3ZY7A

Crystal structure of computationally redesigned gamma-adaptin appendage domain forming a symmetric homodimer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
116
Chain Sequence
MIPSITAYDALGLKIEFTFERSSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTFNWNGYKVQSEAEVNNFPPQSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-1 COMPLEX SUBUNIT GAMMA-1
publication title Computational Design of a Symmetric Homodimer Using Beta-Strand Assembly.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 23
structure length 116
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zy7A00
1W80A 1GYVA 3MNMA 4BCXA 5CN2A 2YMTA 2DWYA 1IU1A 5CN1A 3ZY7A 1QTSA 1KY6A 1QTPA 1OM9A 2DWXA 3ZHFA 2VJ0A 1GYUA 1KYDA 1KYUA 1KYFA 3HS8A 1NA8A 1B9KA 1GYWA 1KY7A 2A7BA 2E9GA 1P4UA
chains in the Genus database with same CATH superfamily
5IOKA 1BEYL 3M1OA 1XGUA 2I07B 5I8KH 1IT9H 1UUNA 3EZ8A 3LZNA 4MMYB 1JWSA 3OAYH 1YHPA 4R5XA 2W65A 3ZHLA 2BCKB 1G9NL 3MVSA 3OTTA 5C9JA 4ATTA 3EF7A 2OBGA 1RU9H 4FD0A 4MXWH 2JIXA 5HGGS 2G0KA 2ESVB 3DI3B 1NOFA 2Z91B 4H1LB 2VJXA 1BJ1J 2VDOB 2Z6FA 3KL5A 2JCCB 3HN3A 2R0ZL 4LAQL 4PWEA 1OAUH 3NCYS 3G6JF 3Q9PA 2ICEA 1AO7A 2ZX9A 3IWUA 4N0YH 3KYMB 3U7AA 1Q9OA 4MFHA 4G1EA 2CGRH 4PLOB 4WLCA 4K71C 2GJZA 4JJHA 1IFHH 3EJUA 5D2NC 4FQHA 4PJEB 3THML 1R47A 3JV0A 4GKZA 1J86A 4M03A 1L7TL 3R0MA 4XB3A 4XX1E 3ZL4L 1GGCL 3MYJA 1XD0A 3KVPA 2NRDA 1T1WA 4HSAC 4IS6A 3I2CH 4M6MH 1M6OB 3VI4E 4PP1D 4L8SB 3Q06A 4H8QA 3IGLA 2B0SL 3D0VA 5CEXA 4OCLC 4UIKL 2A74B 3QPKA 2GUOA 4AENB 5DD3H 3MBWA 3DOSB 2XBTA 5SWZD 2OQJA 3D48R 3E8VA 1OP3K 4HLEA 1W9XA 2IADA 4YS4A 4TSBL 4G11A 3LKSA 4K9JA 5I1GH 5G5DB 3MR9A 3KPMB 1KCRH 1KTDA 3KPPA 4B50A 1PGRB 5GGTL 1K5NB 2H1LM 1T1YB 2PYED 4JVPA 4UT6A 5I76B 3GGWA 3V0FA 1P7HL 3GSUA 4PRBA 2WM0A 2DM3A 2H47C 1A9EB 3IBOA 3GLAA 3QEHB 2CK0L 3QPQD 4HJ1A 4M56A 1IBYA 2Z93B 4Z7NB 2YAHA 2ZWYA 1Y1UA 5F1NA 3RJOA 3I6KA 2M83A 4QTIH 1FE8H 2C3HA 4UMGA 3FO1A 1E8YA 3RVUC 5E03A 5LDSA 1Q9WB 3F7VA 3GMPA 4AT6A 3ZT7A 1RP9A 3S4SB 2H1PL 2VR4A 4AV5A 5BS0E 2GSGA 2EDOA 5FB8B 2YQGA 3VXME 3ABGA 4YHOH 4ZX4A 4JFSA 4O4YH 2IG2H 3O2WL 4F3FA 3L4YA 1WITA 3MRIA 1A25A 4OB5H 2DWSA 4KK5C 3C2SA 3KH4A 2ADFH 3RPBA 5JXEA 4QT5B 5EZIL 3U0TA 2FHBA 1ANUA 1TJHH 5E1AB 3OKKB 3ZIMA 3L81A 3L3DA 1BOGB 4LHUD 2D3VA 1Q72H 1E5UI 4E5XB 2AW2A 2C9SA 5K9QG 5AVZB 4ZNEA 3QUML 3UBFA 1F4WL 1WHPA 1UTDA 2ENQA 2CDFA 3MRFB 4PD4K 5I5JA 3DRTB 3VA2C 2EE2A 5L88H 3KCPB 4UQ3B 5EN2B 4TSAL 3TO4C 1V05A 2F15A 5IFJB 5D2LA 3CFEB 3FRPA 1KJVA 4NXKA 2FQGA 5SWZE 4PG2C 4HETA 1UEMA 1GYVA 2BVQB 3MODL 3OMIB 5CFAA 1IGTB 2H3NA 4PREB 1K4DB 3K91A 3AM8C 4TVPH 5CSBA 2B4CL 2AJSL 3TO4B 4L18A 1NCAL 3QNXA 4P4RB 1E2VA 5CMAB 1RZIB 2R0ZH 2PO6B 3C12A 5JOPE 4LAQH 2F9BT 2J7LA 3S98A 2IANB 5HDWA 3QCTH 4WFEE 1C08B 2DLEA 4EMZA 3PWVB 1HZHH 4LT7A 4JZOB 2IH9A 4KJYA 1P5UB 2BZDA 3RWDB 3FCUB 3ARED 4AQZA 5FX3A 2ZWZA 3ZL4H 1SFDA 3SO3B 1HH6A 3GBML 2J44A 2MPAH 2PCFB 3ZE2E 2UZPA 3OG6B 4IBVA 4J2QA 3PDGA 4U1HA 1J8SA 4RDQF 3V4VL 2FNBA 1F1GA 1EXHA 5AVWB 2WXJA 1S9WB 2IFGA 2Y5QA 2B0SH 2XN2A 3WO3B 4NO0B 4NKDA 4UIKH 4PD4J 1WTLA 3CU1A 4ZQTA 1I9IL 2Y06H 5T1LB 4JE0A 1ND0A 5FO9B 1CD9B 4MD0A 2O72A 1ZAGA 1BFOB 1XB6A 4YZFF 4HS6B 2X7LA 1E27A 2ARJQ 4TSBH 5H94A 2D0FA 3DUSB 3O2VL 3OG4B 4U6TA 3TCLB 3U36B 3TA3C 5GGTH 2VXUL 4WTQA 4I0PB 3H9HB 1EVUA 1IC5L 3GI8L 3WENA 4Z23A 1MXGA 3FQ1A 3UC2A 1OCCB 1U3HB 1KPUB 4QRAA 4FL4B 4KKZA 4ES9A 4YDKH 4LKCB 4JY6B 1F2QA 1IKFL 2APBA 2WLIA 3E7JA 3TA3B 2M1KA 3LNHA 3VRJA 6PCYA 1ZT1A 1HCFX 2H0PA 1G94A 2QSQA 2V0AA 3V4PL 4AXWA 4YE4L 4YSAA 1FFTB 3ZTJH 1INQA 1I7UA 4LPCA 5TH2A 3ZKSD 3BMWA 5D7JC 5C0AD 1MFNA 1P2CA 5TJWK 3P69A 1CDIA 3O81A 3WFHA 2W9LA 2KT6A 1CD1A 5ETUB 2H1PH 4GMTH 4MGXA 3FZUC 3CDYA 1P7KA 4PV1C 4JHVA 4DUWA 6CGTA 4G2AA 4DUXA 2XKSA 2ZOOA 3O2WH 1EZUA 2QPUA 3VFWB 3RWCB 3RGHA 1U92A 2HT4C 5CLTA 3I6LE 2V3DA 3O4LD 5ESVB 4O2EB 2ATKA 4IOSD 5EZIH 3UBXB 4O58H 5GIRA 3BVNA 1LK3H 3CZFB 1T83C 4YJZL 4PGEB 5F0MB 3J7HA 1EXUA 3BPLC 4ZT1A 4PJXA 2UYLB 5ITFA 4K94C 5IFAL 1E40A 4DP5X 2PR9A 4BZYA 2AQQA 3FT4A 3V6ZA 1NMCC 1HI6B 2AK1L 5C1MB 1XIWA 3AS1A 4H25B 2DIAA 4TSAH 3BPLB 1QYGL 3WJLA 5F1OB 3OXRB 4OZHA 5BW7C 3HPLB 4P2QD 2NZIA 3DX9B 1S7SB 1RZPA 4PY7B 1XF2B 5IFHL 2BNRB 5B21A 3WKQA 3VYOA 2B4CH 4Y16C 1NCAH 3BKJL 3QEGL 3UYOD 3VH8G 4PS3A 3CVHA 1HXMA 3NIGB 1NGWA 2NUTA 3GTNA 4H26B 2PTUA 5AKRA 2HUEA 3VG0L 5I5MA 3E6HB 3VSVA 4HMDA 5FYJH 2Z1PA 2H6PA 3WEBA 2WMPA 2VDKL 4RX4A 1WCBA 3B9KC 4LLWA 3HS0B 1NSNL 3A5VA 4YHLL 1CICC 1KYOJ 5EULV 5I0XA 5HGHB 2CO7A 2F8VA 5DJXB 2L8AA 1CVRA 5L4FA 1J05B 1YSOA 4NJAH 4NYLB 4Y2OB 3RA7H 4P57A 1UYWL 1DVQA 3V4VH 5EF3A 3FQXB 4OQTL 4UYQA 2J2ZA 4JZNA 3N40P 3P4NB 3L16A 1M7XA 3CN4A 1I9IH 1EHAA 4ZFOB 3X12B 3UH8A 4JREB 5DTFA 4XNQA 3CQPA 1H0DB 5HGAA 4PJFA 2VW4A 4J3VA 2D31B 3O2VH 4N85A 1SEQL 2XG4A 3ZUCA 4ZYKB 4GT0A 1COBA 4RZCB 2Q6WA 3U82B 3CQQA 4CVWA 3QEQE 2VXUH 3C2AL 3PG2A 2BFGA 2V17H 1OALA 1IC5H 4KMTL 4M6OL 5C0ND 5IB1A 2HFEA 3FSOA 3VXOA 4F58L 3FUMA 4JJ5B 1DLHA 5MP6L 5SV3A 2LU5A 4FTVD 5SX5H 3ABZA 3ZTJG 1IKFH 3HR5B 2E8YA 5LGJB 4HH8A 4DVBA 4KVPA 3U6RA 1DQQB 1UJTA 5GS1B 1W8OA 2ZXEB 5J1AB 1JZ4A 1ZGLA 4J3OH 2QVTA 3PQYB 4EZLA 2IO5A 4CVZA 3RWHB 4S0SD 3VM7A 1JNHB 2NQCA 4HU8A 4I85A 2IV8A 1ZLUH 1TR7A 2A6IB 4Y4FB 1WE5A 4FQXA 3D33A 1DQDL 4Y19B 2XZAH 3ZE0F 1UVQA 3EO0B 3MRPA 5FHAL 4TQPA 4XI5D 5DQ9B 1IO4C 1QBBA 5E00B 1ZSHA 1OF2A 5C7ZA 5ID1A 4KTGA 1W6LA 2YPKA 3H9SD 1MWAB 2BJML 3B34A 3NZ8B 4PJIE 3ZZSA 5J0BA 5JHDB 1J8HD 4DKFL 1A3LH 3AQZA 4XN1A 1R3LB 5CAYB 5CR1A 3CUPB 1J18A 3EYFA 4UT9L 3FT2B 1Y0LB 5IK3A 5KS9B 5TE7H 1JPSL 5IFAH 2IGTA 2VC2B 3OR6B 3KM1A 4ABWA 1MCRA 1RUQL 2WSPA 3X1NA 3SCMA 4MQ7B 1NDGB 1P7QB 4HXBL 2FWOB 2V7HA 3MLTB 2AK1H 4HDIB 3RZCA 3BQUD 4JFPA 3S2AA 1Z6JT 3HOGA 1QYGH 3S37X 5J06A 2VDOL 3N3EA 4N90D 5EWIH 2RQEA 3DUUB 3FFCB 3MV7B 4ABQA 3LD8C 1CFQB 1NUDA 4L3EA 5ALBH 1S6NA 5IFHH 3BE1L 3AG1B 1GJWA 4PTUB 4GI9A 3Q6GL 3VDCA 4AK1A 4TOYL 3RIFF 3QQ3B 2JJUA 3QEGH 2AK4A 4ELMF 1G0XA 2FJHB 5DJ0B 1JK8B 4Q52A 4KQ0A 3DBXB 3VG0H 3O11B 1A6UL 4P2AA 3Q8FA 4BWTA 4HGWA 2WBJD 4KRPC 4Z7WF 2DZEA 4HCFA 4ZPTB 1Y07A 2ZNWA 1NSNH 3MXVL 1E5AA 4YHLH 1N26A 4CSZA 5JDJA 5ICUA 3K74B 1YEGL 3MNDA 4F7MA 3CSYA 4U1GC 1E67A 2FRGP 2K0RA 3GKZA 4N2MA 1HILA 4WUKL 3IXAA 4A39A 2WP3T 4LEBA 4OQTH 4G6MH 2WVVB 4G71B 2K9FB 1G6RA 1A7PH 2WWKT 3ISRA 3BOVA 4E0RA 2EEAA 1DE4A 4U1GB 1S78C 4MDJB 2N59A 1JDDA 1K3IA 1NBCA 1PY0A 1XF4B 2ENPA 3O8XD 5DT1H 1ZJAA 3SBWA 4W9EC 1N8ZB 1AANA 4L37A 2J5WA 1AZVA 2CKNA 2YRZA 2EIKB 1SEQH 2I7SA 1FFPB 4S0HA 1J8HE 4HXAL 2VR7A 4OM1L 4BKTC 5B7MA 4FQLL 2JI3A 4Y9CA 4ZQKB 2VZSA 4KMTH 4M62L 3PL6B 4M6OH 4TPRL 1A22B 4F58H 3OWEA 5C86A 3MRLB 5MP6H 5DC2A 4PEEA 4WO4A 2QL1A 3U25A 5C0FA 2EH8H 5E2JA 1SJEA 4ZS6C 1OTTC 4FQ1L 4KXAA 3ZXAC 4J3OG 5A2BA 3QE5A 3MJ9A 4ZMOA 5H8DA 5IQNA 3SPHA 3ECVA 5CJQH 1NANH 2JKWA 2PW1B 3MOAL 4XC1H 5AEAA 4D0CA 2C3VA 1LO3H 1JPTH 4U49A 4AEFA 3C60C 1KG0B 4BH7B 4PU2A 4GUPB 1CDUA 4NKOA 4KQ3L 1X9RA 1KSRA 3MV8A 1E9PB 1MG3C 1SQMA 1F4XH 3BW9B 4FKEA 2CMRL 1DSFH 5FHAH 2EE9A 5HHMD 1Y1DA 4L1BA 4AIZB 2D7QA 2JB5L 2J6EA 4U1SB 4LGSB 1Z9PA 2X4SB 2QMJA 5EC2A 5E8OA 2BJMH 4WJG3 1KDJA 4AEIL 5D70L 4CJ0A 3D85D 4DKFH 4MRCA 2XZQL 2DN7A 2H2PD 2RFXA 1NEUA 1N68A 4LSRL 1NFIA 4UT9H 3AITA 4EJ1C 3CIAA 3HMXA 2IAMD 1JPSH 2ZOLB 4K7PH 4L4TE 1GTFA 4HWBA 3TONA 4YSTA 2WGNB 2IXQB 4HXBH 4PQXA 5HD8D 4JKLA 3DECA 2WZ5A 2X4NA 4KXCA 2JFCA 3RX9A 3U4KA 2H4EA 4GKNA 1IM3D 1V3LA 1I8IA 3SY6A 3PRZA 4FHKA 3O6MH 1U95A 1B4JL 1RZKC 2X4TB 3MRHB 4H1LH 5FC9A 4YN3A 3VFRB 4OI9A 4Z77B 5TQ2L 3GI9L 3FH5A 2P5WB 4HUWA 4MCMA 2Y7QA 1FZMA 2NMSA 4JDEB 4BELD 2OMZA 1HYSD 1NPJA 4BE5A 5ITBL 2BOLA 4HP5A 3B83A 1A4KA 3MTRA 4DEWA 2VSMB 3Q6GH 2R69L 2YD0A 2Q86B 4TOYH 4QCIA 3BAIA 2EKSB 1HJCA 3QA3B 2D9CA 1A6UH 2BSTB 2X05A 1ZS8B 2CUMA 2VZ1A 3SN6N 3HRZA 4LCUB 1OF0A 2CDEA 4DKDC 1YEGH 4RBPH 2O1AA 4IK7A 2DF3A 4NM8H 4A7SA 1UA6L 1EHNA 3EO1A 1KNOA 4P2RD 5AAMA 4S0TD 2R7EA 2WXPA 1ETJA 1QI4A 4MJ5B 3LPWA 4OVVA 4WGVB 5HHME 3FQRB 2Z31B 5F8QC 3ZDXF 2DQEL 2YRBA 4PYGA 3UTSB 5LUMA 4J3WA 1XF3B 1S7TA 1RK1A 1HHHA 4G5AA 4ESKA 3MV9A 4Z7AA 1GW6A 5HDRA 3MRNB 1A4BA 1QZNA 3VFVB 4HOXA 1G84A 3F6LA 3QXAB 1HHJA 3VFGH 1YEKL 2YXFA 3TBYB 1GMEA 2DMKA 4OM1H 1XGUB 2XWTA 4FQLH 3DBSA 3K2KA 1YN7A 4B9FA 4TPRH 1JWSB 5FA4A 4NQDD 2VMEA 2W65B 1J88A 2QR0A 2ICEC 2Y36L 5C9JB 3IS0X 1F0LA 1L4IA 2QPFA 3PXLA 1CXHA 1J87A 2NZ9D 4FQ1H 4Q9RL 2JIXB 2HJLA 2VERN 5DVOA 3JV6A 4CSPA 3T6QC 4WJKB 3MOAH 1Q0EA 5L2KE 4JRFA 1AO7B 4IHOA 4ZMYA 1Q9OB 4G1EB 1D5ZB 3S5LB 3NDYE 4XXDB 2FX9H 4BK5A 4XO3A 3ASOB 3VSTA 4F9PC 1BD2D 1AKJD 2GBAA 4L8CB 4FQHB 5I9QC 2OSWA 2P44B 3UYRL 3DPDA 5DO8A 2CMRH 1RJZA 3T3PB 3UMTA 5CIPA 1LYQA 2QGBA 3L9EA 1QFPA 1S9VB 4IS6B 2CRIA 1XSKA 2JB5H 2FVNA 3D39D 3L45A 1X5MA 1A4AA 5T33L 4RBPK 3P11L 4DIXA 3QIUD 4AEIH 5GJTH 2UZYB 3D0VB 4Y1AB 2OX5A 2XZQH 5CLXA 1H9VA 4B9PA 5A2JH 2GUOB 3MV11 4LSRH 3B2MA 3EJSA 3A21A 5DZLA 2BY0A 2IADB 3HE6A 5BRPA 4JFDE 2K7PA 4P2RE 2Z92A 4JO4H 1KTDB 2ROYA 2OMUB 2GY7B 3NH7L 5JIQA 4XN5A 4H1LG 2EYSA 1KIRA 3BAWA 1G7PA 3AQYA 4U0RB 3VGBA 3EJJX 2IPKA 1CWVA 1GGIL 4L8DA 3GGWB 1B4JH 3SKOA 3GSUB 4PGDB 5TQ2H 4P5TC 1SM3H 1BMWA 4R7VA 3GUTA 1C5BL 4X6EA 3MRKA 3IGKA 4L5FL 2CPCA 1JD7A 1ZA6A 5ITBH 2YA0A 1MOEA 5FUZL 4OLVL 3C09C 3FT3A 4FLOA 4TLUA 3DTUB 5ICYB 1CF1A 4JRYE 5F1NB 3GIZH 3LPPA 3I6KB 3RTQC 1IM9A 4X4ME 3KLDA 5J13B 2R8SL 4KITB 3F7VB 3K80A 4N24A 5DFVC 4N3UA 1FFQA 5JXEC 1GYCA 5CJ5A 1FDLL 1XTLA 4PJ5E 3BP6A 1WISA 3NEXA 3MRIB 2B77A 2XI9A 4KAQH 1LO4L 4Z0XA 3PHOA 4IMKA 1L3NA 4ZFOL 3HZVB 2ZTBA 5EOTB 1UA6H 5HYJE 3PYCA 5KYYB 1S9XA 3KNBB 4JCMA 5I5IA 4KH2A 4XBPA 4LARH 3L3DB 4LASL 1UWXK 1QOKA 2LT9A 2D7PA 3ILQD 2FEEL 2E9JA 2ZXGA 2DQEH 2R27A 4WVRA 5PCYA 2B9BA 2G2PA 3N0AA 4JY5L 2MQ3A 3JYCA 2CDFB 2BOBA 4RAHA 5C0IA 4RGNB 5ACZB 5I6XC 5DA0B 1YEKH 2X1PA 1X3DA 1NEPA 1NDMB 3QC6X 4NFDA 5D2LB 4B5ZA 4NC0B 1KJVB 2BS9A 4KKCD 2CJUL 4HUUA 3CBJB 4TUUA 5E94B 5IY5B 6FABL 3AUVA 5D7LE 4LCVA 1YZZA 4Q9RH 2V33A 5F9JA 2R29A 2R2BA 4MA7L 3QARA 4QTHA 3HC0A 2AQTA 4RRPA 3U46A 3BSZL 1IVLA 3N2JA 2QVFB 2VDMB 3EOAA 1B9ZA 3QP3A 2Y2YA 4QEGA 3SGDH 4KJYB 1MWAL 1G7JA 3BT0A 1RPQA 1QTPA 3IJ7A 3F00A 1T5KA 4E5XG 4AEHH 4G8GD 1AXTL 1KXQA 1SDYA 4R90L 3S0PA 3UYRH 1OAZL 1HH6B 2XXFA 3BD3A 1FSKC 4MHHI 2NW2A 2WW8A 1QRND 3Q5OA 4PTTA 3WEAA 3D06A 4PS4L 5DCCA 4RLDA 2X09A 5DD1L 2VC2L 5T33H 4APQD 2R2HA 3K8KA 3MMEA 2H32A 2OMYA 3F01A 5FYKL 4NT6B 1WAAF 1FSKB 1QLFA 3QJHB 4XOAA 1J48A 1NWOA 2GCYA 3CTTA 1FVDB 1DVFD 1XL4A 4LIQL 4I1PA 4UTCA 5BS0A 4MD0B 2C5DC 2X7LB 3VXMA 1E27B 3MRGA 5H94B 3G5YB 3PNRB 4A38A 3MYZA 4PSPA 2BSRA 3LTVA 1NIEA 4Y7MA 3NH7H 2E86A 2ITCA 2N1KA 3WMPA 4Z1PA 3FYIB 2BP5M 2O5XL 2X53A 3CDFA 3WJJA 3US0A 4ODXA 6PAZA 1C5BH 2AITA 4L5FH 1SLUA 5KG9A 5J89A 2YGNA 3PABA 3VRJB 1QSEE 4XB7A 4OLVH 1KACB 4DP2X 4AXWB 5HYFA 4Z7VF 3ARSA 1N0LB 5CU9A 3R7QA 1I7TB 2QADB 2VB5A 1ZXQA 5DJ2A 2AHIA 2VABB 3DX7A 5TH2B 1U6AH 2R8SH 2JQZA 1DVZA 5EEZA 3CFQA 2YAFA 5I2IA 1BZ9B 3MSPA 4AGNA 4EN3D 1IJNA 1NBYA 1P7KB 2WXQA 3QRGL 4GI8A 1AGBB 5SWZA 4LP4A 1YO4A 4UIMA 1JZHA 4Y9EA 2F1BA 4X7SL 1R5VB 2VO8A 1LO4H 1U92B 1OSPL 3N50A 2V7NB 3CXFA 1CFTA 4PJAA 5TDOA 3HN8A 4GG6E 3EBAA 3NG5A 2PYEA 2XWDA 4PWJA 1BX2B 5AW3B 5FYLD 2XTLA 4GH7B 1MCOL 1T80A 4GAYA 4G8GE 4YDLB 4LASH 1XIWC 3DROA 2A6DA 3P0GB 3P3TA 1A0QH 1EXUB 4CL7A 2HUHA 4PJXB 5KZCD 4AQAA 3E3QE 5ITFB 4JDTL 4YQXL 2ICWI 2CLRB 1PCXA 3LH9A 4XBMA 4OFQA 1ZLEA 3FT4B 5FCUH 3V6ZB 4FFZA 2ICCA 5I0WA 4Q6IB 1BQLL 1IAIL 2QHRL 4OZHF 3CZEA 2PP7A 3PP4H 3VRIA 3EBIA 3VWJD 3L3HA 2UX6A 3DPBA 4WI8A 2MCAA 1UFUA 4MJ6A 3GZKA 2NXZC 4XTRD 1WT5A 3TIDA 2W0FA 2E75C 4RAVA 3OR7A 4UU9A 2WQXA 2O61B 2Y5EA 4RVBA 2FSEA 1HSBB 4MA7H 1ZWIA 3L5IA 2NUTB 2OLDA 3T5WA 4ZW8A 1K4CA 4Z7QF 1IE4A 3BSZH 3UBXG 3ZRCC 3ESOA 2ED8A 1ONQB 1EQWA 4LHUA 4H8PA 3SKNB 2WMPB 2I9TA 1MWAH 1FNEA 1WCBB 3C9NB 2NYZA 1G6VK 5I28A 4WK4B 4GBXD 4IBZA 5KVDE 3IGAA 4I88A 1FP5A 5DVKA 4EKJA 4OD2A 1OO2A 4GP8B 1PQZB 2N7SA 3WI9A 3P02A 4H13C 5CGYD 5DD1H 1KUMA 2VC2H 4CMMA 2J2ZB 3RLSA 5FYKH 2QPEB 4GS7C 1KCSL 2HMIC 1R24A 2J3SA 1T5WA 2YSSA 4PJFF 1Y6MR 3NJJA 2IPUK 4GFXA 4NZTH 3QR2A 1TQUA 3WNJA 1NUFA 3DMMC 3DVIA 1VFMA 4PJ8D 5HGBA 2AFNA 2PNDA 3K6FA 4R84A 2Q6WB 1PNDA 5I1DA 3SDDD 2WNKA 2VN5A 5EZPA 5DHYB 5F9OH 3B43A 1U2YA 4PJGE 3FAXA 4PGCA 1RZKL 3ISYA 2BZ7A 1GPOL 2BWIA 2O5XH 2HFEB 3BH8A 3ZE1F 3VXOB 1G43A 3AREA 4U1KB 5IB1B 1DLHB 2Q1EA 1H19A 2EVHA 4YHYB 2VYRE 2CXGA 4MMXB 3QRBA 4L3CA 4JHZA 3QDME 4OAWA 4DVBB 3U6RB 3C5ZD 3DWTA 3BH9A 3NQIA 1DBKL 3VM5A 5H37H 4KHTL 1AC6A 5HI4D 4CVZB 1R9FA 1U3ZA 2YLHA 2DBLH 2H8PA 3QNZA 4FQXB 3QRGH 4PWFA 4HJSA 4X5WB 5I8CA 1TZGH 2CHDA 5IB2A 1UVQB 3MRPB 2F54D 4X7SH 4WKXA 5TF1L 3M1CA 3IAQA 2O5NA 2J8OA 2LQRA 3HVNA 4HAFA 4WFGD 1M3JA 1OWWA 3L1OL 3WLWC 5ID1B 1MW0A 2GB2A 2AJUH 2JJWA 4PJBE 3PIQA 3GXIA 5IHUL 1XDTT 3ARXA 1MCOH 5F0JB 5MHSE 1IAIM 5GGQL 1AQKL 3RZCC 3ULUD 1XCQA 2XC8A 3F7KA 5MI0B 4HS3A 4JDTH 4YQXH 3ULVL 5HJ3B 3IDGA 1XSIA 2AQ2A 3SCMB 2A0LC 4UQ9A 2FYYA 5L7XL 1FF5A 1O5PA 5I71B 2V7HB 3FB5B 1EO5A 3J07A 1IAIH 2E56A 2X70B 3K4AA 1F41A 2YXMA 4ZUVA 4PCTA 3P30H 4K7PX 4MAYC 1OB1B 3KW8A 2DW5A 1NQBA 5C0CD 3B9AA 1LDSA 2I27N 3HHRB 4ORZC 3HG4A 3AS0A 3W56A 4G80B 4MYWB 2ZKWA 2Y23A 4P5MA 1UACL 3X13A 2J88L 4DP0X 4Y5YA 5DRXB 2WLKA 5GISH 4JFFB 2DTSA 1XBRA 2AK4B 3O4LA 4R0LA 2J1ZA 1L0QA 4IOSA 4XVUC 2WQSA 1OAXL 2PXYC 4CW1A 4K3EL 4FOMA 1U36A 4BZ2A 5JIPA 2GQHA 3QEQA 2V4LA 4LPUA 1ET7A 1N5YL 2VWEE 3CFBA 4QR7A 1JI2A 2OI9C 1AGEA 1EBPA 3CZLA 4Y4KD 1HT6A 1TTAA 4LDEB 2EXSA 2YMTA 4X9HA 4F7MB 2GJRA 1YEFL 4DZ8A 1D6EA 1LP9F 2ERJB 2F5AL 3AS2A 3SBWC 4NENB 2OI9B 3IXAB 1U8OB 3N6YA 2IWKA 5L4MA 3I02B 4P2QA 3H1ZA 1G6RB 4E0RB 1N67A 3RNQB 1KCSH 2AAVA 1HQRB 4HISA 4IU2A 5JW4M 1IEAA 3P4OA 4UT6L 5IWLA 43CAA 2XWXA 4HG4K 4K3JL 5JDSA 4QRTB 3QIWA 3WFCH 5DJCA 2NXYC 4WO4C 2NT1A 4BD4A 1WZKA 1H3GA 3NCBB 4K3DL 4EKXA 5I8OL 1RP8A 5LNEA 3ULUE 1FLRL 2C9VA 4J4PD 2XPGA 1NLDH 1XXDC 1GPOH 1WDAA 4PJIA 5BRZB 2W0KA 2NXYB 2D3LA 5C0FB 2BHYA 1SJEB 5CBAB 3T3ME 1JPGB 3WAKA 5H37G 3O41A 3Q3GB 3HE7B 1M7UA 2OMXA 1NJ9A 1GYAA 5C0GA 4AJYV 4PRID 2DLHA 2NY1D 2VUKA 3T77A 4KHTH 4XN7A 4W6WB 4AIXA 3KWTA 3OLIA 4O51A 5EOQH 3WS3A 5GZND 3T0WA 3LPGA 4NKOB 3MV8B 3D5OF 2YJLA 3C5XA 1QW8A 2CLVA 2CRMA 3QXDA 3OAZH 1CLYL 1GYUA 2P3YA 1U0QA 2IDSA 5LG1A 5TF1H 3MN8A 4BH8A 2W38A 3QS2A 2ORBH 4P9ML 5D1ZD 1I82A 1OL0A 4R97B 5CBEA 1SOSA 4KXBA 5E8OB 3HUJE 4EI6A 4HG4J 1MRFL 4HK3J 4KKLD 3RVTD 1AQKH 3KGUA 4FTVA 3A0OA 3BO8A 3NACH 4M4PA 2Y4SA 4JHWL 5E1QA 1NFIB 3ARDD 4C4KT 2H0EA 3CFJA 1Z9SA 3ULVH 1PYWA 2ARJB 3FQ2A 3R1GL 3ASNB 3QJXA 2VLRD 4KTEL 1ZIAA 3M86A 1XH3B 3CZUB 4H0IA 2X4NB 1QFWH 1I3RA 4JFWA 1DSWA 5JORB 4GKNB 3GRWH 3H55A 4V1DB 5CZVL 2B1AH 4ALAH 5L4JA 3KLAB 3ZYZA 1OP5H 4DVRH 2VDQB 3LZLA 2Y7QB 1FZMB 2Y9RT 2EAEA 1D9KD 1YJDL 3DHJA 2VDML 3B3IB 2J88H 3K6IA 3JWDC 3RWGB 4QCIB 4ODTH 1QI5A 3DK0A 3WG7B 2XN9B 1AS6A 4S10A 1OAXH 1MREH 1J8HA 5EOCJ 1OSZA 4K3EH 4MCYA 2BDNH 3PUCA 4WSKA 4ANVA 3SBRA 2K45A 1BM3L 4MMZB 5AAMC 1IGCL 3HRZB 2ICWA 2V2XA 1JXKA 1RJCA 1G7LB 2GIYA 3GMNB 4GLRH 3FB8B 4S1QL 2CGZA 2J1XA 1IAMA 2BY1A 1YEFH 3OAUL 4MXQC 2A6KA 3OAZK 4MA3B 1LQSR 3BQUA 2YD9A 2OTPA 3GS7A 2R7EB 3KWVA 4HHAA 3UTTD 3FCTB 1Z1WA 3HI6L 4FXGA 4UQDA 4TL5A 4DN4L 3K1DA 5DURB 1MCWM 3QW9A 1PLCA 2PCXA 4UT6H 3EYQD 2FLMA 1SJXA 4K3JH 1S7TB 1RK1B 1HHHB 1UM6L 3QIBD 1T4KB 3BFOA 4AH2B 2KZ1B 5GRXG 4K3DH 5GGVY 3BWAA 4WUUB 3HIZA 4F7EA 3DSFH 1BZEA 1FLRH 1PZDA 4QHKJ 2Y6SD 4S1SL 1F6FB 2FBJL 2WBJA 3FO2A 4MD5B 4NQUA 4NWTH 4QYAA 1FQ9C 5FA4B 4LP8A 3GO1H 2DMBA 3U4AA 2QR0B 2AS5M 1ZT7B 2MFNA 1CXFA 4PI2A 5K39A 3UC0L 5E8DH 3S35L 2NYYD 1NKOA 2VN6A 3QFJE 5BCAA 3OKMA 2HJLB 2X6UA 4FLRA 4BK5C 1J0IA 4K9EL 1CFVL 4L4TA 3SDXE 3JV6B 4JFVA 5F88B 2VW7A 1KJ2A 3G5WA 5K59F 1RXLA 4KKNA 2VQ1A 3N43F 4I9WD 3CPUA 1UGKA 3I75B 3BHBA 3D09A 1T6VN 4AM0Q 4OGAC 3GHPA 1F11B 3L17A 4TVPD 4KC3B 3O8XA 3QJVB 1QWHA 1E6JH 3OJMB 4P23C 2MNWA 2JJVA 5JHMA 1GZQA 1FZKA 2GBUA 3FU6A 4G5ZL 1A9BA 4G6AD 1G1YA 3Q8CA 4Y88A 1YQVL 5FECA 4BINA 4P9MH 1M9WA 4E9XA 3G9VA 4IKJA 2EVIA 1IGYB 3IU4L 4GQ9H 3WKMH 4QF1B 3HE6C 3ML8A 2VR6A 4NN6B 1MRFH 2PWDA 4LLQA 2OX5B 1N7ML 5KSAC 3GJFA 4Q6KA 4FEIA 2CDGA 3S96A 3W3BA 4JHWH 4ENED 1O9VA 5CCJA 2VT0A 5DSCB 4E2OA 3PP3H 1HU8A 5AYUL 2EILB 5HYSA 1MDTA 1OAJA 1TO4A 3JTBA 4KTEH 1QQDB 4D3CH 3NVQA 1A7OL 1A1MA 2E6PA 4B7IA 3UTTE 2EYSB 1KZYA 3IFOA 3MGOB 3WNIA 1YPZE 1N3NB 5ICXB 3S5ZA 2IPKB 3VB8A 5EIQA 1AR1C 4Y0GA 2KQNA 3SEPA 2CG9X 3SKOB 1A47A 3CVHL 1GIGL 4OLWL 5FW8A 1L9MA 2NX5E 3R4RA 4UUJB 3S5LG 4X6EB 4CADB 3MRKB 3GUTB 2NUPA 4JO2H 4LVHC 3QDJE 3L5XL 1YJDH 2CD0A 2VDMH 4MWFA 3FT3B 1WV7T 3SKMA 1QSFB 4HGKC 3RVVD 3WFBH 2IVFC 2X6CA 3CK0L 3TNMA 1F5WA 3UBHA 1WS8A 2PW2A 3D85A 2V5RA 3FK3A 1KV7A 1CE6B 1SHWA 2QFRA 3TYGL 5EU6D 4OCRH 2F19L 1BM3H 1O5DT 1PIFA 5E6IB 1IGCH 4QPEA 2IAMA 1R6VA 4N22A 1TFHA 4S1QH 1NCWL 1AY1L 5GSRB 1TNMA 3PHOB 4FRWA 5EF2A 4MJIE 4HUVA 1X7QA 5JQ6L 1CXEA 5DD6A 5L2JA 3R06A 3H4FA 4NNYB 3WE6B 1JGEA 4WIQA 5JXAL 4QRPB 5MENE 1KIUB 1S9XB 2OP4L 1H8LA 2X41A 4XBPB 2JMRA 1UXSA 3HI6H 3TEYA 4M9OA 4Y9GA 4OGXL 1RVFL 2R1YA 4I89A 2NY4B 3ATAA 3RWIB 3TVMB 1CBVL 1P7BA 2GHZA 4N6QA 1FC2D 1UM6H 2BOBB 4ZZKA 3VI4F 4FNPA 3BP7A 4JFEE 4S1SH 2ZG2A 2FBJH 2N7AA 2X40A 1ZCRA 2FIKA 4W9KC 3S3DB 4BA0A 3QXUA 4HUUB 3UTQA 3GSRB 3ZTEA 1WFTA 4OCYL 5DZOA 3IF1A 3S35H 4RFNC 1JZ5A 1I1AB 2E74C 5SX4H 3ZKXB 1FNFA 2J8UE 3ZY7A 1MCDA 2R2BB 4JPIB 1CFVH 1ODAA 2BC4A 5EFIA 4QXTB 1JMXA 2EH7L 3HC0B 4P2RA 3NSJA 3KWXA 4G7VL 4M4RB 5DRZB 5CS7A 1KF9B 5C07E 1T2XA 3MJ6A 2H3XC 5GZOD 3UOAB 3EOAB 3LMJL 3DX6A 4NFCA 2QQKL 3QBTB 4LMQE 1HCYA 3CCHA 3S3PA 3QG6A 1NTDA 2IBGA 4PW4A 3VE0A 3O0RL 4ZX6A 3S3BB 2E9WA 3MROB 1XR8A 3N42F 4PTTB 1YQVH 4L29A 1DN0A 1AD9A 1CO1A 1NPNA 1UATA 4JRYA 3HA0A 3UEZA 5FYJD 1YECH 3K6SB 1JIBA 2BPBA 3D9AL 2KZKA 4RISH 5IIEB 1JRHL 1YNLH 3Q01A 5M7QA 3KPQB 7PCYA 1QLFB 3GMQA 4GSUA 2GCYB 1DQIA 1H5BA 3T9WA 5BXFA 3VGGA 1VPOL 4JBSA 3EG9B 2B3RA 4X6DE 5FO8B 5AYUH 3SE3A 2WKOF 4PJ5A 2QT6A 3BFWA 3BN3B 4QUOA 3ETTA 5LO7A 3WJJC 1FAKT 4AQEA 2BSRB 5FGBC 1SBBA 4JQIL 1TZHA 4FMVA 4RIRB 1KGJA 3ARZA 2ITCB 1UWEL 1VFAA 1MEXL 5EZJA 2GFBA 1J0ZA 3TJHD 4JUSA 3BD4A 2DYPA 4OKDA 1KXVA 3KE0A 3T2LA 3KPRD 3MRJB 2W88A 1JYXA 1GIGH 4PP1C 1FNSL 4OLWH 1BD2A 1AKJA 3BZ5A 1ZS2A 5F89A 4ODXB 1Z66A 3LYRA 3GSXA 3EHBC 1E3FA 4E9YA 1NWPA 5D8JL 3ARGA 3VQLA 1OQOA 3D39A 4OBSA 4UANA 3LEVL 4JFXB 5DD0H 2V2WA 1E4XI 1XQ4A 3QIUA 4TUJA 2CJTA 3CK0H 2CQVA 4LOEA 1U58A 3T0XA 3TYGH 4RA0C 3ZGIA 1NBYB 2F19H 5BMFL 3MNZA 3TJEL 1KY6A 2ZYSA 4RDBA 1OQXA 4UIMB 1G6RL 3F7LA 4XCEB 2UWEE 1NCWH 1AY1H 3QORD 1BJ8A 3QR1A 4J3OD 4X6CE 3MRMB 3KDMB 4U6VL 1CFTB 5JQ6H 3QPQC 4PJAB 5TDOB 2HFFB 4OKVA 2AC0A 1KB9J 1A7RL 2PYEB 5ENWB 5JXAH 5KSBA 1K72A 2OP4H 3T2OA 5IVOA 3ZQ9A 5BOJA 1FNGA 4ZS7L 2ZX6A 2XSKA 2YD2A 2A6DB 2P8MA 5DHVA 4WZ9A 2O6EA 2CO6A 2ZP0T 1CBVH 5HY9A 3ZYJA 3W38A 2A9NL 3ZE2F 3RFZB 3U46B 1RUKL 1GRWA 5HHXL 2NR6C 4ZODA 3WFZA 1UH2A 3MJ9L 5CJBA 3AMKA 3VXNA 2VSKB 1OGTA 3VRIB 1RUAL 15C8L 1DJZA 4WKZB 5EPMA 3RI5F 5F7BA 5HDBE 2X4UB 3DPBB 2ZG3A 4CSSA 4TLSA 3EYVB 1BFSA 4OCYH 3RKDD 4MJ6B 3KS0H 3FF8A 1AHWA 3K6NA 4R4BA 3TIDB 4RAVB 1YC7A 4UU9B 4HWZB 3M8OL 2FSEB 5AOJA 1ZXKA 4IRZA 1F42A 4KGJA 1DQMH 3ZZLA 2EH7H 5I1KL 3KPRE 5DFWH 1TLMA 1JXGA 2NTFB 4G7VH 2XVGA 5I16A 3ZHNA 1K4CB 4HF5L 5FM5O 2NSQA 3ZVVA 2J6EL 1KCLA 3MKGA 1SY6L 3H3PL 5CJXA 2QQKH 2I9TB 3AT9A 4Z3IA 2PWHA 4QJ4B 1QFUL 3O0RH 4A04A 2JKXA 3CN1A 1YG9A 2W9DL 3IGAB 4U1JB 5E95B 2DWTA 4H88H 5J6SA 5F7FA 4RFOL 3HMXL 4JUTA 1D7BA 4HUMB 1JCVA 2AXGA 3D9AH 3ES6A 1JRHH 4CMMB 1I4FA 3T0ED 1LO5A 3DURA 1R24B 4V33A 1T5WB 4PVLA 3O3AB 4DOHE 5CGTA 1J9SA 1SXBA 1RIVL 2DPKA 5HGBB 2DQFA 3NIDB 2IWFA 2KYIA 3WN6A 3AREC 5C9KA 3AFLA 3SQBA 4L9DA 5I1DB 3P0VL 4JQIH 1JZ7A 3HZMB 2QKIB 2HCZX 1UWEH 1PF3A 3QJRB 1MEXH 1UGNA 3UX9B 3NJVA 4GG6A 4QIRA 1XZWA 3GT6A 4IBTA 5D93B 1FNSH 3GXDA 4DGYH 3RAJH 5K9QI 3DDFA 4QRBA 4G8GA 1WSST 4PRPE 3ZE0B 1G87A 2WYIA 5CFHA 5FUCC 3FQYA 3N40F 3OV6A 1QRNA 2VR8A 4KXZH 4OAWB 5D8JH 3LEVH 1ORSA 3D0LB 1CR9L 5GJSH 3Q8AA 4APQA 5BVJB 2HX8A 1MLBB 4UTBA 2ADIB 2PTVA 3Q7JA 4AM0A 5TD4A 2VLJB 4KK9D 2H8PB 4ONHA 4WTZA 4LOUD 2M2DA 1DVFA 1D5XA 2Q10A 5BUPA 3SOBL 2VZ3A 1R5IB 4JFUA 2P8PB 4YEFA 2A3TA 3TJEH 5I8CB 5DR5L 4QHLB 4LXFA 2F53E 2XWEA 4EZKA 4CVXA 3ZN6A 2D3JA 3GSWB 4U6VH 3TV3L 3QZLA 4Z18A 2WIIA 3B6SA 3V0VA 3TBTB 2KPNA 4ZS7H 2GEQA 2MCPL 1HKLH 5DEFA 4N3TA 1XCQB 4QWWC 3TWCL 1AGCA 3ZDYE 1D2OA 1UD5A 4WI5A 3L6FA 5I66B 3KVQA 1Q9KA 1U8CB 1JG9A 2YD8A 3IDGB 4GAJH 2EUZA 4Z78B 1NCIA 3MZTA 3GEFA 2FYYB 4J7RA 5DMKA 5C0AB 3G5ZA 3HLAA 1RUKH 1NCGA 4ZUVB 5HHXH 4NO2A 4Y5YC 4HKJB 2Y3AA 3MJ9H 3MRCA 3WTUA 1BV8A 1RUAH 15C8H 4R0LC 2WZPA 4EN3A 1ZY9A 3RIAF 3RNKA 1MHHA 5A1AA 5EUOE 5JIIA 2W0LA 1Q1JH 2ZOTA 3IGUA 1BVOA 4OV5A 4P5MB 3CZSA 5F7MC 1S3KL 3DDGA 1IARB 1EK3A 3M8OH 3OXSA 5DO2D 3O4LB 3DO7B 5MEPA 4LVOC 5I1KH 3NZSA 4KK8D 2WLJA 1ODUA 1WRFA 4CKVX 4Z76A 1MJ7L 1YYCA 2YK1L 4HF5H 4YDVB 4CW1B 3ZYIA 4W9LC 4WSGA 4U05A 2QPDB 3IPBA 3U9UB 5FDWB 4N2GA 1OAQH 1SY6H 2OR8A 3H3PH 2KS0A 3BIBX 4PJGA 4UWQB 3WLBA 3GM8A 1BBJA 2CM6A 5FM8A 1AGEB 1W72A 4EXKA 1UD2A 1QFUH 2DQHL 2AKRA 2JI2A 3VWKD 3BUDA 2FBOJ 1VGKB 4A2GA 2BFVH 4NQCE 5DUPL 3UEQA 1JGLL 5CUSH 4ORGA 3K81A 3N91A 3O9WD 3S48A 3HMXH 3OHXC 3U30B 1OCWL 5ANHA 4E9VA 1HX0A 3QIWC 3SPGA 4WV1A 5FUOL 2E5EA 3MJ8A 1E90A 3GSOA 4P2QB 3VWJA 3K71A 4Z7UB 4ZTOL 3LN4A 3AG3B 3P4LA 1KMGA 3WHE0 1EERB 3FYEB 4J1UA 4OBRA 1LWRA 4IU2B 1LO0L 3WIFA 1IEAB 3P4OB 1LD9B 43CAB 2NY6C 1RIVH 4HIJB 2VDQH 1IAOA 4QRFA 4WFFE 5K9KB 4KTDL 5DJCB 1A02N 3JWNH 4JHAL 3P0VH 1CS6A 4N0CC 4M1CD 1N0XL 4FYTA 5E6ZA 4PJIF 3U4EA 2JLPA 5F3HA 4OFKA 2XPGB 1RZQA 4PJBA 3SPVB 4W70A 2FGWH 2YBGA 4TNGA 4JPVL 1AYOA 1JNLH 4TQEH 3OX8B 1THAA 5B7EA 4ONFH 4BFOA 3II1A 4FTDA 2WYZA 4GRMA 4K8RD 3JTSB 2VXSL 1X5HA 3O41B 1DQVA 2OMXB 4ILDA 5KYXA 2WIMA 3T77B 4R7NA 4PI0A 3FC8A 3RYMA 4FULA 4WFHE 3SGJA 1BEXA 5GRUH 1IIKA 1P6WA 4XZ4A 4KZEL 3GDBA 1BXUA 3OD3A 3E1ZA 4JFYA 3SOBH 3INUL 1P9MC 5DR5H 3WEXB 4JZJB 3QXDB 4PJ8A 3BKCH 4AL8C 2ESVE 2CHNA 2JCCE 1SHSA 3SDDA 4BH8B 4HBCL 3TV3H 3IJHB 4P0DA 1ZLWH 3NRPA 5CBEB 2P80D 3WN5A 4BFFA 3IK2A 3M46A 4EI6B 4H8VA 3T09A 3FH7A 3BUPA 4RGOL 2MCPH 3ARFA 5CHNB 3SD5A 1K2DB 2X4PA 1BW8A 4PJEE 1CDHA 4FTVB 4HJJL 2DM7A 1AD0A 4G8EB 3CFJB 1Z9SB 5I0VA 1PYWB 5JW3L 4J39A 3D1MC 3UADA 3X1FA 1NCBL 3DTXA 3KJ4C 1YNKL 2FEDC 4RFEA 4JPKL 4TVUA 5LGHH 1I3RB 1MCJA 1TXKA 3OC5A 3LH8A 4XI5C 5T3ZD 3GQFA 4KJWD 4J5VA 3KGRA 3CN0A 2CBMA 5DHDA 3WMSA 3GXUB 3NK3A 3E1F1 3ZDWA 1RIUL 2AEOA 2XUWA 1D6VL 2NY3C 4A7GA 3QJUB 2F54A 2UX7A 1TZIA 1QUNA 1CXLA 2DM4A 4XN9A 1S3KH 3VI3B 1QA9A 2OR9H 3IMVA 1ESOA 3F12A 4LMQI 3MLPA 3SDCD 1LGVA 4S2SA 5EO1B 4D94A 4KRNA 4EDWL 3H9SB 4HUXA 1RZJL 3KCWA 1W80A 1LWHA 1MJ7H 1YEDA 4EIBA 3VFSA 2NY0D 2IBZY 4F5CE 1ILUA 1OSZB 3K3QA 3LKQA 5HVHC 4MCYB 5DLLA 3W9EA 3GM0A 3E80A 3BQUC 1OT1A 5IW1B 4WGKA 1SXCA 3DGDA 4NQXB 3O3DA 3ZDXB 2V2XB 3MX0B 4Z7NE 3U4BL 2DQHH 4FXGC 2Q2EB 1S46A 3DHMA 1IBDA 5DUPH 3HFFA 4OLXH 3BQUB 2AXWA 3QZPA 4PCSA 1OCWH 2LU3A 2QJDA 5FUOH 3VGEA 5C0CA 1CFNA 2B1OA 4X5QA 4HHAB 1NCCH 3V79C 2FL5A 4FXGB 1DQTA 4GXUM 4KBPA 1OAYL 3RWEB 4NO0D 3L1EA 5HHNA 1X4ZA 1LO0H 1D2PA 1BF2A 4GRWB 3WEMA 2WBJC 3JWNG 5CN3A 3AWEA 1NCDH 3D0AA 4LRIA 1TEFA 3IDMA 4GPVA 5AW4B 4KTDH 4NN5B 3UTZA 2NNAA 1N0XH 4Z3HA 1N2RB 2JJSA 2ZSVB 2PCYA 3Q5TA 4F1SA 1ZHLA 4H0HB 4B5EA 1UOVA 3FO2B 3HUJA 4KJQD 3RL1B 4I0PD 2CJ3A 4Y4KA 4JPVH 4C4UA 3MO1A 4U3SB 2B5IB 1PCSA 1U3HD 1TG8A 5TK4A 5I6PA 3P1VA 2J4WL 2C9PA 2VXSH 1GC1C 3N1FC 4WAFA 4DESA 2VL5B 2J43A 4PFEA 4HOMA 5AG8A 3O8XC 4ETQA 2OZ4A 3T0VA 1KJ2B 2HVJA 3VXRB 3S35X 5C0BB 2KH2B 2QBWA 5KAQG 3BHBB 1T1ZB 3CFKB 3MJ7B 5F96L 1KFGA 1U8KA 2V6HA 1KLGA 3IKKA 4N8CL 4NERA 4OT1L 4KZEH 5BVPL 1A6AB 2WUBH 2YFNA 4L1TA 3INUH 2JXMA 5KANI 4I3SH 2E9IA 2HJFB 4H20L 5ECJE 3MRRA 1GZQB 3L3IA 1VB9A 4QKXB 1NDTA 2OM5A 4F8PA 1GAFL 4HBCH 1IMHC 2VDNB 1OSYA 2R0LL 4MQSB 5AWNL 2IANE 4A6YH 4J4PA 2HLEB 5FOBA 4FFZL 1FL3B 4LLQB 5KN5B 1CG9A 4RGOH 4RH4A 4XCCL 4DGVL 4NQED 2CDGB 2FBRA 5TDPA 4XE0A 3S96B 3CFUA 4MB1A 5FEBA 3T4AA 4RRPM 5HYSB 5ESAB 4PRIA 3UYPA 4NO3B 3QWNA 2EYRB 4I5BA 1YNKH 3L9YA 4JPKH 1A1MB 1NGXA 3LS4L 3LJ3A 1WA2X 3QDAA 1NAMB 2WQVA 4AX3A 3FUKA 1Y7VA 5GZNA 3BESR 1RIUH 4DK3A 3KPNB 1D6VH 2AQ3A 4E41B 3PPEA 2J12B 2OTUA 2VGLM 1AE6L 1EO7A 2UVEA 2H2PC 4MWFB 5C08D 1KTRL 5FF6B 5D1ZA 4EQ2A 2L7UA 2IAMC 4PB9L 1DBJL 1PY4A 5DMIL 1RZJH 2K7QA 3BZEB 3Q2NA 5D6CA 1JFQL 3NIFB 4OFDA 3TNMB 3I9AA 2PW2B 2P24A 2VLKB 5HD8C 3HVDA 1TETH 2IEPA 2X6MA 2XRAL 1V7MH 4JMXA 4NB7A 3ATFA 3ABMB 1P4UA 1INEL 3ARDA 4LSSH 3NA9L 1SOQA 2FJUB 3UZVA 2IAMB 5BUAA 3PWJA 3U4BH 3EH3B 2VLRA 2BSCA 3B2UD 4Y5XB 4XRCA 3QFJA 1HYSC 1X7QB 4X7TA 4BK8A 3FTSA 5HYQA 4LLDA 1MI5D 1IM3B 3FTZA 2BP8A 2R1WA 4YGVA 5F7HA 1U2HA 1UXSB 4IKLA 1DCLA 1OAYH 4A1RA 2NNFA 3BEWB 5CZXD 1CK0L 2R1YB 1D9KA 2C3WA 3PUUA 1DLFL 4P3DA 2Q2LA 2EDFA 4HKXB 5BQ7A 1KGCE 1I1YB 3EBGA 4DAGL 4TLKA 2YPLD 4UI2A 1BPLB 2R15A 1AQMA 3QYCA 5ADPL 2FIKB 5I17B 5JMRA 4KPHL 5E5MB 3UTQB 4BXSV 1RJLB 1S7RA 3MI6A 3RGVD 3IE9A 1VHPA 2IC2A 3CSBA 4AGQA 4LVNB 4Y2DC 5GGSA 3L9RB 2J4WH 2NY7L 5AVTB 2BC4B 1YMHB 1I1CA 4IOFD 3U48A 3UTTA 4AJ0A 3WD5H 4F15B 1EJOL 2APFA 4X83A 3GHBH 5DJZB 1WBXB 5F96H 3UO1L 1L6PA 1MAML 4N8CH 3DX6B 4OT1H 3WBDA 5BVPH 2BNRE 3P73A 1D5MA 4UQCA 3I74A 3QG6B 1HQ4A 1BWMA 1F58L 2NX5A 2Y1VA 3VE0B 3QCVL 3AGVA 5IBUB 1BF8A 2TRYA 3QIBA 3QSKB 4Y19D 1XR8B 3QDJA 4PBVC 2AJYL 3NIGE 1TQBB 2Z9TA 4L29B 4G6KL 4XMLL 2NYKA 4V11A 2R0LH 2Z35B 5LN8A 5EEWA 2JKNA 4L5FE 1URLA 3SE3C 3EUUA 4M6NH 4N8VA 1IAKA 3TT3H 2N01B 3TLRA 3DXAB 1RK0B 4NQDB 3ZTDC 2EDEA 3QWQB 2W81C 5E70A 2FZ3A 2YWZA 4WJ5B 4DGVH 4LEEA 4ZTPL 1H5BB 1F3DH 3GS0A 5BXFB 2K3TA 4ZFFA 2HFGL 2VDRB 4YBQC 5I6MA 1KXVC 5KWYC 2E7BA 3WTWA 4LQ1A 1J7VR 4M5YL 4MVBC 5MEQA 4Y89A 4YXLH 3ARBB 2AXHA 3FJTA 4CMHC 1OTUD 4AQEB 3O6LH 3PWPD 1Z0MA 2YPVH 2G4EA 4C83A 1VFAB 1KCVH 3PJNA 3A6CL 3ARGC 4RRPG 2GK0A 1EMTH 5AW0B 1IC1A 4WW2A 1BD2B 3S34H 4ENZA 1CXKA 5F89B 3QIUC 4ICWA 2YHGA 1YEHL 2CH8A 1JTPA 1EHKB 3GSXB 4IEFB 4QYOA 1I9RL 4UNIA 1AE6H 2ZUTA 4FA6A 4B60A 3BLPX 2YKKA 3G6AB 4HX1A 3AROA 3D39B 3F2LA 3MGTA 5I74C 4X9GA 1XF5A 2ZPKL 3TP4A 1G7QA 4YPJA 5A43C 3QIUB 2WWMC 4TUJB 1FN4B 3UGUA 5F3BA 2QVMA 3X1BA 1K8DA 1U58B 2UV3A 3BVUA 4F92B 3H2WA 3MFGB 3LOWA 5I74B 5JHAA 1JHTB 5DJ8B 1NANI 1ZE3H 2WXGA 1PZSA 3PS6A 4RMSA 1VSCA 2J8UA 3PQYE 2EECA 1TSRA 2YUWA 3UO8B 3O3BA 4I3GA 1KDIA 2BO0A 2GJPA 5C8JA 5KSBB 1TPXC 5C07A 1FNGB 4M43L 4QRUB 2XTJD 4HMCA 4U2YA 3TH3T 3D4GA 3DX2A 4APXA 1ADQH 1UJ3B 5HHPB 4W9GC 1CK0H 1E4KA 2IQ9L 2P8MB 4LEOB 3VQ1C 5JNYA 1E8WA 4DEUA 1NC4D 1DLFH 5HY9B 1TYEB 5I1CL 1EEUA 3EAKA 3CNKA 5IJDC 2ZUYA 5LNGA 5DDHA 1AHWC 4DAGH 4ZMNA 3HHMA 1PBYA 5JHDE 5AW8B 3MCYA 4CVUA 3VXNB 4FJYA 3KYOB 3BKYL 4PJ9D 5EU6A 4XNDA 4XODA 4F1ZA 1SDDA 4KPHH 1RH8A 3O3EB 5SWSD 3PL6D 1JZEA 1PZUB 5KS9E 2MRYA 3SBPA 5T1DL 4POZC 3ULAB 4R4BB 1EXGA 4FG6C 4W81A 4I3RL 2A4ZA 5DQDL 3TGXA 4FG0A 5CJXC 5LLIC 2NY7H 4DGIL 4NO5A 4X6DA 5FYKE 3ERXA 2C4FT 3BWZA 1HCVA 2XVLA 5I16B 4LIQE 4NAQA 5EF1A 1NMAL 1LNUA 3VSUA 1I8KA 2AV7B 3D3VD 1EJOH 3UO1H 5CR8A 3FFCE 3MV7E 1C8PA 2GVYA 4NUPA 3T65B 4QI3A 1QAWA 3FONA 1CIUA 3HB3C 3QCVH 4YLQT 3VNYA 4KKCC 43C9A 2MMXA 4R3SA 3OJDA 2AJYH 5FWQA 1E28A 1RZ8B 1A3QA 2I7OA 4XMLH 2QQLL 2Y72A 4J3SA 1YEIL 4DPAX 1UENA 4K55A 4ECNA 1E4WL 3ES6B 3LIUA 1I4FB 1EHLL 1KTJA 2OJEA 1LO5B 2UXFA 3DURB 1VCAA 4N25A 3OQRA 2GTWA 3QUZC 4WTXA 2QVKA 1OPOA 3FSZA 2HFGH 1CTMA 3JYBA 4OGYL 2DQFB 3AG4B 4DZBA 3WELA 4ZO7A 2FWUA 5SWQA 3SQBB 2YR3A 2UWEA 5KBNC 4GG6F 4X6CA 3WDIA 2DWXA 2WNXA 4NZDA 1UURA 4OGZA 2W94A 5GZOA 4YAQB 4Z7IA 3A6CH 5AVRB 3E3QC 4ZSOB 3A6BL 5F1SA 3S88L 2Y5TA 2ZKHL 2YBRB 3GHEH 4APQC 4E68A 2B1HH 2B8OT 5BZWA 4BUQA 1BFVL 2P52A 1CLOL 4FNQA 3CX5K 4LK4A 4XWOD 4EIUA 3Q9QA 4KUCD 4N2BA 1OEZW 4P49A 1A4JB 1QRNB 1DVFC 4YLCA 5E6RB 4KDTA 5KVFL 2WXRA 4HEPG 3EGDB 1PZ5B 4LCWB 3CE1A 4GY4A 4XP1L 2DLFL 4AM0B 1BPVA 4M8RA 2Y22A 1GY2A 4ONHB 2X2IA 2G4GA 3MFFA 4LLVA 4OW6A 1M7IB 3B5GA 4U6YA 2DDQH 1M1XA 3JVFC 3NJIA 3NRFA 1JERA 3V4VA 3QJOA 4IJTA 5LBSH 3V5HA 2CO3A 5DJDA 1I8AA 2MIZA 2WINA 2WIIB 3B6SB 4DSYA 3KPRA 4M43H 4IW4C 4ZOAA 4NPYA 1N64L 4YHKL 4GI6A 5DEFB 3WKNA 2ALWA 3RIFK 1GR7A 2IQ9H 3I6GB 1AGCB 5D6DA 4IRSC 4EN3C 3IRPX 5C0DB 3F5WA 1FYTD 5I1CH 3UTSD 2WKGA 1VGEL 2PYFB 5EBLA 5DMKB 3HLAB 2WWNA 1IC4L 3CX5J 3UMNA 4HZLA 1D5BB 4NO2B 3MRCB 3MBXL 3BKYH 1S8DB 2H41A 1FI8C 1KJ2L 1GCFA 3RNKB 1X5IA 2FJFA 3ULVD 4IGBD 1JXDA 2HXAA 3WNLA 1QTYT 3P77A 5T1DH 4OV5B 1A7NL 3QORA 2VITB 2X10A 2GBTA 5CJOL 4DGIH 3HW7A 1LE5A 3U6XA 2XXCB 3F04A 3OXSB 3QDGB 1LP9B 4ONGL 3LH2L 2V9RA 3LPOA 2FWSA 1NLBL 4JRWA 4P5KA 2P5WE 2VDNL 1KJMB 2V5YA 3BX7C 4D9RD 1J5HA 1AQDB 3WLBB 4NKMB 1AQ8A 4PRDA 1E9OB 5KZCB 3V6FA 3UJIL 4X4XA 3FT0A 4K4KA 4LLYB 3EH5B 3V0HA 5K69A 4YSUA 1A3ZA 4PRPA 4JO8A 3LRMA 1XTMA 1NGZA 1JYNA 2XT1B 4FXTA 5D7SH 3AXLA 1DJHA 3PXJA 4TUOB 3IJYA 4DQAA 4TRPL 2DICA 3DV6B 4WV1B 2XA8L 3VWJB 3MJ8B 3GSOB 3TEXA 2EIZA 1XCXA 3LN4B 4FFVD 4G7SB 1EHLH 1YEWA 4J1UB 4XNMA 2L7QA 3EO9H 4YMPA 1NAML 2D7TL 3WIFB 1P1ZB 4Y1AD 3VTTA 3OKOA 1IJ9A 4U1NA 4X99A 4MXVE 3JT0A 1NMBL 1Q90A 1IAOB 2C9UA 4UOW1 1OZUA 4NX0A 2F53A 3TESA 2ADGA 4JB9L 4JM2F 2ZWLT 2CR3A 4GKSB 5I75C 5J9PB 4M8VA 5DA4A 3U4EB 5F3HB 1DFXA 5D5MA 3GIVA 4Y8AA 5CGYC 3FO9A 3S88H 2ZKHH 1RZ7H 1C16B 2G3MA 4XCNA 2EEBA 4ZXBB 5INCB 2HJKA 4CNIA 1BFVH 5F9WB 1AH1A 3UTSE 1CLOH 4GBXB 2EEFA 1DANU 2D0HA 1O7SA 3SGJC 3N44B 4RZKA 1RPKA 8FABA 2OMVB 2WTRA 3GBNH 4DN3H 3DX4A 4L1LA 3H56A 1N6VA 4R7NB 4OLYL 4PJ8C 5E4EB 3DGGA 2QGEA 5DJ6A 3QWRD 3RY6A 2K6WA 4GP5B 4Y9FA 3ULVE 4XP1H 1G9ML 2DLFH 4J12A 3T0EA 4FQIL 4N2CA 4A67A 2WBWB 5I5RA 4J27A 5DC4B 1S2EA 5A2AA 4JFYB 4N26A 1JV2B 2GTZB 2B7DT 4PJ8B 4QHNA 2JB6B 4S11A 1PEWA 2RR3A 3ARFC 4MAZA 2XBDA 3RY5A 3U2IA 4G70B 3SDDB 3TH2T 3LS5L 1WIUA 2VWEC 4CJ1A 1OW0C 4GRWH 5EU4A 1AO7E 4MRBA 3WN5B 5I6OA 5D55A 2AP2A 4WNQA 2A83A 1KWKA 3SGDI 1DJGA 3UBXI 1Q0XL 5HI4C 1T21A 5E23A 3ZKND 1IQDA 4YHKH 2X4PB 1HSAA 2O4EA 3ARPA 2WXIA 3T3PE 5L0QC 3X17A 1AD0B 2EINB 3ZQWA 3MUJA 1BZ7B 3C5ZB 4L4JA 5FGCB 5GGRA 1VGEH 1HN1A 4P99A 2F74A 4RFEB 4QJ5B 1DDHA 1IC4H 4U1MA 2H2SC 4NQVA 4FEMA 3MBXH 1CCZA 1FYHB 4Y1AE 3IDIB 1SUHA 2O6CA 1MW2A 4KI5F 3CLWA 2PWEA 1HJBC 2X2UA 2XX0A 3RTLA 4DW2L 1IGJA 2Q76B 2F54B 1QUNB 1A7NH 4TSCH 1B0RA 3ULUC 1QA9B 4CMHB 1A8JH 2Z0UA 1B0GA 1DBBH 4KROD 1AXSA 4S2SB 1J11A 4YK4B 4ONGH 1HEZA 3LH2H 4HUXB 5FFLA 2XACC 3GB7A 4PW3A 3DX8B 1BBDL 1YEDB 2ZOKB 5HHQA 1HL8A 3VFSB 3LEXA 2FWLB 2RCSL 3LKQB 1NLBH 1UXWA 5FA3A 4D0BA 2VDNH 3ALWA 2QPSA 4KRMB 3AC0A 3TBVA 2FEJA 4YHZL 3NCCB 3UJIH 2EO1A 3CHSA 4C56D 3T3MF 4N9GB 3K46A 3TEZA 3TCXA 1WFMA 2H6OA 2VDRL 1QLRA 3QI9D 1P5VA 3NFSH 1JZDC 2IFFH 4TRPH 1UM4L 2XA8H 3LKNA 5C0CB 1CFNB 1AHKA 2I07A 4UT9A 1KBGL 2FL5B 4MMYA 1D5RA 5IMLB 5JHLA 2JJSC 1NAMH 2BCKA 2D7TH 5HHNB 1CGSL 4OF3A 3WSQL 4G72B 1BFTA 4UILL 1NMBH 2GEEA 3II2A 1S4IA 1LEKB 2Z91A 4JB9H 2R4SH 2NNAB 5BO1L 3UTZB 2JCCA 1QUPA 4M8QB 2FJGA 2FO4B 2JTDA 2O6FA 1ZHLB 4AG4L 1KBKA 2FEEI 2DIEA 3B9VA 2NY5C 4Y4KB 4ZNEE 3MO1B 3FU8A 3O6FB 2CZNA 2JE8A 5IMOA 4MQXC 3VWKA 2AEQL 2WQRA 3GKWH 4PJEA 2WLMA 1BOYA 1A6WL 2A73B 3LN9A 3NFNA 2J1YA 3O0LA 4FNSA 1S7UB 1C5DA 2VUYA 4RGNE 4OUUA 3DJSA 4WEUD 4AQ1A 2OULB 3BUYB 5F97E 1WJ3A 4ETQB 4OLYH 4WWNA 2HVJB 2QADD 4YNYB 5EHFA 5D2LE 2AQ1A 1DJSA 1AGDB 2P48B 1YNTF 4N5ED 1G9MH 3FT9A 4FQIH 1KLGB 1RUPL 3P0YL 1ZANL 2A74A 1E2ZA 2EDQA 2XWCA 4J4PC 1L7IL 3V0IA 2JXMB 4OSUH 1CFSB 3H4HA 5C0JB 3ZKMC 3KXFD 3L3IB 4N2DA 1AZCA 1M56B 1XB3A 3WUWA 4PWGA 1O9WA 5G5DA 1BAGA 3KPMA 3UG3A 1RLWA 3WTSA 3MBEB 2F7PA 2KDGA 2OYMA 1K5NA 4JAMA 4JFQA 1U93B 4LHJB 2NY1C 4WY7L 3K2MC 1DZ0A 2P5PA 3M7OA 5TE4L 1XFPA 5IV2A 4P2OD 1A9EA 3V8OA 4LSVL 4XP9L 4NUGL 5GZNC 2HSIA 1KPVB 3T4AB 1CYGA 1JGIA 3UYPB 4IBUA 4U1IB 2Z93A 2BK8A 1INDH 4UOQA 3H7LA 1T7ZA 3KGSA 5GSVA 4LNRB 1TENA 2YZ8A 4XP6H 1Q9WA 4A7UA 4IRZL 5GRJH 3ARQA 3H6JA 5KUMA 2NLJA 4OM0L 1DBML 4DW2H 5FB8A 1B90A 3EXLA 4AYGA 5IP4A 3DGCR 4KKLC 2DB8A 3RPKA 3JZ7A 3L4UA 3RVTC 5CD5D 3RUGB 2G3ZA 4NP9A 1O75A 2JQAA 2JTYA 5FDYA 4MCZA 5D1ZB 2P80A 1JE6A 2ZCHL 4QT5A 5D6CB 1NIBA 4FYRA 3WJMB 1QHPA 2RCSH 3FNKA 5EIVA 4KVNL 4JW3A 1BOGA 4HIHB 3ARDB 3QDHA 1HNYA 5LQBL 3CMOL 3IFLL 3UZVB 4ZD3H 3PWJB 3O6KL 4PJ7A 2VLRB 3L3OB 3PWLB 3WL9A 1SZNA 5HYSG 3SDXF 4OIBA 1D9KC 4Z95L 2VDRH 3DRTA 2MQGA 5HYQB 4MS8D 5KBKA 3KCPA 2BP8B 3O4OC 2R1WB 4UQ3A 2GAZB 1QRKA 1UM4H 4J3BA 2O5YL 5IFJA 3QHFH 1DQKA 5F6HI 1KBGH 3PNWA 4AQ8A 2FX8L 1CGSH 1H3XA 2QFPA 1IGTA 3WSQH 4GQRA 1K4DA 3RVWC 4UILH 1PG7H 4XN2A 5BQ7B 1TCMA 1E7UA 3SDCA 5I0DA 5EEUA 3IEAA 5JA9A 3FN9A 4Z3GA 4PLNC 4P4RA 4NNPL 3MNWA 1RZIA 4TN9A 4YBLB 3CH1B 2VLME 1A1OB 3IDNB 2ZKYA 4DP1X 1OXYA 2X5PA 1C08A 3FBKA 1JBJA 4MZ2A 3FSVA 2WGXA 4OZFB 3FRUA 4OLEA 4PJXE 2RGSA 4OV6F 3CN2A 4P48A 2P26A 3GTVA 3OGCA 2AEQH 4OJDH 4URTB 5GGSB 5HVWA 1A6WH 4KK6C 3H9YA 5FO2A 3KD4A 3N55A 2BXYA 1IAII 3N42B 2PCFA 4H8HA 4TF4A 1VFBA 1MW3A 3EYQC 4LSTH 4F93B 4HA1A 2PTTA 3QGVA 3FSWA 1MN4A 1IC7L 1YPZF 2CO1A 3F7PC 1NBQA 3QIBC 3T6WA 3LV3B 3W11C 3WY3A 5CEZD 1FORL 1U8JA 3HRPA 4NO0A 1EA9C 4NCDA 4IOIA 4R2GB 1ZANH 4NUMA 3P73B 1D5MB 4UAOC 1L7IH 1HQ4B 3HG1D 1B0IA 4FZ8H 4HS6A 5DEGA 2XV0A 1MCCA 3E8UL 5JOFB 5LVEA 4QAWA 4PV8A 5AENA 3DUSA 2LTQB 3P9LA 2XZCH 1J0YA 4N8VB 1IAKB 4NUQA 2Y6TE 4U6XA 4ZMQA 4I0PA 4G9FD 3H7BB 4DK6A 4TKWA 4WK2B 4IYKA 5GRVL 1IGFL 1U3HA 3WY4A 4R5TA 1CT8A 1IEBB 4LSVH 4XP9H 1RCYA 4NUGH 4R7DA 2CALA 2CGYA 4LKCA 4AIEA 5B38A 3Q5YA 4HJEA 5K9JL 4WW2C 5AOMA 1A6VL 1WD9A 1MFDL 3OZ9H 5HBBA 3TH4T 4I1NB 4G6AC 2GK0B 4UOJA 3VFOB 4AKOA 3KLSA 3GLDA 5FYLL 4ZX3A 3NSXA 1P4IL 1PL3A 3PDOB 5ETUA 5AL8A 1DBMH 3NJFA 5FLUA 4AYDC 4MNHB 3L3JA 1MY7A 1BAFL 3ZR5A 2DJ4A 5IBUG 3VFWA 3VGAB 3B5TA 3MGTB 3GSQB 4QRRD 5F0LB 5JPMB 1S7XB 2RBLA 2ZCHH 1MSPA 4QTFA 1G7QB 2D9QB 4X6BB 1NINA 5F3BB 5ESVA 1MRDH 4O2EA 3UBXA 2DWYA 2BWQA 4HWEL 3CZFA 4NQEA 4PGEA 5CCGE 2DWDA 2IDUA 3V4UL 5LQBH 4G6FD 4EQ3A 2HZHA 3O6KH 1DQLL 2J8UF 1BQRA 2YXVA 3HS9A 3OKDB 4Z95H 1HI6A 5CO1A 3O3BB 1WCQA 2UVFA 2JI1A 4H25A 3PLYA 1RURL 4HHWA 1PNCA 3NGBC 2MQCA 1NBZA 3P2BA 3HPLA 5K1JA 2XV6B 5HDQL 3BPOC 1L0PA 1T2QL 3UTPD 1WA1X 2FX8H 5IQMA 4PY7A 5B1AB 1PZAA 5JIKA 5C08A 4CU7A 2DQ6A 2RH0A 1XF2A 1EO8L 2ZX5A 4LQFL 4ZDHA 1P6AB 2EVGA 3K6OA 4DF9A 3F3HA 3CZKA 3PAYA 3HN5A 4NNPH 4BA8A 3BPOB 1MRCH 4KFZC 1RFDL 1V55B 4KKBD 4QHUB 4Q9CA 1PY9A 3E6HA 3MLSH 5EU6B 4FAAB 1FVEB 1NFDA 4W68A 4X6DF 5LN4A 3NK4A 3HS0A 2EDDA 3HKFA 4NO5B 4RQQA 2YA1A 5HGHA 5DJXA 3HE7D 4Y2NA 4JJOA 3TZVD 2QV4A 1MFEL 4NYLA 1IC7H 4NZRL 1K6QL 4Y2OA 1LNUB 4ACTA 2VXVL 1I8KB 3FQXA 4DEPB 1FCGA 2ZXDA 3POHA 4ISVB 5I18H 3VYNA 5J57B 2AI0L 4HAGA 1U42A 1AMYA 2NY2D 3QUGA 1ZGLP 5TDNB 5JYMA 2OL3B 3M1BA 4ZFOA 4NSKA 1EHXA 43C9B 4JFFE 3OJDB 4R3SB 1OLLA 3HPJA 1H0DA 2AK4E 2OSXA 3E8UH 3IXTB 3SYPA 5TFSL 1WZAA 2D31A 3II3A 4ZYKA 2YPLA 4NRYB 3X14B 4A66A 3CPLA 3D34A 5KYWA 1CD8A 5HHOD 3ZT5A 3VG9B 5EN3A 4PY8J 4JGNA 2CRYA 1ED3A 4GLRI 5GZOC 4R7LA 2GTWB 2ZUQB 1IGFH 4JJ5A 2DBJA 1UB5B 1PKQA 3T2QA 3EW3B 2UWEF 5I23A 3H6AA 3HR5A 3X11B 4X6CF 5JR1L 4MAUL 2B4CC 1A6VH 1DQQA 2EXWD 5GS1A 3FF7A 1LVEA 4R4NC 2R51A 1MFDH 3VGHA 4PRHD 1A6ZA 1DVUA 2V8LA 4XMZA 2BNQB 3RWHA 4LBAA 4ZMPA 3CWGA 5CLZA 4X9IA 4V1DD 4A2MA 5FYLH 2A6IA 1M2VB 4GJTB 1P4IH 5A40E 3AXHA 1XH0A 2GKIA 3L5WB 4OCXL 4Y19A 5BZDB 1X9LA 4Y1SA 1DUYB 3VMOA 3A4AA 1BAFH 3EO0A 2XG5A 3DVNA 4XGZA 2WNGA 5IG7B 5DQ9A 5E00A 1L6XA 5JW5A 3ROLB 1S7QA 4YSPA 1ZPLA 3IDXL 1MWAA 5IVXF 3OKLB 2DL2A 3B1UA 3BGAA 5BRZE 5JHDA 5GHWL 5I8EB 3P2DA 4HWEH 3LKRA 4YGAB 5HDBF 1C7TA 3MFFB 2YD4A 3TJHC 1CMOA 1KIQB 1MNNA 3EGXB 3V4UH 1ZV2A 3CUPA 1SGKA 3EDKA 3EGSB 3MLZL 1DQLH 5AW9B 5KS9A 5FO7A 3S37L 3V5HB 1JCKA 1P7QA 5D6DC 4PG9B 5C71A 1CLVA 1W8NA 2FWOA 3MLTA 5CP3H 4HDIA 5DJDB 3TURA 4J3TA 2WINB 4RWYL 1CF8H 3Q2VA 5IHWA 3FOMA 3MV8E 5E6SB 4FNTA 2C26A 2W59A 5HDQH 1T2QH 4UTAA 3BZFB 3MV7A 1H3WM 3BN9D 2MTPA 2W80C 1CFQA 2WZ6A 1WBZB 3DO4A 4TNEA 1T4WA 5TQ0L 3RZWA 3SQOL 1OK0A 1OLZA 4LQFH 3Q2LA 4KGLA 4PTUA 4JKMA 5DC9B 3NSDA 4FNRA 1WAEA 3UCRA 2RALA 3ZZQA 4YXHH 2FJHA 3EF4A 3GSVA 1RFDH 4HZLB 1T0OA 4IBQA 4GRLB 4J3OC 5B22A 1JK8A 2BIPA 5GS0H 2IOOA 4WUUD 1CL7L 1ZTMA 3DBXA 3O11A 3U7WL 4M48L 1IZKA 1KC5L 2OZ4L 2DYRB 2EICA 1A1NA 2FJFB 1ET8A 4HW6A 4J3OF 4KOCA 1XF1A 5LXVA 3P77B 2Q7AA 3PWUB 5LBVA 3QORB 1A3RH 3MC0A 1LE5B 4LPXA 3F65A 2EDXA 2WO2B 4WDIB 1W8EA 4NZRH 4V1DE 4PR5B 1K6QH 3S97C 4QXUL 2VXVH 3LXBA 3R19A 2AI0H 2VNCA 4NOBA 1O6VA 2MTAA 2XLLA 3JWNE 4LRNL 4P06A 2VMDA 3BDBA 2Z4QB 4LSDA 3V6FB 2QVIA 2OAAA 4MDJA 4QO1B 5T3XH 3ZO9A 1XF4A 3HBPA 4HUCA 3HNTL 1G0YR 3RKDC 1EAJA 2A6JB 5TFSH 2XN9E 3AXLB 1VRSA 1HNGA 5E6YA 1RI8A 4LF3A 3IJYB 2BIOA 1EEZB 3MHZA 5C09D 1QATA 2F61A 2DMGA 5I1HL 5I8KL 1IQWL 5SWSA 1MCWW 1AKPA 3PL6A 4L2YA 3OVUB 3MRLA 3JWDH 4X99B 5DS1A 4X0KB 2X89D 4TVSa 4ANKA 2APSA 4F8TA 4HGMA 4XVTL 5JR1H 2KL6A 4PWIA 4TNFA 4MXWL 5KOVC 4MAUH 2ADGB 1F90L 4X7DC 3PGCB 4HJIA 4UDTA 2DS4A 2PW1A 4K5PA 3TN0C 3K6DA 1L3WA 3OSVA 1BJ1H 5D5MB 3GIVB 1KG0A 2FUQA 2XVKA 1L9QA 4N0YL 3ENEA 1CLZL 5BZZA 4BH7A 2CGRL 4XCNB 1IKNA 2FH8A 2XZZA 4NEHB 3US1A 4XE5B 5AZ2L 3ZDYF 4MB3A 1BVKB 3KHQA 4OCXH 1E9PA 3BW9A 2APWA 3RX7A 3RVUD 4DT2A 2XPZA 4W9JC 4ODUB 4M7ZC 5IMMA 1LWJA 4WUUE 3IVKA 3VUAA 1I9JH 1NCOA 4NWUL 3PV6A 4JMNA 4AZ8A 3DGGB 3KLQA 4M6ML 3IDXH 2X4SA 3G9AB 1Z32X 3QJZA 2H5UA 1MCFA 4EDXB 3T0EB 5CLYA 3V2AR 1XB8A 4D2NA 5AB1A 3DVGB 5EUOF 4KK5D 2PCPA 1YYLL 3NP4A 5DD3L 2P5ED 3DLQR 5E9DD 2AVGA 3MLZH 3FCBA 2AEPH 3CFNA 3VFUB 1QBAA 4DK5A 1UCBL 2IXQA 2G0LA 4XCFH 5IJCC 5EU4B 1EDYA 1CLCA 5DHMC 1MLCA 4QRPD 1U91B 1T21B 2X4TA 3B56A 4Z77A 4WGWB 3X3FL 1A4CA 2ZCZA 2Z8VC 3BAXA 4X8JA 4Y1TA 1EPFA 1CGVA 2GBVA 4JDEA 5AB2A 4KK9C 4N8UA 5TQ0H 2N3JA 2NY4D 3SQOH 2YMOA 3LN5A 4NZJA 1NM9A 2Q86A 5GGRB 1UZ6E 1G5GA 1P6FA 2F74B 3FU7A 1LEGA 4P9HL 3WE1A 1X5KA 1DDHB 2EKSA 4NZ8A 4Y4HB 4YSCA 1PJWA 4NQVB 2YLKA 1PD6A 5LAPA 3UIZA 1CL7H 3U7WH 4M48H 3QAQA 2OZ4H 2EEXA 4XPHH 5LWYL 1ZS8A 1Q0YH 2ZAGA 1R17A 4H4NA 4RGMB 3UERA 2H3KA 3UABA 1B0RB 2BY3A 5B8CA 1I1AD 1T7WA 4I18C 4CDHA 1HEZB 1OT4A 1PDKB 2XN1A 3GB7B 4HKZB 1E0OB 4QXUH 5HHQB 3EXJA 1KTBA 1TJHL 5FA3B 2MNUA 1JD9A 3BIAX 2B08A 4XPFH 1DDTA 1C1EL 4LRNH 3GFUA 3T1WA 4MJ5A 1OP3H 1Q72L 2Y24A 5E2UL 2Y69B 2WBXA 4J6IA 1FYTA 1IIIA 2L7JA 3UTSA 1XF3A 1OGSA 4HU2A 4ADIA 1QSFE 3HNTH 4O2CB 5DEZA 1YEJL 2C9XA 4S1DC 5DRNA 1QLRB 3DX0A 3RPIA 3SE4C 1FIEA 3EDFA 3HC3L 5DO2C 3LKNB 5I1HH 1Z2KA 1IQWH 3D51A 3L4CA 4KK8C 3H53A 2Z4TA 3ZRSA 4IGBA 1JZ6A 2D4FA 4P59H 3SYQA 4JL2A 4XVTH 4TVPL 1AFVH 2JCCF 5EBGA 3GRWA 1PZ3A 5BRQA 1FNLA 1QPKA 3WTTA 4QRPE 3VWKC 1AIZA 1F90H 1G1OA 4YDIL 4JDVA 2Y7NA 4DO6A 4X7EC 2BSED 2FJGB 5DD5L 1VACA 2AJZA 1PG7X 1JMZA 2HYMA 3QCTL 2NTSP 5HI3D 1U8NB 4AQ1C 1N59B 1HZHL 1FBIL 1CLZH 1D5ZA 3S5LA 2AABL 3NCEB 4XXDA 1TOXA 4W1TA 5AZ2H 4L8SC 5HDLA 4JDZA 3GK8L 5D7JD 5IMOB 3VWKB 4L8CA 2IDQA 3NFNB 2CHWA 4IJ3C 1C5DB 2MPAL 2A74C 3OKNA 3BIKA 1Z5LA 3O9WB 4OUUB 4QLRA 4AQ1B 1S9VA 2DRUA 3DJTA 3FZUD 4NWUH 4BQCA 1I7RA 3KVDD 1MELA 1JS4A 1MJJB 2ITFA 1E65A 4M1CC 3NAAL 3IJSB 1SXAA 2YXWA 2UZYA 1TYJA 2P8LA 4IJ3B 1G7IA 3IDYB 1SJVA 5JPNB 4Y1AA 1XGTB 1UHVA 4XP4H 1A7BA 1XAKA 1YYLH 2Y06L 4L05A 4XOCA 1K9TA 1R3KA 3BLKA 4OZGB 2OS7A 4YVNA 3WUWB 1UCBH 2ZUVA 2UZIL 2OMUA 2KBGA 4PJHF 2YUVA 1CJYA 1GJUA 3L7EB 1P84K 4JAMB 4JFQB 1PEZA 4K5NA 4QY8A 1GVIA 2L4OA 4NXSA 3X3FH 5IV2B 3AB0B 3C87A 1TLKA 2O6PA 2XY1A 4JRXD 4PGDA 1BA9A 1KXQE 4HZ1A 4Z7NF 4YDKL 4UB0L 5E08L 1Z7JA 3ZTNL 1FO0H 4OZFH 3SKJL 3H54A 4HOWA 3HFMH 4XMTA 5ICYA 2OJZH 4P9HH 5JUEL 2AF2A 2GSMB 4XBEL 4AW4A 1H3PL 3APMA 5GSVB 3GINA 5E8PA 1JRHI 1X44A 2ADJA 2IDCA 4ZW3A 4Y16D 5HYEA 3TFKC 2VE6A 5LWYH 2NLJB 4GMTL 5A6LA 1LK2A 1SYSA 1S3RA 3Q8EA 5TK2A 1Z9NA 1I8LA 1AVAA 1JGVL 3HEIB 4EBQH 4YHIB 5AVUB 3CVIL 1YY9D 2BMKA 4NC1E 4MCZB 5B1JA 4MDIB 1WWWX 3HZVA 1JVLA 2QTVA 4HCRA 3B9KD 3DC0A 5EOTA 1FPTL 4OD3L 3RJQB 4O58L 3P2TA 4FYSA 1CICD 3KNBA 1YC8A 1B3JA 1LK3L 4F2EA 3TNNA 1T7YA 1MH5B 2V2TA 4KJWC 3VXSB 1C1EH 1E6OH 5E2UH 3TEWA 2X0UA 5EBMA 4KXZI 4JO1L 4PJ7B 1P84J 4PLKC 5FV1L 1UT2A 4WSJA 3V9CA 2GI0A 3WL9B 5IB3A 1YEJH 4AQ8C 3HBQA 5F7DA 1F1DA 5ACZA 2HG0A 3HC3H 1KB5A 1NDMA 2X3BA 4XVSL 5KEZA 1WIPA 4HYTB 4F57L 3EOBB 2PO6C 3PNWB 2CCWA 2OSLA 5E94A 3UIYA 2FUTA 2AZAA 4RMTA 5CSZA 3SDCB 4LKXA 4PJAE 2BHFA 1P5UC 5DK0B 1F1AA 2PYEE 2WK2A 4KKQA 3JUZA 3B5HA 2G3XA 3MNWB 4WK0B 2VL4A 4YDIH 4ERSL 2NY0B 2VAAB 4UNUA 5DD5H 3SO3C 2DQGL 4LBEA 4XBGB 5FYJL 1FBIH 3FRUB 5E7FA 2AABH 3SYCA 3KPSD 2A4CA 5F7EL 1JZGA 3GK8H 3OGCB 4HPOH 1UD3A 3UAJD 1T22B 1VFBB 3LCYA 3FUIA 3H0TA 3MV01 2PTTB 4NJAL 3RA7L 4DO5A 2J56A 4NOFA 4NP4H 4ZMVA 1U8JB 3NAAH 4HCGA 1RJYA 3SO5A 4NT6A 1TCRB 4IOIB 4KH9A 2VLJD 3QJHA 4MDRA 3QQDB 1FVDA 4KJQC 4I0PC 4X80L 2Y7LA 5DEGB 4ZAKD 2YIHA 3N1GC 3G5YA 4PV8B 1U3HC 4FL4C 4J3UA 2ITDA 3NMEA 2UZIH 4PVNA 4Y5VA 5DFAA 3P9LB 4WU7A 1EAPA 4U6XB 1WFUA 3PHAA 5ANMA 1BG1A 4OCWL 2V17L 4XNAA 2BOCB 4LEXH 5IZ7A 3RFRA 3ESVF 2BH0A 4OZFG 5DJYB 3MREA 1MAKA 1WPCA 5F7LB 4F7CB 2VZVA 1CT8B 3B9EA 2GW5A 4R7DB 4UB0H 3WNOA 4ATWA 3ZTNH 5E08H 5B38B 1V54B 1BXXA 1U4EA 3SKJH 3ZRFC 1Q38A 3WTYA 1N0LA 5JUEH 2FX7H 1I7TA 4XBEH 1H3PH 4EI5B 4MTMA 2VABA 1BM7A 2A4EA 1I3UA 3RWFB 5JIMA 1BZ9A 2WJ7A 4NUJA 2JKRM 2VRQA 3EIFA 3L3KB 3V7AE 4C55A 4KZCA 1AGBA 3L3JB 3AT0A 2XZAL 3NIDE 3GDCA 1JGVH 3OMAB 3KXFA 2Y07H 3CVIH 1R5VA 3SGKC 1HFUA<