C 4LF3A 5EB9A 5TFSL 2XTLA 3G9VA 3SJVB 5KN5A 1R4XA 3C87A 2N1TE 3AZUA 3IXTB 2BVPA 1LK3L 2NQDA 2AXGA 3DMMC 2BSRA 3FBKA 1KYFA 3LNEA 5SWSA 4K5LA 4OZHF 4PV9A 2B3RA 1P5UC 4Q9CA 2BOLA 4GP5B 3D7PA 4HCRA 4HAGA 3O6KH 3LSOB 3HUJA 4P2CG 5DJCA 1FNAA 4AENA 5B39A 1RULL 5LBSH 5F96H 4DKFL 1OCRB 5TFSH 2ALWA 3DJTA 5F1IB 2EXWC 4PM1A 4P9HH 1RZJC 3QJTB 2X2JA 5DRXA 4LHJB 4KI5E 5EEWA 1NZRA 4PQXA 1XCWA 1IQDB 3IYLW 4FZ8L 1DQDL 3DV4A 4R97B 5E6IC 1AGBB 5SWSD 2E6PA 4RFOH 1PLGL 3KBPA 4AEHH 2APBA 1R3HB 3NSDA 1AGFA 3ZKND 2R4SL 5F9WB 5JDJA 1JNHA 1UM4H 4H8HA 3RWCA 3VRLE 3U7AA 2WJ5A 1N4XH 3PP3K 4HIHA 5I5RA 2O5ZL 4NN6C 1J0YA 3LV3B 3N9GL 2IPKB 2C3XA 4WGKA 5BO1L 4NP9A 1FFPA 2LR4A 2WGNB 1GS7A 1QKZH 4OJFL 4QHUB 4PRDA 4PLNC 3AGVA 5HHQA 3FUKA 4X4KA 3WIFA 1OHZA 2HPOA 3FRPA 3P11L 2Y7MA 5J3HC 1KBVA 5EIVA 3E80A 2Z0BA 1A66A 3TWYA 2YD3A 2ADYA 3N9GH 5EC2A 5I18L 1A3RL 5BO1H 3CGTA 2GK0B 1XH3A 1RK1B 2RA1A 2JJWA 2X1QA 2ZOLA 2DL2A 4OJFH 4KAQL 1Y18A 4NLAA 2YOCA 3IPEA 3GC3A 2ARWA 2O5YL 1KPRB 3AT0A 2WWNA 3PIQB 1RZ8A 4JCLA 1OLLA 2HP4A 2RIKA 3O3DA 5DK2A 5HI5C 3V4VA 1J12A 2XZZA 1R5VB 5IVZB 3IRPX 3NDYE 3QJHA 3VQ1C 3ET9F 4LCYB 5JW4Q 3BFWA 1G7MB 5F0PB 3F6IA 4AQAA 2X42A 4E9RA 4I48B 1TETL 2UZXA 3MRHA 2VITB 3ZYOA 4AJYV 4XMTA 2I85A 4NRXB 2J8UB 1HS6A 1KPVB 1H3VA 4KI5F 4UBDC 3VXPA 5E8DL 1NMBL 1V27A 1K8DA 3L1EA 4YSPA 1WCBA 2DAVA 5LDSA 4QTIL 2GKIA 2WD0A 3MRRB 3TPUA 5I66B 3EDDA 3CH8A 5EZIL 4EI0A 1HCYA 1TFPA 3UIYA 1FRGL 2H47C 4KOBA 4MNQB 3VXOA 1NGXB 2VUOA 4XWOD 3U1SH 2XJKA 5BUGA 1ZHLB 3BCFA 4UQAA 4Y16B 2ARJA 1QBML 1JDDA 2CO3A 3BIAX 3S3DB 5T3ZE 1NMBH 1DQKA 1WF5A 1ZHNB 5JHDB 4OCMC 1PD0A 2NUPB 4ODHH 1CT8A 1ODAA 1R9FA 4NUJB 4XCCL 1FRGH 5CHNB 3ZBMA 1BWMA 4N0UA 4R90H 2P5EA 1Y6KR 5EZJB 4F5CE 3QYNA 4F8PA 1UJTA 2AABL 4U6VL 4GS7B 25C8L 4FQHA 4BDVA 4M93C 2AI0H 2V8LA 4PRIA 1F41A 2PCFA 5EOQL 5DK3A 32C2A 4ISVB 4PJ5B 2QMJA 3D18A 1VA9A 5DD5L 3D39A 5HXMA 3C6SA 4UIKH 2J2ZA 2BP8A 1OE2A 3MCKB 3GNMH 1PZBA 3K8LA 1CGWA 2FQGA 1BOYA 3FAXA 4BQ6A 1OEZW 1Q94B 5FYKU 3TURA 3BP4B 1VFMA 3IMSA 1Q9WB 5FGRA 4ECNA 4TVPH 2P5ED 3RWIA 1NGWB 4QYOA 1GKOA 3I6KA 1J8RA 2JV6A 2PCYA 3QWQB 4LE8A 5DD5H 4JJ5A 2YO3A 2HJFA 3TT1L 1SY6A 3NJKA 4FG6C 4RGNE 1T1YB 1UADC 2IWFA 3RJDA 1H5BB 3K6FA 4GSUA 3VFTA 1HXYA 4FQLL 3STBA 1WISA 2J8UF 1NGQL 4KK5D 4LKXA 4M48L 1LWJA 2CD0A 4QRQB 4GRWE 3SPJA 3TIEA 3TEWA 3KDMB 4RQQA 1YEGL 3MBWB 3WN5B 4WI0A 3H1ZA 4X6EA 1XF4B 2VABA 4OIIL 1KEML 5EBGA 4IRZA 5FFOA 5L7XH 3TT1H 5FKAA 4YHOL 3EZ8A 2VUKA 3RAJH 4NFBA 1HE8A 4B5ZA 4MZ3A 3C6LB 3RNKB 4HLEA 1C9SA 4FQLH 5L9DH 5A3ID 1U8PA 2H9GA 3EYSH 1A7OL 1DJXA 1NGQH 2FVNA 4HWEL 4IIZA 4OB5L 4YC2B 3ZZLA 4LEBA 4QLWA 1MI5A 1CFBA 4MMZA 3O4OB 5D96B 1Q0XH 2QGCA 2F5BL 3GBML 3ZK0A 2OMNA 3KYOB 1TQBC 3DMMB 4DZBA 5FHAH 4Z7VA 1JE6A 1KEMH 1CDIA 4HHGA 5FK9B 1P5UB 4HKBB 4AGOA 1MJJA 4WNQB 4YDKL 4FXGA 1EEYA 4UNUA 1N9PA 3D2UA 1B0GA 1UHVA 2LU5A 2WSDA 5JOFA 1IT9L 2BNUB 4OB5H 2OTUB 4R8WH 1F6AA 2IAAC 3CIAA 3KPNA 4O2CA 1L3NA 1RZJL 1ND0B 1EFXA 1SDYA 3GBMH 4Z77B 3UYRL 3ZZ1A 5IVXB 2CH8A 2IALA 3V6OC 5ADOH 1H8OA 4YVUA 4IDJL 3ZW3A 4IKJA 2FJHB 3T8XA 4D0DA 4YDKH 5CCJA 1Z9PA 1GCYA 4HQQL 5BPPA 2ZXCA 4GUCA 1I9JL 1AACA 4N3UA 3VX1A 5E6IB 3SBWC 2WKOA 2Z4QB 3DIDA 3BPCA 2OBGA 1O75A 1MELA 1WA1X 1ADQL 3H4FA 2RGSA 3LQZB 3D2UD 4JFFE 3WUWG 1RZJH 4PRAB 3TONA 1URLA 2HYMA 5KUMA 3UYRH 4A68A 2NY7L 4IDJH 4Q2ZB 5EZOH 4NO2A 4PB0L 2C3GA 4NN6B 3NDZE 4AQEA 3VXRB 1D5XA 1EFXD 1SEBA 2HFFA 3QJXA 4GRWF 4HD5A 1I9JH 2CDGB 4G6FD 1TF4A 3CPLA 4P2OD 3A23A 3DURA 1F3JA 2ZCKL 4NQEE 4K8RC 4PGEA 1X9UA 1KTDB 4FFYA 1LDPL 2XFXA 3GMOA 2LFGA 2AITA 2CLRB 3AFLA 4G6AD 5GS3A 4D0BB 2D8KA 4HHAB 2VRQA 5A6MA 5B3JF 3WTTA 1HNGA 1B90A 3RP1A 2Z6FA 1X9LA 1FVDA 2I69A 5LXGL 1DE4B 4WW2B 5T5FL 5EO0A 2E4FA 5AKVA 1HQRA 2N0KA 3MA7A 2UY6A 3QWOA 2E27L 4JFXB 4QHNA 3VFRB 3OAYH 2HRGA 1QHOA 2X4UB 1EMTH 3UJTL 2Z91B 1M42A 4EQ3A 1NAKL 4OFIA 2PWGA 3MOAH 1LDPH 3B8YA 4ZUWA 4ONGH 5EIIA 2ATKB 1URZA 3KL0A 3LRGA 3DVGA 4RMQA 4S1DD 2JLPA 5HGHA 3T0EE 1FCGA 2BOCB 1BLNB 3DIFA 4X8GA 2QQNL 5LXGH 2R27A 3SKOB 3NT0A 4JAMB 3UTSB 1KG0A 3FQXB 3GB7B 2ORBL 4CA4A 3RL1A 3T1FB 1DTUA 4PP1C 3STZB 1X9RA 1R1CA 1NLBL 1AMXA 3AXIA 3L3IA 4KFMA 5D5MB 3MUGB 5A43C 3HZYB 4JO5A 3A4DA 2H1LM 2EP6A 3QDGD 4PJIA 3MLWL 5KUKA 5ICYB 3WCYA 1OSZA 4QKXB 4FL4C 4G8FB 2C4XA 4AJ0A 3G08A 4IGBC 2EDEA 4UT6A 3FTGA 4MJ2A 3GMNA 4LL9A 1H19A 3KG5A 3JWDH 4WU5B 3CMOH 4XXDB 3B6SB 1B0WA 1J5OL 4PI0A 4XVUD 5DD1L 1X7SA 4YWGL 4QGYA 1OVZA 4PI2A 3MLWH 2FLMA 3EJUA 1WIPA 1GW0A 1UVQB 4JQIH 1JZ3A 1SJEB 5E7FA 1PYWA 5HSFA 2VR3A 2BH0A 4CRPA 5MHSE 3T2NH 2CO6B 2JTYA 5DUBB 4PJ8A 3ZE1E 4Z7WE 1K5NB 1WWAX 2Q3ZA 3NMEA 5E5UB 1MW1A 1BREA 1D7DA 5E5LA 2GSGA 2RFXB 4N8CH 4X7FC 1SHXA 2QVFB 3THMH 4RX4D 1J5OH 5DD1H 4X8XA 5HD8D 4ZX4A 5CN1A 2WUCH 3CPUA 3WTVA 5D70L 5G2NA 4DPAX 4AX3A 1OF2A 1HJBC 3I6GB 1FH5L 5FGBC 2OR9L 4WW2F 3TVMA 1UD5A 3AMKA 3IJSA 4OR1A 5DD3H 2NXYD 3F85A 4IBWA 4X5WA 3SBPA 5C0FA 4PIBA 1Z2KA 3S37X 2W5PA 5IOPB 2DIEA 4GW1B 3MJ8B 2EDJA 4GFXA 3MV8E 1L7IH 3HAEA 3OB8A 5HGGS 5MI0C 2JQMA 5TE6H 5LKNA 2QHRH 5C0JA 3OHMB 5AWNL 5IW1A 3QJSB 1DBJL 4CILA 4N85A 3QFJE 4O51B 1I3RB 2X0UA 2A6KA 2BNRD 3I50L 4M6AA 1LO5B 4XWGL 3UZEC 1JZ8A 1OHQA 2VN6A 1CL7L 5E1GA 3KL5A 3SSGA 4LPCA 2Z1KA 2WYIA 2ZP8A 2IDSA 1BYNA 3AMLA 1V55B 3EOYG 3I02B 5T1KD 1JPEA 4PR5B 1UD2A 2IDQA 4U33A 5EUOA 3AQZA 1JUFB 4UM8A 3FC8A 4XT1C 5J13C 2DQEH 3LVEA 3QIBA 4OGXL 4H2CA 5DS8A 4BKLA 3C5ZC 1GHFH 4GMSL 4LCWB 5C09B 1SOSA 3TV3L 2FQDA 4GLRH 3WO4C 4ELKA 1OAZL 1BHGA 5B7EA 4XWGH 4EUPG 3FNKA 1CL7H 1UB6A 2QQQA 5KANI 1FJ1B 3WL9B 2WBJD 5BVJA 2L04A 5HBBA 3VW3H 4LLVB 5B38G 4LLQB 2BXZA 4BIKA 3QEQB 3P30L 2YAPA 3SN6N 4GOSA 1TQBB 2A74A 3UEQA 3ZE1F 3VCLA 1A6TB 1P4LB 1WHPA 3RVWC 4Z7WF 5LG6A 1E9OA 1SJVA 3OAZK 4MCNA 4YXLL 1A0QH 1JHKH 1EO8H 3TV3H 1N12A 1OAZH 4ZFOA 3KS0J 1BG9A 3B34A 3FH8A 5EBLA 4IRJC 2HFEB 4XNQA 3TEUA 5E0FA 2IXQA 3FQWA 4N5ED 4RMSA 1NFDA 5DEGB 4NPYB 1DQLH 4HLJA 1AKJB 1BBDH 5IROA 1RL1A 3P30H 4GRLA 1ZT1A 4MYPA 4JX0A 5FKPA 1CGXA 3VYNA 1FSKB 1I53A 4PJ9D 5EF0A 1FO0A 4X6FA 3QUZC 2RMNA 1JRHI 1K2DA 4K4KA 2VWEE 4KDTA 3MROA 1AGEB 3QUML 4H20L 1OF0A 4WY7L 2R15A 5T1LD 2LE9A 1DJYA 1NANH 2F1AA 3MLVL 3IXAA 2DRUA 4AJVA 1V05A 1P1VA 2LHAA 1SDDB 3CXHK 4QDGA 1EK3A 2OZNA 3KWWB 2D7TL 5BVPL 1N8ZB 5B4MC 1UJ3A 4ODTL 4MD4B 1C5BL 3A6BL 4MJ5A 2AJSL 4V11A 1AZRA 4EBQL 5GRWA 4ZDHA 5LLIC 4GRLD 4N0YL 4WLCA 3WHE0 2X4SA 3ZPDA 5DHVB 5IBLD 3D1MC 3ULUH 3MLVH 1FL5A 2QFRA 5C07B 3B2UD 3TS8A 3TJHC 3JTSA 3RBSA 4R4BB 5DJXA 3T77B 3TBVB 1BJMA 3JVGC 1O0VA 2CIKB 4Y4FD 1AXTH 4Q89A 5BVPH 1XCXA 2WGXA 3TNMA 4E42B 4EBQH 1C5BH 1BQRA 2AJSH 4BUGA 5LHDA 4QRRA 5J5EA 2P26A 3RY6C 1WAAA 5DHVH 3RWDA 4N0YH 2YAMA 1HK6A 1AP2B 5DFTA 3H9SE 2FLBT 1IKNC 4K8RH 1QSEE 2ICWB 5EBMA 2KZKA 3SOBL 4LQFL 4IJ3C 1HWGB 3T0VA 3CG8A 4CC4A 4MVBC 1QLEH 4X6CA 5H37H 2DJ4A 3K4ZA 3S5LB 1JN6B 5B3NA 2ZOTA 2GITB 3CHPA 4M1DL 1BWWA 1KYUA 3H54A 2AV1A 5T3XH 3B9AA 3GLAA 3BAXA 1B0RB 3HOGA 2E56A 2Y4SA 5IQ9A 1QFWI 2BC4B 2W07A 1OE1A 1H0DB 3H9HB 2AEWA 4UM9B 2V7NB 3K6SA 1XR9B 2F7OA 1YC8A 3LHPL 1T21B 3US9A 2BINA 4UMSA 1Y7VA 4UTAA 1VRSA 3NCBB 5DUJA 1F02I 2EDRA 3VD1A 4LCVA 3H2WA 4L4VA 4QRRD 3H8NA 4R7VA 4X6DA 3KNBB 1UYWH 3S37H 3E8UL 5E2TL 2DN7A 2VXQL 5K93A 2JCCE 1FLTX 4IOIA 5C0CE 2PYEA 2N59A 4LSSL 2ZUVA 1KB5H 2A83B 3CHRA 4FL4B 4IDLA 3L5JA 1VFUA 5BRZE 5C2UB 3QJFB 3I75B 1IAIL 4IGBB 4OJYA 1KENH 4NNPH 4OFDA 5LAXB 5JIDA 1I31A 2WWKT 2VQTA 4X7TA 1HEJC 2BLFA 3TGXA 4HZLA 1LP9B 2OMZB 4U1SB 3SDCC 1PLCA 1JPGA 1N26A 3IDGB 3KXFB 4UZGA 5EU5A 1P84J 3E8UH 5E2TH 4M4RA 2VDOH 4AY0A 5F3HA 3K6DA 1LP9E 3DX8B 3QEUA 2VB5A 4LSSH 4MZIA 3GIZH 5E00B 3WLBB 4A2HA 3Q43A 3D4CA 1IAIH 3BSZL 4XRCB 2PYED 4AXWB 2FCBA 1MVUB 1NCDH 1U92B 5GHWL 5F8RC 4WJ5B 1VFAB 3QUYC 2F15A 4TNEA 3V6FA 2VLKB 3PS6A 5CF3A 3F3HA 5J1AA 4OZGE 1I8MB 1DJSA 4GO9A 4L1SA 1JBJA 4FERA 4D9RD 3Q48A 1LO3H 5IMKA 1F4AA 5LNDA 2IAMA 3IETA 3LXUX 4RSVA 4Y7OC 3WHXA 4GBXA 5JIPA 2D7OA 2QELA 5GHWH 2FJGA 3KYKL 5IB4B 4H1LG 2WO3B 1FFOA 1N59A 1I7TA 5MI0B 4NXSA 1I8KA 2CM5A 2NZ9C 1AD0A 1DUYB 1LD9A 3MRCA 5C3TA 3OKEB 3GRGA 1VACB 4Z0XB 4BA0A 1AC6A 3WEAA 4R2GC 4J6RH 4HH8A 3HKZA 2GK2A 1PZSA 3AY4C 5ERWB 5IJKC 3V8CA 3H0TB 3Q2CA 3WY2A 4D9LH 1BVKB 4OD1L 1IEAB 4X83A 4XXWC 2H41A 1YEHL 2DQMA 3FUEA 3KYKH 1MNUL 3LEVL 5CXPA 1DEDA 2IADA 2ITDA 3QIWD 2NMSA 3VSUA 5D1ZB 5J13B 4GBXD 5GRJL 2H32B 2V33A 1FF5A 1TTCA 2XX0A 4OV6F 3VXSE 5GZNC 3AREC 2Q3XA 3P9MB 2YUVA 3WO4B 1IGYB 3FF7A 5I1AB 2NY6C 4HIQA 1JCKA 1U8KB 5I0WA 3AQXA 2QGEA 4KU1A 1E4HA 5AVTB 4CN4A 1LP9F 4IIQB 2EVIA 2R8SH 1YEHH 2Y5TA 1J9QA 4PBWD 1MNUH 1URIA 1U95B 3WY3A 2ZSVB 4C56B 5HYEA 1Q9LB 2WWOA 2X09A 1YDPB 2ZAGA 2WOBA 5IFHL 5GRJH 1UB5A 4OZIB 3FU8A 4W9CC 5IKCB 1XCQA 2NY5L 2WQRA 4MZRA 4XXCA 1BAFL 3TTYA 3RWFB 3BP5B 3DTDA 3GHBL 4IRJB 5TDOB 4LIQL 4GEJA 1T1WA 4N24A 5D7KE 3X1EA 4GUPA 4UCFA 2YPVA 4OZGF 3PWJB 1QPXA 4KX8A 1E30A 2XA8H 3QXVA 2N7BA 1KLUA 2XT1B 1T2QL 4J3WA 5IFHH 2GUOB 4P4RA 3ES6A 1A47A 3QUZB 3WKPA 4B5EA 1BAFH 4XPFL 1FZOA 3VQLA 3OR6B 3Q2LA 1DUZB 2BW4A 4AK2A 1JPST 3FCSA 3S88L 1A9BB 2G9KA 2AQ2A 2WTRB 2CKBL 2Z8RA 3LZPA 4WSJA 1JXKA 2CKBB 1G9EA 2A4CA 3ZTDC 1VFBA 4HPOH 4UB0H 1SQ2N 2AQRA 3W11D 4N22A 4MAYA 4BE6A 5ICXB 3MZGB 3FOLA 2O6CA 2K9UA 5BOZG 1IAOB 4XPFH 3MNWB 3L95B 1TZHA 2EDHA 4G8EA 4HUWA 4QRPE 5IBUG 3QXDB 1T0PB 1YO4A 2WIIA 2NY0C 2I27N 2ZUUA 4TQPA 2HT2D 3QHTC 5DF0A 4DNLA 4LGPB 4TL5A 3T4AA 1V7NH 2YSSA 1WFIA 1XL6A 4OFVA 3CHXA 3WKNA 4PRBB 4LLAA 1E4XH 4KTEL 5DDHB 3BFOA 4MAYD 3S4SB 4IJ3B 4BELD 3REWB 2EABA 4X4ZA 2OMXA 4F15C 5HYJB 1LEKA 1RZQA 1BZ7B 2XN9B 2AK4B 3MREB 1AE6H 2X4RB 3LZNA 1JHTB 2F7PA 5ABDE 1XB8A 1TEGA 1ZV2A 5KYYA 1VPOL 4OZIF 1QHPA 3ECBA 1EHLL 4GO6B 2AGJL 1D7BA 1BZ9B 1U3JA 1G6RL 3NSJA 4I2XA 5DEFA 2ZX8A 4DO6A 5L2KA 2BSTA 1G6RB 1KEGL 3D9AH 3FO1B 3UZQA 5F0JB 1J18A 1JPSL 3ARBC 2VOTA 1SMDA 4L3EA 2XXGA 4RNRA 2BOBB 2ADIB 4JN1L 2Y23A 3PDOA 4QCIA 5DQJA 2DQ6A 2H0FA 2G4GA 3MRBB 5IQOA 1CD9B 1ZHBB 4B97A 1ZLUH 1EHLH 2AGJH 4P5MA 3CZSA 4DVBA 4JJHA 3AS3A 1KEGH 3JV4B 2GTWA 2WBXA 5LQBH 1TVDA 4NO5A 1JGDB 2BVUA 3B7RL 4Y1AB 4V1DE 3O4LE 4JGUA 2ED8A 3NFNB 1DVYA 1XGYH 3JXAA 3PQYB 4Y8AA 2Q86A 5GIRA 3T6WA 3KPMB 5FS5A 3CU7A 3MUY1 4JANA 4AYEC 4L3ED 2EDLA 1DCEA 4FZEH 1TKWB 3D07A 4PH8A 3AWGA 2WLLB 1MCPL 1ROWA 1JWUA 3MRPA 3ESUF 1NJ9A 2X2UA 3GSWA 3IDMA 1HAWA 5GGSA 3SBRA 4DN4L 2Y36H 1AS7A 1A9EB 2L0DA 2YIHA 1RJZB 2X3AA 3SIKA 3OX8A 4ILDA 2C4FT 3ILEA 4DKEH 2X1OA 5HYIA 4KKCC 4MQ7A 4PJDA 3MGTB 4A1RA 2VIRB 2G9HA 4UI2A 5IHZB 1WA0X 4OLYL 3CJJA 3VXNA 4NJ9L 1HQ4A 1F4YL 1TZAA 4R9HA 1MCPH 1FI8C 3ILPA 2W80C 1UH2A 3B2VH 4MDJB 4AITA 1FN4B 4HOMA 4Z3GA 2BP3A 2HKFL 5EORL 4LSVL 4YLQT 4ONHB 1QLRA 1R47A 1SLWA 1WFJA 3D25B 3FT3A 2WXPA 2IC2A 3RWHA 5INDB 4KRPC 1U8QA 3QQ9D 4MA1C 4U3SB 4R2GB 1DQQB 1MAJA 1AO7E 1YPZE 1ZTXL 3PWPB 5GRVL 1F4YH 1TCMA 1PLAA 4LHUB 2G3ZA 1SF5A 2ADJA 1XBDA 1XQ4A 5HVGB 4Z5RB 3QAZB 4BK5C 2OZ4L 5I9QC 2HKFH 4LSVH 4LCIH 4TVUA 1QWNA 3WGUB 4IOFD 1T20B 3QS2A 3W82A 1E5ZA 1ILSA 5IG7B 3K74B 4W6WB 5J57B 3C60C 5JXEC 3AREB 5EEYA 2X4TA 3SDXE 4IW4C 2XQ0A 1OPGH 4PYHA 2NY6B 1ZTXH 4JMXA 3BJLA 2PR4L 3RWEB 3SODB 4C83A 4E41E 5TDPB 2UYLB 5D7LE 3BUYB 4JQXA 1U3ZA 1SFDA 2A9ML 1SYSB 1X9QA 4W9ZA 5FUOL 1U8OA 2R69H 4FJYA 1HCFX 2IWEA 4JZOB 4KNSA 3QORA 4R7XA 3MJ9H 3RTQC 1PW3A 3QWRA 4P23C 3VD5A 2Y0SA 4FA7B 4GKSA 1SHMA 3W56A 4P2RE 1GZPA 3DPBA 4K71B 2PMZA 3GSRB 3B2DC 5DRZB 4H5SA 4HQQH 2CCLA 4M5TA 1EDHA 1ETZB 4LVNB 5BUPA 1F56A 2ETWA 1WT5A 4NQDA 2HTKC 3SPVA 4OZFG 4XOBA 2LLLA 1NLDH 4RFNB 4WI3A 2DI8A 2NOYA 4KDVA 2FEEL 4IKIA 3NABL 4X4ME 3ZQ9A 4MS8C 1QASA 4J4PA 2W9DL 1DQJB 1S9VA 1E9PA 2AJVL 1T80A 4UQ3A 3N41B 5KSUB 4E9WA 4IK6A 4JFQB 5ID1A 3EYVB 5BUAA 3QORD 1M6OB 3WE1A 4OUUB 3F00A 4PW4A 3RPKA 4P49A 1QYGH 4BQ9A 1AR2A 3IVKA 1NPNA 5F70A 4BFIB 1TZGL 1GYAA 5CBAB 1M1SA 4CVXA 4DK6A 5B1JA 2CGZA 2QTVA 3CUPB 2R0KH 4JRYB 4PY8J 4WIQA 5MEOB 4G9FB 3RNQA 3J07A 5AAPA 4NQDD 1Q9KA 2F1EA 2UZIL<