3ZYNA

Crystal structure of the n-terminal leucine rich repeats of netrin-g ligand-3
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
310
structure length
310
Chain Sequence
b'TSCPAACSCSNQASRVICTRRELAEVPASIPVNTRYLNLQENSIQVIRTDTFKHLRHLEILQLSKNLVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4B
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 87
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3zynA00
3ULVA 4CNCA 2R9UA 3PMHG 1DCEA 1KOOA 4CC4C 3P72A 2JE0A 1D0BA 3WPBA 3C6PB 4OQTA 4R0AA 3C6OB 3CIYA 1OTMA 1DS9A 4R5CA 4CILA 2XOTA 2ELLA 5B0TA 4L3AA 1P8VA 4Q3IA 4RCWA 4K17A 2JQDA 4Q3GA 1M9SA 2RR6A 4GT6A 2Z63A 4C2AB 3OGLB 3WPHA 4Z8GA 4U7LA 3E2JA 3M19A 2O6SA 4QC0A 4LSXA 4M7EC 5AZ5A 2A0ZA 5AWAA 1XCDA 4PEQB 5B0NA 3RJ0A 4U09A 2OMZA 3OGMB 4Z61C 3ZYOA 1M10B 3RGZA 1P9AG 2CA6A 4RCAB 4RWTC 4V2DA 3RW6A 3ZYNA 1M0ZA 4R08A 4XGOA 5IJBA 4V2EA 3UL8A 3E6JA 2ID5A 4R58A 4CNMA 3RFEA 2UZXA 3W3MA 3ULAA 4U08A 2BNHA 5CMPA 2JE1A 5GMHA 3G39A 4AY9X 2UZYA 1O6TA 3G3BA 2O6RA 3C6NB 1PGVA 2V70A 1H6TA 3KJ4A 3VQ1A 1M9LA 4MN8B 4WP6A 4BSSA 4J0MA 4AW4A 1SQ0B 1P8TA 1ZIWA 3W3NA 3REZA 1A9NA 4IM6A 3FXIA 3GOZA 2WQVA 2Z64A 2XWTC 4FCGA 4XOSA 4Y61B 1XKUA 4QBZA 1W8AA 3W3LA 4U06A 2V9TB 4LSXC 1U0ND 4I6JB 4Z79A 3UL7A 1FQVA 1DFJI 3WPFA 4L3FA 3G04C 2O6QA 1G9UA 3UL9A 5GMFA 3WPDA 3OGKB 2P1NB 2ASSB 1Z7XW 2WFHA 1OTNA 4Z64C 5IJDA 4Z94G 4LI2A 1JL5A 4LI1A 5B4PA 4EZGA 4R6FA 1OGQA 2Z62A 3O53A 4FD0A 5GS2B 4MQWX 4Q62A 4QXEA 3RIZA 1IO0A 2V9SA 4ARRA 5GMGA 2Z7XA 1WWLA 3WPCA 2WQXA 2OMUA 3E3ZA 4LXSA 5A5CA 4ECOA 4M7EA 3A79B 2OMWA 2RA8A 4BSUA 5GQRK 3E4GA 1H6UA 1O6SA 3W3JA 4KXFB 3G3AA 4BSRA 1OOKG 1QYYA 4FDWA 4PERA 1FS2A 4FMZA 5GS0A 4KNGA 3SB4A 3ZYJA 3BZ5A 5AWDA 3WPEA 4FS7A 2OMXA 2Z7XB 2Z81A 1A4YA 2OMTA 4R5DA 2P1QB 5CMNA 3O6NA 5AWBA 3RW7A 4LSCA 4KT1A 4R09A 3M18A 3UN9A 5HDHA 4ECNA 3W3KA 1FO1A 5D3IA 2Z66A 1XWDC 4P8SA 3VQ2A 1KOHA 3G06A 4R6JA 4B8CD 1FT8A 4UFRA 4ARNA 4GLPA 3ZYIA 4LXRA 5FTTB 4CC4A 2P1MB 4R07A 2BEXA 4HQ1A 3RGXA 1GWBA 1K5GC 3OJAA 1O6VA 5LFNA 2Y5QA 4H09A 4R6AA 5HZLB 5AWCA 4J4LA 3WPIA 3WPGA 4TZHA 1XEUA 1OZNA 2P1OB 4CP6A 2OMVA 4P91A 5IJCA 3CVRA 4G8AA 3WN4A 4NKHA 3W3GA 4C2BB 3RFJA 2Z82A 4XSQA 3OJAB 4BV4R 2IFGA 5IYXC 3DZEA 4PKIG 4NKGA 4R6GA 3CIGA 1OTOA 2Z65A 2WQUA 2ASTB 2OMYA 4PSJA 4V2CA 4YEBB 4PQ8A 1YRGA 3TSRE 1XECA 3ULUA 3JB9j 2P1PB 1K5DC 2Q4GW 1LTXA 4LSAA 2WQWA 3RFSA 2FT3A 4FHOA 4WYKA
chains in the Genus database with same CATH superfamily
3ULVA 4CNCA 2R9UA 3PMHG 1DCEA 1KOOA 4CC4C 4NZTM 3P72A 2JE0A 1D0BA 3WPBA 3C6PB 4OQTA 4R0AA 3C6OB 3CIYA 1OTMA 1DS9A 4R5CA 4CILA 2XOTA 2ELLA 5B0TA 4L3AA 1P8VA 4Q3IA 4RCWA 4K17A 2JQDA 4Q3GA 1M9SA 2RR6A 4GT6A 2Z63A 4C2AB 3OGLB 3WPHA 4Z8GA 4U7LA 3E2JA 3M19A 2O6SA 4QC0A 4LSXA 4M7EC 5AZ5A 2A0ZA 5AWAA 1XCDA 4PEQB 5B0NA 3RJ0A 4U09A 2OMZA 3OGMB 4Z61C 3ZYOA 1M10B 3RGZA 1P9AG 2CA6A 4RCAB 4RWTC 4V2DA 3RW6A 3ZYNA 1M0ZA 4R08A 4XGOA 5IJBA 4V2EA 3UL8A 3E6JA 2ID5A 4R58A 4CNMA 3RFEA 2UZXA 3W3MA 3ULAA 4U08A 2BNHA 5CMPA 2JE1A 5GMHA 3G39A 4AY9X 2UZYA 1O6TA 3G3BA 2O6RA 3C6NB 1PGVA 2V70A 1H6TA 3KJ4A 3VQ1A 1M9LA 4MN8B 4WP6A 4BSSA 4J0MA 4AW4A 1SQ0B 1P8TA 1ZIWA 3W3NA 3REZA 1A9NA 4IM6A 3FXIA 3GOZA 2WQVA 2Z64A 2XWTC 4FCGA 4XOSA 4Y61B 1XKUA 4QBZA 1W8AA 3W3LA 4U06A 2V9TB 4NZRM 4LSXC 1U0ND 4I6JB 4Z79A 3UL7A 1FQVA 1DFJI 3WPFA 4L3FA 3G04C 2O6QA 1G9UA 3UL9A 5GMFA 3WPDA 3OGKB 2P1NB 2ASSB 1Z7XW 2WFHA 1OTNA 4Z64C 5IJDA 4Z94G 4LI2A 1JL5A 4LI1A 5B4PA 4EZGA 4R6FA 1OGQA 2Z62A 3O53A 4FD0A 5GS2B 4MQWX 4Q62A 4QXEA 3RIZA 1IO0A 2V9SA 4ARRA 5GMGA 2Z7XA 1WWLA 3WPCA 2WQXA 2OMUA 3E3ZA 4LXSA 5A5CA 4ECOA 4M7EA 3A79B 2OMWA 2RA8A 4BSUA 5GQRK 3E4GA 1H6UA 1O6SA 3W3JA 4KXFB 3G3AA 4BSRA 1OOKG 1QYYA 4FDWA 4PERA 1FS2A 4FMZA 5GS0A 4KNGA 3SB4A 3ZYJA 3BZ5A 5AWDA 3WPEA 4FS7A 2OMXA 2Z7XB 2Z81A 1A4YA 2OMTA 4R5DA 2P1QB 5CMNA 3O6NA 5AWBA 3RW7A 4LSCA 4KT1A 4R09A 3M18A 3UN9A 5HDHA 4ECNA 3W3KA 1FO1A 5D3IA 2Z66A 1XWDC 4P8SA 3VQ2A 1KOHA 3G06A 4R6JA 4B8CD 1FT8A 4UFRA 4ARNA 4GLPA 3ZYIA 4LXRA 5FTTB 4CC4A 2P1MB 4R07A 2BEXA 4HQ1A 3RGXA 1GWBA 1K5GC 3OJAA 1O6VA 5LFNA 2Y5QA 4H09A 4R6AA 5HZLB 5AWCA 4J4LA 3WPIA 3WPGA 4TZHA 1XEUA 1OZNA 2P1OB 4CP6A 2OMVA 4P91A 5IJCA 3CVRA 4G8AA 3WN4A 4NKHA 3W3GA 4C2BB 3RFJA 2Z82A 4XSQA 3OJAB 4BV4R 2IFGA 5IYXC 3DZEA 4PKIG 4NKGA 4R6GA 3CIGA 1OTOA 2Z65A 2WQUA 2ASTB 2OMYA 4PSJA 4V2CA 4YEBB 4PQ8A 1YRGA 3TSRE 1XECA 3ULUA 3JB9j 2P1PB 1K5DC 2Q4GW 1LTXA 4LSAA 2WQWA 3RFSA 2FT3A 4FHOA 4WYKA
chains in the Genus database with same CATH topology
3ULVA 4CNCA 2R9UA 3PMHG 1DCEA 1KOOA 4CC4C 3P72A 2JE0A 1D0BA 3WPBA 3C6PB 4OQTA 4R0AA 3C6OB 3CIYA 1OTMA 1DS9A 4R5CA 4CILA 2XOTA 2ELLA 5B0TA 4L3AA 1P8VA 4Q3IA 4RCWA 4K17A 2JQDA 4Q3GA 1M9SA 2RR6A 4GT6A 2Z63A 4C2AB 3OGLB 3WPHA 4Z8GA 4U7LA 3E2JA 3M19A 2O6SA 4QC0A 4LSXA 4M7EC 5AZ5A 2A0ZA 5AWAA 1XCDA 4PEQB 5B0NA 3RJ0A 4U09A 2OMZA 3OGMB 4Z61C 3ZYOA 1M10B 3RGZA 1P9AG 2CA6A 4RCAB 4RWTC 4V2DA 3RW6A 3ZYNA 1M0ZA 4R08A 4XGOA 5IJBA 4V2EA 3UL8A 3E6JA 2ID5A 4R58A 4CNMA 3RFEA 2UZXA 3W3MA 3ULAA 4U08A 2BNHA 5CMPA 2JE1A 5GMHA 3G39A 4AY9X 2UZYA 1O6TA 3G3BA 2O6RA 3C6NB 1PGVA 2V70A 1H6TA 3KJ4A 3VQ1A 1M9LA 4MN8B 4WP6A 4BSSA 4J0MA 4AW4A 1SQ0B 1P8TA 1ZIWA 3W3NA 3REZA 1A9NA 4IM6A 3FXIA 3GOZA 2WQVA 2Z64A 2XWTC 4FCGA 4XOSA 4Y61B 1XKUA 4QBZA 1W8AA 3W3LA 4U06A 2V9TB 4LSXC 1U0ND 4I6JB 4Z79A 3UL7A 1FQVA 1DFJI 3WPFA 4L3FA 3G04C 2O6QA 1G9UA 3UL9A 5GMFA 3WPDA 3OGKB 2P1NB 2ASSB 1Z7XW 2WFHA 1OTNA 4Z64C 5IJDA 4Z94G 4LI2A 1JL5A 4LI1A 5B4PA 4EZGA 4R6FA 1OGQA 2Z62A 3O53A 4FD0A 5GS2B 4MQWX 4Q62A 4QXEA 3RIZA 1IO0A 2V9SA 4ARRA 5GMGA 2Z7XA 1WWLA 3WPCA 2WQXA 2OMUA 3E3ZA 4LXSA 5A5CA 4ECOA 4M7EA 3A79B 2OMWA 2RA8A 4BSUA 5GQRK 3E4GA 1H6UA 1O6SA 3W3JA 4KXFB 3G3AA 4BSRA 1OOKG 1QYYA 4FDWA 4PERA 1FS2A 4FMZA 5GS0A 4KNGA 3SB4A 3ZYJA 3BZ5A 5AWDA 3WPEA 4FS7A 2OMXA 2Z7XB 2Z81A 1A4YA 2OMTA 4R5DA 2P1QB 5CMNA 3O6NA 5AWBA 3RW7A 4LSCA 4KT1A 4R09A 3M18A 3UN9A 5HDHA 4ECNA 3W3KA 1FO1A 5D3IA 2Z66A 1XWDC 4P8SA 3VQ2A 1KOHA 3G06A 4R6JA 4B8CD 1FT8A 4UFRA 4ARNA 4GLPA 3ZYIA 4LXRA 5FTTB 4CC4A 2P1MB 4R07A 2BEXA 4HQ1A 3RGXA 1GWBA 1K5GC 3OJAA 1O6VA 5LFNA 2Y5QA 4H09A 4R6AA 5HZLB 5AWCA 4J4LA 3WPIA 3WPGA 4TZHA 1XEUA 1OZNA 2P1OB 4CP6A 2OMVA 4P91A 5IJCA 3CVRA 4G8AA 3WN4A 4NKHA 3W3GA 4C2BB 3RFJA 2Z82A 4XSQA 3OJAB 4BV4R 2IFGA 5IYXC 3DZEA 4PKIG 4NKGA 4R6GA 3CIGA 1OTOA 2Z65A 2WQUA 2ASTB 2OMYA 4PSJA 4V2CA 4YEBB 4PQ8A 1YRGA 3TSRE 1XECA 3ULUA 3JB9j 2P1PB 1K5DC 2Q4GW 1LTXA 4LSAA 2WQWA 3RFSA 2FT3A 4FHOA 4WYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULV A;  4CNC A;  2R9U A;  3PMH G;  1DCE A;  1KOO A;  4CC4 C;  3P72 A;  2JE0 A;  1D0B A;  3WPB A;  3C6P B;  4OQT A;  4R0A A;  3C6O B;  3CIY A;  1OTM A;  1DS9 A;  4R5C A;  4CIL A;  2XOT A;  2ELL A;  5B0T A;  4L3A A;  1P8V A;  4Q3I A;  4RCW A;  4K17 A;  2JQD A;  4Q3G A;  1M9S A;  2RR6 A;  4GT6 A;  2Z63 A;  4C2A B;  3OGL B;  3WPH A;  4Z8G A;  4U7L A;  3E2J A;  3M19 A;  2O6S A;  4QC0 A;  4LSX A;  4M7E C;  5AZ5 A;  2A0Z A;  5AWA A;  1XCD A;  4PEQ B;  5B0N A;  3RJ0 A;  4U09 A;  2OMZ A;  3OGM B;  4Z61 C;  3ZYO A;  1M10 B;  3RGZ A;  1P9A G;  2CA6 A;  4RCA B;  4RWT C;  4V2D A;  3RW6 A;  3ZYN A;  1M0Z A;  4R08 A;  4XGO A;  5IJB A;  4V2E A;  3UL8 A;  3E6J A;  2ID5 A;  4R58 A;  4CNM A;  3RFE A;  2UZX A;  3W3M A;  3ULA A;  4U08 A;  2BNH A;  5CMP A;  2JE1 A;  5GMH A;  3G39 A;  4AY9 X;  2UZY A;  1O6T A;  3G3B A;  2O6R A;  3C6N B;  1PGV A;  2V70 A;  1H6T A;  3KJ4 A;  3VQ1 A;  1M9L A;  4MN8 B;  4WP6 A;  4BSS A;  4J0M A;  4AW4 A;  1SQ0 B;  1P8T A;  1ZIW A;  3W3N A;  3REZ A;  1A9N A;  4IM6 A;  3FXI A;  3GOZ A;  2WQV A;  2Z64 A;  2XWT C;  4FCG A;  4XOS A;  4Y61 B;  1XKU A;  4QBZ A;  1W8A A;  3W3L A;  4U06 A;  2V9T B;  4LSX C;  1U0N D;  4I6J B;  4Z79 A;  3UL7 A;  1FQV A;  1DFJ I;  3WPF A;  4L3F A;  3G04 C;  2O6Q A;  1G9U A;  3UL9 A;  5GMF A;  3WPD A;  3OGK B;  2P1N B;  2ASS B;  1Z7X W;  2WFH A;  1OTN A;  4Z64 C;  5IJD A;  4Z94 G;  4LI2 A;  1JL5 A;  4LI1 A;  5B4P A;  4EZG A;  4R6F A;  1OGQ A;  2Z62 A;  3O53 A;  4FD0 A;  5GS2 B;  4MQW X;  4Q62 A;  4QXE A;  3RIZ A;  1IO0 A;  2V9S A;  4ARR A;  5GMG A;  2Z7X A;  1WWL A;  3WPC A;  2WQX A;  2OMU A;  3E3Z A;  4LXS A;  5A5C A;  4ECO A;  4M7E A;  3A79 B;  2OMW A;  2RA8 A;  4BSU A;  5GQR K;  3E4G A;  1H6U A;  1O6S A;  3W3J A;  4KXF B;  3G3A A;  4BSR A;  1OOK G;  1QYY A;  4FDW A;  4PER A;  1FS2 A;  4FMZ A;  5GS0 A;  4KNG A;  3SB4 A;  3ZYJ A;  3BZ5 A;  5AWD A;  3WPE A;  4FS7 A;  2OMX A;  2Z7X B;  2Z81 A;  1A4Y A;  2OMT A;  4R5D A;  2P1Q B;  5CMN A;  3O6N A;  5AWB A;  3RW7 A;  4LSC A;  4KT1 A;  4R09 A;  3M18 A;  3UN9 A;  5HDH A;  4ECN A;  3W3K A;  1FO1 A;  5D3I A;  2Z66 A;  1XWD C;  4P8S A;  3VQ2 A;  1KOH A;  3G06 A;  4R6J A;  4B8C D;  1FT8 A;  4UFR A;  4ARN A;  4GLP A;  3ZYI A;  4LXR A;  5FTT B;  4CC4 A;  2P1M B;  4R07 A;  2BEX A;  4HQ1 A;  3RGX A;  1GWB A;  1K5G C;  3OJA A;  1O6V A;  5LFN A;  2Y5Q A;  4H09 A;  4R6A A;  5HZL B;  5AWC A;  4J4L A;  3WPI A;  3WPG A;  4TZH A;  1XEU A;  1OZN A;  2P1O B;  4CP6 A;  2OMV A;  4P91 A;  5IJC A;  3CVR A;  4G8A A;  3WN4 A;  4NKH A;  3W3G A;  4C2B B;  3RFJ A;  2Z82 A;  4XSQ A;  3OJA B;  4BV4 R;  2IFG A;  5IYX C;  3DZE A;  4PKI G;  4NKG A;  4R6G A;  3CIG A;  1OTO A;  2Z65 A;  2WQU A;  2AST B;  2OMY A;  4PSJ A;  4V2C A;  4YEB B;  4PQ8 A;  1YRG A;  3TSR E;  1XEC A;  3ULU A;  3JB9 j;  2P1P B;  1K5D C;  2Q4G W;  1LTX A;  4LSA A;  2WQW A;  3RFS A;  2FT3 A;  4FHO A;  4WYK A; 
#chains in the Genus database with same CATH topology
 3ULV A;  4CNC A;  2R9U A;  3PMH G;  1DCE A;  1KOO A;  4CC4 C;  4NZT M;  3P72 A;  2JE0 A;  1D0B A;  3WPB A;  3C6P B;  4OQT A;  4R0A A;  3C6O B;  3CIY A;  1OTM A;  1DS9 A;  4R5C A;  4CIL A;  2XOT A;  2ELL A;  5B0T A;  4L3A A;  1P8V A;  4Q3I A;  4RCW A;  4K17 A;  2JQD A;  4Q3G A;  1M9S A;  2RR6 A;  4GT6 A;  2Z63 A;  4C2A B;  3OGL B;  3WPH A;  4Z8G A;  4U7L A;  3E2J A;  3M19 A;  2O6S A;  4QC0 A;  4LSX A;  4M7E C;  5AZ5 A;  2A0Z A;  5AWA A;  1XCD A;  4PEQ B;  5B0N A;  3RJ0 A;  4U09 A;  2OMZ A;  3OGM B;  4Z61 C;  3ZYO A;  1M10 B;  3RGZ A;  1P9A G;  2CA6 A;  4RCA B;  4RWT C;  4V2D A;  3RW6 A;  3ZYN A;  1M0Z A;  4R08 A;  4XGO A;  5IJB A;  4V2E A;  3UL8 A;  3E6J A;  2ID5 A;  4R58 A;  4CNM A;  3RFE A;  2UZX A;  3W3M A;  3ULA A;  4U08 A;  2BNH A;  5CMP A;  2JE1 A;  5GMH A;  3G39 A;  4AY9 X;  2UZY A;  1O6T A;  3G3B A;  2O6R A;  3C6N B;  1PGV A;  2V70 A;  1H6T A;  3KJ4 A;  3VQ1 A;  1M9L A;  4MN8 B;  4WP6 A;  4BSS A;  4J0M A;  4AW4 A;  1SQ0 B;  1P8T A;  1ZIW A;  3W3N A;  3REZ A;  1A9N A;  4IM6 A;  3FXI A;  3GOZ A;  2WQV A;  2Z64 A;  2XWT C;  4FCG A;  4XOS A;  4Y61 B;  1XKU A;  4QBZ A;  1W8A A;  3W3L A;  4U06 A;  2V9T B;  4NZR M;  4LSX C;  1U0N D;  4I6J B;  4Z79 A;  3UL7 A;  1FQV A;  1DFJ I;  3WPF A;  4L3F A;  3G04 C;  2O6Q A;  1G9U A;  3UL9 A;  5GMF A;  3WPD A;  3OGK B;  2P1N B;  2ASS B;  1Z7X W;  2WFH A;  1OTN A;  4Z64 C;  5IJD A;  4Z94 G;  4LI2 A;  1JL5 A;  4LI1 A;  5B4P A;  4EZG A;  4R6F A;  1OGQ A;  2Z62 A;  3O53 A;  4FD0 A;  5GS2 B;  4MQW X;  4Q62 A;  4QXE A;  3RIZ A;  1IO0 A;  2V9S A;  4ARR A;  5GMG A;  2Z7X A;  1WWL A;  3WPC A;  2WQX A;  2OMU A;  3E3Z A;  4LXS A;  5A5C A;  4ECO A;  4M7E A;  3A79 B;  2OMW A;  2RA8 A;  4BSU A;  5GQR K;  3E4G A;  1H6U A;  1O6S A;  3W3J A;  4KXF B;  3G3A A;  4BSR A;  1OOK G;  1QYY A;  4FDW A;  4PER A;  1FS2 A;  4FMZ A;  5GS0 A;  4KNG A;  3SB4 A;  3ZYJ A;  3BZ5 A;  5AWD A;  3WPE A;  4FS7 A;  2OMX A;  2Z7X B;  2Z81 A;  1A4Y A;  2OMT A;  4R5D A;  2P1Q B;  5CMN A;  3O6N A;  5AWB A;  3RW7 A;  4LSC A;  4KT1 A;  4R09 A;  3M18 A;  3UN9 A;  5HDH A;  4ECN A;  3W3K A;  1FO1 A;  5D3I A;  2Z66 A;  1XWD C;  4P8S A;  3VQ2 A;  1KOH A;  3G06 A;  4R6J A;  4B8C D;  1FT8 A;  4UFR A;  4ARN A;  4GLP A;  3ZYI A;  4LXR A;  5FTT B;  4CC4 A;  2P1M B;  4R07 A;  2BEX A;  4HQ1 A;  3RGX A;  1GWB A;  1K5G C;  3OJA A;  1O6V A;  5LFN A;  2Y5Q A;  4H09 A;  4R6A A;  5HZL B;  5AWC A;  4J4L A;  3WPI A;  3WPG A;  4TZH A;  1XEU A;  1OZN A;  2P1O B;  4CP6 A;  2OMV A;  4P91 A;  5IJC A;  3CVR A;  4G8A A;  3WN4 A;  4NKH A;  3W3G A;  4C2B B;  3RFJ A;  2Z82 A;  4XSQ A;  3OJA B;  4BV4 R;  2IFG A;  5IYX C;  3DZE A;  4PKI G;  4NKG A;  4R6G A;  3CIG A;  1OTO A;  2Z65 A;  2WQU A;  2AST B;  2OMY A;  4PSJ A;  4V2C A;  4YEB B;  4PQ8 A;  1YRG A;  3TSR E;  1XEC A;  3ULU A;  3JB9 j;  2P1P B;  1K5D C;  2Q4G W;  1LTX A;  4LSA A;  2WQW A;  3RFS A;  2FT3 A;  4FHO A;  4WYK A; 
#chains in the Genus database with same CATH homology
 3ULV A;  4CNC A;  2R9U A;  3PMH G;  1DCE A;  1KOO A;  4CC4 C;  3P72 A;  2JE0 A;  1D0B A;  3WPB A;  3C6P B;  4OQT A;  4R0A A;  3C6O B;  3CIY A;  1OTM A;  1DS9 A;  4R5C A;  4CIL A;  2XOT A;  2ELL A;  5B0T A;  4L3A A;  1P8V A;  4Q3I A;  4RCW A;  4K17 A;  2JQD A;  4Q3G A;  1M9S A;  2RR6 A;  4GT6 A;  2Z63 A;  4C2A B;  3OGL B;  3WPH A;  4Z8G A;  4U7L A;  3E2J A;  3M19 A;  2O6S A;  4QC0 A;  4LSX A;  4M7E C;  5AZ5 A;  2A0Z A;  5AWA A;  1XCD A;  4PEQ B;  5B0N A;  3RJ0 A;  4U09 A;  2OMZ A;  3OGM B;  4Z61 C;  3ZYO A;  1M10 B;  3RGZ A;  1P9A G;  2CA6 A;  4RCA B;  4RWT C;  4V2D A;  3RW6 A;  3ZYN A;  1M0Z A;  4R08 A;  4XGO A;  5IJB A;  4V2E A;  3UL8 A;  3E6J A;  2ID5 A;  4R58 A;  4CNM A;  3RFE A;  2UZX A;  3W3M A;  3ULA A;  4U08 A;  2BNH A;  5CMP A;  2JE1 A;  5GMH A;  3G39 A;  4AY9 X;  2UZY A;  1O6T A;  3G3B A;  2O6R A;  3C6N B;  1PGV A;  2V70 A;  1H6T A;  3KJ4 A;  3VQ1 A;  1M9L A;  4MN8 B;  4WP6 A;  4BSS A;  4J0M A;  4AW4 A;  1SQ0 B;  1P8T A;  1ZIW A;  3W3N A;  3REZ A;  1A9N A;  4IM6 A;  3FXI A;  3GOZ A;  2WQV A;  2Z64 A;  2XWT C;  4FCG A;  4XOS A;  4Y61 B;  1XKU A;  4QBZ A;  1W8A A;  3W3L A;  4U06 A;  2V9T B;  4LSX C;  1U0N D;  4I6J B;  4Z79 A;  3UL7 A;  1FQV A;  1DFJ I;  3WPF A;  4L3F A;  3G04 C;  2O6Q A;  1G9U A;  3UL9 A;  5GMF A;  3WPD A;  3OGK B;  2P1N B;  2ASS B;  1Z7X W;  2WFH A;  1OTN A;  4Z64 C;  5IJD A;  4Z94 G;  4LI2 A;  1JL5 A;  4LI1 A;  5B4P A;  4EZG A;  4R6F A;  1OGQ A;  2Z62 A;  3O53 A;  4FD0 A;  5GS2 B;  4MQW X;  4Q62 A;  4QXE A;  3RIZ A;  1IO0 A;  2V9S A;  4ARR A;  5GMG A;  2Z7X A;  1WWL A;  3WPC A;  2WQX A;  2OMU A;  3E3Z A;  4LXS A;  5A5C A;  4ECO A;  4M7E A;  3A79 B;  2OMW A;  2RA8 A;  4BSU A;  5GQR K;  3E4G A;  1H6U A;  1O6S A;  3W3J A;  4KXF B;  3G3A A;  4BSR A;  1OOK G;  1QYY A;  4FDW A;  4PER A;  1FS2 A;  4FMZ A;  5GS0 A;  4KNG A;  3SB4 A;  3ZYJ A;  3BZ5 A;  5AWD A;  3WPE A;  4FS7 A;  2OMX A;  2Z7X B;  2Z81 A;  1A4Y A;  2OMT A;  4R5D A;  2P1Q B;  5CMN A;  3O6N A;  5AWB A;  3RW7 A;  4LSC A;  4KT1 A;  4R09 A;  3M18 A;  3UN9 A;  5HDH A;  4ECN A;  3W3K A;  1FO1 A;  5D3I A;  2Z66 A;  1XWD C;  4P8S A;  3VQ2 A;  1KOH A;  3G06 A;  4R6J A;  4B8C D;  1FT8 A;  4UFR A;  4ARN A;  4GLP A;  3ZYI A;  4LXR A;  5FTT B;  4CC4 A;  2P1M B;  4R07 A;  2BEX A;  4HQ1 A;  3RGX A;  1GWB A;  1K5G C;  3OJA A;  1O6V A;  5LFN A;  2Y5Q A;  4H09 A;  4R6A A;  5HZL B;  5AWC A;  4J4L A;  3WPI A;  3WPG A;  4TZH A;  1XEU A;  1OZN A;  2P1O B;  4CP6 A;  2OMV A;  4P91 A;  5IJC A;  3CVR A;  4G8A A;  3WN4 A;  4NKH A;  3W3G A;  4C2B B;  3RFJ A;  2Z82 A;  4XSQ A;  3OJA B;  4BV4 R;  2IFG A;  5IYX C;  3DZE A;  4PKI G;  4NKG A;  4R6G A;  3CIG A;  1OTO A;  2Z65 A;  2WQU A;  2AST B;  2OMY A;  4PSJ A;  4V2C A;  4YEB B;  4PQ8 A;  1YRG A;  3TSR E;  1XEC A;  3ULU A;  3JB9 j;  2P1P B;  1K5D C;  2Q4G W;  1LTX A;  4LSA A;  2WQW A;  3RFS A;  2FT3 A;  4FHO A;  4WYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...