3ZYIB

Netring2 in complex with ngl2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
330
structure length
303
Chain Sequence
b'DYDICKSWWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSRVLCTEEYSRWAGSKKEKHVRFEVRDRFAILESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 62
structure length 303
sequence length 330
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00053 Laminin_EGF Laminin EGF domain
B PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3zyiB01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zyiB02
2VVVL 4ISIL 2Q1JB 1FSBA 3FCSB 1IQML 1SZBA 1IQHL 2KB9A 2BQWA 4CSYA 2XBYL 4YT7L 5JBCE 2WG3C 1NFUB 3NT1A 4A7IA 1F7MA 3SOQA 4BXSA 2I9AA 1EAIC 1K37A 2P3FL 2FLBL 2VH0B 3BPSE 4NGAL 2XC4L 2EI8B 2Y38A 1GK5A 4Y7AB 3HO3A 1HJ7A 1HAFA 5CKQA 4PLNA 2GD4A 1PFXL 2P28B 4Y71B 1Q4GA 2BO2A 2H9EL 4JZFL 4PLOA 2J95B 4Y7BB 2XBWL 4Z0LA 1F0SB 3MDLA 1HT5A 3TK5B 2P3TA 4O1ZA 2FZZL 2KV4A 1PGEA 1U8CB 1LPZA 5L2ZL 1NFYB 1DX5I 4FM5A 4ZAEB 1G1RA 5COXA 2J34B 2NPRA 3KQBL 3ENSA 5I46L 4JZEL 3LTFB 1IQEL 3F6UL 1COUA 3IJEB 2UWOB 1YUFA 2OYEP 1G1TA 1FF7A 4E1GA 2KL7A 1CEJA 3SW2A 5JW1A 1EPIA 4ZXXL 2FLGA 1MOXC 3M37L 3KK6A 2WFXB 1U67A 4CUEA 1TLEA 2W26B 1JL9A 4MMZB 1UZKA 3SOBB 2W2PE 1DDXA 3HO4A 3CA7A 1ATAA 3ZYJB 6COXA 3LC5B 3LC3B 2K2SB 1JBUL 5JBAE 2YGOA 2F9BL 1KLIL 4RRZA 1EZQB 1F0RB 1EQHA 1NFWB 3OLUA 2Y5GL 1WHFA 5JB8E 1IGXA 3N8YA 2Y7ZB 2BQ6A 1NQLB 3TK6B 1YUKB 4BTTA 1EPJA 4CUFA 4D0EA 4URTA 1G2MB 3BT2A 3OLTA 1CVWL 3KQDL 4LORA 5JBBE 2J2UB 2P16L 1LMJA 2Y5FL 1QFKL 1HRFA 5IKTA 4RUTA 4NG9L 2RHPA 1YUGA 4D0FA 3RR3A 3KCGL 5K0HB 1YO8A 1KLJL 3FFGL 1A3PA 3MQEA 2XBXL 2MGRA 3CS7L 1IQGL 1CCFA 5L2YL 2DDUA 1IQFL 4M10A 1CVUA 4BTIA 1KLOA 3F1SB 2P94L 1TPGA 1HT8A 3DEMA 4OTJA 1LPGA 3TH3L 4LMFA 2Y82B 2BOHA 4XLWA 4Z6AL 1APQA 1G1QA 1CQEA 4BDXA 4PLMA 2UWLB 2XBVL 1ATDA 2WPLE 2BZ6L 1PRHA 2MGPA 1TOZA 4O02B 1K36A 4YT6L 4X8VL 4ZHAB 2MHPA 2BOUA 5JVYA 1G2LB 2VJ3A 2J4IB 5F1AA 3TBDA 5KIRA 3K9XA 1EQGA 1DQBA 3N8VA 2PUQL 1FAXL 3CFWA 4BXWA 3HO5A 3LN0A 1RFNB 3SOVA 1IOXA 2YGPA 5IKRA 1XKAL 4X8SL 3FBYA 5JVZA 4XL1A 2BQ7A 4AQSA 5E8DA 4Z0KB 2P95L 2WYJB 1NFXB 1APOA 3HS6A 2ADXA 2UWPB 1EGFA 1P0SL 2W2ME 2VWMK 4MMYB 3TZIA 1IQIL 1MQ6L 4RRXA 3U7UG 2VWLL 5L30L 2W86A 2XC0L 1NPEB 5KN5C 5F19A 3ZYGA 2Y81B 3POYA 1ADXA 3PGHA 1LPKA 1O5DL 3BT1A 1IQKL 2XC5L 4ZH8B 3Q3KB 3LN1A 3LAQA 5CISA 4D90A 3N8WB 1P9JA 4RRYA 1NZIA 1C5MF 2WPHE 3KL6B 1Z6EL 1EPHA 1IGZA 1UZJA 1WU1B 1I0UA 2OYUP 1HREA 4JYVL 1HZ8A 1EBVA 2EI7B 2BMGA 3TGFA 4RS0A 1IP0A 1XKBA 2WPKE 3HPTA 5JB9E 2WPME 1ZAQA 2W2QE 5CKMA 3GCXE 3CENL 1KSNB 1XDTR 3ASIA 1BF9A 1V3XB 4ISHL 2FLRL 2K2TA 4COXA 3M36L 1EMOA 2Y7XB 3NTBA 3N8XA 2P3FN 4PH9A 1M1XB 2J94B 3U73A 2WYGB 4Y79B 1B9WA 3KQCL 4G1MB 2VVUL 4X8UL 2VWNL 4C16A 3NTGA 1N1IA 2I9BA 3GISX 1IQLL 2PR3B 2BOXA 4Y6DB 2VWOL 2RNLA 3R05A 1LQDA 3N8WA 3LIWB 1N7DA 1NT0A 4AQTA 2W2NE 2EI6B 3V65B 2W2OE 5CKNA 3H5CB 5FDQA 3ZYIB 2P3UA 2P26A 3N8ZA 1J9CL 4BTUA 2VH6B 4X8TL 1W7XL 2TGFA 1DIYA 2CJIB 1EMNA 4TGFA 2Y5HL 3IITB 1WHEA 4JYUL 3N8YB 1HX2A 1ATBA 2B7DL 5IKQA 1L3YA 1XFEA 2P93L 2PHBB 4MMXB 3QMOA 5IKVA 2JKHL 2BOKL 1DVAL 1YGCL 3EGFA 1UZQA 3V64C 4BDWA 3C9AC 2WG4B 4Y76B 3NJPC 5EGMB 1OB1C 1EPGA 2WFTA 3QCWA 1FAKL 3ELAL 2M74A 1MQ5L 2W3KB 4M11A 1IVOC 3GCWE 1HCGB 1JV2B 2RA0L 2VVCK 1W8BL 1L5GB 1HAEA 1FFMA 4JZDL 3KRKA 3KQEL 3HS7A 3HS5A 1FE2A 1X7AL 3LTGD 1UZPA 1IOEL 2G00L 2WPIE 3QH0A 3Q7DA 2Y80B 1PXXA 1Z6CA 1URKA 2AYLA 1IQJL 1AUTL 1CX2A 4RRWA 4OTYA 1IJQA 1CCVA 2WPJE 4NA9L 1G1SA 1ATEA 1F7EA 2J38B 4OVEA 2D1JB 1PTHA 1KIGL 3P5BL 4YZUB 1FJSL 2W3IB 4ZXYL 4CUDA 2FD6A 4XBMA 1IQNL
chains in the Genus database with same CATH superfamily
5SV8A 3ZFEB 1MZ6A 5DDJ2 4YW4A 1MEC3 5DG2A 3ZSJA 4RGKA 2ZCWA 4KNCA 3APBA 2H6CA 1FSBA 2WFPA 4L2NA 2W9XA 1LR5A 2DBIA 3KT1A 1IQML 2X8KA 2ID4A 4NMIA 5FZAA 2XBYL 1V00A 2VOKA 1XBFA 2K0GA 3ES4A 5B4NA 5FLIA 1NFUB 1CAXB 1CZSA 3NT1A 1RUC2 2WT2A 3GHNA 3O0XA 3UETA 4DNYA 2DFCA 3PVOA 4DUVA 1RUJ2 4I3PA 3ZN5A 2X5IB 1UQXA 3T30A 3ZXKA 2R071 3AZVA 1AXZA 1PGW1 4QB1A 5A3MA 1DG6A 2A3XA 4H7MA 4FOQA 2EI8B 4HVOA 4IEYA 3K4AA 1XE8A 3VN4A 2Y38A 2D97A 5A1LA 5KBFA 5E88A 4KWUA 2GN3A 4AHXA 1RUD2 4Y7AB 2BP6A 1HAFA 2RDRA 3VBRA 1HJGA 1VALA 5EHDA 1O3QA 4NROA 2XLFA 4PLNA 3CBNA 2PELA 4YVSB 5BNNB 4M3CA 4FPFA 4LO7A 5FYYA 1XU2A 2Y6FA 2YROA 3DECA 1H4HA 2JG9A 1OC1A 3IB3A 3W59A 5F2WA 1US2A 4AHWA 4LIVA 1UOJA 5A6XA 5LATA 5IVBA 4IEZA 4MGIE 4AI2A 2OPWA 4F3JA 3VD9A 3OBZA 2VC9A 2GH8A 3WLUA 4CXXA 2J95B 2XLGA 4IV1C 3NAPA 4PDWB 2CU5A 1UY3A 3CF6E 5FYHA 3WXPA 1RITA 5A7PA 1O3SA 1IPJA 2HWB3 1L3JA 1PZ9A 3TK5B 3SEEA 2P3TA 2QJVA 1VBA3 4MGTA 3DPRB 2A1XA 1PGEA 3A22A 3TNQA 1U8CB 4JDOA 3I3MA 3GBFA 4MHUA 3J7HA 2XKPA 3AK0A 3SH5A 1D4M2 2O0OA 4FM5A 3KS7A 5A3TA 1ZRIA 5IK5A 2Y6JA 2LS6A 1NXD1 4GWMA 2Y60A 1UW8A 4M4RA 5IVVA 5J48A 3VLBB 1UZWA 3ZXJA 2G9ZA 3JD71 4JKKA 2HEVF 4MGQA 1N1VA 1IQEL 3WP3A 3WW3A 3J9SA 5LBBA 2PLV1 3H1WA 5DAVA 2H0BA 1UPIA 4XQDA 1CX1A 1GUIA 4XUNA 1YUFA 4NJ4A 2ZABA 2E53A 2DUPA 1IHMA 2YC2A 5JLVA 1RUOA 3VZJA 2KL7A 3WY6A 2DTYA 5JW1A 5FPXA 3B69A 2O1QA 2FLGA 4H3WA 1E5HA 4BHPA 2WFXB 1U67A 1K5JA 4AFCA 2DBNA 1AJOA 3AKSA 4HOOA 4PQ9A 4AEDB 3NV1A 1JL9A 3ZYPA 2CHHA 1PVC1 4HT1T 4CDUA 3OUJA 3B9IA 5FPAA 3BOPA 2RV9A 1BBT3 2JJ6A 1LU2A 1V6NA 2YY1A 3TOJA 4CA9A 2KA3A 1BVVA 2EIEA 3I2HA 3LC3B 4XQWA 3GNEA 4XOGA 1UYYA 3K77A 1PNFA 5H9QA 5A3OA 1I3HA 1VB2A 2K9ZA 2JDUA 2MNGA 4E27A 3SQOA 5K0UA 4PIXA 1SBFA 3MLJA 5FZFA 3OLUA 1I1EA 4BXSV 2VOXA 4XAAA 3AKRA 3DYOA 1I6XA 3OPWA 1H2NA 3M2MA 1GP4A 5EJ1B 1ASJ3 2Z2SB 3TN92 1SCSA 4IW3A 3F2ZA 2W39A 3OB8A 4W50A 3J7LA 3KHCA 4O9EA 1JYWA 3NNMA 3W21A 3MW4A 4OI4A 4LOSA 1BK1A 4IEUA 5FZHA 3VBSA 5GJ6A 1AYM3 1DU3D 1Q3EA 1DZTA 5KHIA 3IBMA 1AX2A 2GP3A 4BTTA 5FY7A 1WLCA 2YPDA 4HSJA 3PHMA 1JYTA 5E89A 3WSOA 3JQWA 1QJEA 4D6RA 3LEGA 5JVVA 4QGLA 4QHZA 4URTA 3ILNA 3D6EA 4AWDA 2P17A 5BXXA 2JDPA 1WLDA 4AF9A 4Y1ZA 1LJ7A 1SQ4A 2I07B 3C3VA 1ND3A 2RDQA 5C4WA 5J98B 4GXLA 3JD73 5B2GB 3MPBA 5GZDA 1HRFA 5C9AB 5IKTA 3H9AA 2PLV3 2AR6A 2AUYA 4J25A 4LPLA 3RWNA 4YNIA 3SITA 1ULGA 3I3DA 3MGUA 3OUIA 1O4YA 2RR11 2VVDA 2D6OX 3H7JA 4CU9A 2Q0AA 1Q8SA 1BZWA 4XFCA 1W0NA 4FAGA 1YO8A 1RUI3 4I2OA 1UY1A 3T2OA 3IT8A 1WCUA 4R9BA 2F17A 2UWCA 1LNSA 5FXXA 1IS5A 1MPXA 2AC1A 3HVDA 3KF5A 4KQ7A 5FZ9A 2VMFA 5CNAA 2ORXA 2B9UA 2CV6A 3MLLA 3ATGA 4ZXEA 5JUVA 1COV1 3V0AB 1R083 1H1MA 2CL2A 4NR1A 4BDVB 4QXKA 2RVAA 3JXSA 3T4HB 4QU1A 1G9CA 2DDUA 1IQFL 4M10A 1ZBA1 1PVC3 1N3QA 2PHTA 3QBQA 5F37A 5LCWL 1WCSA 1IG3A 4FFGA 1KLOA 1QJU3 4NIHA 4RD7A 4WM8A 3ZYFA 1TPGA 4XJ9A 3LZZA 2VZSA 4EN9B 1LRHA 2UYBA 3K51A 4R9DA 5AFEA 4F83A 2DCZA 1GNHA 3VDCA 4OTJA 3U10A 1JZ5A 3ITQA 5ABJC 4Z6AL 4LHLA 3I2IA 1ND2C 1OPOA 2DCYA 3J26N 3KCXA 4UAPA 1PO11 2ZKNA 4Q8LA 4W6YA 5FYSA 4COUA 5FY9A 5H9PA 1ATDA 5FZLA 3CZJA 2DYCA 1FATA 3K2OA 1S55A 1KD7A 5FXVA 3RPQA 1ULPA 2VMHA 2Q5TA 2WBKA 5JOYA 4TTGA 2UWBA 2C9KA 4O02B 3VD7A 1LOFC 3AVSA 2MHPA 1B09A 3OBTA 5C3QA 2VECA 5DUWA 1G2LB 3CL1A 1G7YA 1OHFA 3URFA 4DY5A 2WA3A 1AF9A 5JPMB 4EJRA 2D6MA 4FPCA 5KIRA 4YVWA 3VHPA 1EQGA 4BISA 4DEVA 4IL7A 1BEV2 2FDFA 4AAPA 3LA3A 3N8VA 3W5NA 4YGBA 3G7DA 3MIBA 2YG0A 2PUQL 3LOBA 4DRVA 1V6JA 3BN6A 1AYN1 2R6QA 2ZZJA 1BBT2 2J7MA 3CFWA 3SH4A 1LGBA 2DUOA 1UZYA 1UY0A 2WNUB 4I02A 1RFNB 1SFPA 3K3NA 5FCCA 1CIYA 1NCRA 1QIQA 2QQOA 2B4KA 1UZ0A 4QX3A 2IUWA 1IOXA 5IKRA 1OOPB 2ZX2A 3B02A 2D3RA 4GALA 2OA2A 4TXWA 4DRRA 1S0JA 2BWAA 2RR13 3FBYA 1FMD2 2W94A 1U5YA 4DIQA 5FZBA 1OQDA 2PHRA 4ISQA 3C2UA 3R4SA 1IPKA 3HQXA 4NE9A 5G04L 3VDDC 1UF2C 2WFF2 4KWJA 4ASKA 1RYYA 2P95L 1APNA 2WYJB 3MPPG 2ZMLA 3MV01 4LIUA 5D2AA 2D98A 3NNLA 5FYIA 4EZHA 3B01A 2GP5A 3HN3A 4FPYA 4Y4YA 1QOTA 2VE1A 4Z82A 5J37A 3SLIA 1IQIL 1RUE2 4RRXA 2VUAA 3WNKA 2PXJA 2DCJA 4NPRA 2RJ2A 4NPLA 4JTOA 5L30L 2W86A 3WINE 4A6SA 2VMCA 2XJTA 4YW7A 4YZ5A 3DL3A 1W8UA 2Y34A 1JS9A 1SLTA 5JXJA 2V72A 5F19A 2Y8KA 3H8UA 5DQ0A 2DWRA 1S0GA 5IVCA 1EUTA 3B3QE 4Q2FA 3WR0A 4ET7A 5C3SA 3BT1A 4YZ1A 1KDKA 1NCQB 3Q3KB 1W6PA 1PO13 1R64A 2JXAA 1VBD1 3LAQA 4LXLA 5CISA 3FWEA 2NN8A 1F35A 4AEKA 3V0BA 3KSCA 3OOXA 5D8AA 1NZIA 5C8CA 1PMHX 2PAKA 4MOAA 4BLJA 3FFQA 1Z6EL 3I59A 1EPHA 4JGYB 2FD8A 1D2SA 1YI7A 5FY0A 3RMYA 3BVCA 4I0WB 3D8CA 3CHXA 1W8OA 3N7JA 2OXBA 3GM8A 2JE9A 3I49A 1HREA 4JYVL 5GLVA 2J1RA 1QNWA 5FPZA 5FKBA 3WP4A 3MV11 4FOYA 3DGTA 2EI7B 1JYCA 4M3CB 2VNVA 1JZ8A 4ZU4A 1PZ8A 3WG4A 2JG9B 1XKBA 3HPTA 2EVXA 1O59A 1ZAQA 2E7QA 3T0DA 2UY8A 1EP0A 3JUUA 1AYN3 1SBDA 3CENL 4CE8A 1KSNB 3ASIA 4HK8A 4B3NA 2V5YA 1J3RA 4OMCA 5I8SA 1QF3A 3HEIA 3LF7A 4R9AA 4BK4A 1POV1 1ULCA 3WF3A 4DO0A 3VD4A 5A33A 4DOUA 1MS8A 1W6QA 5LK7B 4NRQA 3RWKX 1R091 3MF6A 4P5HA 3ZSKA 1C8NA 3HJRA 3HD8B 1BMV2 3RI9A 3DV8A 1EMOA 1SLIA 5G05L 2WC2A 3ZFGC 3NTBA 4MXWA 1YYNA 2QQIA 4JV4A 5L7OA 2J94B 3OGJA 4RQPB 2WYGB 5I93A 3P3PA 4LUKA 4XF1A 5F9TA 1FYUA 3KQCL 3BALA 4H2AA 4GB32 4YW2A 1OF3A 4UW5A 5ANNA 4X8UL 5F2SA 3OY8B 3S6XA 2J1VA 2W1QA 1AL21 1KRIA 1RUG3 2ARXA 1W28A 1T6GC 4IV1A 1ZBE1 2D44A 4YRDA 4MZUA 4Y6DB 1E5IA 1V1IA 2YC0A 2Y6HA 2XL9A 2RNLA 3WQBA 2XHKA 3LPGA 3ZXLA 3I3BA 2VUCA 4CDWC 3J8F1 1F4AA 3R05A 1UY2A 3N8WA 4RYDA 4UW3A 2E51A 2WZR1 2OKXA 2QVSB 3WX5A 4DUXA 1SCRA 3ZXEA 2YC4A 3HBKA 4HBNA 2WAAA 4SBVA 4AQTA 4CCKA 1QJFA 1FPN1 2E33A 4XILA 3O1RA 4YLZA 2EI6B 5AC91 1O8SA 1H8VA 1VBB2 4ZZ5A 5FPBA 3FHQA 2WZEA 1W06A 3ECQA 5FDQA 4P08A 4XC9A 3ZYIB 2EXKA 1VRH2 1S0BA 2DTWA 1YFUA 2ZBJA 3O1VA 4Y1VA 1AR71 4BTUA 3WF0A 3U1XA 2YZ4A 5C6CA 2PHUA 5K0UB 2VCBA 3EB7A 3ZN4A 5FMOL 4WZFA 2ZMNA 2BYVE 4KU8A 5FXZA 3VBRC 2BTVC 1EMNA 2CWSA 4TGFA 3H3UA 3WNLA 2XG3A 2WRAA 1YFXA 2AACA 4Z2WA 3UYJA 3PURA 4QGMA 1MACA 2CSGA 3ZFFB 3ZXFA 5ANQA 5FZ1A 3VBSB 3FLTA 5F1RA 3NNJA 4KGGA 3POGA 1LHWA 1XFEA 2P3KA 2P93L 1R093 5IKVA 4GMP0 4IV3B 2ZHMA 3NAPC 4P00B 1DVAL 4FP2A 5IVYA 5LA9A 4BWOA 4EZ4A 5IYYA 3V64C 1W90A 4Y76B 3OEAA 1LMMA 1H6YA 1HB1A 2CY6A 3I3QA 3MZHA 1NOVA 5CYYA 4B8EA 4AFMA 1DGRN 1GZCA 3CIHA 1EPGA 2AGSA 1GZWA 1FAKL 4ORFA 1ND3B 3ELAL 4XJ8A 5C4WB 4CTEA 1H30A 4YW5A 2DURA 5T5LA 4M11A 3GCWE 5FZEA 3B00A 5FPLA 1AL23 3J4UH 3FN9A 5LY1A 2WQZC 4FPLA 2XB6C 4D7TA 1HRV2 3MW2A 2WLPA 3OG2A 1HAEA 1OLRA 3W5MA 4MGYE 2WLQA 1FXZA 1QJY1 4JZDL 2Z69A 3DCQA 5TSWA 3AL5A 2ZEYA 3P5BA 4P9XA 4IERA 4COWA 1RC6A 4N43B 3ZXDA 5T52A 5DDJ1 3S5QA 3VKFC 3KQEL 4N9IA 3JB8A 1AX1A 4Q4W2 2XUEA 3OGRA 4LHKA 2WNOA 4G9SB 1Z0HA 4EROA 1JOPA 4Y22B 1G9DA 3MI8A 1UMZA 3NJYA 3UV9A 2FCTA 4N53A 1Q8OA 4ZU7A 3QH0A 4CDXC 1QKQA 1DZRA 2XJRA 3QD6A 3UGHA 3VHRA 3VZNA 5AC93 1A34A 1NY72 1BYHA 4GU4A 2J1SA 1PXXA 1Z6CA 2AYLA 1MQTA 1RUC1 1X36A 3MF9A 3P3NA 4OHVA 4WM8B 3WG3A 2JDHA 4CDUC 1FOD2 2WQ8A 1RUJ1 5IVFA 5HCAA 3UGGA 3H50A 1AR73 3M3CA 4RGGA 5ERLA 2DCTA 2XGXA 4P02B 2QDNA 2WIIB 3T0BA 2OW4A 4OTYA 2RM22 3O0WA 4QKNA 1IJQA 1PM7A 1UKRA 3DXUA 3GYDA 4D8MA 5E16A 2C0ZA 1ATEA 1RUD1 2TNFA 1OT5A 4YM2A 1Y7BA 3M3IA 2J38B 1WD4A 4Y1UA 4AVSA 4YSFA 2A5ZA 1IS6A 1L7LA 1ST8A 2W3IB 4EYUA 5F5IA 2TBVA 1TMF3 1NKGA 4CUDA 3INAA 3LB9A 4P9IA 1LODA 2YV8A 4IEVA 1MZ5A 3NNGA 3O0VA 2JWPA 4YVWB 1SFNA 1W2NA 2VVVL 2BGPA 3I3EA 5ABJA 3GCXA 2IFWA 4QD2A 2HOXA 1YC61 3DYMA 4TN7A 3SKVA 1ND2A 4W8JA 3FMGA 4XURA 3TRSB 4QX7A 2LUWA 3T08A 4LOTA 3P6BA 3C8XA 1ZZ9A 1C1FA 2V73A 3O12A 1IQHL 1NLQA 2KB9A 2BQWA 1ZZCA 4CSYA 1N1SA 2WA4A 1SPPB 3JBG1 5JBCE 3NVCA 1V6OA 3PIGA 4ISRA 5IAVA 2QQVA 3SISA 1PIV3 4AI0A 4CEYB 4CEWC 5DMYA 3HNBM 2ZKLA 3IM0A 4HFSA 4A7IA 4PI2A 5FP4A 2UWAA 4LE3A 1MZEA 2ARAA 2J1TA 3T3YA 2I9AA 1QJY3 1W6MA 2AENA 1EAIC 4CU7A 1QU0A 2X10A 3W58A 3BPSE 1DBNA 3WDTA 4NGAL 2XC4L 1L7QA 4K1YA 4UBHA 4Y33A 5DDJ3 3WV6A 2CGPA 1JW6A 3HQUA 3HO3A 5FJKA 1AR82 2NM1A 4W65A 1V70A 3U07A 2WWUA 4PBOA 4Y5TA 4NHMA 1PMJX 1O3TA 2BWCA 4LO6B 2GD4A 2JDAA 3MFAA 1V6IA 5K9YA 2P28B 2WNVA 1Q4GA 2WSVA 1EAH2 2H9EL 3WNMA 4Q29A 2VO5A 1QNYA 1IZ3A 1CIWA 3MBWA 5A1FA 3H1YA 1GOFA 4Y7BB 2C24A 2XMLA 3VDDA 4QWNA 1FI2A 2DUQA 4QHOA 2GAUA 3DXTA 2Y6GA 2Z5WA 2AEZA 1J84A 4GH4A 3OSDA 2BOJA 3T2PA 4YM1A 1W6PB 3WEZA 2VW2A 1YJLA 3LCPA 4XW3A 1XE7A 1H4GA 1RUD3 4CP0A 1GWMA 2OQ7A 4A2UA 2G1MA 3OPZA 4JKLA 1FV3A 2D3SA 1ZYBA 4OYUA 5KR7A 3V0BB 1GZTA 4P14A 3I59B 1BJQA 3IIIA 5GZCA 5COXA 2J34B 1WW6A 4HSLA 5D21A 5IAXA 1JZ2A 5CAZA 2ZGQA 5FZMA 3BPZA 3IWZA 3LTFB 3IPVA 4NAMA 1MEC1 5JR2A 5EYXA 4ATFA 2XBO2 3WG1A 1GLHA 5C7GA 1WLTA 2Y64A 2A3YA 4BE3A 3F6UL 1A8DA 4A7ZA 3IJEB 1TZOA 1OH4A 3I54A 2BEOA 2ZJCA 4YM3A 4TZDA 4EWDA 4TLFA 1W2OA 2XJQA 1FF7A 1Q8VA 4E1GA 2QNKA 3F95A 1JUHA 5KXDA 2NP0A 1UZVA 4LKFA 2B42B 2KXLA 5DUVA 3USUB 1MOXC 5T5JA 3M37L 5JWPA 3BTZA 1YQCA 4LBQB 2VOWA 1D4M3 4CUEA 1W6NB 2GN7A 5A33B 1SLAA 1W6QB 1O5UA 1U5IA 2ZXQA 1K12A 4NO4A 2W26B 1UZZA 3C7HA 4RS5A 2BGCA 1NCRC 2GC0A 3PUQA 1OF4A 1JMUB 3ZOIA 4MXWB 3HO4A 2X29A 3BUCA 2B8MA 1LK9A 1KITA 4QPIA 4C90A 1S4CA 1WA4A 3ZYJB 1MVEA 3I8TA 3LC5B 1RINA 4QPGC 5CVRA 1JN2P 1LHNA 2WKKA 2QZ3A 3LIHA 2R7EB 3R4UA 3AZWA 2YGOA 2XOMA 3LKJA 4QB6A 1XE0A 4AI9A 4RRZA 1LGNA 3MW3A 4PI0A 1EQHA 1NFWB 4FPEA 3VD3A 3WQ7A 4IV1B 4UYBA 5FUNA 4QGNA 5LY2A 3FUQA 3RZLA 1AXYA 3KT4A 4OQ8A 1UYXA 4YG3A 3AZZA 1IGXA 5FMCA 3S5AA 3ZFGA 5E8AA 1GP5A 2BQ6A 3FHAA 2PMWB 1Y43B 4QKBA 4FFIA 4YFZA 3WUDA 3TK6B 4LO4B 1SEFA 4JRAA 1X9TA 2A6WA 3K3OA 3UESA 1KDMA 2P5BA 2W68A 2VCAA 4LULA 1UU4A 5A7OA 5FP7A 2A6VA 1PGL2 1DP0A 5F5QA 3ZSLA 2BW8A 3FJSA 4D0EA 1BQPA 1X7NA 1OURA 2W1SA 4N8MA 2QQMA 3SH3A 3Q9OA 3THDA 4EQVA 5HV0A 1G2MB 3BT2A 4H55A 4ARYA 2W5FA 2XPJA 4NAOA 5I0UA 5J36A 2HH9A 4LORA 3ACFA 1ZZBA 3PUHA 2J2UB 2UYAA 5JI7A 1ZZ6A 4YPJA 5D8AC 2PQQA 2HKXA 2ZGUA 3FLRA 3TN93 4BQ5A 5C8CC 2P34A 1HRI2 1SMVA 3TNPB 2WYSA 1FX5A 5KC5A 3N9PA 4CDWA 4KU7A 5C5TA 2IXCA 1CJPA 2BVVA 2D7FA 4AFBA 5IFTA 1G6NA 2VPVA 3WHTA 4ASLA 2JX9A 5FV3A 3RR3A 1DYPA 2BNNA 3WF4A 4J1WA 3M1HA 1KLJL 3FFGL 4GA9A 2OZJA 2E7AA 4D6QA 1BEV1 3AMQA 2ZGOA 4UT5A 3A7QA 1OFSA 1W3XA 1RTVA 4B7EA 4IGOA 4QXBA 4CYDA 1G9BA 3FE5A 2D40A 4K1ZA 3ZDSA 1BBT1 5A32A 2OS2A 3HAGA 3WDVA 5FZOB 4CRQA 3POSA 3O7OA 2DCKA 3FC0A 3CMGA 3WW1A 1HV0A 1WLWA 1V6MA 5EXOA 5L7OC 1VE0A 1VBC2 3KM5A 3RZKA 1FMD1 4M3CE 1VBE2 3UKTA 2RS12 1ASJ1 1F2NA 4ZS3A 5BV6A 1QJX2 2GNTA 2WFF1 4META 1W3VA 3WNPA 2YB7A 4BDXA 4D7SA 3ETPA 1LU1A 4OFGA 3OGGA 1H0BA 4A4AA 1AYM1 1PRHA 4NRPA 1HX6A 5FMBA 5A6YA 2CAUA 4BH9A 3V64A 1GKBA 3TEXA 3USSA 2R0FA 2W52A 4XJWA 1K36A 4ZHAB 4LA3A 4AVAA 2D93A 4RN5A 1CD3G 1DHKB 2GMMA 2ZEXA 5FZOA 5SV5A 3VB9A 3D82A 2WS92 3K4ZA 5F1AA 1DCSA 3TBDA 3H3LA 4X6QB 4BQYA 4AGRA 3VKNA 2ZPXA 4MO3M 2BPA2 4OMDA 4BB3A 3E6CC 3OGVA 2LM3A 2XQXA 1FAXL 2VAUA 2WAOA 2XJSA 3RI8A 2UY9A 2ZX3A 1RMU2 1MR5A 3LEIA 4LKDA 4NOTA 4G4FA 5FIXA 1TNFA 4YM0A 3N9QA 3SOVA 1ODNA 5CFCA 3FX3A 3HNMA 1YQ8A 1D2QA 2JG8C 4DY3A 2SLIA 2BUKA 3I2DA 1IKQA 2JICA 4WVMA 5DAXA 1WMEA 5BNPC 5HI0A 1RUI1 2VBDA 3ZX7A 2WSUA 5JVZA 1HQNA 4XMAA 2Q8CA 4XL1A 2BQ7A 1KJRA 5E8DA 1GFF2 4K20A 4CDXA 1PX4A 1BEV3 4UWDA 1R081 4XFGA 2YMZA 2QTWB 4OCTA 4EN7B 4XFAA 1UL9A 2N7GA 1APOA 1CN1A 3HS6A 4WV8A 2XWBB 2ADXA 1X8EA 3IDBB 4LBKA 3N35A 4AI8A 4FOWA 1P0SL 5FO8B 4LA2A 4MMYB 1QJU1 3H0OA 1LKNA 2D6KA 4INDA 5ABJB 2D43A 4LBNA 3S7EA 1YWKA 2P3JA 2WN2A 2ZACA 3ACLA 4BK5A 1REDA 1ND2B 4KWKA 1CR7A 1BMV1 3VDBA 3RG0A 2YDEA 2HBTA 5KN5C 2GNBA 4UOJA 1FMD3 2QQJA 3VZOA 1ULEA 3POYA 3PGHA 2Y6LA 5JAXA 1DQ1A 1QHDA 4CUGA 1O5DL 1SLBA 1WCDJ 1IQKL 4XACA 2WFF3 5GLZA 1RUH2 1PX3A 2VQAA 4MUVA 3GJBA 2XXZA 4GB31 1SACA 4CCLA 5KHHA 1LB2A 1ZA7A 1EY2A 2W08A 1XNCA 4XAEA 3BU7A 3AFKA 3JQXA 4XUPA 4OQ9A 4ZS2A 2HWE2 1P9JA 1KEXA 1C5MF 3M7AA 3R6SA 1RUE3 3AKQA 1C5HA 3AC0A 3KCYA 5D1IA 4MH0E 1JU3A 3ROUA 2L9LA 5FWEA 2FQPA 2IZWA 1I0UA 2VNOA 4QQHA 4XF9A 4JQRA 1EBVA 4HN0A 4D94A 5FMOS 3VBUC 4RS0A 1IP0A 2XJUA 4D0QA 4CEWA 5FLHA 1G9FA 4N53C 2WPME 1F4HA 2W2QE 1UIJA 3KLSA 3WW2A 3ZR5A 4JKMA 5C8WA 5CKMA 3WQ1A 5LA1A 2Z42A 1XDTR 4P9WA 2C1FA 1MQTC 3MIEA 5JZGC 3ZKUA 1BF9A 1TME2 3VDDB 3IAQA 3NQHA 1W05A 1V3XB 1RL3A 1D4VB 2GNMA 1X50A 2J42A 4EN6B 3ZKYA 2K2TA 5JXIA 2VZVA 3NO8A 4M01A 2A6YA 3C7EA 4S2FA 4COXA 3ETQA 3NJZA 4AQ6A 2HEWF 1N1YA 4HKLA 2Y7XB 3LA2A 3CNAA 3FUOA 1JHNA 2P3FN 2YGLA 3H42B 1M1XB 1OKQA 3ORJA 4QT6A 3VHOA 1HXS2 4ASMB 2XVGA 4Y79B 1GWKA 4A42A 3H8RA 5IUQA 2K2SA 5A6ZA 4G1MB 5HCHA 5FY5A 5HCBA 4XCAA 3IPVB 4BIFA 3B93A 3U4XA 2VWNL 2CNAA 3DF0A 3GALA 5F32A 1K5MA 5H9SA 1CJDA 4Q4V2 4CU8A 3OEBA 1BCXA 1IGOA 1W6OA 1C4RA 3HPNA 3ZLIA 1VRBA 4S2GA 4XXPA 4B4PA 4QQLA 2FCVA 3J7NA 3Q8AA 4XABA 4XHXA 4Y3OA 4GQ7A 3OYWA 4NIGA 1AUYA 4M00A 1UAIA 1W9WA 2R32A 2XUMA 1D7PM 3AP9A 3PU8A 5FDBA 3NRUA 1LQDA 4FBFA 1W2AX 2VUDA 5LASA 3EO6A 4P9GA 1N7DA 3M3OA 1GZ9A 2EA7A 1NT0A 2VH9A 4GB33 4QDRA 2VCCA 2ZGPA 1DQ6A 1JHJA 2VVFA 2ZTNA 5HXMA 4O9GA 1GNZA 4NIIA 3WW4A 4FTSA 3AL6A 3WDWA 1HB4A 2W2OE 5CKNA 1Y4WA 1RVF2 1CAWA 2RS32 1HB3A 1XNTA 1HRV1 2WO3A 5DZGA 5FY8A 5GALA 1P8JA 2P26A 4GMP1 4L99A 2ZGKA 4P5YA 3RZMA 4D7YA 2OPKA 1DYOA 4FAHA 1J9CL 3N9OA 3GBGA 1GSLA 1HV1A 2BZDA 5C3PA 3VBHA 5EIYB 5IK4A 1W7XL 3VKLA 5DAWA 3UJOA 5CG8A 1RUF2 4M4PA 4BZ4A 2AH2A 3H8OA 4Q4W1 2IXHA 5IVJA 1W8NA 4WM7C 4PCRA 2MHFA 3MIGA 1QEXA 1B35C 2PHWA 3AFGA 3ZXGA 1LEDA 3PL0A 1J59A 2WNVC 3ZFGB 1O4ZA 1H8TA 1VAMA 4ZHNA 1VJ2A 1OLQA 3TB0A 4ZZ8A 3PJYA 5IKQA 1UYPA 1VBB3 2Y0IA 3E97A 3MEPA 2XDVA 4D3WA 3LPFA 4QPGA 1IS3A 1VRH3 1JXNA 1QJZA 3LSEA 4ZY9A 2CTVA 2BOKL 3J7MA 4GH4C 1UZQA 4BDWA 3C9AC 3HT2A 4R52A 1X33A 3FZ3A 4EV0A 3E5QA 2R072 1PGW2 4Q26A 5EGMB 3KT7A 1MS4A 4I0BA 3D5OA 5FTTC 1OB1C 3MIDA 2VOTA 1DQ2A 1RUG1 2MEV2 5CADA 1NQJA 1NYWA 3KV4A 2P3IA 3BYWA 3CO2A 1IVOC 3ST7A 2XVLA 2R042 2Q4SA 3NJVA 2BDRA 4UBGA 4CDWB 3D4KA 1D0HA 2VVCK 3I2GA 4MYEA 1DDLA 1W8BL 1XYPA 3AYAA 4J6GA 5A7WA 1U5ZA 2NMNA 3ZO0B 1ZZ8A 2JDKA 2ZHNA 1FFMA 1A78A 3A0KA 4HXCA 3T0AA 3WQ0A 4MLOA 3ZVXA 2ES3A 3ZSEA 1OVPA 1Y9QA 3WVJA 4AEMA 1RXGA 2PHDA 1W8TA 3BKZA 3NV3A 4Y1XA 1SLCA 4MADA 1LTEA 3NKTA 2EICA 5A32B 1UZPA 3Q8EA 2B5HA 1YFYA 4UF0A 2G00L 1IQDC 2GALA 1Z7S2 2VMGA 4K8RB 4MVTA 5FUPA 4AL9A 2ZX4A 3K48A 4KG0A 1YIFA 1W0PA 1MVQA 4XFBA 4RS5C 1AR63 1J83A 2Y80B 2X09A 2XL7A 1URKA 4GAZA 4Q0VA 5FBJA 1RHI3 3VBRB 3VV1A 1HRV3 4A45A 2DU0A 4DB5A 3VBOC 3VD5A 1REEA 2PTMA 1IQJL 4GMP3 1AUTL 1EPWA 1RXFA 4GKXA 4OLLA 4QPIC 1CX2A 4IEOA 3ILFA 1XOYA 4KH9A 1WMFA 5JSOA 1YIPA 2CWMA 3IDAA 5EFUA 1NLRA 4U2AA 4Z2AA 3M4FA 5FY1A 3OD4A 4XBLA 3AX4A 1GV9A 1V0AA 1QQP2 4CP2A 4Q4W3 4BA6A 1XNKA 4NA9L 3M8LA 1G1SA 1VIWB 1Y9MA 4PHZA 1ZX5A 3ZN6A 2EIDA 3BCWA 4R4ZA 3PVBB 1CGPA 3NAPB 3L9JT 4O61A 4DPNA 2ZMKA 4HG6B 1FJSL 1YEWA 4NHXA 3KGLA 4K40A 4WVWA 5HCFA 2W1WA 5M0TA 2HWF2 1WGPA 1JUIA 2O14A 2R1BA 3AYEA 3NV4A 1YNAA 1XU1A 4MGKE 1FOD3 1HN0A 3PVNA 4FOVA 2VG9A 4LBQD 4XBMA 1IQNL 2VVEA 4EN8B 5BNOC 4UFJA 4GIQA 4C8DA 2D6NA 3KQ4B 4CP9A 1FAYA 5F5AA 1JYIA 4ISIL 3QLQA 2RM23 4MX3A 3AXEA 4JZRA 4QX8A 1JH5A 2BQPA 3FHIB 4QXHA 5JSPA 2XJVA 5F3EA 1SZBA 1Y3TA 4HLTA 1CWPA 5EJ3A 3ZYRA 4IEQA 3N4MA 1O8PA 4YT7L 1KS5A 2WNEA 4FPGA 4Q4Y2 5FP9A 3OPTA 3I2OA 1H1AA 5T5PA 4WVMB 1CONA 1VAVA 4BCUA 1WW4A 3SOQA 1PMIA 4GZ9A 1UY4A 1K37A 2QUOA 5CZKA 5ACA2 2P3FL 2FLBL 4CDXB 4HETA 4HVRA 2FCUA 5IVEA 4JGZA 1GK5A 4AK3A 1BKZA 5FZ8A 5HV4A 5KXCA 3HQRA 4CDUB 5FRAA 4RSUA 2Q1ZB 2UURA 2W91A 1OVSA 5FQ0A 5CKQA 2OQ6A 2VNRA 1OLME 4C0HA 4AZZA 1PFXL 5GLTA 1F5JA 3RZHA 2YXSA 3AKPA 4JC1A 3HBZA 2AEYA 2BO2A 4FTBA 3I2KA 2FZ1A 2JG8A 4M0NA 5FR3A 5BNPA 4JZFL 4XJAA 5DZFA 2Q1MA 1HJFA 2GH2A 2HLEA 1SHWB 1DIWA 4PLOA 5LB6A 4LBLA 4XIKA 3AMPA 2W95A 1GBGA 3Q8FA 2E31A 5F6LB 3MDLA 4QDQA 2E6VA 1S0FA 1UNBA 2ZX1A 1V6KA 2ZX0A 2FZZL 4IE6A 4HANA 2I2SA 1AR83 1LPZA 1U0AA 5L36A 4AVTA 1SBEA 5L2ZL 1TMF1 5FP8A 1NFYB 2KD7A 5EV7A 3O1UA 3LGRA 2NPIA 1DGRA 1SLLA 1JI6A 2QQKA 4CDQC 4AI1A 1LEMA 2NPRA 3SC7X 1W03A 3KQBL 1VB4A 1W39A 1EAH3 3ENSA 1O5LA 4JZEL 5K7PA 3C7OA 1JTZX 4UFMA 5A7SA 1F8VA 3RYRA 5FYVA 4E4DX 5K8SA 1COV2 3UK9A 3RRDA 5LRRA 1LOAA 1DGWX 2E7TA 1COUA 4K21A 1ZBA2 4RFT0 2UWOB 4CEWB 4NN0A 2OYEP 1W8WA 5KHJA 1G1TA 4ARXA 4GULA 3KF3A 5L9VA 1CEJA 3O1TA 1PGL1 2ZOEB 1PIV1 3Q8BA 5FMDA 1AR62 4ZXXL 3BOWA 1NG0A 1RHI2 4UI9L 3KK6A 3O1MA 1TQ5A 1QH6A 5FYBA 3H8XA 2H6BA 4BLIA 1TLEA 5EWSA 4A6OA 4NHLA 1IG0A 3BB6A 5CFDB 4NHKA 1ZRFA 5FXWA 4MMZB 1UZKA 5CFCC 3RZJA 4ATEA 2JDNA 3I97A 4YW3A 1YFWA 1ZNPA 2XBO3 2VTXA 4N9HA 3CA7A 5FUIA 4BYYA 1XQNA 3V65A 2XVKA 2EXIA 3CDZB 1PHMA 3VBUA 2PHFA 1ATAA 3PMEA 1GQPA 2K2SB 1OA2A 3GCWA 4X8NA 1JBUL 5JBAE 5A6QA 4UW4A 3UT0A 1NZCA 4B7KA 1KLIL 2IXIA 4Y26A 1V1HA 2ZEWA 1Q8QA 3GXUA 5JZGA 1OI6A 1F0RB 2RMU2 5CB7A 1W6OB 2Y5GL 1WHFA 2XHNA 2J1EA 2VM9A 4PDWA 5JB8E 4DMIA 1J3PA 2A3WA 3SEPA 4CPBD 3N8YA 3DPRA 3OBRA 2ERFA 3QH6A 3IAPA 2P3YA 3I2JA 2QKDA 1YUKB 2JD9A 2LRPA 1VBC1 1CZVA 3WOGA 2HWD2 1VBE1 2RS52 1EPJA 1OA3A 4CUFA 2BNMA 2JB4A 1IPSA 3C7GA 5A80A 1QJX1 3AMNA 4LR4A 2VW0A 4A94C 1CAWB 5F3IA 1OMIA 1CVWL 3KQDL 1QMJA 4QX1A 2P16L 3E6DA 4FP3A 5A3PA 1LMJA 1M4WA 2W47A 1J58A 3G6JB 4XIOA 1QFKL 4RR3C 1SDDB 3IMNA 4RUTA 3U11A 4NG9L 1MS1A 2H0VA 5L73A 4MV2A 2BU9A 1YUGA 1CESA 2HWC2 4D0FA 2WS91 3KCGL 1D4M1 1NCRB 2XJPA 4Q0SA 4QPYA 4AEDA 1WUVA 1ULFA 1X9PA 1CZTA 4JHTA 5DG1A 5FZ6A 1HW5A 3AVRA 2BBVA 4CXWA 4CCNA 1ACCA 4P9YA 3WHUA 1A3PA 3M3QA 5BY5A 2BBAA 1JZ6A 1XSQA 4QPGB 5T55A 1RMU1 2VQUA 5DZEA 2JDYA 2WO2A 4BMEA 4BQ4A 4CU6A 1CCFA 1UD1A 1QY4A 4AE2A 4XDPA 5L2YL 1HRI3 5I0SA 4KI5M 1VBD2 1CVUA 4BTIA 1C8M2 4OI1A 3RGBA 1W04A 5FO9B 3TEZA 3F1SB 2P94L 2ILMA 3WG2A 3GDBA 4I0AA 4WM7A 2JD4A 1LOEA 5E1RA 3BIEA 1POV0 4Q8KA 3POIA 1DZQA 4RHV2 4YARA 1B35A 1LULA 1OUXA 2NYYA 3LQCA 3MIHA 4CCMA 3NMBA 3U75A 2YU1A 2C6SA 1LPGA 1UXXX 2F6BA 2IVJA 1GU3A 2Y82B 1REFA 5FLJA 4OHWA 2BOHA 4XLWA 2JENA 1W9TA 2BERA 4ONUA 4Q4X2 4Q1RA 4BU2A 1CQEA 4PLMA 4UFHA 3VBFC 1CAVA 5A7WB 3WUCA 5I8TA 1W0OA 1K5MC 3O1SA 2ENRA 4YGDA 2CYFA 1GICA 2J22A 2WPLE 3WNOA 2EXJA 2BZ6L 2BFUL 3MUZ1 5E6HA 5FPVA 2ZHLA 5GZEA 2MGPA 1ZVFA 1J1TA 1I5ZA 4OHXA 5J09A 4YT6L 2E63A 3KCCA 3ZSMA 3N7LA 1PK6C 4E8DA 2EIBA 3CJXA 4U36A 2ZGMA 5EJZB 2ADDA 2J4IB 4JDMA 5C8CB 5D8AB 1GP6A 1IKPA 1SG3A 1VBC3 4UF0B 3A4UA 3K9XA 1DQBA 1VBE3 2RS13 3HMYA 2WR9A 3TN91 5FBZA 1QJX3 2A6ZA 2PHLA 2Y6KA 4XVHA 2FDJA 5JMOA 1RUH1 1S2EA 4CUBA 5KWRA 4YG6A 1WD3A 5DABA 1JYXA 5JXHA 3IIAA 3BODA 3EXUA 4BXWA 3HO5A 4L92A 4FSJA 4QU2A 1MS0A 2Z4FA 2PAMA 5AFBA 4XTPA 4AVBA 1XYOA 1S0CA 3LAGA 1R1ZA 2YGPA 1EPZA 5APAA 4DUWA 1XKAL 2WABA 3POFA 2BNOA 3VBHC 4NIDA 2KR2A 2QFEA 2VZQA 4JHZA 4XF3A 3U78A 1WCKA 2OUHA 3ZN6B 4AAXA 3VL9A 4L11A 2WS93 3V0AA 5BYNA 4Z0KB 3LFIA 2DF7A 3CEWA 1N3OA 2Q30A 3AYCA 4GKYA 3PDQA 1OBNA 2HJIA 2QQUA 4QM9A 2VMEA 1NFXB 3J8F2 2ZGSA 1H8TC 4LUMA 2UWPB 3VBOA 2PHXA 1RMU3 2WZR2 3ACHA 3QACA 4NHYA 2W2ME 2RE9A 4PBPA 5L7OB 2VWMK 1VLNA 2OYZA 3T2QA 4KG8A 3ZXAC 4CP9B 5LZ6A 3CZUA 2HBUA 3I2FA 3MIFA 1S0DA 1ZRDA 3U7UG 4HPKA 4XUOA 5HBAA 2P2KA 2XC0L 1J1LA 3CJIC 1HLCA 3HWJA 3R0RA 3D0JA 3ZYGA 2VXRA 3WCSA 2Q8EA 1DQ4A 5HPOA 3W20A 2W46A 1R1A2 3U4SA 4WZCA 1HXS1 3N9MA 3POBA 1ENRA 1UU5A 4ZH8B 3B9CA 3THCA 5IK7A 4HKOA 4FPOB 1CQ9A 2RJLA 3LN1A 2VULA 1Q5OA 2C4XA 2GC2A 1DYKA 3N8WB 5BNOA 2I45A 4QDSA 4Q4V1 1G86A 4R9CA 4CSWA 1QIUA 2R0HA 2VL4A 1JBCA 1IGZA 2G9FA 2Q8DA 3GZTB 4SLIA 5H9RA 2P37A 3LFMA 2OYUP 1HZ8A 1N1TA 2JE8A 3K4DA 4JTNA 5I91A 5LW9A 2HYKA 3W9AA 1OQEA 4ZU5A 2BMGA 3TGFA 1F5FA 4TWTA 4RFRB 2ET7A 1AX0A 1US3A 2JG8B 4BXFA 4BQ3A 5BNPB 1RUH3 5B4XA 1GMMA 5CBLA 1I9RA 1V9U3 4QB2A 1UOBA 5CA6A 1H9PA 1LAJA 4V1PA 5KHGA 2RDSA 4BQ2A 3DKWA 2HWE3 3AXDA 1O3RA 2QQLA 4ISHL 4DZGA 2FLRL 3KV9A 4Z07A 2JDMA 2F4LA 1H2LA 2JEMA 1BHGA 2O8OA 1W9FA 3O1PA 3PMSA 4XPVA 2E9QA 2ZGNA 1G8WA 5F39A 3N8XA 4URAA 4XETA 3KV6A 3RDIA 2E26A 1RUF1 4LQRA 1XNAA 1U12A 3LEKA 3JZVA 4LO5B 2DV9A 1FV2A 1GQGA 1YCIA 5C70A 2R16A 4GJZA 1O4TA 1XPWA 2JIJA 3VZLA 3U37A 3NTGA 1N1IA 1VPHA 1YQ5A 4BQWA 4XJZA 1NA1C 3RYPA 1TME3 1EV12 2XWJB 4MGZE 1GWLA 5C5UA 1GZWB 4QHBA 2ARCA 4XE9A 1KXGA 3ME2A 1NAEA 2ARBA 4XCBA 4BQXA 2XLAA 2CDPA 4MHRA 5CG9A 4CCDA 2WO1A 3MUY1 3FFZA 4Q5OA 1NCQA 1JOBA 2D3PA 5FZ3A 1AR92 1L7RA 2VWOL 2K46A 2H9EC 3IDEA 5IHRA 4LKEA 5J96B 2FDGA 1UU6A 5KC6A 1W8FA 1YHFA 2R062 3OUHA 1HXS3 1S2KA 2OVUA 4XJUA 2AYHA 4FQZA 4CDQA 3E5XA 3LIWB 1PO22 2O8QA 4JGYA 4E4ZA 3VUOA 1CAUA 2IWGB 2MEV1 1LECA 4GWNA 3ZPOA 1RUE1 4COZA 2R041 1WMDA 4ZPIA 3S0MA 3V65B 3VBUB 2E32A 4Q4V3 4YZ3A 2GZWA 2ZEZA 3H5CB 3THPA 5FZKA 4QMAA 3UNPA 1K42A 1QH7A 4N53B 3S57A 3LIGA 4BM8A 2HORA 2Q1FA 1YLLA 2GMEA 1ZRRA 2Y26A 3PJQA 4FPKA 4IE5A 2VH6B 4X8TL 2CGOA 2VXJA 4GU3A 1E5RA 1A8MA 1OFNA 2P4EA 2WL1A 3PIJA 3KVBA 1MQTB 1UO9A 2B46X 4GD4A 1DIYA 4JGZC 4K9SA 2CJIB 4S2HA 3E1F1 4AFDA 5JZGB 4JX0A 3PUIA 2VQ0A 3AZXA 1GANA 2A6XA 2Y5HL 2G19A 3IITB 3BIWE 1WHEA 5F3CA 4L9BA 1QOOA 1XYNA 2WZPP 1YRZA 4IETA 2DU1A 3N8YB 1Z7S1 1OA4A 1ATBA 5LRSA 3GZUC 4QQOA 4QX0A 3ZR6A 2B7YA 3FBMA 5EQUA 1HDKA 2RS33 1RVF3 3ELNA 3JBG2 3N9NA 3KMHA 4FFFA 1A3KA 2ZS6B 4K3UA 4RQPA 4L0PA 4FTEA 3QMOA 2JKHL 3WT3A 4M0HA 4R4XA 4B1MA 3EGFA 4FPHA 3OY8A 4L97A 5A7QA 4XFHA 1OD3A 1RUF3 3POEA 1WZXA 1QQP1 2YBSA 3B94A 4BQ1A 4LT5A 4TSVA 1XJAA 3V56A 2R49A 2WFTA 3GF6A 3QCWA 1ONAA 4LLOA 5IATA 1M06G 2BGOA 3ZFEC 4FXKB 1RJ7A 3NWKA 3AM2A 1JV2B 4QX2A 2RA0L 4LHNA 4NUBA 2FDKA 2HEYF 5FK8A 3NSTA 2A70A 1W9YA 2HWF1 4OUSA 1ENSA 2IXJA 1T6BX 4CCOA 5FPUA 3MLKA 3KRKA 2YYOA 3RJ2X 2WJSA 4UFKA 3S7IA 3UGFA 3AP7A 5FYMA 1V9U2 1OQ1A 1ULDA 2OUJA 2R073 1IOAA 5J1XA 1W6MB 2BSFA 1POQA 1X7AL 2C26A 2X5IC 2MEV3 2WPIE 2BOIA 4F8AA 4LKSA 3ZM8A 2PA7A 3O1OA 1UX7A 4Q4Y1 2R043 4RR3A 3CQOA 3ACGA 2VTFA 3OCPA 3RNSA 5KXEA 1KS4A 4Z1VA 5C3RA 2G9GA 4WM7B 2J1AA 2KNIA 4UXAA 4DEQA 1B35B 2VZOA 4YVSC 1DFQA 3THTA 5BNNC 3KB5A 5FO7B 2WNVB 4FT8A 4JDNA 5ACA1 1MEC2 2VNGA 4QKDA 3D0SA 5CFDC 3WZ1A 3ZFFA 4XZUG 3WDYA 1CAVB 2YBPA 1C5IA 4IE0A 1F7EA 2BT8A 1QDOA 1LESA 1YUDA 2ORZA 3NJXA 4OVEA 4LBJA 5AVPA 3ZIXA 1VBB1 5JOWA 4YG0A 2YFUA 3GHMA 4XZPA 2D1JB 1PTHA 4DQAA 5JDBA 1LCLA 4GH4B 1Z7S3 2LW8A 4IV3A 1UMIA 4PDWC 4AHZA 4C1WA 1VRH1 4PF1A 4ES8A 4W6WA 2VU9A 5L19A 2DVFA 4E2QA 3GZAA 3DPRC 4CCCA 3TEWA 4K8FA 3WDUA 3L2YA 5C71A 2FD6A 3EQEA 5DUUA 1U5XA 2DVDA 3AYDA 5IWFA 4ES9A 2ZZQA 1W8HA 3PVEA 5GZFA 5JOXA 2Q1JB 1CPNA 1Z78A 3H1MA 3K75B 5LA2A 2JKXA 3NV2A 3DKQA 5JIAA 1QQP3 4S2DA 5A7NA 3VBFA 5GZGA 1ZZ7A 4LO8A 2PFWA 3FCSB 2BV4A 4DS0A 4B29A 1WW5A 4XBNA 1WMXA 1F9KA 1H9WA 3FLPA 5LBCA 2FMDA 3WD5A 2WG3C 5FY4A 1TE1B 4N43A 2V4AA 1KFUL 5FK7A 2GU9A 3EHKA 4JAAA 1F7MA 2LROA 1PK6A 1DLCA 1IS4A 1LENA 2HWF3 4BXSA 1YXWA 2W2IA 4Y4RA 5FZGA 3SMHA 2VMIA 3HR9A 2VZ3A 3VHNA 4Y22A 2A73B 1WCQA 5L9BA 2VH0B 2VCMA 1XNDA 3RVHA 1GNYA 2FBEA 5FWJA 4TLGA 1XB9A 2HWB2 2Y0OA 1LOGA 1X8MA 4RS5B 4AFAA 1VBA2 1GOHA 3E6BA 4AEDC 4WBBA 1HJ7A 1GYKA 2P6CA 3VBOB 3MHZA 5C3OA 1NLSA 5EYYA 3NKGA 1AR61 1JOJA 2FMYA 4FCAA 4QPIB 4ZONA 1OD5A 1RHI1 3NW4A 1H2MA 5LEJA 4HPKB 4Q4Y3 4Y71B 4K6BA 1DQ5A 5DAQA 3HN1A 3MICA 1HKDA 5JMCA 3TEYA 4GWJA 2DVGA 4PIYA 3MO4A 5GLUA 5CU1A 2W0XA 4O7XA 4X8PA 1Q8PA 2XBWL 4Z0LA 1UCXA 1F0SB 1I5PA 4FPJA 5ACA3 2LALA 5FZCA 4LHSA 2ETEA 2ZGTA 1NXMA 4AR2A 5I8YA 1HT5A 2DVAA 4AEJA 2I74A 4YGEA 4PF5A 3T2TA 4O1ZA 5ISLA 2WN3A 2KV4A 2D5HA 5I0TA 5BPXA 1NY71 2QZ2A 3KHBA 4H7LA 5BNQA 3H3ZA 2QBXA 1W2UA 2VUJA 5A70A 5BNOB 1FNZA 1DX5I 4ZAEB 2RMU1 4OUMA 4XFFA 2BRTA 1G1RA 1FOD1 2XKOA 2QQNA 3N7KA 4UFLA 1BVP1 4P9LA 4I01A 2VTXJ 4LK7A 2GMPA 3LDRA 4OUEA 2W92A 5I46L 1RJ8A 1YQ2A 3CJIA 3SNMA 5KXBA 4FI9A 3PUAA 2RM21 1CVNA 4YWAA 1WWYA 2PN5A 3WP6A 1AJKA 4NPMA 4HVQA 1KGYA 4DXSA 3RMXA 4YW1A 3BGAA 1SPPA 5I0RA 5IT6A 3MFCA 1UKGA 4NWWA 4CEYA 2W1UA 3OJBA 1YI9A 5CEHA 4XMIA 3N7MA 2HWD1 2A71A 3SW2A 4HL0A 5FKCA 3SKJE 2RS51 1EPIA 4JRLA 5C9AC 3POWA 1C1LA 4BMBA 1ASJ2 2ZHKA 1H2KA 2BVBA 1UMHA 2P6HA 3POJA 4KBBA 1O91A 2FDIA 3KQRA 3SOBB 1AL0G 2V5DA 2VY0A 4F7ZA 2W2PE 1DDXA 2PAEA 2EIGA 4JCKA 1COV3 2B9VA 2WQ4A 1AYM2 1NX9A 4W4ZA 5EP9A 4B1LA 4C0BA 1KKEA 2WINB 4DINB 6COXA 1ZBA3 1T2XA 2MPFA 4QQPA 1YJKA 4LJHA 1PGSA 2HWC1 2YGMA 3LOIA 4Y20A 5AVAA 1STMA 3ZMOA 2F9BL 1LHVA 1PVXA 4G3YC 4TYSA 1EZQB 3IKWA 3QH7A 4QQ2A 4A7YA 5LK5A 4P9JA 1DLLA 1LHUA 2RJKA 4RL7A 4QXCA 1GQHA 4CXYA 4N7IA 3D3AA 2R1DA 2EAAA 3JD72 2BFUS 3RZZA 3JCIA 3SHRA 3ZDVA 2W3JA 4V2VA 5IK8A 5FZ0A 3EMRA 3WCRA 2TEPA 5JSRA 2PLV2 2Y7ZB 1C8M1 4IEXA 1NQLB 1NQDA 1ALYA 1AR81 1JYVA 4CDQB 2VQTA 1AXKA 2QE3A 1SFYA 1CAUB 4RHV1 5A3WA 1W99A 1RUI2 4OI2A 3OBAA 1UOGA 3CLPA 4EWEA 1C28A 3VKOA 1EAH1 1NA1A 4Q4X1 5FFOC 5GKAC 1UPSA 2EAKA 2JDZA 2RMU3 3T1LA 3OLTA 4N7UA 3LWCA 1QXPA 4N90A 5FP3A 4XEZA 3RS6A 5JBBE 1R082 3HNYM 3IN9A 2P1BA 5BUVA 1PNGA 3ILRA 1S0EA 1PVC2 2EF6A 4IXLA 2Y5FL 5K4LA 3VKMA 1SDWA 4AXOA 4OULA 3UKNA 3BTAA 4E4HA 1QDCA 1QJU2 3USUA 4CVUA 1F15A 4LBQA 5A3UA 3RQ0A 3S6PA 5GLWA 5I0DA 1W6NA 2RHPA 2VRSA 3ENRA 4Y5SA 2DFBA 1MS9A 2AZ5A 4XQ4A 5K0HB 1ENQA 2WNUC 4HK9A 4Y5Z0 5CFCB 2HWD3 3U0ZA 4I3GA 1UWWA 2RS53 2QCSB 3KGZA 1OH3A 2ADEA 3N36A 3MDPA 4IEWA 1OOPC 4NWVA 1WKYA 2JKBA 4UW6A 3MQEA 2XBXL 1WW7A 2MGRA 3EYPA 5T3NA 3VZMA 3WF2A 3CS7L 2XBO1 3NNFA 1IQGL 4C91A 4LNVA 4IGQA 1W2TA 5J7MA 3ZYHA 1XXNA 1JYNA 2YU2A 1C3HA 1URXA 3PUSA 4XUTA 1VMJA 3PLQA 2ZA9A 3AMMA 1NE6A 5A3LA 3RZGA 2KM2A 4KWLA 4AG4A 5FZDA 4XF4A 1DF0A 2ZGRA 2JECA 5L9RA 1HT8A 3ZYBA 1JZ7A 4UFIA 3DEMA 2HWC3 1XRUA 4J1XA 4LBMA 4H14A 4XFIA 1RGSA 3TH3L 3ALQA 4LMFA 3RFRA 1APQA 5FJHA 1G1QA 3TAYA 1QGLA 4IGPA 2UWLB 2WUHA 2XR4A 4FXGB 4YGCA 2XBVL 5LWBA 3OD0A 2R30A 1UX6A 2A75A 3O14A 1QOSA 1YQ6A 2Z79A 3QOPA 3DUIA 3ON7A 1VBD3 2BJSA 1TOZA 1C8M3 1ZM1A 1NCQC 4X8VL 2D5FA 2J1UA 2VD7A 2BOUA 5JVYA 1XC6A 1OLMA 2VJ3A 3BI3A 3B5LB 2RR12 3CU7A 4HMZA 2B39A 4BIOA 4RHV3 1JU4A 2NQYA 5JOZA 3ZFEA 4IDZA 1R1A1 3HOBA 4JGYC 4RR3B 4V2WA 5EPAA 5T5OA 5JI9A 3GZEA 1EYBA 4Q4X3 4AOCA 4BJ0A 4C1XA 4FFHA 2ZAHA 5DUXA 3LN0A 2YFZA 4LE4A 4A44A 2JIGA 3VDAA 3E5UA 4OI0A 1VMFA 4XDQA 2NLRA 1UYZA 4AGGA 5LEKA 4EN0A 1C57A 2JG9C 4L8QA 2GC1A 3LDKA 4MGSA 5F8PA 2WWJA 1CAXA 2B45X 4YYOA 3N3HA 1DQ0A 3T09A 3LSDA 1POV3 4X8SL 5IW0A 4QPWA 4CUAA 3SCHA 2IC1A 5JCTA 2X5IA 4AQSA 3LDBA 4PQQA 4CP1A 2WZ8A 1QXJA 1PO12 5JIUA 3OTFA 5DN2A 1HRI1 4OHZA 2W87A 1EGFA 4Y1YA 3IZOA 1LOBA 4YW6A 2GDFA 4YVSA 2QDRA 3IMMA 5BNNA 4RQPC 5F3GA 3TZIA 3DN7A 4AI3A 2VBBA 2QQPA 1MQ6L 2VOVA 1MZFA 5CFDA 2VWLL 1KJLA 1MS5A 1JODA 1OKOA 2TUNA 2VBPA 3VBFB 4A3XA 1K5MB 1NPEB 4XTMA 4A7KA 5FYCA 1ZBE3 3P1IA 1S2BA 3AP4A 4AVCA 2Y81B 4HZFA 1A6CA 5GM0A 1ADXA 1LPKA 2XC5L 3PU3A 5LBEA 1N3PA 3RSJA 1AVBA 3OYWB 1AYN2 4LTAA 2LTNA 1PK6B 2PQSA 3J8F3 2UU8A 4Q0PA 2YHJA 2WZR3 5FREA 4MG2A 4D90A 4E2SA 4RRYA 2WPHE 3KL6B 4JQTA 4PIZA 1S0IA 1EV11 2BT7A 1EUUA 2VZRA 3JB4C 1MS3A 4QKFA 1FPN3 1UZJA 4LK6A 4ZKTB 3EBRA 4DXTA 1WU1B 2RS11 4CPBA 3C7FA 1QWRA 1AR91 2C9AA 2VZ1A 4XXAA 4CUCA 2X05A 1ZRCA 1BXHA 5HXVA 4CCJA 1VMHA 1BK0A 1BLZA 2R061 1R1A3 4IUGA 2WPKE 5JB9E 1O7FA 2WDBA 3BTXA 4BPZA 1PO21 5CIRA 3VBHB 1W8ZA 3GCXE 1E5SA 1FNYA 1LOCA 3KV5A 3KZ4C 3RYKA 4K7JA 5K0UC 2VGDA 1TEIA 4IQPA 3IDCB 4AHYA 1RUG2 1VP6A 5FZ7A 2V4VA 2IFRA 1Y9GA 3GBWA 1RIRA 1QXRA 5A3NA 3LD8A 1VAKA 4Z8BA 1UXZA 1H8TB 3M36L 1LHOA 1V6LA 4HONA 3T4VA 4I09A 3ZFFC 4AYUA 3UJQA 1CPMA 2Y33A 4COVA 4FO9A 4XF0A 3VBSC 4PH9A 3U73A 5JXGA 2CAVA 3AP5A 3O5SA 4IE7A 1XNBA 4Q27A 3WDXA 1VR3A 1RB8G 3PTRB 1Q43A 2OIIA 1B9WA 4OHYA 2VVUL 4IV3C 1E57A 1OSGA 3BTYA 1JZ3A 3CJIB 4OZXA 4C16A 1TG7A 1W9SA 1WBFA 3I7DA 3RJRA 3BU0A 2EXHA 2I9BA 4NIAA 3GISX 1IQLL 2PR3B 4COYA 4Z92B 2BOXA 4EE2A 4LITA 5DAPA 1GR3A 1ND3C 3A0NA 2WO7A 5C4WC 1LOFA 4IESA 3KWVA 2XQRA 2ZGLA 3AJYA 4QX5A 1HIXA 4RGAA 4WVZA 2YBKA 4Y24A 1DGLA 2NZ9A 2VJXA 3LEMA 5F5CA 5FAXA 5IJRA 3UL2A 1OPMA 5LA0A 1AHSA 4XHBA 3BPSA 2NMOA 5FOJB 4KL1A 2JB8A 2WYFA 4KBZA 2JE7A 5FOBB 2ZAAA 1TNRA 4NRMA 4QAWA 4XUQA 4ITCA 4E8CA 2VR4A 2W2NE 4N43C 2PYTA 2IXKA 2YPJA 3AP6A 4A41A 4PT6A 1FT9A 1UN1A 1EV13 4O65A 2G4IA 4ZXKA 2P3UA 1R092 1X82A 2A7AA 4QM8A 3ZMNA 4HKWA 3T1MA 2HYXA 3ES1A 1O6UA 3N8ZA 1LGCA 2D6PA 3A23A 4Y20B 4A3ZA 1RUC3 5FYTA 1AR93 4DXZA 4EWAA 3SCFA 5IFPA 2FHRA 3JU9A 2TGFA 4MXVA 4DXRA 1NE4A 2OT7A 4AQ2A 1RUJ3 4D69A 3SCGA 4E2GA 5C9AA 1V9U1 2R063 4WM8C 4AVVA 3NL1A 3X29B 4IEPA 3M70A 2FDHA 1CX4A 3A21A 1PO23 2HWE1 4JYUL 4LEJA 3CKHA 3GJAA 3LA7A 1HX2A 3R4DB 4WVVA 1AL22 2B7DL 3Q8CA 4NVPA 1D0GA 3FL7A 1UIKA 4CCEA 1L3YA 1HN1A 1ULOA 1ZBE2 1HQWA 3DYPA 2QQWA 2YUEA 5DXDA 4OZOA 2PHBB 4MMXB 1KFXL 4Q0UA 5EZWA 3N9LA 1TVGA 4MSVA 2FZ2A 4YZ2A 1YGCL 2VZTA 3ACIA 2ATFA 1ENXA 2WG4B 1OUSA 3TYJA 3ABZA 3GGLA 3NJPC 1NA1B 1NUKA 2EALA 4FQ4A 4KMQA 1K3IA 2VMDA 3HIFA 3SXWA 5JPNB 4BOWA 1N47A 2AREA 5DPNA 3VZKA 1ODMA 3L2HA 1TME1 1ZA4A 2IVIB 2M74A 1MQ5L 2W3KB 4FVVA 4GJYA 4YVWC 2SBAA 1FPN2 5FZ4A 5T54A 4XYXA 1HCGB 4B4RA 5AC92 2GNDA 1J3QA 4B4QA 5LBFA 1GOGA 2IXLA 1L5GB 2XH6A 4JVAA 3H7YA 2C5DA 1K45A 3I4IA 3JBG3 3WNNA 2YGQA 3PTYA 3UKVA 3WF1A 1AR72 4AW7A 2VZUA 4LBOA 4W6XA 4DFSA 3M3EA 2JJLA 1H1IA 3K46A 3LE0A 1PM4A 4CEYC 5T50A 1G9AA 2GC3A 2RG4A 3HS7A 4IE4A 4HN1A 3OF1A 2VW1A 3HS5A 1H6XA 2XONA 3AKTA 1FE2A 4LLFA 4XBQA 3VGIA 3VL8A 2GSYA 1WA6X 1HQLA 3LTGD 1JZ4A 1F31A 4KGQA 1IOEL 1AZDA 1PZ7A 3B7MA 4CZSA 2WWSA 4R8HA 3U14A 3Q7DA 4JGZB 3WNXA 4YFWA 5C33A 1Q56A 1TMF2 2WT0A 2OZ6A 3AZYA 1KQRA 5FQ0B 4E4SA 4Q1PA 2X53S 3ZIWA 2V09A 5F7UA 5FYZA 1S1AA 2RDNA 4RRWA 2ET1A 2WNUA 3KVAA 3KD4A 4AGVA 5F6KA 4I30A 5KHKA 4YZ4A 4Q0QA 2HWB1 1XSRA 5J3UA 5FZIA 1CCVA 1IQAA 1OOPA 1VBA1 3AJZA 2WPJE 4RA0A 4X6RB 4XDOA 5FYUA 1RUNA 2F4PA 3S30A 3TWIA 3HT1A 4PJYA 3AMHA 2VZPA 3MYXA 1OXCA 2WT1A 3OGSA 1KIGL 1RVF1 2CGNA 2RS31 3EJKA 5JR7B 4M3CF 5A1AA 3ZPYA 3P5BL 1ZREA 2OX0A 1PIV2 4YZUB 2DVBA 1UOFA 2Q8OA 4GWIA 4ZXYL 1HB2A 4D6SA 1WBLA 1QJY2 3WP5A 1DGWA 2D6LX 4E9KA 2CDOA 3AB0A 3PNAA
chains in the Genus database with same CATH topology
5SV8A 3ZFEB 1MZ6A 5DDJ2 4YW4A 1MEC3 5DG2A 3ZSJA 2ZCWA 4KNCA 3APBA 2H6CA 1FSBA 2WFPA 4L2NA 1LR5A 3KT1A 1IQML 2X8KA 2XBYL 1V00A 2VOKA 2K0GA 3ES4A 5FLIA 1NFUB 1CAXB 3NT1A 1RUC2 2WT2A 3GHNA 3O0XA 4DNYA 2DFCA 3PVOA 1RUJ2 4I3PA 3ZN5A 2X5IB 3ZXKA 2R071 3AZVA 1AXZA 1PGW1 5A3MA 1DG6A 2A3XA 4H7MA 4FOQA 2EI8B 4HVOA 4IEYA 1XE8A 3VN4A 2Y38A 2D97A 5KBFA 5E88A 4AHXA 2GN3A 1RUD2 4Y7AB 1HAFA 1O3QA 3VBRA 1VALA 2XLFA 4PLNA 2PELA 4YVSB 5BNNB 4M3CA 4FPFA 4LO7A 1XU2A 2YROA 1H4HA 2JG9A 5CFDB 3W59A 4AHWA 4IEZA 4MGIE 4AI2A 4F3JA 2GH8A 3WLUA 2J95B 2XLGA 4IV1C 3NAPA 4PDWB 3CF6E 3WXPA 1O3SA 1RITA 1IPJA 2HWB3 1L3JA 1PZ9A 3TK5B 2P3TA 2QJVA 1VBA3 3DPRB 3TNQA 1PGEA 1U8CB 4JDOA 3GBFA 3SH5A 2XKPA 3AK0A 1D4M2 2O0OA 4FM5A 3KS7A 5IK5A 1NXD1 4GWMA 1UW8A 5J48A 3VLBB 3ZXJA 3JD71 2HEVF 1N1VA 1IQEL 3WP3A 3WW3A 3J9SA 2PLV1 3H1WA 2H0BA 1UPIA 4XQDA 1YUFA 2ZABA 2E53A 2DUPA 1IHMA 5JLVA 1RUOA 3WY6A 2KL7A 2DTYA 5JW1A 5FPXA 3B69A 2O1QA 2FLGA 4H3WA 4BHPA 2WFXB 1U67A 4AFCA 1AJOA 3AKSA 4AEDB 4PQ9A 3NV1A 1JL9A 3ZYPA 1PVC1 4HT1T 4CDUA 3B9IA 3BOPA 1BBT3 2JJ6A 1LU2A 1V6NA 2YY1A 3TOJA 2KA3A 1BVVA 3LC3B 4XQWA 3GNEA 4XOGA 1PNFA 5H9QA 1I3HA 1VB2A 2K9ZA 2MNGA 4E27A 5K0UA 4PIXA 1SBFA 3MLJA 3OLUA 1I1EA 2VOXA 3AKRA 1I6XA 1H2NA 3M2MA 1ASJ3 2Z2SB 3TN92 1SCSA 2W39A 4O9EA 3MW4A 4OI4A 3VBSA 1BK1A 4IEUA 5GJ6A 1AYM3 1DU3D 1Q3EA 1DZTA 3IBMA 1AX2A 4BTTA 1WLCA 4HSJA 3PHMA 5E89A 3JQWA 5JVVA 4QGLA 4URTA 3ILNA 3D6EA 4AWDA 2P17A 5BXXA 1WLDA 4AF9A 4Y1ZA 1LJ7A 1SQ4A 2I07B 3C3VA 1ND3A 5C4WA 5J98B 4GXLA 3JD73 5B2GB 3MPBA 5GZDA 1HRFA 5C9AB 5IKTA 3H9AA 2PLV3 2AR6A 2AUYA 3RWNA 4YNIA 3SITA 1ULGA 3MGUA 1O4YA 2RR11 2VVDA 2D6OX 3H7JA 2Q0AA 1Q8SA 1BZWA 4XFCA 4FAGA 1YO8A 1RUI3 4I2OA 3IT8A 4R9BA 2UWCA 1IS5A 4KQ7A 5CNAA 2B9UA 2CV6A 3MLLA 3ATGA 3V0AB 1COV1 1R083 1H1MA 2CL2A 4NR1A 1G9CA 4QXKA 2DDUA 1ZBA1 1IQFL 4M10A 1PVC3 1N3QA 2PHTA 3QBQA 1WCSA 1KLOA 1QJU3 4RD7A 4WM8A 1TPGA 4XJ9A 3LZZA 4EN9B 1LRHA 2UYBA 3K51A 4R9DA 5AFEA 4F83A 2DCZA 1GNHA 4OTJA 3U10A 5ABJC 4Z6AL 4LHLA 1ND2C 1OPOA 2DCYA 3J26N 3KCXA 4W6YA 1PO11 2ZKNA 4Q8LA 5H9PA 1ATDA 2DYCA 1FATA 1S55A 1KD7A 3RPQA 2VMHA 2Q5TA 5JOYA 2UWBA 4O02B 1LOFC 3OBTA 2MHPA 1B09A 3E6CC 2VECA 5DUWA 1G2LB 3CL1A 1G7YA 1OHFA 3URFA 4DY5A 2WA3A 1AF9A 5JPMB 4EJRA 2D6MA 4FPCA 5KIRA 4YVWA 3VHPA 1EQGA 4IL7A 1BEV2 3LA3A 3N8VA 4YGBA 3G7DA 3MIBA 2PUQL 3LOBA 4DRVA 1V6JA 1AYN1 2R6QA 2ZZJA 1BBT2 3CFWA 3SH4A 1LGBA 2DUOA 1UZYA 2WNUB 4I02A 1RFNB 5FCCA 1NCRA 1IOXA 5IKRA 1OOPB 2ZX2A 3B02A 2D3RA 4GALA 2OA2A 4DRRA 1S0JA 2BWAA 2RR13 3FBYA 1FMD2 1U5YA 1OQDA 2PHRA 4ISQA 3C2UA 3R4SA 1IPKA 3HQXA 3VDDC 1UF2C 2WFF2 4KWJA 3MPPG 2P95L 1APNA 2WYJB 2ZMLA 2D98A 3B01A 4FPYA 4Y4YA 1QOTA 4Z82A 5J37A 3SLIA 1IQIL 1RUE2 4RRXA 2VUAA 2DCJA 4NPRA 4JTOA 5L30L 2W86A 3WINE 4YZ5A 2XJTA 3DL3A 1SLTA 5F19A 3H8UA 2DWRA 1S0GA 3B3QE 4Q2FA 3WR0A 3BT1A 4YZ1A 1KDKA 1NCQB 3Q3KB 1W6PA 1PO13 2JXAA 1VBD1 3LAQA 5CISA 3FWEA 2NN8A 4AEKA 3V0BA 3KSCA 5C8CA 5D8AA 1NZIA 5I0SA 2PAKA 4BLJA 3FFQA 1Z6EL 3I59A 1EPHA 4JGYB 1D2SA 1YI7A 3RMYA 4I0WB 3D8CA 3N7JA 2JE9A 1HREA 4JYVL 5GLVA 1QNWA 5FPZA 3WP4A 4FOYA 3DGTA 2EI7B 1JYCA 4M3CB 4ZU4A 1PZ8A 3WG4A 2JG9B 1XKBA 3HPTA 2EVXA 1ZAQA 2E7QA 2UY8A 1EP0A 3JUUA 1AYN3 1SBDA 3CENL 1KSNB 3ASIA 4HK8A 4B3NA 2V5YA 1J3RA 5I8SA 1QF3A 4R9AA 1POV1 1ULCA 5A33A 4DOUA 1MS8A 1W6QA 5LK7B 3ZSKA 1R091 3MF6A 4P5HA 1BMV2 1C8NA 3HD8B 3RI9A 3DV8A 1EMOA 1SLIA 2WC2A 3ZFGC 3NTBA 4MXWA 1YYNA 4JV4A 5L7OA 2J94B 3OGJA 4RQPB 2WYGB 5I93A 3P3PA 4LUKA 4XF1A 1FYUA 3KQCL 3BALA 4GB32 4YW2A 4UW5A 4X8UL 3OY8B 3S6XA 1AL21 1KRIA 1RUG3 2ARXA 1T6GC 4IV1A 1ZBE1 2D44A 4YRDA 4MZUA 4Y6DB 2YC0A 2XL9A 2RNLA 2XHKA 3ZXLA 4CDWC 3J8F1 3R05A 3N8WA 4UW3A 2E51A 2WZR1 3WX5A 2QVSB 1SCRA 3ZXEA 4HBNA 4SBVA 4AQTA 1FPN1 4XILA 4YLZA 2EI6B 5AC91 1VBB2 1H8VA 3ECQA 5FDQA 3ZYIB 2EXKA 1VRH2 1S0BA 2DTWA 1YFUA 2ZBJA 4Y1VA 1AR71 4BTUA 2YZ4A 5C6CA 2PHUA 5K0UB 3ZN4A 5FMOL 4WZFA 2ZMNA 2BYVE 4KU8A 3VBRC 2BTVC 1EMNA 2CWSA 4TGFA 3H3UA 2XG3A 1YFXA 4Z2WA 4QGMA 1MACA 3ZXFA 3ZFFB 3VBSB 3FLTA 5F1RA 4KGGA 1LHWA 1XFEA 2P3KA 2P93L 1R093 5IKVA 4GMP0 4IV3B 2ZHMA 3NAPC 1DVAL 4FP2A 4BWOA 3V64C 4Y76B 1LMMA 3MZHA 2CY6A 1NOVA 4B8EA 4AFMA 1DGRN 1GZCA 1EPGA 2AGSA 1GZWA 1FAKL 4ORFA 1ND3B 3ELAL 4XJ8A 5C4WB 4CTEA 1H30A 4YW5A 2DURA 5T5LA 4M11A 3GCWE 3B00A 1AL23 3J4UH 2WQZC 4FPLA 2XB6C 4D7TA 1HRV2 3MW2A 2WLPA 1HAEA 1OLRA 4MGYE 2WLQA 1FXZA 1QJY1 4JZDL 2Z69A 5TSWA 4P9XA 4IERA 4COWA 1RC6A 4N43B 3ZXDA 5T52A 5DDJ1 3VKFC 3KQEL 4N9IA 3JB8A 1AX1A 4Q4W2 4LHKA 4G9SB 1Z0HA 4EROA 4Y22B 1G9DA 3MI8A 1UMZA 3UV9A 4N53A 1Q8OA 4ZU7A 3QH0A 4CDXC 1QKQA 1DZRA 2XJRA 3QD6A 3VHRA 3VZNA 5AC93 1NY72 1BYHA 4S2FA 4BE3A 1PXXA 1Z6CA 2AYLA 1MQTA 1RUC1 1X36A 3MF9A 3P3NA 4OHVA 4WM8B 3WG3A 4CDUC 1FOD2 1RUJ1 5HCAA 3H50A 1AR73 3M3CA 4RGGA 2DCTA 2XGXA 2QDNA 2WIIB 2OW4A 4OTYA 2RM22 3O0WA 1IJQA 1PM7A 1UKRA 3GYDA 5E16A 2C0ZA 1ATEA 1RUD1 2TNFA 4YM2A 4AVSA 1Y7BA 3M3IA 2J38B 1WD4A 4Y1UA 4YSFA 2A5ZA 1IS6A 2W3IB 2TBVA 1TMF3 4CUDA 3INAA 3LB9A 4P9IA 1LODA 2YV8A 4IEVA 1MZ5A 3O0VA 4YVWB 1SFNA 2VVVL 5ABJA 2IFWA 4QD2A 1ND2A 3FMGA 3TRSB 2LUWA 1ZZ9A 1C1FA 2V73A 3O12A 1IQHL 4LBKA 2KB9A 2BQWA 1ZZCA 4CSYA 1N1SA 2WA4A 4ISRA 3JBG1 5JBCE 3NVCA 1V6OA 3SISA 3VZJA 4CEYB 4CEWC 4AI0A 1PIV3 2ZKLA 3IM0A 4HFSA 4A7IA 2UWAA 4LE3A 1MZEA 2I9AA 1QJY3 1W6MA 2AENA 1EAIC 1QU0A 3W58A 3BPSE 1DBNA 3WDTA 4NGAL 2XC4L 4K1YA 5DDJ3 4UBHA 3WV6A 1JW6A 3HO3A 1AR82 2NM1A 4W65A 1V70A 3U07A 4PBOA 4NHMA 1O3TA 2BWCA 4LO6B 2GD4A 3MFAA 1V6IA 5K9YA 2P28B 2WNVA 1Q4GA 2WSVA 1EAH2 2H9EL 4Q29A 1QNYA 1IZ3A 1CIWA 3H1YA 4Y7BB 3VDDA 1FI2A 2DUQA 2GAUA 4GH4A 2Z5WA 3WQ0A 4YM1A 1W6PB 2VW2A 1YJLA 3LCPA 4XW3A 1XE7A 1H4GA 1RUD3 4CP0A 4A2UA 3OPZA 1FV3A 2D3SA 1ZYBA 3V0BB 4P14A 3I59B 1BJQA 5GZCA 5COXA 2J34B 1WW6A 4HSLA 5CAZA 2ZGQA 3BPZA 3IWZA 3LTFB 3IPVA 1MEC1 5EYXA 4ATFA 2XBO2 3WG1A 1GLHA 1WLTA 2A3YA 3F6UL 1A8DA 4A7ZA 3IJEB 3I54A 2BEOA 2ZJCA 4YM3A 4TZDA 4EWDA 4TLFA 2XJQA 1FF7A 1Q8VA 4E1GA 2QNKA 5KXDA 1JUHA 2NP0A 3USUB 2B42B 2KXLA 5DUVA 5JWPA 1MOXC 5T5JA 3M37L 4LBQB 2VOWA 1D4M3 4CUEA 1W6NB 2GN7A 5A33B 1SLAA 1W6QB 1O5UA 1U5IA 4NO4A 2W26B 1UZZA 4RS5A 2BGCA 1NCRC 2GC0A 4MXWB 3HO4A 2X29A 2B8MA 1KITA 4QPIA 4C90A 1WA4A 3ZYJB 1MVEA 3I8TA 3LC5B 1RINA 4QPGC 5CVRA 1JN2P 1LHNA 2WKKA 2QZ3A 3R4UA 3AZWA 2YGOA 3LKJA 4RRZA 1LGNA 3MW3A 3WQ7A 1EQHA 1NFWB 4FPEA 4IV1B 4QGNA 3FUQA 1AXYA 3KT4A 4YG3A 3AZZA 1IGXA 3ZFGA 5E8AA 2BQ6A 1Y43B 4YFZA 3WUDA 3TK6B 4LO4B 1SEFA 4JRAA 2A6WA 1KDMA 2W68A 4LULA 1UU4A 2A6VA 1PGL2 5F5QA 3ZSLA 2BW8A 3FJSA 4D0EA 1BQPA 1X7NA 3SH3A 3Q9OA 2XPJA 1G2MB 3BT2A 4H55A 5I0UA 5J36A 4LORA 1ZZBA 5JI7A 2J2UB 2UYAA 3TN93 1ZZ6A 5C8CC 5D8AC 2PQQA 2HKXA 2ZGUA 3FLRA 2P34A 1HRI2 1SMVA 3TNPB 1FX5A 5KC5A 4CDWA 4KU7A 2IXCA 1CJPA 2BVVA 2D7FA 4AFBA 1G6NA 2VPVA 3WHTA 4ASLA 2JX9A 3RR3A 1DYPA 2BNNA 4J1WA 3M1HA 1KLJL 3FFGL 4GA9A 2OZJA 2E7AA 1BEV1 3AMQA 2ZGOA 1OFSA 1RTVA 4B7EA 4CYDA 3FE5A 2D40A 4K1ZA 3ZDSA 1BBT1 5A32A 3HAGA 3WDVA 4CRQA 3POSA 3O7OA 2DCKA 3FC0A 3WW1A 1HV0A 1WLWA 1V6MA 5EXOA 5L7OC 1VBC2 3KM5A 1FMD1 4M3CE 1VBE2 3UKTA 2RS12 1ASJ1 1F2NA 5BV6A 1QJX2 2GNTA 2WFF1 4META 4BDXA 4D7SA 1LU1A 4OFGA 3OGGA 1H0BA 1AYM1 1PRHA 1HX6A 2CAUA 4BH9A 3V64A 1GKBA 3USSA 2R0FA 2W52A 4XJWA 1K36A 4ZHAB 4LA3A 4AVAA 2D93A 1CD3G 1DHKB 2GMMA 5SV5A 3D82A 2WS92 5F1AA 3TBDA 4X6QB 4AGRA 3VKNA 2ZPXA 2BPA2 2LM3A 1FAXL 2XJSA 3RI8A 2UY9A 2ZX3A 1RMU2 1MR5A 4NOTA 4G4FA 1TNFA 4YM0A 3SOVA 5CFCA 3FX3A 1D2QA 2JG8C 4DY3A 2SLIA 2BUKA 3I2DA 1IKQA 2JICA 4WVMA 5BNPC 1WMEA 5HI0A 1RUI1 3ZX7A 2WSUA 5JVZA 1HQNA 4XMAA 4XL1A 2BQ7A 1KJRA 5E8DA 1GFF2 4K20A 4CDXA 1BEV3 1R081 4XFGA 2YMZA 4EN7B 4XFAA 1UL9A 2N7GA 1APOA 1CN1A 3HS6A 4WV8A 2XWBB 2ADXA 1X8EA 3IDBB 4AI8A 3N35A 4FOWA 1P0SL 5FO8B 4LA2A 4MMYB 1QJU1 3H0OA 1LKNA 2D6KA 4INDA 5ABJB 2D43A 4LBNA 3S7EA 1YWKA 2P3JA 2ZACA 3ACLA 1REDA 1ND2B 4KWKA 1CR7A 1BMV1 3RG0A 2YDEA 5KN5C 2GNBA 1FMD3 3VZOA 1ULEA 3POYA 3PGHA