3ZYIB

Netring2 in complex with ngl2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
330
structure length
303
Chain Sequence
DYDICKSWWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSRVLCTEEYSRWAGSKKEKHVRFEVRDRFAILESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4
total genus 62
structure length 303
sequence length 330
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00053 Laminin_EGF Laminin EGF domain
B PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3zyiB01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zyiB02
1XKAL 2YGOA 5IKRA 3F1SB 1PGEA 2WFXB 5F19A 1WU1B 3F6UL 1J9CL 3U73A 1FF7A 4FM5A 3GCWE 4X8UL 2VWMK 2AYLA 3N8WA 4AQTA 4URTA 3R05A 1DDXA 2WPHE 4BXSA 2W2PE 1JL9A 2I9AA 2M74A 4Y76B 2P28B 2P3TA 2VJ3A 1IOXA 2XC0L 1NFWB 4BTIA 4NGAL 1ZAQA 5CKMA 1EGFA 1Z6EL 2J94B 2MGRA 2Y80B 2FLGA 3NT1A 1CCVA 1F0SB 3ZYJB 4E1GA 3NTGA 1I0UA 3N8XA 3P5BL 3SOBB 1TLEA 4ZH8B 2P26A 4JZDL 1HREA 3N8YB 2KL7A 2PUQL 3TH3L 3TK5B 4BXWA 2PR3B 1HCGB 4JYUL 2WPLE 4RRXA 4LMFA 3LIWB 5COXA 3LC3B 2B7DL 1KSNB 3ENSA 1LPZA 3BT2A 1UZQA 4X8VL 1FAXL 3Q3KB 2WPKE 2Y5FL 2VVUL 5JB8E 5F1AA 2EI7B 1IQGL 4ISIL 1KLOA 2H9EL 4O02B 4Z0LA 1SZBA 4MMYB 2W2OE 1IQFL 1CVUA 1WHFA 1HT5A 4YT6L 4D0FA 2WPME 2I9BA 3H5CB 2J95B 2VVCK 2WG4B 1F7MA 1DIYA 5CISA 1IJQA 1DVAL 2EI8B 1LPKA 1K36A 3FBYA 1IGZA 3ZYGA 5JBAE 2PHBB 2BMGA 3MQEA 1XFEA 3LAQA 1DX5I 3BT1A 2D1JB 4XBMA 1L5GB 1G2LB 2Y7ZB 1CVWL 1UZJA 2VWOL 2W2ME 1A3PA 1YO8A 2FZZL 1ATAA 2OYUP 1N7DA 1EPIA 2XBWL 4MMZB 2J38B 4BDXA 3BPSE 5JBCE 2P3UA 1FJSL 3N8VA 1IQLL 1NZIA 1CX2A 1EPJA 2RA0L 5CKQA 3CFWA 2G00L 2P3FL 1IQML 1WHEA 1EQHA 2FLRL 3LC5B 5IKVA 5JVYA 5KIRA 2BQ7A 1CCFA 4NG9L 3N8ZA 6COXA 1PFXL 4G1MB 3FFGL 2JKHL 1HAFA 2DDUA 1V3XB 2MGPA 1IGXA 1YUKB 2BOUA 1K37A 4Y71B 1IQIL 1M1XB 2ADXA 4RRWA 3ZYIB 3NTBA 4RRZA 1IOEL 4M11A 1HZ8A 4Z6AL 3ASIA 1JV2B 1XKBA 4PH9A 2K2SB 1ATDA 1EPHA 2VVVL 1LQDA 2TGFA 5FDQA 2W3KB 3C9AC 1UZKA 1MQ6L 4M10A 2UWLB 4AQSA 1IQNL 1YUGA 1NQLB 3NJPC 1G1TA 4BTTA 2YGPA 2RHPA 1NFXB 1UZPA 2KV4A 3TZIA 4D0EA 1B9WA 1YUFA 4OTJA 3HS6A 3DEMA 1Q4GA 2XBVL 1P9JA 4A7IA 3IJEB 1F7EA 2XBXL 2EI6B 2J34B 3KL6B 5I46L 4NA9L 1CEJA 1CQEA 1KIGL 3HPTA 2CJIB 3QCWA 3IITB 4Z0KB 1BF9A 1EMNA 1COUA 2FD6A 3KQDL 1G1QA 2Y82B 4Y79B 5JB9E 1EQGA 1EMOA 2P94L 1HX2A 3MDLA 3KQEL 2W86A 4JYVL 5IKTA 3LTGD 3N8YA 1U8CB 3QH0A 2VWLL 1QFKL 2XC4L 3GISX 1EBVA 2Y5HL 5L2YL 1NPEB 1DQBA 2BQ6A 1HJ7A 3SOVA 2NPRA 5L2ZL 4CUDA 1PXXA 1P0SL 4Y6DB 4RUTA 2WFTA 1IP0A 1U67A 1W8BL 1FFMA 2J4IB 4MMXB 1Z6CA 4XL1A 1F0RB 2K2TA 1FE2A 2Y38A 1OB1C 3HO3A 1FSBA 2UWOB 3KRKA 1HT8A 4OTYA 3TGFA 2MHPA 2WYJB 4TGFA 5CKNA 1FAKL 3PGHA 2XBYL 3GCXE 2VH6B 3N8WB 5JW1A 2UWPB 1RFNB 2W26B 3HO5A 1EAIC 3V65B 1APQA 1AUTL 4X8SL 4PLMA 3KK6A 1HRFA 2BOKL 1LPGA 2VWNL 2BQWA 4YZUB 4CUFA 3HO4A 1G1RA 2F9BL 4Y7BB 3CA7A 4ISHL 3M36L 4ZXXL 2BZ6L 2GD4A 2WG3C 3LTFB 2KB9A 3HS5A 3V64C 1YGCL 1NFUB 1W7XL 2W2NE 5EGMB 1NFYB 2WYGB 2W2QE 1ATBA 3KCGL 5JVZA 3CENL 1PRHA 2RNLA 3SOQA 4ZAEB 3KQBL 2FLBL 2Y5GL 3TK6B 2XC5L 3SW2A 2Q1JB 2WPJE 5L30L 4XLWA 1IVOC 1MQ5L 4RS0A 3U7UG 3HS7A 1LMJA 4D90A 1G1SA 4CUEA 1GK5A 1G2MB 2WPIE 1TPGA 5JBBE 3K9XA 4PLOA 3LN0A 1NT0A 2Y81B 2Y7XB 2BO2A 4JZFL 1IQKL 1EPGA 2P16L 3EGFA 1X7AL 3OLUA 3OLTA 3CS7L 4COXA 4PLNA 1MOXC 1N1IA 5IKQA 1IQJL 1IQHL 5K0HB 1ADXA 3Q7DA 4Y7AB 1XDTR 4C16A 4ZXYL 5KN5C 3LN1A 1JBUL 4X8TL 3TBDA 4JZEL 1IQEL 2BOHA 3ELAL 4ZHAB 2P3FN 1KLJL 4BTUA 3POYA 5E8DA 2VH0B 1EZQB 4RRYA 1C5MF 3FCSB 1HAEA 2P93L 3QMOA 1TOZA 1PTHA 1O5DL 2BOXA 1L3YA 4LORA 2P95L 4O1ZA 1KLIL 3RR3A 2OYEP 4CSYA 3KQCL 3M37L 1URKA 4BDWA 2J2UB 1APOA 4OVEA 2W3IB 1ATEA 4YT7L
chains in the Genus database with same CATH superfamily
1M4WA 4HPKB 1XKAL 1OLQA 3G6JB 5DZGA 2W0XA 5F19A 2DFCA 3VGIA 3AK0A 3NW4A 4XBNA 5CZKA 1DGWA 1BEV1 2RS53 4BK4A 1DQ0A 4HVOA 5A6QA 2ARBA 1QOTA 3ZFEC 1RUH1 1IOAA 2ZZJA 3HOBA 4PQQA 4IDZA 5T55A 1FMD3 3HBZA 1W8ZA 4WVVA 3T3YA 1V6IA 4CU7A 4AXOA 3PMEA 4NPMA 5GZEA 2Y6HA 3VD3A 2A71A 2XUEA 4Z8BA 3R05A 1PX3A 5FPLA 4BXSV 2XB6C 1K5MA 4L0PA 3L2YA 3ZM8A 2YFZA 4FPYA 2Z4FA 2VPVA 2I9AA 2M74A 4Y76B 2BUKA 3ACIA 1ULOA 4Q4X2 4AVVA 5L9RA 2VJ3A 4QKNA 4CDUC 2W9XA 4A6OA 5FK7A 4BTIA 3BUCA 4TWTA 5BNPB 2ZHNA 5CKMA 3ACHA 2DU1A 2Q4SA 1IS5A 1SLTA 1Z6EL 1T6GC 2QQOA 4LBQB 3UGFA 2JG8A 2FLGA 1D0GA 2GMMA 4WVMA 5KHHA 2CNAA 5DXDA 2H0BA 1ZM1A 4YVSA 2AZ5A 1I0UA 1RMU3 4LBKA 4ZXEA 1RUC2 3N8XA 1V9U1 3FC0A 4JGYB 1TLEA 4ZH8B 2P26A 3WSOA 4DB5A 1NCRC 2V09A 1QDCA 1QJU1 1YQ5A 1OFNA 4XFCA 4XFGA 1FYUA 1HREA 1I3HA 1LOBA 2IFRA 4ZY9A 3ZX7A 4KGQA 4E4SA 2WINB 4A45A 1SBFA 1LU2A 2PUQL 2A6ZA 2X10A 1LTEA 3SMHA 4XCAA 3FFQA 1HCGB 3N9OA 1VBD3 2WPLE 1BLZA 1PNGA 1IHMA 4C1XA 3MBWA 1UN1A 2PHLA 5DAQA 3WW4A 3LC3B 1MQTA 3CU7A 2WN3A 3ENSA 1VBE2 4EWDA 4IE6A 1O91A 1RXFA 4QQ2A 2ZX1A 3PUSA 4HLTA 1OT5A 1S0DA 1EY2A 3ZXAC 4KBBA 4CUAA 2ZGNA 5CNAA 3O12A 3Q9OA 5FZGA 1FPN2 1LAJA 1ZZ9A 5KBFA 5D8AB 4Y1XA 2VM9A 1J59A 2CWSA 4CCJA 3VBRC 4CU9A 1B35B 2HWB3 2XUMA 2RR11 4KU7A 2K2SA 4N9IA 3POSA 3AVSA 3POIA 1W2OA 4LO5B 4RR3C 5FFOC 2VUDA 4AW7A 2QDNA 4ARXA 1US3A 5AC91 5DZEA 5HCFA 2W2OE 2CAVA 3NV3A 1OPMA 1CVUA 4Q4Y2 1UY0A 4XZPA 1FOD1 4RQPC 1W05A 3ZYBA 1OQDA 5B2GB 2G9FA 4LO7A 3I97A 2ATFA 2WWJA 3K77A 3SQOA 4D0FA 1WLWA 4Y22A 3OPZA 1QJY1 3NJVA 4WM7A 1QNWA 4ZS2A 2I9BA 3H5CB 1ZVFA 4IEWA 4NPLA 2EVXA 4NRMA 3R6SA 3ECQA 3WEZA 1PO12 1TVGA 1XRUA 2VZUA 5K8SA 2RR13 1MR5A 2WFF1 4UFKA 4YG6A 2VVCK 2WWUA 4XQWA 3OCPA 4AI8A 3GJBA 2V4VA 3FZ3A 1DVAL 4FPCA 3ZXEA 5ACA2 2W5FA 5F6LB 4JCKA 4XC9A 3USSA 2WDBA 1REFA 4GH4A 4QX1A 4NOTA 3JD73 4RR3B 3EMRA 3WP4A 4ZU4A 3V0AA 2DVBA 1DGRA 3FBYA 1PZ7A 2JDMA 5LBFA 2SBAA 4INDA 2W94A 1RUOA 5JAXA 3I3EA 3ZYGA 2QZ2A 2RS12 3LB9A 4XUNA 3I2KA 4YARA 1GP5A 5IK7A 2PHRA 1SLIA 4BQ2A 4AEDA 4DEQA 4Q26A 1US2A 4C90A 3KCYA 4OZXA 4NN0A 4O61A 4QB6A 5H9RA 4AVTA 3RZLA 1QGLA 2EIGA 4Y24A 4IE7A 2JD4A 3VZNA 2CSGA 1WMFA 1W3XA 5JXHA 4QX7A 4FXGB 1L5GB 1C8M3 4P9GA 3B02A 4FOQA 3T1MA 1LODA 2OZJA 5BNOB 4CDXC 1JUIA 5FZ7A 1UZJA 2VWOL 4YM3A 5FO9B 1E5HA 2JE8A 5A3NA 1ATAA 1DYKA 1HRI2 2OQ7A 2HWB2 3ACFA 3KVBA 3VKFC 3BPSA 1EPIA 4MMZB 5C71A 2J38B 1N3OA 2WFF3 3POWA 3BPSE 5JBCE 2P3UA 2WZPP 3HMYA 3N7JA 3THPA 5GLWA 1DGRN 2WNOA 3MIDA 4GQ7A 5FJKA 1U5YA 4Q4Y3 1ONAA 1X82A 4HN1A 4K7JA 4AEDB 4CXWA 4LKSA 3W5NA 3Q8FA 2BNNA 2PFWA 1KDKA 1C57A 3NKTA 4IE5A 1H1AA 3TEZA 1OA2A 1W0NA 1FOD3 1HQLA 1Q8OA 2VOKA 1WHEA 2D97A 2VTXJ 2XDVA 2ZBJA 1N1TA 3WT3A 3WNKA 3ZXDA 1Q43A 1AR73 5AFEA 1PO13 2R041 1OD5A 2UURA 2J22A 3I2IA 2VNVA 3MFCA 5EWSA 3VKMA 3AZWA 3CF6E 5J98B 1QF3A 5JVYA 2GH8A 1I1EA 3E5UA 5FXVA 5ABJB 3ZFGB 5KXEA 1X8EA 3U75A 1F31A 5K0UA 1OVPA 3FFGL 2VMHA 1FV2A 3JD72 1BYHA 1ZBE1 3PVOA 3TAYA 2AENA 3U4SA 2MGPA 3X29B 1FATA 4QPIC 4OULA 3KHBA 4JDOA 1ENQA 4LLFA 4E4DX 4H2AA 5FXZA 1K37A 1IQIL 3LKJA 4LUMA 4D8MA 5A70A 4YYOA 5DUVA 1CAUB 1UY2A 3NTBA 2HBTA 2ILMA 4Z2WA 4X8NA 4M11A 1IS3A 1RMU2 1QKQA 5EIYB 3U07A 5JOZA 1ZBA1 4JC1A 4IGPA 2A73B 4KQ7A 1JV2B 3E1F1 3KGLA 1OBNA 1X9TA 1RUF1 2H6BA 3N36A 3VZOA 2GNMA 3J7MA 3OTFA 3RZJA 2VVVL 3HNMA 4DINB 4LO4B 1U12A 2W3KB 2IXKA 1MQ6L 3K4ZA 3VDBA 1YFYA 2IUWA 4FPGA 4XBLA 1LHNA 3PMSA 1W8TA 1IKQA 2HWE3 5CA6A 1NQLB 2PMWB 2W3JA 4PDWA 5A3TA 4MGTA 3FX3A 1RUF3 1IZ3A 4BTTA 1VB2A 2OKXA 4Y3OA 2W47A 1HW5A 1IS4A 1IGOA 1WD3A 1YCIA 3WP5A 3VBHC 1N3QA 1YUFA 2IZWA 3DGTA 1JHNA 3IAQA 5HCHA 3BOWA 4XILA 3OF1A 4ONUA 1Q4GA 5LASA 2XBVL 1VRH3 2VL4A 1CAUA 4F8AA 2YROA 3BIEA 5FBJA 1F7EA 2XBO2 3ZR6A 3NV2A 4XFIA 2AC1A 4AYUA 2BGPA 5C4WB 4CXYA 2D6PA 1UMHA 4NHYA 1QJEA 4OUMA 4BQ3A 4NA9L 3M2MA 4ASKA 5FR3A 2WSUA 4E4HA 1I9RA 1RUJ1 4N8MA 4Q0UA 5FMOS 5A6XA 1JOJA 1ND2A 2XWBB 4QX3A 2D6OX 3EYPA 3ZN6A 4LBQA 5B4NA 3M7AA 4J6GA 1FXZA 2BP6A 4XEZA 3IITB 4W6WA 3UKVA 4V2WA 3VZLA 4Z0KB 5KHJA 5L7OC 2P3YA 1COUA 2JDYA 1LMMA 3AKTA 4NAMA 4QGLA 3N9PA 5GLZA 2Q8EA 4BMEA 1H2LA 4NMIA 3VL9A 4Y79B 2QQUA 2Y6JA 2QQNA 1TMF3 1MS1A 3HN1A 1EQGA 2DUPA 4RS5B 5FPVA 4YW3A 4B29A 1H2NA 1U0AA 2P34A 2ZAAA 2BQPA 4XVHA 3N8YA 4JAAA 5L19A 5BUVA 2EXIA 3D0JA 3IPVA 5T50A 3ZPYA 3QH0A 2VWLL 2W91A 3A0KA 4CZSA 3H1MA 4FQZA 3I3DA 4COZA 2Y5HL 1MQTC 4AHZA 5C8WA 3KCXA 3RQ0A 1NPEB 1QOSA 1DQBA 3FHIB 2Z5WA 1PK6B 1HJ7A 4AEMA 2PELA 3SOVA 2NPRA 5JWPA 5L2ZL 5CG9A 3AKSA 2CGPA 1POQA 1VJ2A 1YEWA 5I8SA 4BZ4A 2HWD1 2VZSA 3WUCA 3LCPA 3SLIA 1YI9A 3VDDA 2HBUA 3KV6A 3ORJA 3WNLA 3PUAA 1CAVA 3RMYA 5LB6A 2ZEYA 4LJHA 1S0BA 2J4IB 2PN5A 3O5SA 4XETA 2K2TA 2XLGA 1OB1C 4ES8A 4HXCA 3BTXA 2XL7A 3WHUA 5HV4A 3K2OA 3MW4A 4FOWA 4YZ3A 4KBZA 5BNNA 1GU3A 3PVEA 1LHWA 3TGFA 3AVRA 2OQ6A 4AF9A 1RJ8A 2K46A 2ZHKA 2DVAA 1XNCA 4MGKE 1FAKL 4Q0SA 2V72A 3T2OA 2VH6B 1IQDC 3JD71 2UWPB 1QJY2 1YQ8A 3DYOA 1EAIC 4GMP3 4QPGC 4K8RB 1APQA 3UETA 3VDCA 4X8SL 3VBUB 4G3YC 2E33A 4DY3A 1TEIA 1LHVA 2P3KA 3UJOA 2E32A 2GDFA 3ES1A 5J36A 3NNFA 4TTGA 2VRSA 1BJQA 4FFIA 2BOKL 1WZXA 1ULPA 2RDQA 1O5UA 2FCUA 5K9YA 2GN3A 1JH5A 2WNVA 3WF0A 4HOOA 2BQWA 3NNJA 4YZUB 4CUFA 4RS5C 1XNAA 2LROA 2YPJA 5L9BA 1NG0A 3GZTB 1BVP1 1PMIA 3QLQA 4SLIA 1AR82 2FQPA 3MUZ1 4YVWC 3N9MA 4GKXA 5LA9A 4QDSA 5SV5A 1AYM2 2A7AA 5C9AC 2WG3C 4AK3A 4AHYA 3DXTA 2ZEZA 3ZFFB 3PIJA 4DNYA 1L7QA 2WN2A 2RS31 2XJVA 1ZBA3 1W6MB 1FV3A 2ZKLA 1W7XL 1POV1 2C1FA 3POEA 1IQAA 4TN7A 1ASJ1 1OLMA 3ZSMA 4C1WA 4DXSA 1ZZBA 1BEV3 2RS51 4Y4RA 4YW6A 5EP9A 4XJ9A 2W2NE 5EGMB 1NCQC 1KJRA 4ORFA 2WRAA 4X6QB 1W9SA 2Q1MA 3CHXA 2DCKA 4UW4A 2ERFA 4NR1A 4XHBA 4A3ZA 1G7YA 3SOQA 1W6PB 4I3PA 3VDDB 1G9BA 3T2PA 3I2JA 2CL2A 5B4XA 2I45A 1AR92 2J1RA 1JBCA 3T1LA 3SW2A 3WDWA 4RFRB 1DQ4A 3N3HA 3GZEA 1G9CA 4PT6A 1WA6X 5BNOC 2CDOA 3VBRB 5L30L 2Y6GA 5LRRA 2YBPA 5FZDA 4F3JA 1KD7A 3SKJE 1MQ5L 4QPGB 3AMQA 4OI4A 2YC0A 2DCJA 3OD4A 3U7UG 2ZA9A 2PAKA 1O3QA 1AJOA 3ETQA 1EAH1 1PO11 1UCXA 2JG9C 2VNRA 3HR9A 2PLV1 1YLLA 1G1SA 1E57A 3M3CA 4QPWA 2EXJA 2QQJA 3PLQA 3PUHA 1G2MB 2EIDA 5GKAC 4MV2A 5HV0A 1XNBA 1ULDA 3LIGA 4QXHA 5IWFA 2P6CA 3WP3A 1GZTA 5BY5A 4Q4Y1 1OOPB 2WC2A 4MXVA 1Y3TA 3N7LA 1UYYA 4GJZA 1YIFA 1A34A 1Q8SA 2WZR3 1ND3C 4ZONA 5FLIA 4PIXA 2BO2A 2G9GA 2GH2A 4LXLA 3KMHA 3PVBB 4DY5A 2SLIA 4EZ4A 3DV8A 3OLTA 3TN93 3J7LA 5JDBA 1C8M1 4OQ9A 4Q4W2 1X50A 4GMP1 3BPZA 1P8JA 3JUUA 1VMHA 4LPLA 5EXOA 4FOVA 1N1IA 2CYFA 2PHFA 4TYSA 5FZOB 3RWKX 2OVUA 2WA3A 2J7MA 1I5ZA 3C7OA 3MIGA 4IEVA 2VMEA 2RDSA 2R49A 5K0HB 1NA1A 2BFUL 4OMCA 5BYNA 4YWAA 1GUIA 1LGNA 2JDZA 4CE8A 1LGCA 2XR4A 5C33A 4C16A 1W2NA 1CJDA 2C9KA 4FCAA 3LN1A 3CLPA 2BOJA 3IAPA 4Q1PA 5FOJB 1ZZ7A 1NZCA 3AP5A 3T4VA 4AEKA 4COVA 1JBUL 3EQEA 4X8TL 2RJLA 4MHRA 3TBDA 2UWBA 2GNTA 2Z42A 3AKQA 2NP0A 1DIWA 3D82A 4YVSC 3ZKUA 3B94A 2WNVB 2OIIA 5CVRA 1KS5A 5F9TA 3V0BA 1ZZCA 2Y26A 2FDJA 4ZHAB 3J7NA 1QJX1 2P3FN 1WGPA 4EWAA 2JG9B 2RMU3 3OEAA 3SKVA 5JIAA 5E8DA 2ZCWA 3VBUA 5LA2A 1QOOA 3IMNA 4RRYA 3ENRA 3VN4A 1PO23 3FCSB 3LDBA 4Q4X3 4LKEA 3L9JT 3GZUC 4HKOA 3LSDA 4QQHA 4QD2A 2JDAA 4IUGA 1AX0A 3B3QE 4Q4X1 4R8HA 1PO21 2UY8A 2ZKNA 4ZU5A 4L92A 5A3PA 4GALA 2ENRA 2NLRA 4LKFA 2VMGA 2VU9A 2WKKA 4P5HA 2JE9A 2DBNA 3RR3A 1CONA 1W99A 2ZABA 3BIWE 4LHKA 3W59A 5JLVA 3KQCL 2NZ9A 5JI9A 1URKA 4BDWA 1HB2A 1JYCA 2IVIB 2QZ3A 2HORA 1GZ9A 2BERA 3R4UA 2WZEA 1AXYA 4MVTA 5F5AA 5KWRA 1F4HA 5L7OA 4QHBA 5FP4A 2XVKA 2KD7A 3E6BA 3HQXA 3Q8BA 2YGOA 4XF0A 3TYJA 3EBRA 5C3PA 3NSTA 4GZ9A 4CCLA 4B4PA 3ETPA 3JQXA 4XDQA 5JSPA 2WJSA 1OD3A 2YG0A 4CPBA 3HBKA 4ATEA 1A8DA 4PF5A 4JDNA 4CP9B 5KC6A 3WQ1A 1ZRCA 4X8UL 3AKPA 3WINE 4AHWA 1TQ5A 1TME3 1E5SA 4C0BA 2VWMK 3UV9A 2AYLA 4EE2A 3P5BA 2XHNA 1SLBA 3IPVB 4Q4V2 2OS2A 4WM7C 4PI2A 1V9U3 2BSFA 2XQXA 5A7SA 4RGAA 1DGWX 4BDVB 1R1ZA 4IETA 3USUA 2QBXA 1LKNA 2BPA2 1VPHA 2X5IC 1G9AA 1YYNA 3QBQA 1FPN3 5IT6A 2D3PA 3HJRA 5FZCA 4WZCA 1IOXA 2VMFA 4L11A 2XC0L 2UWCA 4I2OA 1ZYBA 2WNUC 1BEV2 2J94B 1F5FA 5JOYA 2J1VA 2RMU2 1ALYA 2OXBA 3RG0A 3NT1A 4NIHA 1VB4A 4W6YA 1AR91 2EXKA 2P2KA 1XYNA 4MO3M 2BZDA 5A80A 3TNQA 3TEYA 1GNYA 5CADA 3HPNA 5F5CA 4AVBA 1EAH2 3D0SA 3ZN4A 3WHTA 2FZ2A 1UZVA 4KG0A 4JZDL 2JX9A 3KF5A 4LBMA 3WDUA 1M06G 1REEA 2D5FA 3WVJA 3MIBA 2BEOA 2JDPA 2KL7A 3D5OA 2Q1FA 2H9EC 3FLRA 4P00B 4CEWC 3TH3L 3TK5B 4QPGA 2GC0A 1DFQA 4LMFA 1SFYA 5F39A 2GC2A 2DV9A 2B7DL 3ILNA 3GBFA 3IMMA 5DABA 5AVPA 5GLUA 1ZBE3 2FMYA 2WFPA 4PDWB 4CYDA 1OI6A 1WD4A 4MGZE 4CEYB 1JS9A 4AFAA 5JOWA 2WAOA 1RUC1 1UZQA 4X8VL 1DF0A 1FAXL 1O8SA 2XJUA 2KA3A 3IDEA 4IV3A 2Y5FL 4N7UA 1XE7A 2AR6A 2A1XA 4FT8A 3AP7A 4LBNA 3KGZA 3WG4A 4ISIL 5EZWA 1JZ3A 4J1WA 1RUG3 1U5XA 2PQQA 2RJKA 3J8F3 4NHMA 4OHWA 4DUWA 4GU4A 2Q5TA 1UX7A 1GV9A 3SXWA 5JZGB 3OUIA 2ID4A 4O02B 2WIIB 3E6CC 4QX0A 4Z0LA 2EIBA 4LULA 3VHOA 3MLJA 1IQFL 3A21A 1WHFA 1UD1A 2PTMA 4YT6L 5I0UA 4GWMA 5GM0A 5FYUA 4Q4W3 3ZN5A 4EYUA 1O4TA 4XTPA 3S7IA 2VW0A 1X36A 4P9IA 5JZGA 3CBNA 1R64A 1LGBA 1VAKA 4IERA 4QQPA 3VD7A 4CUCA 2P1BA 3IBMA 5K0UC 4CVUA 2J95B 5LBEA 3ZYPA 2WG4B 1F7MA 1OSGA 2GNBA 2ZX3A 1PGW2 2YC2A 3MI8A 4IV3B 1VBB1 3UGGA 1W39A 5CISA 4BB3A 1IJQA 4WV8A 4XIOA 2WYSA 1UMZA 1FOD2 3HAGA 1SLLA 5C3RA 2EI8B 1MS9A 3V65A 2VUCA 3H3LA 3RYPA 3ZFFC 5FZLA 2CV6A 5C3SA 3E5QA 4DRRA 3ZFEB 2DVFA 3P6BA 1RUE1 4JRAA 2J42A 1RITA 2ZACA 4L9BA 4UT5A 4NJ4A 4UFMA 4YRDA 4HSLA 5CAZA 1UU6A 4Q2FA 4MADA 3PIGA 1NKGA 4GMP0 3WF4A 1BBT3 2VZTA 3LAQA 1OH4A 2ZZQA 3LWCA 4OUEA 3RZKA 4B8EA 1UPIA 1S0JA 4RGKA 1PM4A 5FK8A 4NIGA 1W2TA 1BK0A 4XBMA 1JHJA 1R1A1 2B5HA 3APBA 4CU6A 3OPWA 1R081 1Z0HA 1LR5A 4IEPA 1U5IA 3PTRB 5C5UA 2XG3A 1ND3A 2E26A 1KEXA 4M3CB 1G2LB 3ILFA 1N1VA 4AI0A 1RHI3 1VBA1 5K0UB 2WLQA 4FPKA 1CVWL 4J1XA 3LGRA 4P14A 3GBGA 1UXZA 4XF4A 4LBOA 2B8MA 2DTYA 1N7DA 5EPAA 2F17A 4GWJA 1F4AA 1N1SA 1W9WA 2Q8OA 1CZSA 3KD4A 3NNGA 4NROA 1KRIA 1H9WA 1FJSL 1HQNA 4E27A 1NZIA 3NV4A 2QE3A 3I2GA 1OQ1A 5FTTC 1S2KA 2R30A 1Q56A 2RA0L 5CKQA 3CFWA 4QU1A 2G00L 3GHMA 3JZVA 5A6YA 2W1UA 3VDAA 3B69A 5FZFA 4CPBD 5DAXA 2WR9A 3H9AA 1GQPA 5FJHA 2G1MA 5G04L 3WXPA 2R16A 4B4RA 2CGNA 2EAAA 4LBLA 3THCA 1CZVA 3WR0A 5FAXA 5FYSA 1RUH2 3WF2A 5C8CA 1D4M2 2OPWA 3M4FA 2BQ7A 5C9AB 4XFFA 4Q0QA 5E89A 4CCNA 3CEWA 3N8ZA 1CD3G 2RV9A 2HH9A 1B35C 1JW6A 4JGZA 3ZSJA 3ZDSA 1C4RA 5FY5A 2ADEA 2JKHL 3HEIA 1HAFA 2QQMA 5D8AC 4LBJA 2XBO3 1BMV1 4MH0E 4AHXA 1RUD2 3U10A 1QH6A 1HKDA 1LESA 1NE4A 5I8YA 2BOUA 3OSDA 1K5MC 4ZXKA 2ORZA 3N7KA 1PIV3 4CEYC 3M8LA 4CRQA 3THTA 1HRI3 5FZ8A 5FBZA 4N7IA 4YGCA 5SV8A 5FLJA 2VGDA 2JWPA 4AVSA 2JB4A 4YZ5A 1HZ8A 3ASIA 3WG3A 4AGRA 4LHLA 3UK9A 1W03A 2DURA 4PH9A 1ATDA 1VBC2 3VDDC 1C1LA 4XJZA 1JZ5A 3IN9A 3NRUA 4K6BA 4CDQA 4FPJA 3C9AC 5A1AA 4RFT0 1UZKA 1TMF2 3QD6A 2Q30A 4K8FA 3JU9A 4M10A 1YFWA 3ZKYA 4NPRA 2LUWA 4XE9A 1IQNL 1Z7S3 3B9IA 4P02B 1NCRA 4Q5OA 1S55A 2UYAA 4HVRA 1YUGA 1DQ5A 4ZZ5A 4TXWA 4UW5A 2B9UA 2Y0OA 3LA2A 3N35A 2YGPA 2RHPA 2HWF3 1NFXB 1UZPA 2KV4A 2BU9A 1UYXA 4D0EA 1BHGA 1B9WA 1HRV2 5FWEA 3ZSLA 4QT6A 4Q27A 1CPNA 2QNKA 4UBHA 2D3SA 3SCGA 1NA1B 1RIRA 2VZPA 5DDJ1 2VY0A 1OOPC 4A7IA 3AZYA 3IJEB 1CAXB 2TNFA 2GP3A 1FX5A 4MGIE 2XBXL 2BDRA 4BYYA 2V5DA 3ELNA 2AREA 5EHDA 5DDJ3 1RUH3 1CZTA 4LO6B 4RN5A 2XL9A 1CEJA 3O1SA 1KIGL 1O8PA 2XLFA 2YZ4A 5A7QA 5JUVA 2P4EA 1GMMA 3C3VA 3QCWA 4ZU7A 1ULCA 5C9AA 2XKPA 1BF9A 5BNPA 1V6OA 1EMNA 2X8KA 3AMMA 4S2HA 2HOXA 3O1UA 1AXKA 3KQDL 2Q0AA 1WCQA 1O3TA 1EPZA 3TEWA 5KXCA 2D6LX 2HJIA 3OOXA 3BN6A 5JB9E 1J83A 1EMOA 2KR2A 2P94L 4HL0A 3MDLA 4K20A 3KQEL 4I3GA 3LF7A 2VZQA 4ASLA 2R063 1ENXA 3DYMA 5FV3A 4JYVL 5IKTA 1S4CA 2HWC2 5D21A 3LTGD 5FYBA 3RZMA 3SNMA 2P3JA 3BB6A 1XSRA 1NCQA 3AMNA 1R1A2 1HXS3 2Y6LA 3IM0A 4N53A 1QFKL 3PJQA 3BVCA 3T08A 1VBC3 2XC4L 4CUGA 3ST7A 5F37A 3H1YA 5L2YL 1DDLA 3K48A 2L9LA 4I30A 5GZGA 1YIPA 5L36A 1RVF1 3I3MA 4MG2A 2VR4A 1PXXA 4CP1A 1P0SL 1OMIA 3OYWA 1HX6A 1QXRA 4XBQA 2VOXA 5A3WA 4OHVA 5BNOA 1AR83 2GMEA 1U67A 4M3CA 3T0AA 1FFMA 2JE7A 1H30A 1N47A 1AX2A 2V5YA 1G86A 1CVNA 2VD7A 4MXWA 2JICA 1ZBA2 3IDAA 4LNVA 1V6NA 3HO3A 1KQRA 1RHI2 5FCCA 1WW4A 1MZ5A 3Q8CA 3KRKA 1C5IA 4B7KA 4E4ZA 1AR61 5IVVA 5T5LA 4XTMA 1OQEA 3AKRA 2ZGOA 4A4AA 4QU2A 4IEUA 3POFA 3OB8A 1ZX5A 4TGFA 5CKNA 3PGHA 2YBSA 1A78A 5JZGC 2GU9A 2ARCA 1TG7A 1RFNB 2HEWF 4JX0A 3HO5A 3EJKA 3FUOA 4J25A 4GH4B 1EUUA 4AR2A 1YFXA 3HQUA 3KK6A 3SH3A 1UZ0A 1W0PA 1REDA 1HRFA 1D2SA 1ZRFA 4LQRA 1MZFA 2OW4A 5F3IA 1F2NA 2CHHA 5KXBA 1LECA 2CTVA 1RUD1 3R4DB 4LR4A 1SPPB 4H55A 4YFWA 2BBAA 3M36L 1R091 1PVC2 3LDKA 3PURA 4ZXXL 2ZX2A 2GD4A 4N90A 3K75B 1KFUL 1DZTA 1LOCA 2JKBA 3CIHA 3GNEA 1S2BA 1Y9GA 2GNDA 2Z2SB 4YM0A 1D4M1 5F6KA 1W6QB 4CTEA 4S2FA 5IATA 1R1A3 1HXS2 1WA4A 2VC9A 1YI7A 2LTNA 1LK9A 4LIUA 4S2GA 3MFAA 4H7MA 4I0AA 1OF4A 1W06A 4AFMA 2PAMA 3AP9A 5JPMB 1NY71 3S5QA 1PX4A 1BBT1 1J1TA 3J4UH 4WM8C 3ZYRA 1UNBA 2O0OA 2NM1A 2VW2A 3S57A 4MOAA 2VXJA 4XDOA 1H8TC 2ES3A 2GP5A 1DGLA 5M0TA 3QH6A 1BK1A 1NFYB 5T3NA 1RUE3 3FLTA 1QNYA 4XOGA 1IPSA 1Q3EA 1ATBA 1KS4A 3CENL 2ZOEB 3QH7A 5KHGA 1PRHA 2RNLA 3H42B 3I59B 4ISQA 1CWPA 5E1RA 1NXD1 3KQBL 2A75A 1ODNA 2VVEA 3OYWB 2W1WA 2R071 2WABA 3BALA 3NAPB 4JTOA 4Z82A 2E9QA 2VUJA 4IEQA 4MYEA 1C1FA 3EHKA 4FP3A 4IE4A 4K1ZA 1IG0A 1RVF3 1GYKA 3VKNA 2WPJE 3MW3A 4DXRA 1IVOC 2BGCA 3ES4A 4PJYA 1VBA2 1IPKA 1MS3A 5GLVA 4Y1VA 1V1IA 4M00A 4CDUA 5A3MA 3ZFGC 2ZAHA 1STMA 2VCMA 2W92A 1LMJA 3AZZA 3U0ZA 3RZGA 1VBE3 4D7YA 5DAVA 1J3RA 1AZDA 1UIKA 5H9PA 4BQ5A 1MS8A 5FZOA 2ARAA 1AYM3 3OUHA 4JGYA 1RMU1 1RUI1 3PVNA 4WM8B 1RYYA 1TPGA 4WZFA 3S6XA 4PLOA 3JB8A 5JMCA 5HXVA 1C28A 1K42A 4R9CA 1NT0A 3E5XA 4QAWA 5CFCC 4UOJA 3VBHA 5IAXA 3NJYA 5IK8A 1JUHA 5A7PA 1NX9A 3BTAA 2W46A 1AVBA 1IQKL 2EAKA 1GLHA 1EPGA 3RSJA 5FZ9A 3ZXLA 3B00A 3HT1A 4XF1A 4YLZA 2HWD2 1SCSA 2WA4A 2TUNA 3O14A 3LEIA 2DBIA 2QVSB 4BE3A 4A42A 4DQAA 2DVDA 2JECA 4V2VA 3TRSB 3CS7L 2I07B 2JJ6A 4NRQA 4F7ZA 1MOXC 5A7OA 1W6MA 1MEC2 3VHRA 1WUVA 5TSWA 5IKQA 1GOFA 4HZFA 1IQJL 4BWOA 2IC1A 4UW3A 1FMD1 1ND2C 4OZOA 4K3UA 4QB2A 2VOTA 5HXMA 2QQWA 4CDUB 3LSEA 2D43A 1XDTR 1UO9A 4XF3A 5JR7B 3AXDA 2FZ1A 4BH9A 4YW5A 1QQP1 3VBRA 4ZXYL 2VZ3A 3NJXA 4MSVA 4C8DA 1UY1A 1LJ7A 5FYTA 2PYTA 4JHTA 4BXFA 4XHXA 3WZ1A 4A44A 5EJZB 1JYIA 3C8XA 2BV4A 2WZR2 4DUVA 5DAPA 2X5IB 1B09A 3PU8A 4Q4V3 3RPQA 4FAHA 1PVXA 2XMLA 4LIVA 4OHZA 3RYKA 4BTUA 4CUBA 2NPIA 5FZBA 3UGHA 4P9JA 4G4FA 4Z2AA 2VULA 4GA9A 2MEV3 1GWLA 1HDKA 3IWZA 2OT7A 1O59A 2WNUB 3QMOA 1VBE1 4R4ZA 1SDDB 4WVWA 4BISA 1TOZA 3K4DA 2ZHMA 2Y34A 2YXSA 4FXKB 5J96B 3D6EA 1PTHA 1C8M2 3I54A 4LORA 4ZZ8A 3FUQA 1PVC1 3MPBA 4LUKA 3JBG1 2OYZA 4DPNA 1KLIL 4YG3A 5DUWA 2B4KA 2OYEP 4MUVA 1UOGA 1SFNA 1W9FA 1WWYA 2J2UB 4V1PA 4E2SA 1GNZA 3N9NA 1ATEA 4UXAA 5G05L 4NAOA 1SPPA 2WL1A 2ZX4A 1WMEA 5DG1A 2VTFA 3KQRA 5IKRA 4CEWB 2VQAA 3F1SB 3MIEA 2EIEA 2VQUA 2XLAA 1PMJX 4FVVA 1KITA 3SCFA 2E7QA 4CCMA 2DTWA 2WFXB 2B39A 1GQGA 3WNXA 4K9SA 4CA9A 3MGUA 1LOEA 3F6UL 3W20A 1FF7A 5CFDA 3BOPA 1GWMA 3RJRA 4G9SB 3RFRA 3IKWA 1D0HA 4BIFA 3AX4A 3H8UA 5IVFA 1NCQB 5IVEA 4URTA 1AUYA 2D6NA 1URXA 4Z07A 1AL21 3WV6A 2YU1A 1EYBA 4Y5Z0 1OUXA 2RM22 4PHZA 4EN0A 4AWDA 5T5OA 4RHV2 2WPHE 4BXSA 2W2PE 4RS5A 5GZDA 1JYVA 3Q8AA 1EV13 2IVJA 1R093 5IVBA 4W6XA 2P28B 1W9TA 4DXZA 4FP2A 3AZXA 1X7NA 4I0WB 4W65A 3VUOA 4CU8A 1QH7A 2WO7A 3L2HA 5K7PA 2ET7A 2A3WA 4NGAL 1ZAQA 4I09A 4SBVA 5CEHA 1XNDA 3SH4A 5I93A 2MGRA 5FP9A 1ZNPA 5JOXA 5JXJA 2G19A 3BYWA 1DU3D 3C7HA 1CCVA 1YQCA 3PDQA 4XJAA 3EO6A 3ZYJB 3G7DA 2R072 3W5MA 1LEDA 4FSJA 1COV2 4XUOA 3VD4A 3KF3A 4OYUA 3URFA 5CFCB 3P5BL 3SOBB 2GSYA 3INAA 4BQWA 1SACA 5AVAA 1O4ZA 1TME2 3WG2A 3O1MA 3NJZA 1DYPA 1V1HA 4FOYA 5HBAA 3LFIA 5LA0A 3N8YB 2QCSB 1W2AX 2WS92 2VBBA 4OI1A 4BXWA 2PR3B 2RS13 5IVYA 3V0AB 1GP6A 5EJ3A 3ZIXA 3LIWB 4KI5M 5EJ1B 5FQ0B 2RS32 3MHZA 4QPIA 1KSNB 2R32A 2XJTA 5FOBB 4NVPA 5JIUA 1V9U2 5FXWA 2DUOA 1LPZA 2A5ZA 4A41A 4AOCA 1TNFA 3N7MA 4M3CF 3Q3KB 5JB8E 1VBB3 2VVUL 4BLIA 4MX3A 1WW5A 2C6SA 2W2IA 2Y0IA 1I6XA 2YUEA 4DRVA 3WCSA 2VCCA 4FQ4A 1OXCA 1KLOA 1QJZA 3RJ2X 1UY4A 2Y64A 2IWGB 2CGOA 2WFF2 5LK5A 4YFZA 5FP7A 2PHUA 3PNAA 4N9HA 1SZBA 4MMYB 2RM23 1JZ8A 4EQVA 5IVJA 2DYCA 2RM21 1J1LA 1R092 4MGQA 3ABZA 4R9DA 4YW4A 1Y9MA 1EAH3 1YRZA 1LCLA 1UAIA 2PAEA 3DPRC 3IIAA 3TWIA 4CDWC 4KWUA 4YGEA 4BQ1A 3VL8A 4KH9A 2JENA 3LEKA 5A7WB 3I49A 4NHLA 5A7NA 1OF3A 1DIYA 4XFAA 4NUBA 4Q0PA 4YM1A 3RVHA 2B42B 4YSFA 5FP8A 4BQXA 1W6OA 2BFUS 3ZXGA 3CZJA 2R073 3ZO0B 2C4XA 4K40A 1COV3 1S0FA 3OG2A 4Q1RA 1Y43B 4OQ8A 5F1RA 1AL0G 1UPSA 2VOVA 2ZGPA 4OUSA 1GWKA 1SG3A 2J1UA 1VAMA 1VR3A 1XQNA 4KWKA 4Y1YA 1G6NA 2WS93 3AP6A 5D1IA 5A33A 3S6PA 1CAWB 3ZSEA 4JGYC 4B3NA 4Y5SA 4COWA 4LHNA 3MQEA 4O9GA 3POJA 3POGA 1JZ7A 2WS91 1ZRRA 1DX5I 2GC3A 2PHXA 3J8F2 1H8TB 3CO2A 4ITCA 4P9YA 4QDQA 4GB33 4XMIA 5CFCA 2EALA 4AAPA 1QHDA 1D4M3 1U5ZA 5DUXA 1SCRA 3OY8A 1WKYA 4A7ZA 1AJKA 1UOBA 1VALA 3DL3A 1XC6A 2Y7ZB 4XQDA 3VBUC 3WG1A 2XJQA 4CP2A 1OLRA 4A6SA 2W2ME 1CIWA 1YO8A 3NAPC 2TEPA 3OEBA 1SDWA 4PBOA 1W90A 2IXHA 1RUI3 3B7MA 2GN7A 2XBWL 1V6MA 2QQLA 4QKFA 1WCKA 3SISA 1QXJA 4BDXA 1J3QA 2ETEA 2V4AA 1RGSA 2WYFA 3WNMA 5F3GA 4QHOA 3N8VA 1IQLL 1V70A 2PHTA 1EV11 1L7RA 2AYHA 1CX2A 1GFF2 3ZIWA 3KCCA 5F3EA 4IEZA 5K4LA 2ZGMA 4GWNA 1VAVA 4PF1A 5C4WC 5IFPA 1AL23 2ET1A 1W04A 3I2HA 4IQPA 4OFGA 4Y1ZA 1ODMA 2P6HA 1NQDA 1VLNA 4MGYE 5EYXA 5FZHA 4BHPA 3LA7A 4UW6A 2XBO1 5CFDB 2H0VA 2YPDA 2FLRL 3GF6A 3QOPA 3UKNA 4DIQA 4LOTA 1E5RA 1MEC1 3LC5B 5IKVA 2GZWA 2MNGA 3IZOA 4JV4A 1XSQA 4LOSA 3GDBA 1CCFA 4TLFA 3WF1A 2G4IA 3ZYHA 2ZHLA 2R1DA 4NG9L 5ACA1 4R4XA 4JVAA 4IESA 1RUNA 1R082 3NQHA 5A7WA 1MS5A 2E7TA 4R9BA 2O1QA 1WCSA 3MW2A 2YU2A 3VBOC 3OY8B 2DDUA 5LATA 4ARYA 1AYN1 1X33A 3LOBA 4N53C 2DU0A 3WP6A 3T30A 1JZ4A 2W08A 1QU0A 4Y71B 2R7EB 4XAAA 5CIRA 4WVZA 4XZUG 2R6QA 4GKYA 4RRWA 3ZYIB 3HNYM 3JBG2 2QFEA 1UF2C 1DYOA 5FO8B 2A3YA 4Y4YA 4YW1A 1KXGA 1UYPA 1PK6C 2BNOA 3TOJA 2XH6A 4AL9A 4Q8KA 3C7GA 1YQ2A 2WNUA 4QM9A 4YVWA 4S2DA 4RR3A 1LOFC 2K2SB 2ZGQA 4K1YA 3J7HA 3ZMNA 2FDHA 3SC7X 2VTXA 2XQRA 2YDEA 3CKHA 2X09A 2YV8A 4YW7A 1LQDA 2TGFA 5FDQA 1V6JA 2CAUA 5T52A 1C8NA 1HIXA 4XFBA 4YZ2A 1XJAA 1BQPA 2ZGKA 4Y20A 1S0EA 1RUI2 1YHFA 2NMNA 4AQSA 2D5HA 3I8TA 4NIDA 2HWC3 1W8UA 4H7LA 2DCZA 1H1IA 4IXLA 5IHRA 4GWIA 3NJPC 2WBKA 4JKLA 2QQPA 1X8MA 2XGXA 3TZIA 5FQ0A 4DFSA 5JSRA 3BKZA 5DMYA 1ULGA 3AB0A 2WQ8A 4BQYA 4OTJA 1OHFA 3KVAA 3HS6A 5ERLA 2VH9A 3MF9A 3V56A 2FHRA 5LBBA 2D6MA 3BTZA 1OVSA 2VG9A 1AR72 3WD5A 4AI9A 4COYA 1F8VA 3RNSA 5FZKA 1BMV2 2EI6B 2R042 4B1LA 4IV3C 5DG2A 3ZPOA 2Q8DA 4Z1VA 2J34B 5I46L 4LITA 1FNYA 1CQEA 2O8OA 1O6UA 1GZWB 1SBDA 3DYPA 4M0NA 4QXBA 4BMBA 2ZX0A 1RUJ2 1DBNA 4C0HA 4XABA 5FY7A 5KC5A 2VNOA 2X53S 5FLHA 5ABJA 4DZGA 5HCAA 2K0GA 4P9LA 2ZTNA 1Q8VA 3PL0A 1AR81 4MGSA 1GANA 2Y82B 3D4KA 2RDRA 2BWAA 4IEXA 1Q8PA 1MQTB 2UY9A 5F32A 1DZQA 3AFGA 1HRV3 1HX2A 1QIQA 1XYOA 4XF9A 1KFXL 2P17A 2W86A 3TNPB 4BK5A 5F3CA 2E7AA 1PGSA 1S0CA 2C9AA 3HVDA 3IB3A 1XNTA 5DN2A 3GXUA 4DXTA 3BTYA 1LHOA 5KR7A 3M3EA 1CX4A 2DWRA 2VBDA 2VZOA 2AEYA 1RINA 3GISX 1EBVA 5IW0A 2Y60A 3ZSKA 3J8F1 4YNIA 1IG3A 2VQTA 4IV1C 3WW2A 3R4SA 1DCSA 2QUOA 5DDJ2 3P3PA 4CUDA 4XPVA 5JXGA 1QIUA 1TZOA 4IEYA 3DCQA 3MF6A 4JQRA 1RXGA 3GZAA 5GZCA 1ST8A 4KMQA 3RWNA 1JYXA 2JG8B 3W21A 1GICA 1HB4A 4XQ4A 3VZJA 4DOUA 1IP0A 3H8XA 2B7YA 1W8BL 2PLV2 4XL1A 4MMXB 3DF0A 1RB8G 1F0RB 2FDIA 4IL7A 4QXCA 2A3XA 2B46X 1OKQA 2XJRA 1AX1A 4KWJA 1HT8A 2VJXA 3S30A 3U1XA 2EF6A 1O4YA 1UU4A 1K5MB 3K4AA 1UQXA 1D7PM 2UU8A 4NIIA 3U78A 1X9PA 2XJSA 1RUE2 4LBQD 4YM2A 1O5LA 2QDRA 1OA4A 2YMZA 4ZKTB 2MHPA 2WYJB 2R043 3BU7A 3PTYA 2GAUA 3O0VA 2K9ZA 4UF0B 5FRAA 5CU1A 5IUQA 3H8RA 3N8WB 2ZMNA 3ZFEA 4TSVA 4N43B 3OD0A 2HWC1 1AUTL 2YGQA 5HI0A 1HQWA 3M1HA 3N9QA 4PLMA 3W58A 3I7DA 4BCUA 2FDGA 3WNPA 2VVFA 1DP0A 2UYBA 4QXKA 4HT1T 5APAA 1LB2A 1JU4A 1W6OB 3HWJA 2VWNL 4LA3A 2G9ZA 3DKWA 4NIAA 2ZGLA 3FE5A 1JZ6A 3HO4A 2VZ1A 5C5TA 2ZGTA 4JTNA 2BVBA 5H9QA 2RG4A 2F9BL 4CCOA 1MZEA 3LOIA 2E6VA 1WCUA 3M70A 3QACA 4LK6A 5E16A 4AFDA 1SFPA 2DCYA 3M3IA 4ZS3A 4EJRA 5L7OB 5A3LA 2V73A 3HIFA 2WLPA 2BZ6L 1JODA 1SLCA 4PIZA 2A6XA 1UOFA 4Y22B 3LTFB 4FPLA 3U4XA 2FDFA 2CDPA 1R083 3GCXA 3WDXA 4CCDA 3HS5A 1Y9QA 1YGCL 1AYM1 3H1WA 1JZ2A 1HRV1 4LT5A 4Y1UA 5ISLA 1NFUB 3PHMA 2Y6FA 1XE8A 1JXNA 1PNFA 5ANQA 5GJ6A 4YZ1A 3S5AA 3MEPA 2WT0A 1G9FA 1W8OA 2YY1A 4HKLA 1XOYA 3BGAA 4CXXA 5LW9A 2XPJA 5FYIA 1B35A 2JIJA 1AR63 4FAGA 3WLUA 5LWBA 3KT1A 5D8AA 2QKDA 4DEVA 1UX6A 3DN7A 1OFSA 2WAAA 5FYHA 5JVZA 3EXUA 1LOGA 2OUJA 5EFUA 5FXXA 3ZDVA 5DUUA 1CGPA 4CEYA 1NOVA 4ISRA 1GP4A 4XYXA 3O1TA 1EPWA 2Y5GL 3TK6B 1FT9A 2RJ2A 3LA3A 4L99A 5GALA 2XC5L 5LK7B 2WNEA 3VB9A 1WLCA 2IXJA 2VW1A 2VZRA 1PVC3 4KWLA 3RS6A 1V6LA 4XLWA 4AEJA 1MEC3 5FYVA 3KS7A 1XBFA 4RS0A 1PM7A 1F5JA 3B9CA 3M3OA 3HS7A 5FZ6A 1W6NB 1QJY3 4CDQC 4CSWA 3N4MA 2E31A 4D90A 3BI3A 3VBSB 2JEMA 3CDZB 1FI2A 2O14A 4META 1GK5A 3TEXA 3H3ZA 4LLOA 3FBMA 2BBVA 1D2QA 1VMJA 3K9XA 1S2EA 3ITQA 4DMIA 1VRH2 3LN0A 4JKMA 1QJX3 1Y4WA 2E53A 3JQWA 1UW8A 2WO3A 5FPUA 4WVMB 1LULA 2C5DA 2Y81B 2NQYA 3GYDA 3LAGA 5E88A 3T2TA 1RUG2 1ULFA 2J1EA 3KV4A 4Y26A 3MZHA 4Z92B 3LFMA 1XYPA 3LZZA 4URAA 4JZFL 2XOMA 3ROUA 3VBOA 3VBHB 5I0DA 2ARXA 2PA7A 2P16L 2PHWA 2WZ8A 1X7AL 1OOPA 3I2FA 3O1VA 3A7QA 3OLUA 1RUJ3 2EICA 1ACCA 1Q5OA 1DQ1A 5FY4A 5F8PA 3UNPA 3S0MA 2XVLA 3AJYA 1JTZX 2D44A 3DUIA 1CAXA 3WNOA 1Y7BA 4FO9A 2N7GA 1VBD1 1W6NA 4GB31 1IQHL 1HB3A 4GH4C 1ADXA 1LOFA 4EV0A 1ENSA 4Y7AB 3MLLA 3V64A 3TN91 4GAZA 2ZGUA 3RZZA 2DVGA 4FFGA 4FFFA 2FBEA 2JB8A 3FHAA 2BVVA 3KB5A 5A3OA 4X6RB 3ZVXA 3C2UA 3K51A 1W9YA 4XAEA 4JHZA 1JOPA 2WQZC 4AEDC 4JZEL 1NAEA 1W8NA 2QQIA 3LPFA 3AYCA 4LKDA 3F2ZA 2HWE1 3RI8A 4D6QA 5LZ6A 3RRDA 2RDNA 4P9XA 5FPZA 2RVAA 3ON7A 1KGYA 3ATGA 1H6YA 3KV9A 1J84A 5T54A 1KLJL 2RS52 4CDQB 3O1RA 2P37A 1ZREA 2VH0B 5BPXA 1EZQB 3H7JA 1APNA 5FZEA 1NY72 3MDPA 4FPFA 1FMD2 4Q29A 1HAEA 1CR7A 1WW6A 2KNIA 2BT8A 2WNVC 3RMXA 2GALA 2VMCA 3KWVA 5DPNA 3WQBA 4NWWA 5J1XA 4QPYA 4ASMB 2HYXA 3FFZA 2WWSA 4GD4A 1HRI1 1L3YA 3HT2A 1WBLA 2EA7A 4MZUA 1FNZA 2R061 4O1ZA 3B01A 3T2QA 2JXAA 1QJX2 3FLPA 1PIV1 1HN0A 3AL5A 5FZ0A 5FMCA 1NXMA 1XXNA 3IDBB 3VBFA 3VHNA 5IK4A 1W3VA 4OVEA 1APOA 3U37A 2W3IB 5LBCA 3OBZA 4Q4V1 1BZWA 3GM8A 4YT7L 4ZPIA 4GULA 2BW8A 4FTSA 1CAVB 1RUG1 2LRPA 4JGZB 2J1AA 5A3UA 1ZBE2 3U11A 1WW7A 2TBVA 4XJWA 2XJPA 5FMBA 1PGEA 1QMJA 3FJSA 4RSUA 1V00A 1QQP3 1WU1B 2RS11 2VZVA 3KM5A 3DKQA 5C8CB 1EUTA 1ASJ3 1J9CL 3U73A 1MS4A 4FM5A 3GCWE 1YFUA 3HQRA 4P5YA 4PIYA 2YGMA 3MUY1 1UXXX 3AMHA 4XUTA 5J09A 4LTAA 2RS33 3CL1A 4FPEA 4N53B 4OLLA 3N8WA 3K3NA 4AQTA 4RA0A 4N43A 1YQ6A 1NUKA 3H3UA 1IPJA 1QDOA 2ZEXA 1DDXA 4UWDA 4IV1A 2H6CA 3GJAA 1MS0A 1JL9A 3WCRA 2MEV2 4AQ6A 1BKZA 2DFBA 5T5PA 4AVCA 2YBKA 2P3TA 3P1IA 5JPNB 3USUB 1GZCA 1SMVA 5JI7A 5FUIA 2HWF1 3VBOB 1CIYA 4CDXB 3EB7A 1NFWB 1RUD3 4PBPA 3KHCA 4XACA 1EGFA 2Y8KA 4XUPA 2Y80B 1VP6A 3ZN6B 4CCCA 1OA3A 2OX0A 4E2QA 1PGL1 4Q8LA 3M3QA 1F0SB 1GZWA 4I0BA 4E1GA 3NTGA 3A0NA 3PJYA 3AJZA 1YWKA 2VMDA 2VCBA 1YJKA 2D93A 4BQ4A 3OBAA 1DQ6A 1ENRA 4WM8A 3UL2A 1HJGA 3CNAA 3N9LA 1OURA 1H8TA 5FUNA 2RR12 1H4GA 3D8CA 4PDWC 3WNNA 1K45A 1WBFA 3AYDA 1UU5A 1XU2A 1ZRIA 1LHUA 1CAWA 3MIFA 1EP0A 2AH2A 2E51A 2JKXA 4B1MA 5A33B 1JMUB 1JI6A 4JGZC 4KNCA 1KKEA 4UI9L 4LE3A 4JYUL 4RRXA 1BBT2 1KJLA 1NLSA 3UJQA 3F95A 5C3QA 5COXA 3HN3A 4K21A 1N1YA 1J58A 3IDCB 3NAPA 1VMFA 2E63A 1H8VA 4Q0VA 1W6PA 4HN0A 4KL1A 2Y33A 3BT2A 4IGOA 4R52A 3U14A 3VLBB 4NHXA 4QWNA 1RC6A 2WPKE 1HB1A 5FZMA 2WQ4A 1QQP2 3LE0A 5ACA3 2PQSA 1W28A 2JDHA 5F1AA 1LNSA 2ZGRA 1PMHX 3VHPA 2EI7B 4HK8A 1UOJA 1IQGL 4X8PA 2BYVE 1ZZ8A 4D6SA 2HYKA 2H9EL 4M3CE 2CY6A 2UWAA 1QWRA 5JVVA 5C4WA 4GB32 3WDYA 5A1LA 3A4UA 1LEMA 1ZZ6A 1WCDJ 3JCIA 3NO8A 2FMDA 3OGVA 4RQPB 3WUDA 5JR2A 1BXHA 4JQTA 3UYJA 3OBRA 4OHYA 1HT5A 1BVVA 3CJXA 5DQ0A 3IT8A 4IE0A 2WUHA 4KU8A 3TN92 4EN9B 3K3OA 3BODA 5FY1A 1K12A 3MV01 1UZWA 2WPME 3ILRA 3GGLA 2AEZA 1DZRA 5D2AA 3VKOA 1V6KA 1VRBA 1PHMA 4HFSA 4RD7A 3C7EA 3WDTA 4HSJA 3A22A 3MLKA 4BPZA 4OI0A 1NCRB 3AM2A 4F83A 4EZHA 1GKBA 4UFJA 2BNMA 4GXLA 1CESA 2R062 1VBB2 3LD8A 2Z69A 5LEJA 5LRSA 2R0FA 4LHSA 2FDKA 2VMIA 1QXPA 4L2NA 4AQ2A 3T0BA 4I02A 4UYBA 5A32A 2VXRA 3J26N 1LPKA 1HJFA 3E6DA 4NRPA 4JKKA 5EQUA 1K36A 1IGZA 1C3HA 3CMGA 3O0WA 2FD8A 3IIIA 1XE0A 2RE9A 5BV6A 1VRH1 1PIV2 3OGJA 1F9KA 2Q1ZB 4W50A 5JBAE 2PHBB 2BMGA 1XFEA 2A6YA 3NNMA 2XHKA 3T0DA 5BNNB 3BT1A 4IW3A 2W95A 4AI3A 3B93A 2D1JB 2QTWB 2VAUA 4IGQA 5BNQA 3I3QA 3SITA 1RJ7A 4YVSB 2ZJCA 4E2GA 2WO1A 1COV1 2R1BA 4IEOA 1L3JA 4XDPA 2IXIA 3H7YA 1A3PA 2X29A 3AZVA 4QKDA 5L73A 3RI9A 3S7EA 1GSLA 2FZZL 4QKBA 1ZA7A 2I74A 4QX2A 2OYUP 1OH3A 3K46A 4UBGA 3JBG3 4RGGA 2JDUA 5FIXA 4R9AA 2D6KA 3PUIA 5GLTA 2WZR1 3UT0A 1NLRA 3H8OA 3RDIA 5F7UA 5I8TA 1GBGA 3LEGA 2HWF2 4HG6B 4GIQA 5A6ZA 3ACLA 5BXXA 1EPJA 2AUYA 4M4PA 1MVEA 3O0XA 4AAXA 2MEV1 3FL7A 3ME2A 3VBSC 5LCWL 1H6XA 1VE0A 1FAYA 2P3FL 1IQML 4AZZA 1ZRDA 1ASJ2 1JOBA 1UKRA 5FPXA 4JDMA 5C3OA 1EQHA 4KGGA 3LDRA 2HWE2 1TME1 1JU3A 2YB7A 4QGMA 1NE6A 5FZ1A 4NWVA 4GU3A 5KIRA 3KZ4C 1YNAA 4DUXA 2LW8A 3I4IA 3CZUA 5E6HA 4AE2A 5CFDC 5FY8A 2JD9A 1DG6A 1UYZA 2YGLA 4B4QA 4CEWA 4EROA 2J1SA 4M0HA 6COXA 5ANNA 4AFBA 1PGL2 1HV1A 1PFXL 1RUF2 5FZAA 2Q8CA 4FTEA 4G1MB 3HNBM 2WT2A 2PXJA 1UZYA 3VKLA 4A94C 1POV3 3AFKA 4P9WA 4UAPA 3AMPA 3RYRA 3LQCA 2VNGA 3T09A 1V3XB 1KDMA 1JYNA 1IGXA 3NV1A 1YUKB 1AR71 2LM3A 4WM7B 2BWCA 1RL3A 5FYYA 2HLEA 5FPAA 1O3SA 1MACA 2MPFA 3AL6A 1M1XB 2ADXA 3LIHA 3ZLIA 4ES9A 5JMOA 3AYAA 3ZMOA 3VV1A 2P5BA 4RRZA 1Z78A 1IOEL 2GMPA 3H0OA 1H9PA 4LK7A 3ZXKA 1AL22 1UKGA 4UFLA 4Z6AL 5FPBA 4FPOB 5A1FA 1JYTA 1XKBA 5JCTA 1DLCA 2FCTA 2NN8A 2JDKA 3AYEA 5A32B 3A23A 4BM8A 3DPRB 1EPHA 4JRLA 2QJVA 4CDWB 2DUQA 3CJIC 4AG4A 1OC1A 2C24A 2JG9A 2VECA 2BJSA 1TMF1 4AFCA 5I0RA 1Z7S1 2NYYA 3H50A 2PHDA 3ALQA 1RVF2 4TZDA 3FWEA 3V0BB 2UWLB 3SCHA 1A6CA 1T6BX 1VBA3 2YC4A 4XUQA 3ZR5A 4P08A 2A6WA 2AACA 2EXHA 1G1TA 5FZ4A 4QQLA 1UWWA 4L97A 5FDBA 2XKOA 4FFHA 4CCEA 1QY4A 2VQ0A 1SHWB 4YVWB 4D3WA 3NKGA 3JXSA 3T4HB 3DEMA 4XIKA 1P9JA 1LRHA 3PUQA 5FKBA 5FY0A 1Q8QA 2W52A 4A7KA 4FTBA 2D40A 4D7SA 2CU5A 3NL1A 2OUHA 2XVGA 2IXCA 3WQ7A 5F5IA 5C6CA 1AYN3 4DO0A 5I0SA 4W8JA 4PQ9A 3KL6B 1QEXA 3CQOA 1OPOA 1OUSA 1E5IA 3WQ0A 5FP3A 3HPTA 2CJIB 1NA1C 4HK9A 2HWD3 3OJBA 2C26A 1GOGA 2AGSA 1O7FA 5I91A 2OA2A 3MYXA 3ZFGA 2OPKA 4HANA 5LY2A 1W8FA 3O1OA 1XNKA 1K5JA 3O7OA 4M01A 4UFHA 2OZ6A 3J9SA 2FD6A 4QM8A 4YGBA 4OMDA 1G1QA 4O65A 4GJYA 3VD5A 3NWKA 1CQ9A 1PZ9A 3E97A 4BU2A 1LENA 3MO4A 1NLQA 4D94A 1J3PA 1H1MA 1LOAA 5DZFA 4I01A 3NNLA 2D98A 1C5HA 1JYWA 4FI9A 4CP0A 4BLJA 1U8CB 1IKPA 4H3WA 4QHZA 1VBC1 2ZGSA 4M4RA 4YZ4A 5AC93 3DXUA 1A8MA 2Y6KA 1A3KA 1XB9A 2LALA 2W39A 3TB0A 3ZXFA 2YFUA 2VO5A 1GOHA 1SLAA 2ZPXA 4L8QA 2BQ6A 4XW3A 2IFWA 4E8CA 1SBEA 3WF3A 4O7XA 3I2OA 5CG8A 4CCKA 4Y6DB 1Z7S2 2QQKA 2WT1A 2XWJB 4LEJA 4RUTA 3WDVA 3I59A 2WFTA 4MHUA 1RHI1 1S0GA 3WY6A 1TE1B 2FCVA 1ND3B 3UESA 1Z6CA 1AXZA 1FE2A 1XU1A 2JG8C 3MV11 2Y38A 4MLOA 1S0IA 4QQOA 1FSBA 2UWOB 1GNHA 2IXLA 3Q8EA 1YXWA 2BOIA 5C8CC 1NYWA 4OTYA 3MIHA 2D7FA 4QMAA 2O8QA 2J1TA 1AR62 5IK5A 2HEYF 4EN7B 5FZ3A 4BA6A 1AYN2 3PU3A 5JW1A 2XBYL 3GCXE 1CX1A 4YG0A 3RZHA 4RYDA 2W26B 1WLDA 2A6VA 2VVDA 3AC0A 2ORXA 2I2SA 3V65B 3POBA 3OGRA 4LA2A 1OKOA 4TLGA 1AR93 4A7YA 2ZMKA 5FKCA 4QDRA 3LPGA 4HMZA 1CN1A 1G8WA 3I3BA 4QGNA 1LPGA 1UZZA 1WMDA 2HKXA 2X5IA 3NMBA 1AF9A 4C91A 1H2MA 4EN6B 2LS6A 4OHXA 1G1RA 1I5PA 4HPKA 5CB7A 4Y7BB 3CA7A 2C0ZA 5FREA 1MPXA 4ISHL 1DLLA 3SHRA 3O1PA 1LU1A 4XXAA 1H4HA 1FPN1 1HXS1 5IJRA 2F4LA 3CJIB 5FYZA 2ZMLA 4A2UA 2CWMA 3KQ4B 1N3PA 3BCWA 5IYYA 2YYOA 4EWEA 5FZIA 3WX5A 4AVAA 2KB9A 1EV12 3V64C 1YC61 4ATFA 5AC92 4U2AA 4Y5TA 3SEEA 3SEPA 2PLV3 2JJLA 4UF0A 5LEKA 3OBTA 4BIOA 1YUDA 4XURA 3VZMA 2KM2A 4RQPA 5EYYA 1W2UA 3OGGA 5F5QA 1ULEA 5GZFA 2B9VA 3FHQA 3MICA 2ZEWA 2BRTA 4PCRA 2WYGB 1T2XA 1HLCA 4HETA 2W2QE 4MXWB 1QJU2 3FMGA 3OUJA 4HBNA 2DF7A 1DQ2A 2GC1A 3MPPG 3OPTA 1XPWA 4KG8A 3KCGL 3ZXJA 1RUC3 4D6RA 1PZ8A 3GCWA 4H14A 1WLTA 2KXLA 3FN9A 4U36A 2BT7A 5F2WA 3AP4A 4ZAEB 3D3AA 4HKWA 2FLBL 1ZA4A 4QPIB 2Q1JB 5JXIA 5FMDA 1VIWB 5HCBA 1PK6A 3RGBA 1MVQA 1V0AA 2ADDA 2WO2A 3VD9A 5LA1A 1HV0A 4FPHA 1QJFA 3VBSA 3R0RA 1UL9A 1HN1A 2F4PA 2JDNA 1OLME 5F2SA 4QB1A 3WOGA 5BNPC 5FY9A 5JSOA 3VBFC 1UIJA 5BNNC 4OCTA 4HVQA 5CYYA 2XXZA 4CUEA 5L9VA 5KXDA 3P3NA 1UY3A 3GHNA 3DECA 5T5JA 3KV5A 4HONA 2WPIE 5JBBE 4Y33A 3THDA 3ZYFA 4ZHNA 5J7MA 2RMU1 1PGW1 4LO8A 5E8AA 5KHKA 5C70A 1F35A 2BGOA 1MZ6A 2VOWA 3HD8B 3KT4A 2Y7XB 2QQVA 5LY1A 1GR3A 4NHKA 4QX5A 3NVCA 4CDXA 1CJPA 4YGDA 4AGGA 1ND2B 2W1SA 3EGFA 5CBLA 1GQHA 1NQJA 4RHV1 4WBBA 5J37A 5KHIA 5C7GA 1YJLA 4N43C 2A70A 1O3RA 1PO22 2WSVA 1CPMA 3GALA 4FBFA 4COXA 1L7LA 3ACGA 3I2DA 3KSCA 4IV1B 4PLNA 4NE9A 5DAWA 2JIGA 4AGVA 4D0QA 4BOWA 2W87A 5HPOA 2VUAA 5FUPA 4XFHA 4YW2A 3UKTA 2DCTA 2MHFA 4RL7A 4XXPA 4DS0A 3Q7DA 3ZFFA 2ZXQA 2NMOA 5AFBA 5FMOL 5ABJC 4PI0A 4CP9A 3CJIA 5EV7A 4RHV3 1QJU3 5KN5C 1G9DA 1F15A 1K3IA 4AI1A 3LEMA 4A3XA 3W9AA 1D4VB 2ZS6B 1IQEL 1H0BA 5FYMA 4W4ZA 4YPJA 3AXEA 2BOHA 1SQ4A 1BCXA 3ELAL 4ET7A 3BU0A 4Y20B 5IFTA 1S1AA 4JZRA 5J48A 1UMIA 3OGSA 5I0TA 3POYA 4NO4A 3VBFB 1RTVA 5FO7B 2VE1A 4OI2A 3GBWA 3DPRA 4AI2A 4CDWA 2B45X 1C5MF 1WMXA 2YHJA 4D7TA 5J3UA 4XJUA 1DHKB 2F6BA 2P93L 4UFIA 2R0HA 4E8DA 1AHSA 2P3IA 4XCBA 4B7EA 3KLSA 4LE4A 1SEFA 1W8WA 1W8HA 1JN2P 2W1QA 4O9EA 3WW1A 3KT7A 4Q4W1 3SH5A 2XONA 1O5DL 1POV0 2HWB1 2BOXA 4XMAA 4COUA 1W6QA 1TNRA 3C7FA 1H2KA 2P95L 1W0OA 2D3RA 2VBPA 3B5LB 4QX8A 5IAVA 2X05A 5FYCA 3VZKA 3ZOIA 2W68A 4E9KA 2BTVC 4D69A 2VCAA 3JB4C 3WW3A 4CSYA 1IS6A 3M37L 2HEVF 1VBD2 2Z79A 4XJ8A 4BJ0A 4EN8B 5FWJA 5H9SA 5IVCA
chains in the Genus database with same CATH topology
1M4WA 4HPKB 1XKAL 1OLQA 3G6JB 5DZGA 2W0XA 5F19A 2DFCA 3VGIA 3AK0A 3NW4A 4XBNA 1DGWA 1BEV1 2RS53 1DQ0A 4HVOA 2ARBA 1QOTA 3ZFEC 1RUH1 1IOAA 2ZZJA 5T55A 1FMD3 3HBZA 4WVVA 1V6IA 4AXOA 3PMEA 5GZEA 4Z8BA 2A71A 3R05A 2XB6C 1K5MA 3L2YA 4FPYA 2VPVA 2I9AA 2M74A 4Y76B 2BUKA 4Q4X2 4AVVA 2VJ3A 4CDUC 4BTIA 4TWTA 5BNPB 2ZHNA 5CKMA 2DU1A 2Q4SA 1IS5A 1SLTA 1Z6EL 1T6GC 4LBQB 2JG8A 2FLGA 1D0GA 2GMMA 4WVMA 5KHHA 2CNAA 5DXDA 2H0BA 1ZM1A 4YVSA 2AZ5A 1I0UA 1RMU3 4LBKA 1RUC2 3N8XA 1V9U1 3FC0A 4JGYB 1TLEA 4ZH8B 2P26A 4DB5A 1NCRC 2V09A 1QDCA 1QJU1 1OFNA 4XFCA 4XFGA 1FYUA 1HREA 1I3HA 1LOBA 2IFRA 3ZX7A 4KGQA 4E4SA 2WINB 1SBFA 1LU2A 2PUQL 2A6ZA 1LTEA 3SMHA 3FFQA 1HCGB 4C1XA 1VBD3 2WPLE 1PNGA 1IHMA 1UN1A 2PHLA 3WW4A 3LC3B 1MQTA 3CU7A 3ENSA 1VBE2 4EWDA 1O91A 4QQ2A 2ZX1A 4HLTA 1S0DA 1EY2A 3ZXAC 4KBBA 2ZGNA 5CNAA 3O12A 3Q9OA 1FPN2 1ZZ9A 5KBFA 5D8AB 1J59A 2CWSA 3VBRC 1B35B 2HWB3 2XUMA 2RR11 4KU7A 2K2SA 4N9IA 3POSA 4LO5B 4RR3C 5FFOC 4AW7A 2QDNA 5AC91 5DZEA 5HCFA 2W2OE 2CAVA 3NV3A 1OPMA 1CVUA 4Q4Y2 4XZPA 1FOD1 4RQPC 1OQDA 5B2GB 2G9FA 4LO7A 2ATFA 4D0FA 1WLWA 4Y22A 3OPZA 1QJY1 4WM7A 1QNWA 2I9BA 3H5CB 1ZVFA 4IEWA 3R6SA 2EVXA 3ECQA 1PO12 5K8SA 1XRUA 2RR13 1MR5A 2WFF1 4YG6A 2VVCK 4XQWA 3OCPA 4AI8A 3FZ3A 1DVAL 4FPCA 3ZXEA 5ACA2 5F6LB 4JCKA 3USSA 1REFA 4GH4A 4NOTA 3JD73 4RR3B 3WP4A 4ZU4A 3V0AA 2DVBA 1DGRA 3FBYA 1PZ7A 2SBAA 4INDA 1RUOA 5JAXA 3ZYGA 2QZ2A 2RS12 3LB9A 4YARA 5IK7A 2PHRA 1SLIA 4AEDA 4Q26A 4C90A 3KCYA 4OZXA 4NN0A 4AVTA 5H9RA 1QGLA 2EIGA 4Y24A 2JD4A 3VZNA 1WMFA 4FXGB 1L5GB 1C8M3 4P9GA 3B02A 4FOQA 3T1MA 1LODA 2OZJA 5BNOB 4CDXC 1JUIA 1UZJA 2VWOL 4YM3A 5FO9B 1ATAA 1DYKA 1HRI2 2HWB2 3VKFC 1EPIA 4MMZB 2J38B 1N3OA 2WFF3 3POWA 3BPSE 5JBCE 2P3UA 2WZPP 3HMYA 3N7JA 3THPA 5GLWA 1DGRN 3MIDA 4GQ7A 1U5YA 4Q4Y3 1ONAA 1X82A 4HN1A 4K7JA 4AEDB 4Z92B 2BNNA 2PFWA 1KDKA 1C57A 3NKTA 1H1AA 1OA2A 1FOD3 1Q8OA 1HQLA 2VOKA 2ZBJA 1WHEA 2D97A 4N43B 3WT3A 3ZXDA 1N1TA 4ES9A 1Q43A 1AR73 5AFEA 1PO13 2R041 1OD5A 2UURA 3MFCA 5EWSA 3VKMA 3AZWA 3CF6E 5J98B 1QF3A 5JVYA 2GH8A 1I1EA 3E5UA 5ABJB 3ZFGB 5KXEA 1X8EA 1F31A 5K0UA 3FFGL 2VMHA 1FV2A 3JD72 1BYHA 1ZBE1 3PVOA 3TAYA 2AENA 3X29B 2MGPA 1FATA 4QPIC 4OULA 4JDOA 1ENQA 4LLFA 4E4DX 1K37A 1IQIL 3LKJA 4LUMA 4YYOA 5DUVA 1CAUB 3NTBA 2ILMA 4Z2WA 4X8NA 4M11A 1IS3A 1RMU2 1QKQA 5JOZA 3U07A 1ZBA1 4JC1A 2A73B 4KQ7A 1JV2B 3KGLA 1RUF1 2H6BA 3N36A 3VZOA 2GNMA 3OTFA 2VVVL 4DINB 4LO4B 1U12A 2W3KB 2IXKA 1MQ6L 1YFYA 4FPGA 4XBLA 1LHNA 3PMSA 1IKQA 2HWE3 5CA6A 1NQLB 4PDWA 3FX3A 1RUF3 1IZ3A 4BTTA 1VB2A 1HW5A 1IS4A 1IGOA 1WD3A 1YCIA 3WP5A 3VBHC 1N3QA 1YUFA 2IZWA 3DGTA 1JHNA 3BOWA 4XILA 3OF1A 4ONUA 1Q4GA 2XBVL 1VRH3 1CAUA 4F8AA 2YROA 1F7EA 2XBO2 3NV2A 4XFIA 4AYUA 5C4WB 2D6PA 4OUMA 4NA9L 3M2MA 2WSUA 1I9RA 1RUJ1 4Q0UA 5FMOS 1JOJA 1ND2A 2XWBB 2D6OX 3ZN6A 4LBQA 3M7AA 4J6GA 1FXZA 3UKVA 4XEZA 3IITB 4W6WA 5KHJA 3VZLA 5L7OC 4Z0KB 1COUA 1LMMA 3AKTA 4QGLA 5GLZA 4BMEA 1H2LA 3VL9A 4Y79B 1TMF3 1MS1A 3HN1A 1EQGA 2DUPA 4RS5B 4YW3A 4B29A 1H2NA 1U0AA 2P34A 2ZAAA 2BQPA 3N8YA 4JAAA 5L19A 5BUVA 2EXIA 3D0JA 3IPVA 5T50A 3ZPYA 3QH0A 2VWLL 3A0KA 4CZSA 3H1MA 4FQZA 4COZA 2Y5HL 1MQTC 4AHZA 5C8WA 3KCXA 3RQ0A 1NPEB 1QOSA 1DQBA 3FHIB 2Z5WA 1PK6B 1HJ7A 4AEMA 2PELA 3SOVA 2NPRA 5CG9A 5L2ZL 3AKSA 2CGPA 1VJ2A 5I8SA 4BZ4A 2HWD1 3WUCA 3LCPA 3SLIA 1YI9A 3VDDA 1CAVA 3RMYA 1S0BA 2J4IB 2PN5A 3O5SA 4XETA 2K2TA 2XLGA 1OB1C 4ES8A 2XL7A 3WHUA 4FOWA 3MW4A 4YZ3A 5BNNA 3PVEA 1LHWA 3TGFA 4AF9A 1RJ8A 2ZHKA 2DVAA 1XNCA 4MGKE 1FAKL 4Q0SA 2VH6B 3JD71 2UWPB 1QJY2 1EAIC 4GMP3 4QPGC 1APQA 4X8SL 3VBUB 4G3YC 4DY3A 1TEIA 1LHVA 2P3KA 3UJOA 2GDFA 3ES1A 5J36A 1BJQA 2BOKL 1O5UA 5K9YA 2GN3A 1JH5A 2WNVA 2BQWA 4RS5C 4YZUB 4CUFA 2YPJA 1NG0A 3GZTB 1BVP1 1PMIA 3QLQA 4SLIA 1AR82 2FQPA 4YVWC 4GKXA 5SV5A 1AYM2 2A7AA 5C9AC 2WG3C 4AK3A 4AHYA 3ZFFB 4DNYA 2RS31 2XJVA 1ZBA3 1W6MB 1FV3A 2ZKLA 1W7XL 1POV1 2C1FA 3ZSMA 1IQAA 1ASJ1 4C1WA 1ZZBA 1BEV3 2RS51 4XJ9A 2W2NE 5EGMB 1NCQC 1KJRA 4ORFA 4X6QB 2Q1MA 2DCKA 4UW4A 2ERFA 4NR1A 4XHBA 1G7YA 3SOQA 1W6PB 4I3PA 3VDDB 1G9BA 2CL2A 2I45A 1AR92 3WDWA 1JBCA 3T1LA 3SW2A 1DQ4A 3N3HA 1G9CA 5BNOC 3VBRB 5L30L 5LRRA 4F3JA 1KD7A 1MQ5L 4QPGB 3AMQA 4OI4A 2YC0A 2DCJA 3OD4A 3U7UG 2ZA9A 2PAKA 1O3QA 1AJOA 3ETQA 1EAH1 1PO11 1UCXA 2JG9C 2VNRA 3HR9A 2PLV1 1YLLA 1G1SA 1E57A 3M3CA 2EXJA 3PLQA 1G2MB 5GKAC 4MV2A 1XNBA 1ULDA 3WP3A 5BY5A 4Q4Y1 1OOPB 2WC2A 4MXVA 1Y3TA 3N7LA 1YIFA 1Q8SA 2WZR3 1ND3C 5FLIA 4PIXA 2BO2A 2G9GA 2GH2A 3KMHA 3PVBB 4DY5A 2SLIA 3DV8A 3OLTA 3TN93 5JDBA 1C8M1 4Q4W2 1X50A 4GMP1 3BPZA 3JUUA 3USUB 5EXOA 4FOVA 1N1IA 2CYFA 2PHFA 4TYSA 2OVUA 2WA3A 1I5ZA 4K40A 3MIGA 4IEVA 5BYNA 2R49A 5K0HB 1NA1A 2BFUL 1LGNA 2JDZA 1LGCA 5C33A 4C16A 1CJDA 4FCAA 3LN1A 3CLPA 4Q1PA 5FOJB 1ZZ7A 1NZCA 3AP5A 4COVA 4AEKA 1JBUL 3EQEA 4X8TL 2RJLA 3TBDA 2UWBA 2GNTA 2Z42A 3AKQA 2NP0A 1DIWA 3D82A 4YVSC 5F9TA 3B94A 2WNVB 2OIIA 5CVRA 1KS5A 3V0BA 1ZZCA 2Y26A 4ZHAB 1QJX1 2P3FN 1WGPA 4EWAA 2JG9B 2RMU3 5JIAA 5E8DA 2ZCWA 3VBUA 1QOOA 3IMNA 4RRYA 3ENRA 3VN4A 3FCSB 1PO23 4Q4X3 3L9JT 3GZUC 4HKOA 3LSDA 4QQHA 4QD2A 1AX0A 3B3QE 4Q4X1 4R8HA 1PO21 2UY8A 2ZKNA 4ZU5A 4L92A 4GALA 2ENRA 2NLRA 2VMGA 2VU9A 2WKKA 4P5HA 2JE9A 3RR3A 1CONA 2ZABA 4LHKA 3BIWE 3W59A 5JLVA 3KQCL 2NZ9A 5JI9A 1URKA 4BDWA 1JYCA 2QZ3A 3R4UA 1GZ9A 4MVTA 5L7OA 1AXYA 5KWRA 4QHBA 2XVKA 3E6BA 3HQXA 2YGOA 4XF0A 3TYJA 3EBRA 3NSTA 4B4PA 3JQXA 4XDQA 5JSPA 2WJSA 4ATEA 1A8DA 4PF5A 4JDNA 5KC6A 3WQ1A 1ZRCA 4X8UL 3AKPA 3WINE 4AHWA 1TQ5A 1TME3 4C0BA 2VWMK 3UV9A 2AYLA 4Q4V2 3IPVB 1SLBA 4WM7C 1V9U3 4RGAA 1DGWX 1R1ZA 4IETA 3USUA 2BPA2 1LKNA 2X5IC 1G9AA 1YYNA 3QBQA 1FPN3 5IT6A 2D3PA 4WZCA 1IOXA 4L11A 2XC0L 2UWCA 4I2OA 1ZYBA 2WNUC 1BEV2 2J94B 1F5FA 5JOYA 2RMU2 1ALYA 3RG0A 3NT1A 1VB4A 4W6YA 1AR91 2EXKA 2P2KA 1XYNA 3TNQA 5CADA 4AVBA 1EAH2 3D0SA 3ZN4A 3WHTA 2FZ2A 4KG0A 4JZDL 2JX9A 4LBMA 3WDUA 1M06G 1REEA 2D5FA 3WVJA 3MIBA 2BEOA 2KL7A 3D5OA 3FLRA 2H9EC 4CEWC 3TH3L 3TK5B 4QPGA 2GC0A 1DFQA 4LMFA 1SFYA 2GC2A 2DV9A 2B7DL 3ILNA 3GBFA 5AVPA 5GLUA 1ZBE3 2FMYA 2WFPA 4PDWB 4CYDA 1OI6A 1WD4A 4MGZE 4CEYB 4AFAA 5JOWA 1RUC1 1UZQA 4X8VL 1DF0A 1FAXL 2XJUA 3IDEA 2KA3A 4IV3A 4N7UA 2Y5FL 1XE7A 2AR6A 4FT8A 3AP7A 4LBNA 3KGZA 3WG4A 4ISIL 5EZWA 4J1WA 1RUG3 1U5XA 2PQQA 2RJKA 3J8F3 4NHMA 4OHWA 3SXWA 2Q5TA 1GV9A 5JZGB 4O02B 2WIIB 3E6CC 4Z0LA 4LULA 3VHOA 3MLJA 1IQFL 1WHFA 1UD1A 2PTMA 4YT6L 5I0UA 4GWMA 5GM0A 3ZN5A 4Q4W3 1O4TA 4XTPA 3S7IA 2VW0A 1X36A 4P9IA 5JZGA 1VAKA 1LGBA 4IERA 4QQPA 3IBMA 5K0UC 2J95B 3ZYPA 2WG4B 1F7MA 1OSGA 2GNBA 2ZX3A 1PGW2 3MI8A 4IV3B 1VBB1 1W39A 5CISA 1IJQA 4WV8A 4XIOA 1UMZA 1FOD2 3HAGA 1SLLA 2EI8B 1MS9A 3V65A 3RYPA 3ZFFC 2CV6A 3E5QA 4DRRA 3ZFEB 2DVFA 1RUE1 4JRAA 1RITA 2ZACA 4L9BA 4YRDA 4HSLA 5CAZA 1UU6A 4Q2FA 4GMP0 1BBT3 3LAQA 2ZZQA 3LWCA 4B8EA 1UPIA 1S0JA 4XBMA 1R1A1 2B5HA 3APBA 1R081 1Z0HA 1LR5A 4IEPA 1U5IA 2XG3A 1ND3A 4M3CB 1G2LB 3ILFA 1N1VA 4AI0A 1RHI3 1VBA1 5K0UB 2WLQA 4FPKA 1CVWL 4J1XA 3LGRA 4P14A 3GBGA 4XF4A 4LBOA 2B8MA 2DTYA 1N7DA 1N1SA 2Q8OA 3KD4A 1KRIA 1H9WA 1FJSL 1HQNA 4E27A 1NZIA 3NV4A 2QE3A 1OQ1A 5FTTC 1S2KA 2R30A 1Q56A 2RA0L 5CKQA 3CFWA 2G00L 3GHMA 3JZVA 3B69A 3H9AA 3WXPA 2R16A 4B4RA 2CGNA 2EAAA 4LBLA 3WR0A 5FAXA 1RUH2 5C8CA 1D4M2 3M4FA 2BQ7A 5C9AB 4XFFA 4Q0QA 5E89A 3CEWA 3N8ZA 1CD3G 1B35C 1JW6A 4JGZA 3ZSJA 3ZDSA 1C4RA 2JKHL 1HAFA 5D8AC 4LBJA 2XBO3 1BMV1 4MH0E 4AHXA 1RUD2 3U10A 1QH6A 1HKDA 1LESA 1NE4A 5I8YA 2BOUA 1K5MC 4ZXKA 3N7KA 1PIV3 4CEYC 3M8LA 4CRQA 3THTA 1HRI3 5FBZA 4N7IA 4YGCA 5SV8A 5FLJA 2VGDA 4AVSA 4YZ5A 1HZ8A 3ASIA 3WG3A 4AGRA 4LHLA 3UK9A 2DURA 4PH9A 1ATDA 1VBC2 3VDDC 1C1LA 4XJZA 3IN9A 4K6BA 4CDQA 4FPJA 3C9AC 4RFT0 1UZKA 1TMF2 3QD6A 2Q30A 4K8FA 3JU9A 4M10A 1YFWA 4NPRA 2LUWA 4XE9A 1IQNL 1Z7S3 3B9IA 1NCRA 1S55A 2UYAA 4HVRA 1YUGA 1DQ5A 4UW5A 2B9UA 2Y0OA 3LA2A 3N35A 2YGPA 2RHPA 2HWF3 1NFXB 1UZPA 2KV4A 4D0EA 1HRV2 1B9WA 3ZSLA 4QT6A 4Q27A 1CPNA 2QNKA 4UBHA 2D3SA 3SCGA 1NA1B 1RIRA