3ZY7A

Crystal structure of computationally redesigned gamma-adaptin appendage domain forming a symmetric homodimer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
116
Chain Sequence
MIPSITAYDALGLKIEFTFERSSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTFNWNGYKVQSEAEVNNFPPQSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational Design of a Symmetric Homodimer Using Beta-Strand Assembly.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
molecule keywords AP-1 COMPLEX SUBUNIT GAMMA-1
total genus 23
structure length 116
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zy7A00
1IU1A 2DWXA 1QTPA 3HS8A 3MNMA 1GYUA 2E9GA 1KY7A 1GYWA 5CN1A 2DWYA 1P4UA 1KYFA 2A7BA 3ZY7A 3ZHFA 2YMTA 1KYUA 4BCXA 1NA8A 1OM9A 1KY6A 1QTSA 1B9KA 1W80A 1GYVA 1KYDA 5CN2A 2VJ0A
chains in the Genus database with same CATH superfamily
5T1JA 1S2EA 1K8IB 1ES0A 5BV7C 2DQEL 2F54A 1ZTXE 3P3TA 4JDVB 5JQHC 4YBHA 1PY0A 1F18A 3O11A 2BSRA 4PJ9B 3G9AB 4E41D 1Q1JH 1UG9A 3N85L 1N59B 2JWYA 1MRCH 2WW8A 1URLA 3PP4H 5IY5B 3A6CH 4IS6B 3SKNB 1A7QL 1XGTB 5F7FA 5I18L 4LESA 4AEIL 3U9UA 4Z7WA 2OI9B 5C07D 1QPKA 1CDYA 2R23A 4LXFA 2I27N 3CPLA 4YBQC 3NRPA 3AT8A 1JGLH 3BUDA 3WEOA 4N6QA 4Z7NB 2J1XA 3SKMB 3TPUA 4LF3B 1K9TA 4WV1B 4PU2A 1RJZB 3AITA 5KBPA 3IGLA 4MNHA 4EE2A 2V0AA 3ISWA 1HWGB 1XH0A 2BLFA 3MXWL 2R8SH 3HE6C 4NN7C 2PR4L 3EZ8A 3PL6C 4H5SB 2K4WA 2W94A 5IROC 5M7QA 1R19A 5I8KL 2OMUB 4EKJA 4FFVC 1G43A 2VDKH 2ZCLH 4YC2B 3KCPB 4U1HB 1PNDA 1RL1A 5FLUA 3LRHA 4PJ7F 4KK8D 2XG4B 5BO1L 2C9PA 2ZUXA 4G8FA 4R7LA 3F64A 4NQUA 2F7RA 4XMKL 1QFUL 2K7PA 1N0XH 5T1KD 3GSUB 5AKVA 3RUGF 2DWEB 3BN9D 3W0WE 3IAGC 2Q7YB 4RA3A 5FIEA 2OPCA 3QQ4A 5BRZA 4Y4FA 1Y6KR 3GK8H 4JG0H 5DUML 5HHNB 1T2XA 5FM5M 3FQ4A 2WYZA 5BCAA 3IDXH 2YGVA 3LRSA 4KJWD 5CHNB 2NOYA 3F3HA 4BZ2L 1IU1A 5DHVH 1II4E 1H5BA 4TNWF 1JI2A 2CCWA 4HBQA 3V6OA 5D2NB 4WI8A 4KKAD 2CBOA 4DP6X 2KQMA 2PUQT 1I8LA 2F2HA 1HQRB 2YQ3A 1EO8L 4IRSD 1OAYH 4NHCL 1LEIA 2VAAA 4DAGL 1KYUA 2FO1A 4JO1L 4J3OG 3T6VA 2DEYX 4ZUVA 3ZSTA 1F86A 1F6LL 3L1EA 4JFPB 3CN1A 2VXUL 3HG3A 1DJHA 1CT8B 3FUMA 4N3TA 1VKXB 2VR8A 3GK8L 4JG0L 4PJGB 2JJSC 1PLBA 4XN4A 3SDAD 3VXSD 2P8LB 5HYQA 3N04A 5BW7C 2XHNA 2X6UA 3KLQA 3G7TA 1MUJA 1XL6A 3BSHA 4N5EC 3GXPA 5CSGA 4WNQB 1E2VA 3IPBA 4XPBH 5HTSA 3C5XA 4K07A 1SJHA 1G9MC 4U1GC 1PW3A 4KXCA 1BGXL 4OR1A 1XF4A 4XPTH 5DZAA 1J8KA 2ILLA 3NFNA 5I23A 5DUMH 3D30A 5EOQH 5LBVA 1QEXA 3KDMA 5SWSD 1G9NL 1QPPA 4GXUN 4CDGC 2R0ZH 3HUJA 4HF5H 5FFOA 4F8PA 3UP6A 3P4OB 4NRYB 5DFTA 3QIUB 1KLFA 1YEFL 5IQOA 5HDWA 43CAB 4MS8C 4Y5YB 2GY5A 3SO5A 4P2OB 4ODSH 3BN3B 1J9TA 1NOLA 2MFNA 4I3GA 3A4EA 5F9OH 2AV7A 3M6DA 4QCIA 2GBUA 3X3FL 3KHOA 5ES4B 1EZLA 5D4JA 3WL9A 3F7PC 1NIEA 1RPKA 2D73A 3MLTA 4AE0A 3HLAA 4CMMA 4HDIA 3JZ7A 4WAFA 2OZ4H 4G1MB 5C0DA 3MI6A 4M7LL 1NM4A 3NJFA 1T5KA 2K6WA 4ZFOB 2VZSA 2VSCA 3TIEA 3TNMA 3CXHJ 2MEJB 1UCBH 3W2DH 5C0CA 3GTVA 3SDDC 4LE8A 3SDYL 5CJ5A 2F54E 2WD0A 2HYMA 4FKKA 4LSUH 5JHLL 4CVWA 1B2WL 2R2BA 5EBMB 4CJ0A 4UZGA 2ZXWB 4XX1E 1KB5L 1Y18A 1S7QA 1UXWB 1UH3A 1XF5B 3PV6B 4NKMA 1CFBA 3S36H 4O2EB 5ICYB 3V0VA 2YXMA 3U46A 1RJZA 4NQCA 1AHWA 1E42A 1F11A 4JFDE 3KJ6L 4NM4H 2HKFL 4M7LH 3UTTA 3ULUD 4HIQA 5CZKA 4PG9B 2B8OT 1GSMA 1KELH 2H9GA 2V33A 4WRLA 4YL9A 3F85A 1NFIA 4C56B 3ABLB 3ARGD 3RGBA 2EACA 5DEGA 3T0EC 4JY4B 5FDWB 4BZ2A 5I16B 2ZJSL 4PGCB 1MCBA 4YNYA 3V0GA 5JYMA 3ZUCA 3QWNA 3GHBL 3GMQB 4JFZL 1XF1A 5E9DA 2OMWA 2C9AA 3STZB 1Q9KB 1XFPA 4X5RA 5J11B 2F7PA 5CR1A 5KEZA 2R4RH 2FIKB 3L9BA 1TTFA 5EEVA 1MCIA 2AQ3A 5C0IA 1RU9H 1ZA6A 4YVUA 2WV3A 5AVZB 2XQ0A 2NW3A 4I0CC 1G1YA 5L2JA 1BEYH 1AC6A 1FHGA 1S7RA 1U8IB 4QHKI 2XNAB 5J13C 4PVBA 1JCVA 1RMFH 4KHXH 1A9EA 3BKYL 4ONFL 5DJCB 3B5TA 3ZQ9A 3MBWB 1JHKL 2GSGB 3O2VH 7FABL 4FMKA 4MLIA 2ITEA 5TK2A 4AKQA 4I5BB 3Q5OA 1TJXA 1ZV5A 2Z0UA 4QXTB 1A9VA 3PYCA 5EULV 4R3SA 4YEFA 3NSJA 4PJCF 3ASWA 5CIPA 1B88A 1E5YA 2NUTB 5H94B 2HJLB 3HA0A 3RWJA 3N9GH 4HWBL 5AVRB 3VFOA 4ZZFA 3PF2A 2DMBA 2OXHB 1B0RA 1YG9A 4MMYA 5KVDH 3B7UX 4IBYA 3KYMB 3RX7A 2QADD 2CH8A 4F8OA 4JMXA 1NGPL 3O4LB 3PNWA 4FLQA 4RDBA 2A6KB 3C75A 2R83A 5T3XH 5KG9A 4HXBL 2MHAA 3RGVA 2ADIB 1VZHA 4L8DB 3QQ3A 2APXA 1MJJA 3EYOA 3EYFB 2XQBH 2ZCKH 4Q6IB 3RTLA 3FOMA 1S6NA 3AREC 2FR4B 1O7SA 4J3OF 4TVPD 5GSVB 2X9YA 3ARUA 1GOFA 2MCPH 4I0PD 5TDNB 4JFQA 4AWJC 3KPMA 3EXLA 1LQBC 4LVNC 4ODVL 3K4AA 1MFUA 2NR6D 2ZOTA 5JHLA 1BCIA 1L3WA 4HZAA 3ESOA 3K2MC 4FFWD 4I9XA 5DF0A 3B3BA 4G9DA 4OLEA 1ZANL 1JGEA 2BSDA 2V5MA 2HFEA 2ZCLL 4XP9H 3JWOH 4N1CA 5IB4B 4N0YL 4IHOB 2JFCA 3OHXC 3GMLA 1NAKH 3ECBB 1G0XA 3BGAA 5D1XD 4HV8B 2HJFA 3LRKA 5C6TH 1KV7A 3E8UL 4TKWA 3ULVC 3O8XB 2H2PC 3QCVL 2AXGB 4QJ3B 3FFCE 4MMZA 3ILPB 3LZQA 5CHNA 3LKNB 4Y4KC 2X4TB 3NJXA 2FWUA 4M5SA 2AEQH 5KVGL 5LQBH 4YSRA 1GJUA 5EA0L 5LBGA 2EH8H 4I4WB 4WI3A 2MQ3A 3NBNA 1QEWB 1BZ8A 1F3DJ 3GS7A 4RNRA 2DQFB 3KWWA 2ICWB 4HIJA 4D9LH 1UM5L 5TE4L 3HUJF 1HL4A 3ET9F 2OMVA 1V8HA 2E6PA 4F7TB 1OZTG 3QUML 2X6CA 1NLBL 3NSDA 1WFMA 2OCJA 1U91A 2ZOLA 4MX7A 3S37X 4BFOA 3ZUNC 4NO0D 1ZWIB 1DUZB 1KXTA 2JIXD 2WWOA 2XXCB 1H8LA 4YUEH 3DX8A 3RURA 5C71A 4CSSA 1E5AA 1SY6H 1LXMA 1IEHA 1Q9WB 1S7UB 3CFEA 3IFOA 1YC7A 4A7TA 4WEBH 2AC0A 2CDFB 2IF7A 4QRSA 2VDRH 2YBGA 5D7JC 5I74B 1V3LA 3SBPA 1KIRB 1HL9A 5L0QC 1KJ2L 3JV4A 3VW3H 4MDJA 4GI6A 4IBSA 4U33A 4XXWC 3QUMH 3VNYA 1AZRA 2NY1B 1QVOB 3L45A 2HTKD 3TO2A 2YPVL 3LQMA 1A66A 4M62H 3TGXA 3P0YL 4QHMB 4XVSL 1PZ2A 3V4PB 2P24B 2V3DA 3FB6A 3GBLA 5DHMC 1OTTD 1M1XB 1MW1A 1WIPA 2HX8A 2HLFD 2XX1A 3GMOA 1FJ1A 4OH2A 3F00A 1N59A 1PG7X 4TUOB 1H0DB 1DJIA 4AH2B 4H25B 4QOKB 1PD6A 2CR6A 3CU7A 3PGDA 4O9HL 3BP4A 3E1F1 4Q89A 5C0RL 1KIPA 2EICA 2DH3A 4AM0A 1CS6A 3PFQA 2OZ4L 2VMJA 2IFGA 1MW3A 3AACA 4G9FB 1NUNB 1CUOA 1KNOB 3VFGL 5HJDA 1ZEAL 5FK9A 4ALAC 2XZAL 2ICWI 1BAFH 3A67L 5DYOA 3UAFA 1AD0A 2P7TA 4DGUA 1QFWI 3LAFA 2VN3A 4WHDA 4N2LA 1CK0L 3S5ZA 2F9BT 5SX5H 1RZFH 1XR9A 4E5XA 3VGGA 2VLRA 1JIBA 1H3XA 4JRXB 4OF7A 2EC9T 4N0FB 1A02N 1Q0YH 2B4CC 5F9WB 2FGWH 3NCXA 3PXHA 5GRJH 4UINL 2N1TE 1PJWA 3S5YA 4GBXB 2OYPA 5BS0D 3IWUA 4JFXB 4LOFA 4NPYB 1NLBH 2B08A 3KLHC 4XR8C 2EIBA 1CGWA 3P3YA 5KVFL 5FOBA 3GLAA 3ZYOA 1HQ4B 2WO4A 3QUMA 4HC1H 5DMGD 1BAWA 1VB9A 4RSYA 2F7OA 3DVGB 3MXVL 1UT1A 5C07B 1C7TA 2Z1KA 4OD1L 2E7BA 3ZDYF 5TDOA 3FSOA 3GSXA 3T09A 2XZAH 3DHMA 4XO4A 3H7LA 4AVKA 1WQVT 4K9EL 4HXAH 1FC1A 1DE4A 4KXZH 2X9XA 1U4FA 1T1WB 2DKUA 5EU3A 4GB9A 4C4KT 3B1UA 3VYPA 3D9AL 1F90L 1FQ9C 3U1SL 1HKFA 5I15H 4ES9A 4G5ZH 4OGQC 3O3AB 3RWIA 2EVFA 1U95A 2EYSA 4ISVA 3EF4A 3LVEA 1JNLH 1YMHA 3FHAA 4OV5B 3UYOD 1J86A 3M8OL 4BUGA 1IM3B 2A74A 1DQML 3RYMA 1FLRL 3T1FB 2WXJA 3B2VH 5FO9A 3II1A 2LTQB 3ATAA 4FYRA 4OFKA 3ZJAA 1PAMA 1NC2D 1IEBA 5SWZD 2ZYSA 1UURA 3HBZA 4B5ZA 2DDQL 3WIFA 1L9PA 4JFPA 1SOQA 4J5VA 2I7OA 3FU8A 4HHAB 3G6JF 2EXWC 1HEJC 1G7QB 3P4MB 3VD1A 3LRMA 4F92B 5FYKU 5KBMA 1KC5H 1IGFL 2HX7A 2XA3A 3MA7A 4GH7B 4PWEA 5EORL 3WFCH 2FZ3B 2NUPB 5LB1A 4YSEA 3BISA 2VDKB 1TKWA 2MCPL 2HRPL 3WNPA 4JGJA 1R3JA 2A6KA 2M83A 1QI4A 2RGSA 1UOKA 4NI6A 4K7PL 5GRUL 3WOVA 3VWKA 2VO5A 1PKQA 1N64L 3FCSA 5GGTL 3FC8A 1S5HA 5D55A 5JDSB 4K7FB 4LP4A 4PHXA 4APQA 3KPOA 3RBGA 4KROD 4I18B 1MFVA 2Q20A 1AE6H 2AXFA 3AAZA 3OXRB 4XNQB 5ESAA 2V4LA 2E9WA 5ID1A 2QTEA 3DETC 4GSQA 1M05B 3CN2A 1E2WA 4PQXA 3IJYB 5F70A 5FGRA 3QDJE 2Q5BA 5AOLA 1Q0XL 4WVRA 4OZHB 2BVOB 2XBTA 4XBGB 5IQ9A 1H5BC 3JXAA 1LE9A 1KGIA 4G6FD 3BQUB 1KBPA 1WWWX 3ULVE 2OXGA 4IHOA 4P2QB 4LAJH 2CD0A 2R23B 1GS6X 2J8HA 2JCCF 2IQAA 3SDCD 1NUDA 4B41A 2FNWA 4LVHB 4N2NA 4XBPA 3L3OB 2E47A 2WVTA 5I1LA 1LE9B 2EDWA 4C56A 2Q76A 1DQKA 1QFUH 1XB6A 3I6GA 3PNRB 4AYSA 4RWYH 1SOKA 3Q05A 4MAYD 4Y4KD 2VZVA 3NIDF 4HG4J 1R3LB 2Q8BL 4J39A 5EF1A 5EU4B 5I1LB 1EA9C 1TQWA 4Y2OA 2ZOWA 1TSHA 4RAHA 5CLTA 1CCZA 3ZTDC 1HEZA 4AEHH 2VN4A 3SE4C 1IRAY 2D7MA 1SGKA 1HN1A 4ZX6A 4KGLA 2E76C 1A3QA 1T0OA 4I0KA 1EAQA 4IIQB 2Y7NA 3B2MA 5ESVB 1RIVL 1FORH 4A67A 3R0NA 2NNCA 3BP6A 3S5LG 2NR6C 2FBJL 1M7DB 5BUAA 3WTVA 4JJ5B 2EEBA 3VRLE 4IRSA 1MCOH 1AXTL 2SEBB 4R90L 3QRGL 4AYGA 4UTAH 2ZUVA 2X9ZA 2Q0ZX 4MDIB 4XP5H 3V4PH 1EMTL 1Z9NA 3UC0L 4RFNC 3WN5A 3B3IA 3KBHE 1PZ5B 5DS1A 2GTWB 3OHMB 3SQRA 1J0HA 2VRKA 2QSQA 3SDXE 4X0KB 2XBZA 3PCYA 3TCTA 5DUBA 3I3DA 3ZDYB 4JM2B 2E3VA 3HR6A 1E27A 2AEPL 4WENB 1U8LB 4JG9A 5E2WL 3INUL 3CVIL 3TH3T 4Q14A 3DIFB 3UAAA 3I9GH 5CFHA 3ZK0A 3MTRA 1S9YB 1FG9C 1WFTA 2F8IA 3CZSA 3WO4B 2PNDA 5IB5A 4L1DA 2QSVA 1FZJB 3OZKA 3MMEB 4ODTL 3BIKA 3NEXA 4KHTL 4OZIB 4MXWH 1T5XA 1KLFB 2J55A 1XO8A 3QEHB 1A7OH 4A6YL 3RWEB 1T03L 1BQLL 3AT0A 1XF3A 4DO5A 2BIIA 1UYWH 3UPAA 3ZE1F 4PSRA 4IS6A 3SKNA 2ZSVA 2W92A 2ISDA 5GJSH 2PYEA 4KKCD 3T3ME 3VMPA 3HZMB 3QVAA 3QUXD 1CE1H 3IKCB 1HHGA 4HJTA 1U41A 2ED7A 5D1ZC 2AK4E 2XYCA 2BJMH 4OZHE 2E7DA 4JQIA 3VD0A 3EJZD 5D93C 2KDGA 5EC2B 4APQB 1UHVA 5GRVL 1QRND 1XSJA 1UT9A 3HNTH 1TZAA 1FFQA 3BP7A 3DVGA 3J7HA 5C07A 4JFDD 4N8VB 3BO8B 4ORGB 2EZ0C 3UTSD 4N0FA 3WEBA 1I9IL 4QHKJ 2GI0A 4HXAL 5KVFH 5KYUB 1KLUA 3S3CB 3GM0A 1G4MA 1BDYA 1OM3L 4J7RA 4K4KA 1A3RH 3MRBB 1FV1A 3DJTA 2ICWA 2P9RA 4HIJB 1KTDA 2F54D 1M2VB 3FB5A 3LPFA 4TSBH 5TE7H 3ZMRA 4DP8X 1WLHA 5BUGA 3QYNA 1UZGA 3RI5F 3UL4A 4G83A 3GB7B 4PTUA 1LNUB 2VDLL 3A6OA 1RPQA 5E6IA 4GRWH 2NX5D 2HB0A 3H9YA 2ZCKL 3W0WD 1IFGA 4HSCX 1AFVH 3VMNA 4ENZA 1ETB1 3RZCB 4CNIA 4IBQA 5AW6B 1J9RA 4ZPTB 4MJJA 4XC3H 4U6XA 3L1FA 3UCRA 3KDMB 3V6OC 3MJ9L 2UY6B 3GHPA 1E0OB 4U1NA 5GIRA 4HIEA 3SDXA 2R4RL 3TO4C 4HJEA 1M6OA 2TRYA 4F33A 3G5YA 4NUGH 5F7YC 3JUZA 4NB7A 5F71A 4G8EA 4PGCA 2CBQA 3BVWA 4K3DH 2ADGB 4RFEB 1ZHBB 4BSVB 1P6WA 3MRQA 4HH9B 4NYLB 1TVHA 1PY9A 4PLKC 2FLBT 3PHQA 4MA1C 4N2HA 1ZIAA 4C4BA 4Z3EA 3CQQA 3U4EB 3RY6A 3KCWA 2IAMA 2BSEA 5DVMA 3VFNB 4ONFH 4GRWE 3TZVB 4F2ME 4M7LT 5TGBB 1A1OB 2I7SA 3I75A 3MREB 2WKGA 3NIDB 3WHE0 4X9GA 4XVTH 1KTLB 5LCVA 4A6YA 5E1QA 5CJXA 5D6CB 3WEMA 4FFZA 4FFWC 4WIQA 4M5TA 1ECYA 2J5WA 4O2CB 3U6RB 1KSRA 1X5FA 1NC2B 2EO7A 3BJLA 4FXTA 1KTCA 2WVVB 3LZRA 2HPTA 4OQ1A 2FRGP 2ZXCA 2FX8H 5IZ7A 4Y5XB 4EI0A 2GCYB 4ZXBC 2DW5A 2B2XL 1O7VA 1XGQA 2NNFA 3O3DB 5IVXA 4UM9D 3FS9A 3CDGA 4FQJL 2VC2L 4E42B 3LIZA 3PDDA 4I77H 4TQEL 4DKEL 5LDUA 2CMRL 2XKUA 3X3FH 3TA3D 3QDGE 1J1OH 5IG7A 1YY9C 1DBBL 2XKNB 1FBIH 4HAKA 4I48B 1TCMA 3RE0A 2RIKA 4GJTB 1CF1A 1UGKA 1BMGA 4JR9L 3OAZK 1CGVA 5B38A 2NY3C 2GY7B 3QA3B 4GRLB 4O2FA 4PJCB 1NGQH 2D2CC 3TYFA 4M48L 4I8DA 4OM0L 1D5ZB 2Z35B 3PPSA 4LDEB 4CGUB 3QIWD 4PJ5A 1RHHA 5JPNA 4ZDHA 2DIBA 3GSRB 2A6JA 4M6NH 2VDOB 3NIDE 3QCUH 4HWZA 2UWEB 4RH4A 3WJJA 1G9NC 1U8QA 5DMKA 4ZAKA 2MQCA 5F3HB 4ODWA 5C6TL 5LWYH 3EJCA 4PJFB 5FO8A 3MGOB 4PJIE 1CN4A 3ZKNC 3VDBA 3CCHA 4JB9L 5DMJB 5DRNA 5I26A 4XBGA 4PG9A 3BAWA 1K4CB 3W57A 5GGQH 4HUUB 4XNDA 5EBWB 1A14L 5I0WA 3G9VA 3QR1A 4TYUA 1NQBA 3L9RA 3AS2A 3WAJA 5JW5B 1KPVB 1ODUA 3CV5A 4X6EA 1YEEL 2XIDA 5EOCL 1J10A 1AR1C 2WKOA 4ZNCD 5I1AA 1G5AA 4R2GD 2O5XH 2WN3A 3KXFE 4LSRL 4YHPB 3IN2A 2A9CA 3VSQA 4X50A 4BFIA 4K8RD 3EAKA 3NN8A 5E2JA 3IFLL 1T7WA 2TSBA 1FV1B 4LDLB 1P5VA 1DANT 4B9GA 5L2KD 4F5CE 1I3GL 4HPYH 2XLLA 3T0EA 2AQNA 3TBVB 4NT6A 3DGGA 2AMUA 3C87A 4L1LA 1SY6L 2O5NA 3GB7A 2WO3B 3PGFH 2RFXB 3IU3A 3L3IA 2AI0L 3WTXA 4P3WA 1E30A 2AXWA 1T80A 1FG2A 2Z6FA 2X53A 4FFZL 2XWBB 3KYKL 1EANA 1RZ8B 3QAQA 1CD0A 5FUCE 1YUKB 4FL4B 2RFXA 3IU3B 3L3IB 5SWSE 2H6PA 4NJAL 3BI9X 4KHTH 2ALAA 5CIPB 4WY7H 5E2TH 4RZCA 1KG0B 3BEWB 4DVBB 1E9PA 1MQ8A 2UZIL 1YEEH 3X1FA 4IMKA 5IHZB 1XMWA 4DKDC 2Z7ZA 4YLCA 3M45A 4R84A 5B3JE 4M6ML 3LIZL 3C09C 1ZLWK 3FSZA 3K72B 5ABAA 2FBJH 1AKPA 1X9RA 3HZVB 2PWHA 1IC7H 1D5IH 4LARH 4XB8A 4M48H 2DQTL 1D6VL 2V5RA 2P8PB 4YHIA 4NO5A 1J0YA 5FUOL 4DZ8B 2H6UA 4GUPB 1EMTH 1FL5A 1FVCB 3PWPD 3EJYC 3RPKA 3SPGA 3ASOB 5CN1A 3UC0H 4H26B 2VN5A 3BWAB 1KIUA 5E2TL 4BRVA 2VDML 5IB5B 1KPUA 4KJQC 2R0KL 3QJXA 4GKNA 1PLGL 1JF1B 4YIQB 4M29A 2Y06L 3L3OA 4QRTB 5J8OA 5L4FA 1ZLVH 2LABA 4QYOB 1H3TA 5AVTB 5IVZB 3VTAA 5A40E 4YNYB 2AXHA 1RULH 3QEHA 4G1EA 2ZOKB 1VF5C 5MENE 1URZA 3V8CA 4K55A 2HVKB 4KBPA 5EU6D 4NPYA 1OW0A 2V5SA 5IT2H 4XCEA 1OAUH 5C2BL 5GS1A 1KYOK 1UM6L 4FMFA 1N6UA 3LZFL 1WBZB 4N26A 3GRWH 3MNVB 3RPIA 5L4JA 3MRGB 4NCC2 4S11A 1Q0YL 3QDJB 2RCSL 1F4WH 3TWCH 1IEAA 3PJSA 3O6FA 1OGAB 4WEMB 1S5IL 3LEYL 3BP6B 1QLFA 4EXKA 1AY1L 4U7MA 5FGBC 5GGVY 4KKQA 4NP4L 1CDUA 3PLYA 4LLDB 5JNYA 1OARH 4K71B 1NBZA 4Z7IA 5D71L 4K8RC 1EEYB 5D7EA 5FFLA 2YD6A 3RUGE 3AQDA 4XMLL 3VI4F 3NFPA 3K3QA 1GZHC 2IEPA 3TN0C 5KZCD 4ZTEA 1SY6A 3FT4B 4J3UA 5A2BA 1Q0XH 3LZOA 4P8QA 4EDWH 3NJGA 3OV6A 2CCVA 3T04D 4IK7A 3S8FB 3W3BA 8FABA 5L2KA 2XN0A 1Z3GL 1ZK5A 4JO3H 1Z9LA 3QUHA 3T77A 1PKQE 5J0BA 2EUVA 3PHOA 3KEDA 1S3RA 2ZXBA 4IHBA 1E8YA 4MXVF 4XO8A 1I31A 2PLTA 4KO9A 3HAEG 3AGWA 1UB6A 2N56A 3BPOB 4GRWF 5DHXB 5D7IE 1U95B 4LLWB 1Q94B 2VAAB 4E9WA 2EIDA 1AH1A 1AQ8A 1NMAH 1O5PA 2R1YA 1JWUA 3HJ0A 4L9DA 2CAKA 1YEJL 5EG6C 2UYLA 4R7XA 2BNRA 4GKSB 5EZLB 1BECA 4G9DB 2D0FA 2B16A 2GT9B 2IGTA 4QHUA 5DLMH 2DI8A 4BIKA 3S97C 1X5KA 1ETA1 5KSAD 1CVRA 1NEPA 1VERA 2ZWLT 3D2UB 1OALA 1L5GA 2NXYD 4S2SB 4OFQA 3PUUA 4Z0BL 5FKPA 3GRWA 4K7FA 4BDVA 3FSVA 3ATBA 5B1AB 2HTLC 4DPCX 3QUZB 2FWOA 2R51A 5DGRA 3TFKD 1FDLL 5DJDA 3SE9H 1VACA 5FUZL 1CL7L 5LXGL 2G2NA 1IJ9A 4MB5A 4CVXB 4QMEA 2OMZA 3M88A 4RMBA 4UOW1 3OQ3B 4PVNA 1PIGA 1OB0A 1JYWA 4FRWA 4FD0A 3PV7A 4L4TE 2IADA 5AOZA 4H40A 4PRPA 4W6YB 3LQZA 2L3BA 1JZEA 2WXHA 5DJ0B 2FD6H 4O58L 1T20A 1GGIH 3VWKB 2OCCB 3CX5J 4I87A 4MAYC 2DD8H 4PIBA 1FYTB 3AY4A 1QBML 5F0PB 1LWJA 3LQZB 3PHAA 1NMAL 2ZOUA 3VTMA 3K2IA 4I85A 2I24N 2XQYG 1J1PH 5DJ0A 4F8LA 1KTDB 4DOHB 1OF2B 3K81A 3ZTJG 1TLMA 4EZMA 4F7TA 1RZJH 5CP7A 1V7NL 2H1LM 4JK0D 2WK2A 4IRJB 2HXAA 4DPBX 4BFRA 3SB3A 3Q8FA 5I5MA 1CDCA 2P8MB 3BO8A 4CU6A 3G5VB 3K46A 5E08H 1T89C 5I30L 1F8TL 1P0SE 2WCPA 4U1SB 3QWRD 3ROLB 1J8HE 5KSAA 5DI8B 2A77L 2YAHA 2VWEC 1G7IB 2QR0A 4HJ0D 2H2PD 3NG5A 4KY1L 4NUJA 5TDPB 3V5HB 5IP4A 2D3JA 4FQJH 2J88H 2O72A 5EBWA 2NTFA 3KWTA 3RWDB 2Z34A 5DFWH 1U92A 1RZJL 1NGWA 2BWIA 1K6QL 3Q3GB 4BINA 4H7VA 4L3AA 1HKLH 4R4ND 2X44D 3DBXB 3BQVA 3MOBL 1UKQA 4LGRB 1Y1UA 5C0RH 4U1JA 1F90H 3RVTD 4K2UH 1S9XA 3WENA 4HKXA 4ZAKB 1RZPA 2AEWA 3O0RH 1HHIA 2EDTA 3QRGH 4OM0H 1AHMA 2JCCB 5HGHA 5JIPA 3N85H 3MA9L 4R7NA 5GZOC 2ZPKH 1CTOA 2Y7LA 4ICWA 3QJHA 3QQ4B 4AYFA 5C07E 2WOYA 3HB3C 4U1MA 3OXSA 5LBSA 2F54B 4JDVA 4F2MA 4AQEA 3L5IA 4HCRA 2X2UA 1WE5A 2C34A 3TYGH 2DQUL 5EO0B 4GIOA 2PR9A 1MLCA 1XBDA 1Z32X 2HN7B 2NXZC 2EDBA 3N06B 1DN2A 3QNYB 3TJPA 3P11L 5AVXB 1NOFA 3IAQA 3SE3A 5KUKA 3WFZA 4MD4B 2XN9E 1M1SA 5DO2D 3FQNA 4NQXB 4OZFA 2JJUA 3OL2A 4JRYB 5DZPA 3L3GA 3UTTE 4KITB 3LH9A 5B3JF 1NL0H 5IBTL 4XT1C 1RUPH 1GYCA 4PP2A 1HWHB 1OIOA 3IFNH 3ZSSA 3JWNE 3D39B 1A4BA 5BV7L 3BHBB 3MBEB 2ED8A 3HMXL 1Q0EA 6FABL 1NMCB 2BX5A 2H5UA 2CNZA 2KKQA 3FUNA 2I85A 5EO1B 2Y06H 3TVMC 1J87A 2FBOJ 3CHQA 3ZO0A 4H8WC 4MMXA 4PGBA 5HHOB 3LCYA 3SKMA 3TPUB 3VSUA 4ODUA 1HHGB 2WXLA 1KLGB 4NRYA 1NCBH 2VL4A 4HH8A 2IIJA 3G04A 4PRNB 3LD8C 2OR8A 3D3VB 3DVNB 3ELAT 3T8XA 2FK9A 4PBDA 1LMKA 3CD4A 4XB7A 4YHYC 3LH2L 1ASOA 1HXMA 4KI5D 3FXIC 4HBCL 1JFQH 5I0DA 5CP3H 4GKZB 3RDTA 2XWXA 2ZUQB 1HS6A 1A6TB 1MOEA 4P5TA 3WXVH 2UZIH 2DS4A 2OYKA 2IQAB 1QZNA 1F3DH 5DO2C 2Y2TA 3O3EA 1HAWA 4LCCC 3VAEA 1A6UH 5H4YA 4X99B 1QUNA 2F74A 4AEIH 4CVZA 3CFJA 5BOPA 2G2PA 4MJ5B 4WWOA 3C6LB 1L6PA 1RUKH 1YPZA 4HK3J 3L3JA 2DPKA 4NC0B 1QABA 3TNMB 1EXGA 4YHML 3GLZA 3NCWA 2FAUA 3D39E 2VLME 3UMNA 5DD1L 4O2EA 2YUXA 2VDLH 5KYUA 1IT9H 4DVRL 4P5TC 3KXFD 2A0LD 2WO2B 5CS7A 5HYEA 4GI9A 4H2AA 5JW4N 4OQTA 3DLQR 4IJ3C 2B5IC 2PXYD 4MVBD 2VUKA 4OTXH 4TUKL 1AHWC 1KCRH 3FSAA 4OZ4B 5C86A 2CO7A 2MSPA 1UOWA 2NCEA 3OZLA 4XWOC 4ZUTA 3V9FA 1RAMA 5JPNC 3EOTH 5C1MB 4JPSA 1AFVL 3NOIA 1AKJD 5DXWA 1BLNA 1MCFA 2AKRB 5LBSL 5TF1H 1E7UA 1MCNA 1XCWA 2OMVB 3TBVA 4AQAA 1OTTC 2NQ3A 4HHWA 3QUKB 2MPAL 5KTEL 4EIGB 1WCQA 2MPVA 2IDTA 3KM2A 1DLHB 1SEBA 1GH7A 1WZ1H 5PAZA 4OV6F 3NN8B 2MNJB 2WQRA 2YEQA 4G6MH 1LO0L 4MS8D 4WV1C 1L5GB 5HDBB 3MRKB 4FNPA 3UIZA 3WY1A 1C5CL 4QRQB 5EF3A 1CF8L 4P23C 4OGYL 2AZAA 2FUTA 3VGAB 2R69L 2EADA 1UXSA 5FWRA 1FDLH 3DUSA 4MWFA 4U3SA 2J5LB 4CBZA 3GNML 1USQA 2QHLA 3DRQA 1BSIA 3HBPA 4RISH 4NZRH 4PN6A 1I7TA 3L3HB 3WJMB 5JTWA 1RJCA 1FIEA 1WA2X 4HK0A 3VW3L 2VR6A 2WYIA 3MRMA 3WNIA 3DUSB 2VZTA 4KTDL 5MERA 3QDGD 1LD9B 4KMLB 1K4DB 5CZXD 1CGXA 1WYJA 1CXIA 4FGMA 3OKNA 2ZF9A 1PAZA 4FZ8H 4U1KA 4C58B 5IUSA 1VKXA 3WFBH 3C60B 3HBQA 5IFJA 4PGZA 1HEHC 3A4DA 2OJEA 3GMPA 5E4EB 3STLB 5K9KB 2RD0A 2E7LC 2HG5A 2VC2H 3AROA 4NOBA 1PMYA 3IFLH 1I8UA 4XCNB 5I6NA 3H3KA 4BZ1A 1R3HA 4S0TD 1E7VA 1E5UI 2NPLX 2VDKL 1X4YA 2EIKB 1WV7T 3BWUF 4ZFQA 2J1ZA 3ILDA 4RGND 4NQXA 4OZFB 1OP5K 5JLZA 2EEFA 4HSAC 4XP5L 5ESVA 3BKJH 3ENEA 3TV3L 2QFRA 3EF7A 2X4QB 1ZEAH 3QDJD 2WPGA 2Y2WA 1C1EL 2XACC 3FKUS 3QJVB 4APQD 2QKIC 4NQCE 5IMMB 1IGIH 1JZGA 1OGAA 4E5XB 1OK8A 1HESA 4HJUA 5J9PA 1TPXB 3ARBC 1G7HB 4UQDA 3C9NB 4KX7A 5C0FA 4X6FA 4K8RH 2X4QA 3T3PF 3W39A 2WNXA 5AVSB 2GAZA 4NKQB 3MNVA 3VFPA 5GGUA 1BREA 3R06B 4E41B 3ZRCC 3F12B 1HSBA 2WXPA 1HCZA 32C2B 4H8HA 2J25A 4JHVA 3OAUH 4YQXL 2C3XA 4WFHE 1LEGA 1CXLA 1O6VA 3ARFC 1TTRA 1HX0A 2WKLA 3HI5L 3S4SA 2V37A 3KYNA 2BHYA 4GRWB 4F2MB 5J6HA 2ADYA 5KSUA 4Z7UB 1A5FL 4WW2F 2ZNXA 1T5WA 5FGCB 4Y5YC 5FECA 1CFNB 4ZS7H 1GGTA 3G5XB 3LH8A 3THML 1YEDB 2OYMA 4LVOB 3DO4A 4NQEB 3FQ2A 5B1JC 2NDFA 5DQDH 3ARDC 4A37A 4PB9L 1JJUA 4G8EB 4M1DL 1UEMA 2EH7H 2XTLA 3TT1L 4Z3TA 3VU2A 1ERNA 1T1XB 4U0RB 2ZQKA 5FV1L 3APDA 3TYGL 4JPVL 4E36A 4X9IA 1FI8C 3DX8B 2DBJA 3E38A 1A3LH 1RZFL 2VERA 1FA4A 3C08H 1TQCC 3FFDA 4E5XG 1KGUA 4RZCB 2F8XC 2Y9RT 4K3EH 1CXKA 1TQBB 4WK0B 4PV9A 1MELA 4LPUA 3BVTA 3DMMB 1DHKA 5T33L 1KOAA 4JJHA 5GS1C 3GSQB 3FPYA 1GMEA 3VFMA 2VLJA 2NMSA 3L3GB 4X9HA 4CADA 4G7QB 3WDHA 4G2AA 4NFCA 3DDGA 4UT7L 3GI9H 1GC1C 1B4JH 3E8UH 3Q1EA 5AVUB 4ZUUA 3TEZA 4GQPH 2ZUWA 3RVWD 3FYEB 4BZ1L 1KLUB 3FCUB 1OCWH 4N6RB 4OIFA 5FYKH 2DMGA 1NFKA 3MRHA 4JG1L 3GSNL 5DFVD 5IK3A 3RLSA 4DWHA 4BV1A 2DQIL 3T3MF 4AIZB 4UV4L 1U8PB 3ARYA 3L7FB 3QJOA 4G7VL 5DD0L 3T4YA 1JZ4A 3CXHK 5DJ6A 1NIBA 4MDRA 4MJ5A 4XE5B 3MRCA 5FA4A 4ZMYA 5HYJB 2D4FA 4LCYB 3VCLB 4M62L 2X4UA 4WO4A 3JTSB 4RGNB 5F6IC 9CGTA 1JBJA 4QHLA 2JVUA 4XMZA 2A6IA 5ENWA 4FA7B 5GJTH 3AB0C 1ZTXL 3GC3A 4GKZA 4OFVA 5ETUB 2MNUA 4YHNB 3RVUC 2PYED 4Z8FH 3PWPB 3C6SB 2OAAA 5AW0B 5D2LF 4WI0B 3TIDB 3RNKA 4XHQA 1B4JL 1XX9C 4JFTA 1WAPA 5JXAH 1IX2A 1JD9A 1G9MH 1OOWA 2YAEA 4AUYA 5IR1B 3IPFA 4PRNA 3KPLA 3LMJH 3DRTB 1JYVA 5TDPA 3V5HA 1XAKA 5CSBA 2WLKA 4BBWA 2DICA 4R97B 3H1ZA 5T3XD 1JGIA 2E9IA 1U9KA 4JG1H 4Z23A 3VFGH 4L4VE 4C54A 4ORZC 1SBSH 3PIQB 4XXCC 4XMWA 4PS8A 5KVEL 4LLVA 3V2AR 3SE9L 3SY6A 2WN2A 1DVFC 3BE1H 2PXYC 4KU1A 4MVBC 5AZEH 3VFRB 1G7HA 3EIFA 1ZSDA 2X1XR 3CE1A 3APCA 3BKYH 3ARVA 3FU0A 2ERJC 3K2UL 3UBGA 1C5CH 3IB4A 2Z0BA 2NY0D 5JUEL 1GYVA 5F7EL 5F89B 5SX4I 2BNRE 2FGWL 3ESVF 2ZKHH 3O2VL 5F3BB 3EYUH 3CIAA 4MMYB 4P57A 2APWA 3EZJB 2HN7A 3O4OC 3Q2NA 3FTGB 4W6XB 4X7TA 3ZGHA 3Q06A 3ZHKA 4R4FL 1HHKB 4XWGH 4XPAL 4N8VG 5C0ND 4DT2A 3UZEA 1JRHH 3P2DA 2SEBA 4PJBB 4CGTA 1G6RH 3KWUA 2RTTA 3MOQA 2QQLL 4I5BA 3RKDD 3B9KC 3HG1D 4P5MA 4TNVK 1IGCH 4IW4C 4QXTA 4H25A 1MVUA 5DEZA 4PRHB 5JR1L 1M7XA 1JYXA 5K1JA 4FP8L 4CN1A 3GLDA 3FBQA 5IWLA 1BGXH 1O7DE 5CSZB 3UOAB 3ULVD 3LIUA 1R3IH 1HHHA 3O8XC 3ZZ1A 2FL5B 2B15A 3D69A 3I75B 4YK4C 3DI2B 3EGSB 3EYUL 1JP5A 5FYLD 3NIGB 5E99H 5HDQL 3ARQA 4ETQB 3FUFA 4UQ2A 5IBLD 4JPWL 2XTJB 2IBZX 3GSNA 5DUJA 2A7BA 2PYFA 3H4FA 3VI4B 2APFA 2AEPH 2B1AH 5IFAL 4DIXA 1Y1DA 1YEGH 2X0UA 4ZT1A 4M6MH 4UOZA 1KBGH 3D85D 2X1OA 3O81A 1BFSA 4HEMA 3PDOB 3VXUD 4APXA 3MQIA 2RH0A 1XSKA 2J21A 5JOPD 3BN9C 5EF2A 5T3ZH 3MCKA 4JEGB 3EG9B 2G5UA 4K2UL 4XO9A 1T4WA 5HGDB 3DVNA 3FU9A 3BZEB 3T71A 3FYIB 4WO0A 3GRBA 3T5WA 4G6KL 2ROYA 5HJBA 5CD5D 2BHZA 2CKBH 3IDUA 3W11D 2ZXEB 4OZGA 3RDTC 5GS0D 1FF5A 3ZVVA 2AJSL 1G7PB 3ESMA 4QRFA 5D7KE 3OMNB 4N28A 2GAZB 4XNAA 4WWPA 3FQWA 5KANI 2GBAA 3SJVE 1FH5L 4LCCA 4M6OH 1OEZW 3KPQA 3PAYA 4K3GA 5EC1B 2OMYB 3IMRA 3MUUA 3T4AC 4RCAA 3RX5A 2IWEA 4Z1PA 4Z7OE 3MOAL 3QG7L 4WWNA 2IFFL 4ZUUB 3DMMD 3PE9A 4QKXB 1MW2A 2B20A 3HVDA 1LEKA 1SN5A 4ZSOB 1MEXH 4EUPG 2R56L 1RVFL 2RAMA 5JPMC 4ZTPH 1BHGA 3OLEA 4KQ3L 5E2VL 1OAZL 4PR5A 3KYKH 3VWKD 3GFUA 4L48A 1CBVH 4L8SB 4P2OD 4NUQA 4U6HA 3WEXA 2GB2A 3HHMA 1B0WA 3B2VL 3TBWA 1IBHA 3RJDA 1G94A 1QSZA 2QMJA 1JPTH 4LCUB 2PCYA 3CMOL 4ENEC 5GGQL 2VJXA 1NA8A 4NC1C 1I3VA 4MA3B 1IM9B 4WI7A 4GXVL 3SBRA 1LTXA 1IZKA 1XXFC 4KTYA 4WHYH 2F53D 1L9RA 2B9BA 3RTQA 2J6EH 2WUCH 5FO9B 3BKCH 3QUYC 1E9OA 1EDQA 3ME0B 3CMGA 4FG0A 2PABA 4KK9C 4UF7C 5G4NA 2JKIS 5FYJU 1L9TA 4U6YB 5AL0A 3EXJA 1PCXA 5MEOA 4PLJC 4PJ7A 1LO5B 4JUSA 5FYLL 3LQAC 1F42A 3SGKC 5FKAB 4FLHA 1JVKA 3EUDA 4U6TA 4L3CA 4DSYA 3ARGB 3P9LA 3HTLX 4RMUA 3ZKQD 4OCLC 2X70A 3KYOA 2QDWA 1HYSC 5BRQA 2VLRE 3MJGX 5EZOL 5C09E 5C0CE 3WI9A 4LHQB 3IMBA 1CGYA 3O6KL 4Z76A 3BKMH 4PTTB 3NPSC 1MKFA 1CICC 4WGVB 1P9MC 2G60H 1IKFH 3UBXA 3T2LA 4NN6B 1CFQB 3QPKA 4N2GA 2HWZL 3WLBB 2Q7NA 2EIJB 3FO1A 3HC0A 3AT9A 4PCSA 3RHWK 1HJBC 4OSUL 1E6OH 3ZT6A 4AV0A 1O9ZA 4AIZA 1Y0LB 4QGYA 1J0KA 4L0YA 3FF7A 4ZQKB 1KJ2B 4RFOH 4UT9A 5LJYH 2E7HA 4C56E 3IMVA 3KPRB 2VSMB 5HBBA 2BY2A 4XMPH 5DUBB 1PG7L 2XWDA 4ZS7L 1KYDA 5F88B 4LOUC 5HHOA 4L4JA 1S3KL 3DO7A 1M56B 1FLRH 2P43B 3FULA 5ACLA 5BUPA 1NWOA 1XTLA 1NWPA 3DTUB 2VITB 4MA7L 5H35A 4D7BA 3CUPB 4OF3A 4WFED 5I8OH 4YZFF 2BSBA 5GGRA 5BS0A 4QTIH 3EOYG 1DBMH 5IW6B 4TLUA 4GW1A 2J3SA 4MJIA 3QDJA 2HH0L 1H8SA 3O6FB 3DMMA 5CU9A 1P9MA 4JFDB 4RQQB 5CJQL 3QXVA 2LHAA 4FN0A 4ZOAA 5F21B 3BD5A 5HI5D 3VRJB 1S8DB 5FM5O 1DQJB 3SJVB 1U3YA 3SCMC 2YOCA 2W9DH 4H1LB 1UCTA 4DCQB 4F7MA 4LOVA 2D7NA 3F04A 4G1EB 3SD2A 1QUNB 1T22A 5D4IA 5FLVA 2C3WA 1NCCH 5DURD 5ABZA 1GVIA 2VDNH 2F18A 4M9OA 3SIKA 5CILH 1EFXB 4D9RD 4RESB 2BOLA 4LBEA 3CK0H 1SVCP 3UP1A 1MVYA 5I1CL 4FEIA 4WK4B 4YHOL 1WBZA 4LEOA 3T3PB 2Q8AH 5JHDB 2CUHA 3BUPA 3FDWA 3Q2WA 4JFYB 1ONQA 4NKIH 5DZNA 5JZ7D 4HS3A 1JMXA 4EVNA 5C0BE 3F7KA 1TFHA 3O45A 1GZQA 5AQ0A 5EUOA 1X7TA 1WWBX 5C3LD 3ETBJ 4H1LG 5GGSA 3RG1C 1KCUL 3X3GH 4IRSC 1KZQA 4AIXA 1VEMA 1VIWA 5DMKB 4KTEH 5DQ9A 5AVVB 4PLJD 3A4AA 3GXDA 2DJ4A 3CBKB 5DZLA 3RL2B 3TASA 4BH7A 2Y07L 2NCMA 2EIZB 1NBYA 3SYPA 4BFBD 1J18A 1MVUB 1AGCA 4YXLH 3SDAA 3VXSA 1LILA 2CNYA 5E6IB 4YDIL 2JE8A 1CQYA 4N8CH 3U30B 2LAAA 1QAWA 4ABVA 2X89D 5HD8C 1CI3M 3HG1A 1LNUA 4TF4A 1GXEA 5EO9A 1E6OL 2R2BB 5EBMA 4N86A 2FJUB 3NH7L 1INQA 4TRPL 1X5MA 4GO8A 2DYPB 3FTSA 3D34A 5I0ZA 3BH8B 3UDWC 1QBAA 1KPRA 3H3PL 5E94A 1WC7A 2G5RA 3MYZA 2DQ6A 1ZIBA 1EEZB 1F58H 2MPAH 3NCJH 1R24B 5CLZA 1YQVL 4W70A 4UT9L 5EN3A 1CE1L 6CGTA 5HI3C 1JGUL 5DUPH 1FNLA 2YSTA 4BJLA 5IKCA 4DAGH 3MA7B 1F13A 4HJSA 1Z0NA 3GI8L 4X8XA 2QQKL 5EOCJ 5AW5B 1XAUA 2FT8A 3CGTA 3QNFA 1RP9A 2MTPA 4MJ6A 3HB3D 1ANUA 4L8CB 4GO6B 2FT7A 2WXMA 3IKCA 4OJAA 3UBXB 5F7KC 3AVEA 4H2CA 4U1KB 3HE7B 3F7RA 3VFTB 4PHZA 3B56A 3SPVB 1XGPA 4QRRD 4Z7VB 2Q7AA 2O1AA 5IF0B 3AQZA 2FQGA 3DKHA 4CMHB 1B0GB 2ZWYA 1IQWL 5C7XH 3KLAB 5IEKA 2WVUA 2CLRB 3ZHLA 5EBLB 2GJJA 2ZZUT 5IB1A 5J12B 3ALPA 2EDLA 2H3NA 4XRCB 4FXGA 4LCWB 43C9B 5EU6B 3NZ8B 3G04B 3D4ZA 4LIQL 4U1LA 1IKNA 4FTVD 4MNQB 3B2PA 2BVPB 2DLFL 3BAXA 4IDJL 1WWCA 4LSRH 1P4BL 3H9ZA 3MRIB 4H88L 5DUPL 4OZIA 3F7VB 5A43C 43C9A 1FGVH 5FA4B 3HE6A 5HGGS 1HL8A 4PD4J 4L0ZA 4WO4D 5DD3H 5DJZA 5J7CC 1AANA 2F1BA 2MWCA 4ODXA 3QJTB 2VQ4A 2XBDA 2GTZA 3EYVA 4W6WB 3MRJB 5T8IA 2XFXA 3MLRL 5C70A 4LGPB 4PREB 5HHOE 3UTZB 2I69A 3F84A 5FCSH 3MNWA 4HZLB 3RA7L 2JNZA 1S7VA 4EI5B 5C0GB 2UWEE 4GXVH 4RMRA 1HSBB 5AALA 3E6FB 5DD6B 3ZR5A 4MTMA 2VDQL 3M86A 2BNUB 1L3NA 3CMOH 5I6LA 5DDHB 1NZRA 5I15L 3MXVH 4HIXH 3GPSA 1JHLH 2H0FA 3ZDXE 4QXUH 1H9VA 4QR7A 4KZCA 5E51A 1FBIL 5IMMA 2EDKA 3M1BB 2AK1L 2IH1B 2VDLB 4P57B 2R1WB 2XG4A 1WIOA 5B7MA 3TT1H 3VWJB 2J2ZB 2KZKA 1YVLA 3BAKA 3IMSA 3B3IB 2GSGA 2ZG2A 1XSOA 4TL5A 1YEHL 5LUMA 1OXYA 4DGVL 1TQSA 3VXQA 2HVBA 3T65B 1PQZA 3SE6A 3CN3A 2FQEA 1BVKB 4WWKC 1XCXA 5BZWB 3V9CA 1MI5D 1OAKH 3VFNA 4PRBB 5E2WH 1KPVA 3B5GA 3L16A 4UINH 4LSSL 2BOCB 3VXOB 3S48A 5L8KB 3SDAB 3VXSB 3CG8A 3ZDZE 1YEDA 2P26A 3VTTA 3ZE0B 4ZYKB 4YLBA 3SYQA 4Y4FC 5CZVH 4D7PA 7PAZA 3K7UA 3T0EE 2VXVL 2NTSP 2VKXA 5IMKA 3LHPL 1B9KA 3FQRB 3KDPB 4MXVE 4ANWA 3D6GA 1JE6A 3VB9A 3KLHD 4AKPA 1S9VB 4Q7DA 4WF7A 2C7UB 4OB5L 2UZXA 4PWIA 4F33B 2VR3A 3DOSB 4OT1H 5DJAA 1BG9A 1ZHLB 3ARGA 3MO1A 3MGTA 3X1EA 3FQTA 4LPTA 4NQDD 3ALXA 2BW4A 4K7PH 5GRUH 2OP4L 1JTPA 2GFBB 3EH3B 4Q0XL 3O3BA 1UOLA 4A2EA 5ESQB 4D8OA 3QT2A 4G80A 4D0DA 4DTGL 1OTUC 1TO5A 3BEWA 5CJQH 3JV0A 4GRLA 3BIBX 3C5SA 4YZFE 3WV0A 1AGEA 4BQCA 2RALA 1S7TA 2C8NA 3LHPH 4MFHA 5FHAH 3IDNA 1AZNA 1SM3H 1OGAD 4XH2B 3DURA 4EPSA 5LCVH 2GI7A 3TF7C 4HF5L 1YY8B 3PP4L 1VGEH 1F4WL 1ZANH 3CXFA 4PJXF 1A9BB 4TVPE 4E41E 4PJGF 4P2RD 2PWGA 1AC0A 5M95B 1TR7A 3IJHA 2MNWA 4N6RA 3WJJC 1MJUH 2VZ3A 4G7VH 3NA9H 1T3FB 1IL1A 3WE6A 4LEBA 3KL5A 1JI1A 2WMPA 3QUXC 3EBAA 2CO7B 1ZTXH 1KWGA 2QV2A 3U0PB 5IESL 2O61A 3F7LA 2C7FA 5D7HA 3WHXA 3EH5B 5HJGA 1G6RB 5A1AA 3BUBA 3BWUC 3T2PA 5EWIL 1U58A 3LEXB 1TVBB 4DGYH 2Z65C 5C0JB 2GSIA 1IBGL 3L9RB 4PY7A 3EGXA 4JX0A 1NBQA 4D9LL 4FULA 2R69H 1KB5H 2YEZB 5I6MA 4JQXC 4LCWD 2BDNL 2EDQA 4JM4L 4JO5A 4U3CA 1AG6A 4OBSA 4PJHB 5E8EB 2DQDL 4CN6A 4PJ7B 1UJ3A 5TE4H 1A22B 4I7ZC 3F7VA 3MSPA 3ME0A 3IDJA 3KPLB 2E56A 4YPGB 1X5IA 2VTFA 1LP9A 2ARJB 1B90A 1X7SA 4XCCL 4LEOB 5B39A 1RJYA 4KJYA 2GYSA 4N20A 4DEPB 5DLML 4ELMF 1J48A 3HZ3A 2PCPB 3LN4A 3MCLH 2XN1A 4RGMC 5C3IA 1FAIH 5MEOB 3BSGA 4RIRB 4TUKH 1IFRA 3DI3B 4LHUA 1EEYA 4KNTA 1W6WA 3VYNA 3W38A 1UENA 4HYTB 4JDEB 2PKDA 3HE7A 5E5MB 1HVXA 4MRCA 4PPTA 5LLIC 5DQJB 1P1ZB 3UERA 3X11A 3KM1A 4ZTPL 5MHSD 1IUZA 4LRNL 2Z4QA 4Y4FD 5B1JA 5BRZD 3U6XA 1OVZA 1R5WA 1EEQA 4BA8A 1YNKL 4QGTA 3DSFH 4L4VA 4YS4A 1MCPH 3L4TA 4XBEL 4LLUA 5GGRB 5BS0B 4Y5XA 1WTGT 1MFAL 1U8JB 3QDHA 4BCXA 3CN4A 4UT7H 2FEJA 2YD1A 3A0OA 1AD0B 2P7TB 3CVHB 3VMOA 3L95B 4JFEA 2W38A 2CKBL 4FQHA 3VXMA 2A9DA 1IAKB 4TULL 5C0AB 5A16B 4HUKB 2H8PB 3GSVA 3P9MA 4M7ZC 1XCQB 4FA8A 1KFAH 4JJOA 1WD9A 2PTVA 3V4VL 4UB0H 5D72H 4MNHB 2HG0A 3ZE2F 2BCMA 5IJBC 2F58H 3FUEA 1CLYL 4X5LA 5E8PA 3MLYL 2FSDA 3V4PL 2AJXL 3HVNA 2R29A 2XZQL 3BFWA 3DGDA 3QR2A 3S3PA 5F1NB 1BQSA 4X6CF 3KPPA 1BXAA 2W81C 3GXNA 2NY0C 4Y4KB 5FK9B 2WZPA 1BXXA 1FGNL 5DSCA 1ZGLA 3NA4A 4L18A 1RCYA 3BCDA 5A2AA 1BWMA 2CUMA 4S0SD 1YA5A 5C8JA 3CDCA 1J8RA 3HS0C 4L05A 3FUIA 4NBYB 1U8QB 3EOBB 1ASPA 5IJDC 3DYOA 1U0QA 2HRGA 4JDZA 1DVTA 2CPCA 3HZVA 4HS3B 3ARTA 3GSRA 1NCBL 4YZWA 3O45B 3NRQA 4YWGL 5ERWB 4UILL 1KY7A 3PWPA 5CCJA 3B9EA 1CGSH 4NEHB 1SDDA 2WNKA 3FBKA 4L9LA 4ZOBA 3V0VB 3SKJL 4EJ1C 4JFVA 1UVQB 2OMTB 5JA8B 1TJHL 3GKZA 3R7RA 4FL4C 1OAZH 4WLCA 1I8MA 3BDXA 3KH3A 3VA2C 1XD1A 4KUZH 3KPOB 5FOBB 2AV1A 4AZUA 3UDWA 1IAIL 3J07A 4LNRB 2BY0A 3GMMA 3BGMB 1NMBL 3OHXA 5C09B 1VFBB 2DMKA 3OVUB 5D7JB 4O9HH 1EHNA 1DZBA 2AEQL 3IJEA 5KVGH 4JN1L 4X4ZA 1J1XL 1P4UA 1QKZH 4U2ZA 4WFFE 1Y7VA 1F4HA 3VO0A 5IQNA 1JDCA 3K2UH 2NY1C 2H6PB 4C4KO 1QO3A 1CDJA 3W9EB 3MR9A 1T04B 2X4NB 1O5DT 4EN2A 4GW4A 2KYIA 5CD3B 4OZ4A 1E65A 2YXWA 4HHAA 5F3BA 1S7SA 2HJKA 1H15A 3GBNL 3LEYH 1SVBA 1OP9A 2CIIB 3T0ED 5CD5C 4Y5YA 5CZVL 5JOPE 1HXYB 3CLEL 1IGJA 4GP8B 3NCEB 2ARWA 3QWQB 3WUWB 4L5FL 1MHEA 1Q1JL 4AX3A 1UWFA 1IM3A 3TZVA 4L4TB 1XIWB 2ZX9A 1SUHA 1AJ7H 3N44F 3SCMA 3HN3A 5I1DB 2FHFA 2WZAA 3K1KC 4FMVA 4G71B 4ETYA 1MUJB 4WNQA 1BPVA 4PTTA 3H42L 1I3UA 1NCTA 5TJWK 3VD9A 2YGOA 3W56A 4F8TA 3CLEH 4OLUH 3BFQG 2WLZA 4GRMB 4BFKA 2YGNA 3LNGA 4FXGB 4LCWA 3V4PA 5GZOA 3F5WB 1NGYB 3HC4L 3GUTA 1N10A 3BRDA 3QWRA 4NZJA 1ZLSH 3GZOA 2QVIA 5I30H 2FO8A 1IT9L 1FSKC 3RP1A 2EDHA 1LE5A 3DDFA 5MI0C 4AXWB 5IBUG 4BUQA 3D9AH 3DVFA 1PZUB 1R6VA 1LK3H 3QIWA 4PJ5D 4X7FC 2FHCA 4YSDA 1U8NA 1E4KC 2KLTA 3FN3A 5EZJA 4HG4K 4A68A 3DX9A 4MMXB 4UQ9A 5DJ6B 3WN6A 2BSCA 2GABA 4XP6L 5TQ2H 1PZCA 2O6EA 3DWTA 4XXCA 2XY1A 4OJFL 2WMPB 4R9HA 5KVFE 4XAKD 1QP1A 3L7EA 5D5ME 2FLRT 2XT1B 5DHVB 2IGFL 2GUYA 5ISZB 1G7MB 1VFOA 4FYQA 4HUWB 2WGXA 1SLXA 2WLYA 4KRNA 3TBTA 2VH5H 1U93A 2B77A 4EZLA 1EO8H 4AJWA 1KCUH 5D1QB 4UYPA 3FZUC 4GQ9L 3QXAA 4L2YA 1IILE 1KGCE 3KPTA 1LDSA 2CA3A 2F8OA 1CDHA 1CFVL 1A3ZA 2VRAA 4PJIF 1IC4H 4U4BA 5JOEA 2OMNA 4Z8FL 5GZOD 1G7LB 3VDAA 3JSSA 5DMYA 2ZSWA 4WW1A 1I8LC 3WTSA 1Q38A 3WKYA 1OAXL 2XC8A 1PDKA 1AD9A 5T5NF 4XC1L 1QLEH 1AS7A 3D85B 1KV3A 4PYGA 5IBTH 4OJFH 3CFMA 1ZGLM 3K1DA 4MHHG 3RAJL 2QTVA 4NDMA 2C26A 5DVLA 1E2ZA 3EUUA 4MQTB 5EA0H 3VSTA 4J3OH 4Z3HA 1CFMA 3OAUL 2OMTA 2H1PH 1QHQA 4DGIL 1AIFA 5D7LB 5AW7B 4L3EE 4ZYKA 3L48A 3NT0A 5D5MB 1KIRA 1U8OB 5B21A 3R4RA 1I4FA 5J6GB 3Q5TA 1J0JA 1KIQB 4FG4A 5CLXA 3SD5A 3VXMB 1JZ7A 4XCYB 4NQQA 5M94B 1KXVC 1NCWH 2R9HD 2H8PA 3GSVB 4Z95L 5E7BA 4L8DA 1KFAL 4QHMA 4X7CC 1S8DA 2VQUA 3V0IA 4PJXB 1SEBB 3Q8CA 4X4XB 3NDZE 2WP3T 3T0WA 4HZ1A 5I75B 2YN5A 1G7JA 2ADFH 1UD3A 3QBTB 2X6VA 1TKWB 3OKDB 1QRNB 4XPHL 4AIEA 1KEGH 4EQ3A 1SJXA 2P4AB 4OJCA 4MCMA 3UG5A 5BZDA 3CQPA 3O6FD 3MLTB 1IGFH 4XVJL 3LY6A 1KF9B 2HFTA 3N1PC 3WTYA 1P7HL 3HOGA 4NAQA 1IC5L 1L9MA 4F7PB 2X4TA 1TEGA 2PPEA 1DANU 3N44B 4HKJB 1KGWA 4OGXL 5C0BD 5FX3A 1YLBB 1T0PB 3AY2A 4JY6A 2ADJB 4UUJB 1A6PA 5MERB 4MMZB 1RULL 3K6IA 2DQFA 4N2KA 3QZLA 4CSTA 3P0GB 4PMEA 3TJEH 1AE6L 3X13B 1E3ZA 1KZYA 4UYQA 1FZKA 4J3WA 4F3FB 5C2UB 1W15A 3ZDWA 4EZJA 1S7XA 2MIZA 4FZEH 4Y5VB 3QUXA 2WZPD 5F44A 4ABWA 3QK0A 3U7WH 1OWWA 4P59H 4PP1C 2HFEB 3NJNA 2OMWB 1GZHA 2CK0L 1ZXQA 3NSYA 4CILA 5E8EA 5K9JH 4Y5VA 3IDXL 1N4XL 3WU1A 1V05A 1CO1A 2J1YA 3C6SA 5IGXH 4FNLH 5HXMA 3I6LD 4U1NB 5GIRB 4OVUA 4WI0A 1JNJA 1MIML 3VXMD 5FO2A 3B9AA 1F6FB 3WUWG 4PI2A 5CBEA 1V5JA 1RK1A 2EKSB 3U46B 3QUKA 1ADWA 1XT5A 3L5WB 2EDNA 3QS2A 5E9NA 1YJDH 4AGPA 4UU9A 3ZDYE 9PCYA 4QY8A 4UNIA 3ZT5A 1EBAA 3I6SA 3TVMB 1WBYA 4X8JA 5E1GA 4QJ5B 4ZMNA 1EWHA 4HEME 35C8H 3CZLA 5DMIL 2AJZA 1A7BA 4H0IA 4RAUA 3NCCB 1T04A 4HUCA 1Z3GH 2P5WB 1GGBL 4QIRA 2EXYC 1PZSA 4FCAA 4FEMA 1HH6B 3II3A 1KXQA 5I1IH 3V55A 2BNQE 1FNSH 25C8L 1E4WH 2CIIA 3B2UC 3JV6B 2GTWA 4G6JH 4LHUD 4PI0A 1DQDH 2K6YA 1WBXB 2VDNB 1WC7B 4LAQH 3O9WA 5GHWL 5CN3A 2O93L 2X89A 1ZLEA 1P53A 5BZZA 1NC4A 2GK0A 3VXME 4P07A 3V4UH 5CCKL 2Y69B 1FFNA 4F7EA 5FUZH 4GEIA 4JZJC 4YHKH 4D94A 3QJFA 3G6JE 4JREC 3Q48A 2LLNA 1XZ0B 3GI8H 1GC1L 4OV5A 4JDTH 1RERA 3EBGA 2C9QA 3C60A 4F8QA 5IJKC 1HXMB 2D7PA 3QEQB 4NM8H 3CLFH 3WDIA 3TA3C 1C1EH 3O41A 5JR1H 1T66D 1UA6H 3OX8B 4N2AA 4P5TB 1MPAH 2DY2A 3P0VL 3IDMB 4GKOA 4Y4KA 5L88H 2CDEB 1YSOA 4K3JL 2H2SC 2BC4A 1FN4A 1WSST 2Y5EA 2PPAA 4DP4X 5I1GL 4R7DB 3GEWB 3C5JA 5AW4B 2IGLA 3IJYA 2GKIA 3HN5A 3QYMA 5GSVA 3I9PA 1JTOA 5J9PB 2HUHA 1YUHB 2Q9OA 4CU8A 5JUEH 5GISL 1UFGA 3AWEA 2FCBA 3WBDA 5ILTH 1AQDA 2WBJA 4IKNA 4N5UA 1U8HA 2KHAA 3E1ZA 4DKAA 2D03L 2PPFA 4YAQB 5AKRA 1S5HB 4J12A 1LVEA 1VFMA 1K3ZA 2J73A 2L7UA 3W81A 1DBBH 32C2A 4WTZA 1MHHB 1C5BH 3ZYZA 3ULVF 3VRIA 3Q01A 3EDEA 5GS0H 5GGUB 1PPIA 3F8UB 4NN5B 5F8RC 2AZUA 5A2FA 2E9BA 4OI9A 5I6PA 5HYSG 5LGJB 2DIJA 1ZVYA 3Q13A 4AENA 3QQNA 4XO3A 3ZBMA 1D3CA 3D0LB 3O0LA 2JTYA 3A6BL 1BIIB 5DVPA 4FYTA 5EDXA 2Q8AL 2Y6TE 2CJUH 3ZHNA 2HKHL 4JBSA 4GW5A 5E24E 3VQ2C 1ZT1B 1JG9A 3QULB 4EZKA 2BY1A 4FQCL 5ICXB 3MRBA 3X1GA 4IU2B 1P5UB 3HCVB 4TULH 3BMWA 2E9GA 3T0EB 3CFBA 3BW9A 4H5SA 1BPLB 4DGIH 3ZL4L 1R4XA 2P5ED 1DDHB 4QYOA 3WIIH 3STLA 2VE6B 1QEWA 4RNRB 5BRZE 1QA9B 1A1MB 4BSWA 2A9MH 4XNUL 3T2QA 5SWZA 3O3BB 1F97A 2BSED 5K9QI 4Q56A 2QV4A 2L4OA 3OTTA 3V7AE 2X4OB 3LQAL 3VJ6A 2A2QT 4AV4A 2NY1D 4BSVA 2RQEA 4KROC 3TN0A 1WS8A 3GMQA 3MJ9H 3PDGA 2QMKA 3CSYB 1P6FA 3SBWA 3GSNH 1JWSA 1DL7H 2XZCH 1QFWM 4NUGL 1ZLDA 1OZUA 3L2LA 5CJOL 1YEFH 5E8DL 5I9QB 3SDXF 2KLSA 2R0LL 1PEZA 3MV7E 4F91B 5FAAA 3U9WA 1G0YR 4GRMA 3MRQB 4FZ8L 1TZHB 3IF1B 4YUEL 4FI8A 4YHIB 4A7GF 2F53A 1FNEB 1CYGA 1JGVH 5E8OB 4B5EA 4N2IA 1TPXC 4MJ2A 2Q86B 3AXLB 3OXRA 3S2CA 2YARA 5HHMD 3UTOA 2VERN 4OT1L 4ZFFA 3T6QC 2O61B 1Z9SA 3NCJL 3R1GL 4FLOA 5HP5A 3MJ8A 3OG6B 1IKFL 4G43B 5I6XC 3H9SB 1AZZC 1SMDA 1HXKA 3ATEA 5D9SB 1G5GA 4JRXA 3EGXB 3UAJA 5F7HA 3VGBA 3CZEA 5GS2D 1BA9A 2GJZA 1U21A 4DHLA 2WIIA 2HLAA 2XOTA 4HT1H 1KB9J 2G2RA 3MUGA 5KVMC 2CRYA 2Y1AA 3HNVL 3A3YB 5I8EA 4WUUE 4Q74A 1T1ZB 4I1PA 2YPLD 4K15A 4W9CC 4AK1A 2XA8L 1TXKA 5GRWA 5J11C 3GZPA 1CGTA 3UTSA 2DN7A 3K80A 2WUBL 4ZUWA 4BE5A 3K0YA 3GSQA 2YWZA 3O3DA 5IVXB 3V10A 5GGVL 1DJGA 3VFMB 8CGTA 1R3IL 1L9NA 1X5ZA 5EZJB 1N7ML 1EGJH 2BO0A 4R8WH 5GZND 5IV2B 2VQ1A 4PLOB 5EOTB 4GG6B 3UABA 5EBGA 2YAOA 3LKPA 2IALB 2VUOA 3C8DA 3KCPA 4QRUB 5GJSL 3PWLB 4HLZG 2K45A 4XPHH 1KEGL 4GP5B 4UTBH 4FXKA 3JT0A 1XH3A 5D1XC 4K94C 2AITA 3Q6FA 3IWVA 3MRPB 4V1DB 1I7UB 5DD1H 4WU5B 2BVTA 4W9GC 4NQDB 4FABL 3H3BC 4HGWB 3D85A 2CHDA 3T8VA 3RWFA 1MAKA 3T0AA 2HTLD 1NDMA 3V5KB 1BAGA 5KW9H 4KH2A 5K33A 2VW6A 3D0AA 2YUVA 1RURH 5C0NC 5KSUB 5I19L 1NSNH 3DIFA 5K59F 3CFIC 4M8QA 2WAHA 1LO2L 1XF5A 3QHZL 5IJVB 4F93B 4LKXA 4M3HA 1F3JA 1T4KA 3IGUA 4MQXD 3V0WL 4JM2A 2LVEA 5KVEE 1Z5LB 3BIKB 2WM0A 3P02A 4EUPH 4BQ6A 2XXFA 5AYUH 5I8OL 3ARZA 4OZIE 3S35L 3UTTB 3LYRA 4X5QA 3B43A 1KULA 1X5HA 1UD5A 1INEL 1SMAA 4P9HL 2LFEA 4H4NA 2BIOA 1MCDA 2FJFA 2QVTA 3US1A 3VRLF 1DDHA 2HRPH 3ZN6A 4IIZA 4LCIH 3N0PB 3V6ZA 3F01A 2NW2A 2CGRH 5I19H 3SE8L 1N5YL 3LSOB 4XC3L 4NZUH 2EC9U 1YEHH 1FC2D 2YXVA 4FLSA 4NO0A 5JDSA 4JAMB 4CJ1A 5EUOE 1P1ZA 3JVGC 3RWHB 4BFNA 4D3CH 1HYSD 4NO0B 4NZRL 5DO8A 1CXEA 1K5NB 1KCBA 5F89A 3Q2VA 2MMXA 3EH2A 3OM3B 5D7IA 1RZIB 3FJTA 3GGWB 4F15C 4K3JH 5DD0H 1DLFL 4QXWA 3LNIA 1HOCA 3BAJA 3MLWL 3PWUB 2YZ8A 4ZODA 4H26A 2JCCA 5HGHB 2VZ1A 2OJEB 2XX0A 3FUDA 3GMPB 2W0FA 1UACL 3GZKA 3LKRB 1OGPA 4XODA 1DVFB 5IMOA 1SQMA 5IOPB 1U2YA 5D1QD 5CU5A 2HZHA 4TNWK 3KLSA 5J3HC 4P46D 4HISA 4AQZA 5EDSA 1OCCB 3VXPB 3CZNA 4UQCA 5IR1A 3OGCB 2ZWSA 4X8GA 4PJXE 3MLYH 3O6LL 5DTFA 4KQ0A 1UGNA 2QQQA 2ZSVB 4MD5B 1JF1A 3D06A 3I2CH 3E7JA 3E9TA 4KZEH 1IGIL 3A21A 4YXHH 3SOBL 4HFUH 3JVGA 1BZ7B 1EZUA 3MU3A 4L37B 1BVZA 2W9LA 4GUPA 4JY5H 4L5FE 3U2SA 3EO0A 1MRFH 4EN3B 3MLVH 1NCGA 2Y07H 3NJLA 5H2BA 1G7IA 2QR0B 4OBRA 1NPUA 4MA3A 4UCFA 4XTRD 5IM7B 4F3FA 1J1OL 3IU4L 4PLNC 4ZO7A 1CDIA 2MOVA 1DN0A 1DQLL 3L8QA 4HKZA 3SDCB 4JKWA 4ZPTA 1A2YB 1XH1A 4YHMH 3RB7A 4K9JA 4B9IA 3T3PE 2EECA 4S1DD 4LRNH 3M7FB 3TURA 1PZBA 4WCYH 1KDJA 4KY1H 2F5AL 2YSSB 2Z8VC 4DZBB 3IMTA 4DVRH 2Q87A 1E9OB 3SJVD 2HFFA 1QZ1A 3JWOC 1RUQH 3T0DA 4GFTB 2R4SL 3FQYA 4JFXA 3POCA 1DQMH 1YN6A 4LRIA 4OLXL 1EV2E 2VDRB 3NIFB 1X4XA 3DOIA 1A14H 1MI5B 3CZKA 3FN0H 3L4YA 3DO3A 4O02L 1U42A 4UOJA 3IU4H 1KT2A 4BXSV 4N9OB 4WU7B 4AQ1A 5FYJL 2IBZY 1CXFA 4HIHB 1WCBB 3I74A 3Q1SL 1WGVA 3CZGA 4I13B 1MRFL 2I60L 4KX9A 3S3SA 3VD3A 3WTWA 3QNXB 1PS3A 2OTUB 4ANXA 4GSDL 4H8QA 4BZ2H 1Y0LA 1GGIL 2NY5C 3V6FA 3UTQB 3AMLA 3GTNA 4FS0A 5D6CA 4R2GB 3V7AG 4Z18A 4X98B 3C6LA 4LKXB 4J3XA 4XCYA 3C6LD 3K4DA 4ZOEA 1JPGA 3DHJA 5HGBA 1OAYL 4NHCH 3QUZC 5SX4H 3MCKB 1XGRB 4OLVH 2UXTA 3MMEA 2QZQA 2WNWA 2EUZA 2OTPA 5FYJE 2EVGA 2KPWA 2MOGA 1OGTB 4YWGH 4AW4A 5CEZL 2ZP0T 4KV5F 4ZPVA 3OKKA 3LDBB 2CDEA 4IBZA 4IDJH 3RWEA 5EUKA 5FKAA 1ADQH 3HPJA 5F7LB 3EOAB 1SJVA 4OD2A 3N91A 1J12A 2A6DA 2HT4D 1BQHG 3P77B 1QRKA 4W93A 3UTTD 2OMXB 4KKAC 3CFNA 5K1NA 2IH8A 5FS5A 1C8PA 2XN9D 4XN2A 3SJVA 2EDJA 5HDBE 3KBPA 2XA8H 3FUHA 3LKPB 3WY2A 2WHVA 1INDL 1J05B 4AC4A 1E67A 2COVD 4TPRH 3GSUA 4L1TA 4XCFH 4M02A 1SPDA 2P45B 1YN7A 1CLZH 4HDIB 2WQVA 2Q8BH 1CMOA 3FU6A 3W2DL 2MJWA 4Y16B 1OT1A 4WSJA 3SGDH 4E0RB 3MN8A 2MQGA 1VFBA 2P46B 5EMYA 4QRRB 3UJTH 4ZOCA 4W9JC 2QGCA 2WWKT 3ZX1A 3NACH 5KW9L 1EVUA 3H53A 1AQDB 2WBJB 2OULB 4QAMB 3H6AA 4G1MA 2NQDA 5I71B 5B8CC 4HSQA 4BQBA 1V54B 5ANHA 1OWRM 4J1UB 1MJ7H 2QDVA 1BYOA 4JCMA 4PJEA 4HCGA 1U8OA 5DZJA 1AXIB 3Q9QA 5C0BB 2PW1A 3K6SA 4B27A 4KO5A 3QORD 3QPQC 4HMDA 3MUJA 4HGWA 3AY4C 2GG1A 3ILPA 1F45A 3FHQA 1S7VB 5C0GA 3KPSE 2DIAA 2HPOA 5SWSA 1G9EA 3H7BA 1J9SA 1HHJA 4JVUA 1J5OL 3WDJA 1S9XB 3LXCA 1A8ZA 2WYHA 3AC0A 1GS8A 2E46A 1CU4H 4L3CB 4UTAA 1L7TH 1MQKH 4F7KA 4IKIA 5D6DA 4XC1H 5D8JH 1I9RH 4ZTOL 4OCXL 1JK8A 2ZKHL 2NTFB 3RWDA 2NXZB 4NZFA 3BLKA 4M93C 3CXDH 3IDJB 4NDMB 2CDFA 3R8BB 1UD2A 2ETWA 1I7UA 4XNYL 5GJTL 1UZ8B 1TDQA 3IFPB 3SGDI 3FPXA 3TBCA 5BJTA 1M6OB 2DI9A 3ZMEA 2X40A 3FTXA 5DC9B 4BXVA 4LFHG 3GBNH 4PLKD 1QVOA 4KX8A 1HOCB 3HC2A 1CFSA 1DLHA 4RFNB 4WUUD 4D9QE 5CM1A 2J2ZA 1I9EA 1V10A 2HFFB 1JHLL 2JIXA 5GXBB 1KTRL 4PRDA 4NT6B 1AG0A 2MRYA 4OGYH 4JM2C 1HINH 1J8SA 3I02A 3VXOA 5DJ2B 2WQWA 2ZIDA 2VDPL 1SLUA 2OCFD 3TCLB 3I50H 4BK4A 3GNMH 5KYXA 5DRZB 3CXDL 4FNQA 4GMTH 3KYMA 1WGOA 4Z7QF 1LP9E 4GIPD 4PJIA 4AUJA 3X11B 2NNXA 1A6ZA 3GUFA 4G42B 3WS6C 4WHTA 2ZICA 5D8JL 5DRZA 3FSWA 1ADQA 2HVJB 3LX9A 5DS8A 4KWUA 2GJZB 1AR1D 1MFDL 4YHZH 1M7IB 1NEZG 3P4OA 5DZOA 1AGFB 3CSPA 4MJHA 1CVSC 2YHGA 3ES6A 5JQ6H 1DVYA 3C5ZB 2WVVA 3LHAA 1YEIL 3MV7B 5DHEA 1A6VH 1DSFL 1HE7A 3QQ9D 2HMIC 1BYNA 1IE4A 3TH2T 5DYOB 4GPVA 4YSQA 1CFTB 2IO5A 3BLBA 4JQVA 4YE4H 2VZOA 2M1KA 3HE6B 3MFFA 4NNYA 2VLKE 5J1SC 4WDIA 5CMAA 1NAKL 5D1XA 5EOCH 3LTVA 2E4TA 4UU9B 2YC1B 1U8NB 4YDJB 2Z91B 3VXNB 3BZ5A 3ATDA 1GCYA 1FL3B 4G80B 3ISYA 5E5UB 1TLKA 2IJ0C 4D0DB 2GC4C 3G6AA 1RD6A 1ACZA 1SRDA 1JXFA 4PG2C 1P7KA 1JD7A 3CVHL 2FVNA 1ZCRA 1D9KB 5I66A 5D5MF 4QRRE 4APQC 5FW8A 1HIMH 2IDSA 4HQQL 4LOUD 3UBXG 2OYLA 2Q1EA 4PBVC 4O2FB 2AJXH 1KYAA 1B0GA 4WI6A 4IJ3B 1T7VA 3TFBA 3S8GB 4L0PB 3EBHA 4R7VA 3T8MA 1U3NA 3B2UD 4M5YH 4UTBA 1YC8A 4XVUD 2P5WE 4HJ1A 4LSDA 1O0VA 4LSQH 3EJTA 2YPLA 3WNKA 4EVNB 4PJ5B 5JPNB 1DVZA 2K9FB 3ZYJA 3ZZLA 1MCOL 4YQXH 3L54A 1A4CA 4X6DE 4HLZH 3RGVD 3SODB 1KCWA 5T1MB 1R34A 3KYAA 4OZGF 3UAJD 1U8PA 1EXUA 1FORL 4JRXD 1YEWA 3BP5B 2YD4A 4N2CA 1OY3B 2W5PA 4PBWD 1TG8A 4J4PD 3HE7C 4JO2L 3H3PH 2UX6A 2WUCL 2JKWA 1XR9B 1CG9A 1Z9MA 2LE9A 3BPLC 1ZHKA 4Z78A 5DA4A 2FATH 2LFGA 4DFIA 4LLDA 2IV8A 5FYLE 1VDGA 3P73A 1IGCL 2ZOLB 5IW1A 1FZOA 4AGLA 2P3YA 4W9HC 3WGUB 2X05A 3VGAC 1RU9L 4Z78B 3PS6A 3DPDA 4N0UB 4MZRA 5CEZH 5MEQA 4JAMA 1F3JB 4X6CA 3QP3A 3SGEI 1TZ8A 4R4FH 3NFSH 1S7RB 3QQDB 3KH4A 2CRIA 1AQKH 3ZQXA 3DV4B 3C5JB 4U1IB 1PF3A 5EN2B 1VGEL 2K8MA 4MA1B 4Q2ZB 3R19A 3WAKA 5AVQB 4GS7B 3DSNA 3WLBA 3KXFB 4LGSB 5DC0A 2X88A 3ABZA 1FVDB 3II2A 3IMWA 5FUOH 4X5XB 1ZV9A 2ZAHA 3AWFA 1GIGL 4P2OC 4XN9A 5KUMA 3STBA 2DL9A 2YLHA 2FX7L 3FF8A 3V0HA 5KS9E 1H6TA 1SNRA 4GKNB 4TVUA 2HJFB 4YIQA 2OSWA 2DMCA 4QRTA 5D7SH 3IDIB 3LKOA 3U4EA 3KEHA 3KLAA 5IEKB 5HPMB 3RRQA 2XVGA 4K3EL 4CRPA 5FO7A 4MA7H 1MFEH 2B0SH 5CUSL 1P4LB 2K7QA 4NNXB 5HHME 2WC7A 1UH4A 1FVEA 4NQCD 2ZG1A 2ENJA 1UWXK 4ESKA 5JOFA 2H3NB 4NCDA 4XRCA 4PWGA 2R27A 4OY9A 3FFOA 3REWA 4ZUWB 1DCLA 3CVHA 1X9UA 4MA8L 2FECI 3D50A 3Q6GL 2YK1H 4CSPA 4IRJA 2PO6B 4FFZH 5TPWH 1HZKA 2YGPA 2NY2C 5C0JA 2FEDD 5B1KA 4PW3A 1K3IA 3QEGH 5EOTA 3TL5A 2PYEE 2Y0SA 2JLPA 3FUKA 1WF5A 4UTBL 3RJOA 1A6ZB 1YDPA 4G42A 4PJ6A 3VH8A 4ZMPA 3S8WA 2ICEB 2WBJD 4BELD 3SDAC 3AABA 3UTSB 3I9AA 4IBLT 5GGSY 1MHPH 4KXZI 4WKZB 1AMYA 4LSVH 5JLZB 3RJQB 5LVEA 1NKGA 2EDXA 5KANG 2CALA 3ZHFA 3HI6H 3HRZC 3ZT7A 2G0KA 3QEGL 3H4HA 2G9KA 4N25A 3I6LE 4IIQA 4N4YB 4OZFG 1AZBA 1HC1A 4PJ7E 4I4WA 1NUFA 2EXSA 3QDGA 4FQ1H 4TRPH 4P99A 5GS2H 2YK1L 1SF3A 3DGCR 3CLFL 4Y7MA 2IC2A 3GEFA 4M8RA 3HBGA 2ZAIA 3VFSB 2IH3B 1R3KB 3MNMA 4K23L 4AQ8A 4FQ2H 2PCFA 2KDYA 1HH9A 3QIBB 8PAZA 1N0LA 1XGYL 2VXVH 3BPCA 2VYRE 2TSAA 5KBLA 2O6DA 2IQ9H 4JZNA 1XF4B 1UASA 4KK8C 1NC4D 3CX2A 3TPKA 4PVMA 1UH2A 1Z1WA 2W0KA 2AJ3B 2QT6A 3H9SE 1X3DA 4HCRH 2CZNA 2WKOF 4TNFA 1TITA 1IBYA 4G6JL 1TZGL 2CWRA 2OL3A 3QUGA 4E9LA 1UJ3B 1A4KB 4Z7AA 1PZ5A 2D03H 3NIGF 2HJKB 1CD8A 1ITCA 1NANH 3IJSB 1RIHL 1N18A 4ANVA 1J9CT 4FQXC 4G6AD 1YPZE 2OS7A 1WT5C 2ZUTA 3U4BL 4QJ4B 4NWTL 3IDGA 4JW3A 1JZ6A 5E7FA 2QQLH 1V7MH 4ES8A 1FFOB 4DN4H 5C0AA 3IJHB 3N6YA 3D69B 5DR5L 5FHAL 4RLDA 3LS5H 3WJLA 3BLPX 3FCSB 2A1WH 4N0UA 5CLYA 1QHOA 5T3ZL 3KXFA 4QOKE 4BE6A 1CLVA 2NZ1A 2QLVB 3TBSA 2UV3A 2D3VA 3WN5B 4NKDB 3OLDA 2P1YA 4XAWH 3VFWB 5ID0B 2PETA 3X12B 3DVIA 3EFDH 4PCYA 4GSRA 1BBJB 1ESOA 3LKQA 3U82B 3UGUA 1U8KB 3H9HB 4AL8H 3LXBA 3NQIA 4LKCB 1AR1B 4J8QA 4G5AA 4KI1A 4O2CA 2YBRB 4JPKH 4P5TD 1OE3A 3SBWC 1EHLL 3LS5L 1T1YA 3RDTD 1GS7A 4UMGA 1W2KT 3SBQA 1B3IA 3A6CL 2C3HA 2HSIA 3K6DA 3OKNB 3IPEA 1X5YA 1HEZB 4BWWA 1E5ZA 1U8HB 3FRUA 2C3VB 4NWTH 2E6JA 3RVWC 3H42H 2XRAL 2XFXB 4AJVA 5I16A 1KFGA 3H55A 4ZUSB 3DBXA 3NIFE 1R3LA 5DU7A 3RHWF 1QNZH 1MI5E 4UQBA 5MEPB 5IHHA 4FLRA 2XIIA 1AO7D 2DYSB 3KG5A 4XOCA 4YSTA 4R0LA 2GUOA 4P9ML 1MG2C 4N2FA 5F7BA 2XN9B 2XWJB 3DIDA 5IIEA 2Z91A 3GDCA 1S7QB 3PV6A 4NKMB 3VXNA 5BS0E 5INCB 2N7AA 4XPTL 5BXFA 1UWXH 2ZE0A 3TJHC 2ZXDA 2L04A 4HS6B 4OJEH 4XHJD 4Y0GA 3G5YB 1F56A 2C3GA 1XB3A 2SODB 2UY6A 1FHNA 5D2LA 4DH2A 3P9LB 1OCOB 3GZQA 1S78C 4O58H 4S1RL 4M56A 3C09B 4M7ZB 4F57H 5C0FB 5IB3A 1N67A 4LLYB 4YSOA 1RK0B 1TZIB 3RTQB 3VXRB 1ZKAA 3TVMD 3G5ZA 1MCKA 4TOYH 4MNQE 5JHDE 5CXPA 1QMUA 5MEQB 3FQNB 3IAPA 4LQFL 4A7VA 2DQCL 4NQTA 5DQJA 2YQBA 2F19L 1PY4A 3RKPA 3RVUD 3WG7B 3U48A 1T0MB 1E28A 1TQUA 5IHUH 2EE6A 4AGQA 1ORQB 3QCUL 4AT6B 2QGEA 5LN8A 2XTJC 4UAOB 5E4AA 3HG0A 5TH2A 3DSFL 4AQOA 4Z3GA 4NJAH 2QEJA 4U31A 5E5LA 5E9DE 1HI6A 2BOBA 1J8HA 1JXGA 2B39A 2CG9X 4PGDA 4HU8A 3D25A 3QXDA 3OKOA 4J28A 2D31A 2H2SD 2VXSH 3PRZA 1Z66A 1FNGA 3F5WA 4G3YL 4R4BB 4HPHA 3CVBA 1E4WL 3DJRA 1G0DA 2GJPA 3FT2B 1H3VA 5H2BB 1A7NL 3PG2A 1FNEA 3VWJD 4WSGA 4GAYA 2Q86A 2LOEA 4TSAL 1U3HD 5J6GA 5ITBL 4OCRL 1NCDL 2YN3A 2HT3C 5FO7B 4OSUH 1G9HA 3PDOA 3LNDA 4KK6C 3RVVC 1KELL 1JWUB 2F1AA 4HK0B 1FE8L 4KO6A 4OGZA 1SXZA 4LASL 1OE2A 4Q4EA 5DWUL 4ZMXA 4I3RH