3ZYNA

Crystal structure of the n-terminal leucine rich repeats of netrin-g ligand-3
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
310
structure length
310
Chain Sequence
TSCPAACSCSNQASRVICTRRELAEVPASIPVNTRYLNLQENSIQVIRTDTFKHLRHLEILQLSKNLVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4B
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 87
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3zynA00
3VQ1A 4R6AA 2O6RA 2OMYA 2JQDA 4PKIG 4R5DA 2R9UA 3WPIA 5D3IA 2P1NB 4MQWX 3RGXA 3WPEA 2BEXA 1Z7XW 1OTOA 4LXSA 2UZXA 2JE0A 3RJ0A 4V2DA 4KNGA 1XECA 4Q62A 3ZYJA 4IM6A 4R07A 3JB9j 4P8SA 4Z64C 4PQ8A 4U06A 2Z7XB 5AWAA 2OMUA 3ZYOA 4PSJA 2CA6A 5AWCA 4CNCA 1W8AA 1K5GC 4FD0A 2V9SA 3FXIA 4FCGA 3G06A 2Z82A 4TZHA 4UFRA 4NKHA 3C6OB 4R6FA 2UZYA 4FMZA 3SB4A 1G9UA 4U7LA 2WQWA 4FDWA 3A79B 2Z62A 4Q3IA 2RA8A 4BV4R 4FS7A 3ULUA 2WFHA 2V70A 4V2CA 4J0MA 1DFJI 3UL7A 4LI1A 3G39A 4C2AB 3WPDA 1PGVA 4QBZA 3RGZA 3WPHA 2FT3A 4RCAB 2WQVA 4QXEA 4V2EA 4KT1A 4LSAA 2OMWA 1OGQA 3GOZA 3UL8A 3BZ5A 4PERA 4BSUA 1M9SA 4RCWA 3WPFA 3DZEA 4YEBB 1A9NA 1ZIWA 4M7EA 5IJCA 5AZ5A 1O6TA 3WN4A 2Y5QA 4R0AA 4LXRA 2Q4GW 5GS0A 4GLPA 3WPBA 3E6JA 3VQ2A 3C6NB 5IJBA 3O53A 5HZLB 3C6PB 4H09A 4ARNA 4B8CD 5HDHA 1FT8A 1M9LA 5B0NA 3W3LA 3E4GA 1A4YA 4Z8GA 4AY9X 4R08A 4Q3GA 4BSSA 4XSQA 3OJAB 1QYYA 4R09A 4Z79A 5GMGA 1O6SA 4C2BB 5GS2B 1GWBA 4P91A 2O6SA 5GMFA 4CC4A 2WQUA 3REZA 2BNHA 4XGOA 5B4PA 5B0TA 5GMHA 4CNMA 4KXFB 3W3JA 1LTXA 1M0ZA 2P1MB 3W3NA 3RIZA 4M7EC 4CP6A 5AWBA 3PMHG 4I6JB 4LSXA 4Z94G 1FQVA 2XWTC 4PEQB 4ARRA 4NKGA 2RR6A 1D0BA 4GT6A 3M18A 3ZYNA 5AWDA 2Z7XA 1IO0A 1H6UA 3KJ4A 2OMZA 4R6JA 3ULAA 4QC0A 2IFGA 3OGMB 2P1OB 1JL5A 2ASTB 3G04C 1DCEA 1XCDA 4ECOA 4L3AA 1P8TA 3WPGA 1M10B 3RFJA 2Z63A 3OGKB 1YRGA 1DS9A 3CIYA 1XWDC 4CC4C 4MN8B 2Z81A 1K5DC 4BSRA 3ULVA 3RFSA 4RWTC 3W3KA 4J4LA 2XOTA 1OOKG 5CMNA 2P1PB 2P1QB 4LSCA 1H6TA 4R5CA 1SQ0B 2Z64A 1O6VA 4AW4A 1OTMA 4LSXC 3W3MA 4R6GA 2ASSB 1FS2A 3M19A 2V9TB 4U09A 3OGLB 4FHOA 1P8VA 4U08A 3UN9A 1WWLA 2Z66A 4WP6A 1U0ND 3G3BA 4Z61C 4XOSA 4Y61B 5IYXC 5LFNA 2O6QA 5IJDA 5GQRK 5FTTB 4EZGA 1FO1A 3CIGA 2ID5A 4CILA 3E2JA 2OMXA 2WQXA 2A0ZA 3UL9A 3RW6A 2OMVA 4WYKA 3P72A 3TSRE 4ECNA 1OZNA 2ELLA 1KOHA 1KOOA 4OQTA 1XKUA 4HQ1A 4LI2A 3RW7A 5A5CA 2Z65A 3OJAA 4K17A 2JE1A 3ZYIA 3WPCA 3E3ZA 4G8AA 1P9AG 5CMPA 1OTNA 3RFEA 3W3GA 3CVRA 2OMTA 3O6NA 3G3AA 4L3FA 4R58A 1XEUA
chains in the Genus database with same CATH superfamily
3VQ1A 4R6AA 2O6RA 2OMYA 2JQDA 4PKIG 4R5DA 2R9UA 3WPIA 5D3IA 2P1NB 4MQWX 3RGXA 3WPEA 2BEXA 1Z7XW 1OTOA 4LXSA 2UZXA 2JE0A 3RJ0A 4V2DA 4KNGA 1XECA 4Q62A 3ZYJA 4IM6A 4R07A 3JB9j 4P8SA 4Z64C 4PQ8A 4U06A 2Z7XB 5AWAA 2OMUA 3ZYOA 4PSJA 2CA6A 5AWCA 4CNCA 1W8AA 1K5GC 4FD0A 2V9SA 3FXIA 4FCGA 3G06A 2Z82A 4TZHA 4UFRA 4NKHA 3C6OB 4R6FA 2UZYA 4FMZA 3SB4A 1G9UA 4U7LA 2WQWA 4FDWA 3A79B 2Z62A 4Q3IA 2RA8A 4BV4R 4FS7A 3ULUA 2WFHA 2V70A 4V2CA 4J0MA 1DFJI 3UL7A 4LI1A 3G39A 4C2AB 3WPDA 1PGVA 4QBZA 3RGZA 3WPHA 2FT3A 4NZTM 4RCAB 2WQVA 4QXEA 4V2EA 4KT1A 4LSAA 2OMWA 1OGQA 3GOZA 3UL8A 3BZ5A 4PERA 4BSUA 1M9SA 4RCWA 3WPFA 3DZEA 4YEBB 1A9NA 1ZIWA 4M7EA 5IJCA 5AZ5A 1O6TA 3WN4A 2Y5QA 4R0AA 4LXRA 2Q4GW 5GS0A 4GLPA 3WPBA 3E6JA 3VQ2A 3C6NB 5IJBA 3O53A 5HZLB 3C6PB 4H09A 4ARNA 4B8CD 5HDHA 1FT8A 1M9LA 5B0NA 3W3LA 3E4GA 1A4YA 4Z8GA 4AY9X 4R08A 4Q3GA 4BSSA 4XSQA 3OJAB 1QYYA 4R09A 4Z79A 5GMGA 1O6SA 4C2BB 5GS2B 1GWBA 4P91A 2O6SA 5GMFA 4CC4A 2WQUA 3REZA 2BNHA 4XGOA 5B4PA 5B0TA 5GMHA 4CNMA 4KXFB 3W3JA 1LTXA 1M0ZA 2P1MB 3W3NA 3RIZA 4M7EC 4CP6A 5AWBA 3PMHG 4I6JB 4LSXA 4NZRM 4Z94G 1FQVA 2XWTC 4PEQB 4ARRA 4NKGA 2RR6A 1D0BA 4GT6A 3M18A 3ZYNA 5AWDA 2Z7XA 1IO0A 1H6UA 3KJ4A 2OMZA 4R6JA 3ULAA 4QC0A 2IFGA 3OGMB 2P1OB 1JL5A 2ASTB 3G04C 1DCEA 1XCDA 4ECOA 4L3AA 1P8TA 3WPGA 1M10B 3RFJA 2Z63A 3OGKB 1YRGA 1DS9A 3CIYA 1XWDC 4CC4C 4MN8B 2Z81A 1K5DC 4BSRA 3ULVA 3RFSA 4RWTC 3W3KA 4J4LA 2XOTA 1OOKG 5CMNA 2P1PB 2P1QB 4LSCA 1H6TA 4R5CA 1SQ0B 2Z64A 1O6VA 4AW4A 1OTMA 4LSXC 3W3MA 4R6GA 2ASSB 1FS2A 3M19A 2V9TB 4U09A 3OGLB 4FHOA 1P8VA 4U08A 3UN9A 1WWLA 2Z66A 4WP6A 1U0ND 3G3BA 4Z61C 4XOSA 4Y61B 5IYXC 5LFNA 2O6QA 5IJDA 5GQRK 5FTTB 4EZGA 1FO1A 3CIGA 2ID5A 4CILA 3E2JA 2OMXA 2WQXA 2A0ZA 3UL9A 3RW6A 2OMVA 4WYKA 3P72A 3TSRE 4ECNA 1OZNA 2ELLA 1KOHA 1KOOA 4OQTA 1XKUA 4HQ1A 4LI2A 3RW7A 5A5CA 2Z65A 3OJAA 4K17A 2JE1A 3ZYIA 3WPCA 3E3ZA 4G8AA 1P9AG 5CMPA 1OTNA 3RFEA 3W3GA 3CVRA 2OMTA 3O6NA 3G3AA 4L3FA 4R58A 1XEUA
chains in the Genus database with same CATH topology
3VQ1A 4R6AA 2O6RA 2OMYA 2JQDA 4PKIG 4R5DA 2R9UA 3WPIA 5D3IA 2P1NB 4MQWX 3RGXA 3WPEA 2BEXA 1Z7XW 1OTOA 4LXSA 2UZXA 2JE0A 3RJ0A 4V2DA 4KNGA 1XECA 4Q62A 3ZYJA 4IM6A 4R07A 3JB9j 4P8SA 4Z64C 4PQ8A 4U06A 2Z7XB 5AWAA 2OMUA 3ZYOA 4PSJA 2CA6A 5AWCA 4CNCA 1W8AA 1K5GC 4FD0A 2V9SA 3FXIA 4FCGA 3G06A 2Z82A 4TZHA 4UFRA 4NKHA 3C6OB 4R6FA 2UZYA 4FMZA 3SB4A 1G9UA 4U7LA 2WQWA 4FDWA 3A79B 2Z62A 4Q3IA 2RA8A 4BV4R 4FS7A 3ULUA 2WFHA 2V70A 4V2CA 4J0MA 1DFJI 3UL7A 4LI1A 3G39A 4C2AB 3WPDA 1PGVA 4QBZA 3RGZA 3WPHA 2FT3A 4RCAB 2WQVA 4QXEA 4V2EA 4KT1A 4LSAA 2OMWA 1OGQA 3GOZA 3UL8A 3BZ5A 4PERA 4BSUA 1M9SA 4RCWA 3WPFA 3DZEA 4YEBB 1A9NA 1ZIWA 4M7EA 5IJCA 5AZ5A 1O6TA 3WN4A 2Y5QA 4R0AA 4LXRA 2Q4GW 5GS0A 4GLPA 3WPBA 3E6JA 3VQ2A 3C6NB 5IJBA 3O53A 5HZLB 3C6PB 4H09A 4ARNA 4B8CD 5HDHA 1FT8A 1M9LA 5B0NA 3W3LA 3E4GA 1A4YA 4Z8GA 4AY9X 4R08A 4Q3GA 4BSSA 4XSQA 3OJAB 1QYYA 4R09A 4Z79A 5GMGA 1O6SA 4C2BB 5GS2B 1GWBA 4P91A 2O6SA 5GMFA 4CC4A 2WQUA 3REZA 2BNHA 4XGOA 5B4PA 5B0TA 5GMHA 4CNMA 4KXFB 3W3JA 1LTXA 1M0ZA 2P1MB 3W3NA 3RIZA 4M7EC 4CP6A 5AWBA 3PMHG 4I6JB 4LSXA 4Z94G 1FQVA 2XWTC 4PEQB 4ARRA 4NKGA 2RR6A 1D0BA 4GT6A 3M18A 3ZYNA 5AWDA 2Z7XA 1IO0A 1H6UA 3KJ4A 2OMZA 4R6JA 3ULAA 4QC0A 2IFGA 3OGMB 2P1OB 1JL5A 2ASTB 3G04C 1DCEA 1XCDA 4ECOA 4L3AA 1P8TA 3WPGA 1M10B 3RFJA 2Z63A 3OGKB 1YRGA 1DS9A 3CIYA 1XWDC 4CC4C 4MN8B 2Z81A 1K5DC 4BSRA 3ULVA 3RFSA 4RWTC 3W3KA 4J4LA 2XOTA 1OOKG 5CMNA 2P1PB 2P1QB 4LSCA 1H6TA 4R5CA 1SQ0B 2Z64A 1O6VA 4AW4A 1OTMA 4LSXC 3W3MA 4R6GA 2ASSB 1FS2A 3M19A 2V9TB 4U09A 3OGLB 4FHOA 1P8VA 4U08A 3UN9A 1WWLA 2Z66A 4WP6A 1U0ND 3G3BA 4Z61C 4XOSA 4Y61B 5IYXC 5LFNA 2O6QA 5IJDA 5GQRK 5FTTB 4EZGA 1FO1A 3CIGA 2ID5A 4CILA 3E2JA 2OMXA 2WQXA 2A0ZA 3UL9A 3RW6A 2OMVA 4WYKA 3P72A 3TSRE 4ECNA 1OZNA 2ELLA 1KOHA 1KOOA 4OQTA 1XKUA 4HQ1A 4LI2A 3RW7A 5A5CA 2Z65A 3OJAA 4K17A 2JE1A 3ZYIA 3WPCA 3E3ZA 4G8AA 1P9AG 5CMPA 1OTNA 3RFEA 3W3GA 3CVRA 2OMTA 3O6NA 3G3AA 4L3FA 4R58A 1XEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ1 A;  4R6A A;  2O6R A;  2OMY A;  2JQD A;  4PKI G;  4R5D A;  2R9U A;  3WPI A;  5D3I A;  2P1N B;  4MQW X;  3RGX A;  3WPE A;  2BEX A;  1Z7X W;  1OTO A;  4LXS A;  2UZX A;  2JE0 A;  3RJ0 A;  4V2D A;  4KNG A;  1XEC A;  4Q62 A;  3ZYJ A;  4IM6 A;  4R07 A;  3JB9 j;  4P8S A;  4Z64 C;  4PQ8 A;  4U06 A;  2Z7X B;  5AWA A;  2OMU A;  3ZYO A;  4PSJ A;  2CA6 A;  5AWC A;  4CNC A;  1W8A A;  1K5G C;  4FD0 A;  2V9S A;  3FXI A;  4FCG A;  3G06 A;  2Z82 A;  4TZH A;  4UFR A;  4NKH A;  3C6O B;  4R6F A;  2UZY A;  4FMZ A;  3SB4 A;  1G9U A;  4U7L A;  2WQW A;  4FDW A;  3A79 B;  2Z62 A;  4Q3I A;  2RA8 A;  4BV4 R;  4FS7 A;  3ULU A;  2WFH A;  2V70 A;  4V2C A;  4J0M A;  1DFJ I;  3UL7 A;  4LI1 A;  3G39 A;  4C2A B;  3WPD A;  1PGV A;  4QBZ A;  3RGZ A;  3WPH A;  2FT3 A;  4RCA B;  2WQV A;  4QXE A;  4V2E A;  4KT1 A;  4LSA A;  2OMW A;  1OGQ A;  3GOZ A;  3UL8 A;  3BZ5 A;  4PER A;  4BSU A;  1M9S A;  4RCW A;  3WPF A;  3DZE A;  4YEB B;  1A9N A;  1ZIW A;  4M7E A;  5IJC A;  5AZ5 A;  1O6T A;  3WN4 A;  2Y5Q A;  4R0A A;  4LXR A;  2Q4G W;  5GS0 A;  4GLP A;  3WPB A;  3E6J A;  3VQ2 A;  3C6N B;  5IJB A;  3O53 A;  5HZL B;  3C6P B;  4H09 A;  4ARN A;  4B8C D;  5HDH A;  1FT8 A;  1M9L A;  5B0N A;  3W3L A;  3E4G A;  1A4Y A;  4Z8G A;  4AY9 X;  4R08 A;  4Q3G A;  4BSS A;  4XSQ A;  3OJA B;  1QYY A;  4R09 A;  4Z79 A;  5GMG A;  1O6S A;  4C2B B;  5GS2 B;  1GWB A;  4P91 A;  2O6S A;  5GMF A;  4CC4 A;  2WQU A;  3REZ A;  2BNH A;  4XGO A;  5B4P A;  5B0T A;  5GMH A;  4CNM A;  4KXF B;  3W3J A;  1LTX A;  1M0Z A;  2P1M B;  3W3N A;  3RIZ A;  4M7E C;  4CP6 A;  5AWB A;  3PMH G;  4I6J B;  4LSX A;  4Z94 G;  1FQV A;  2XWT C;  4PEQ B;  4ARR A;  4NKG A;  2RR6 A;  1D0B A;  4GT6 A;  3M18 A;  3ZYN A;  5AWD A;  2Z7X A;  1IO0 A;  1H6U A;  3KJ4 A;  2OMZ A;  4R6J A;  3ULA A;  4QC0 A;  2IFG A;  3OGM B;  2P1O B;  1JL5 A;  2AST B;  3G04 C;  1DCE A;  1XCD A;  4ECO A;  4L3A A;  1P8T A;  3WPG A;  1M10 B;  3RFJ A;  2Z63 A;  3OGK B;  1YRG A;  1DS9 A;  3CIY A;  1XWD C;  4CC4 C;  4MN8 B;  2Z81 A;  1K5D C;  4BSR A;  3ULV A;  3RFS A;  4RWT C;  3W3K A;  4J4L A;  2XOT A;  1OOK G;  5CMN A;  2P1P B;  2P1Q B;  4LSC A;  1H6T A;  4R5C A;  1SQ0 B;  2Z64 A;  1O6V A;  4AW4 A;  1OTM A;  4LSX C;  3W3M A;  4R6G A;  2ASS B;  1FS2 A;  3M19 A;  2V9T B;  4U09 A;  3OGL B;  4FHO A;  1P8V A;  4U08 A;  3UN9 A;  1WWL A;  2Z66 A;  4WP6 A;  1U0N D;  3G3B A;  4Z61 C;  4XOS A;  4Y61 B;  5IYX C;  5LFN A;  2O6Q A;  5IJD A;  5GQR K;  5FTT B;  4EZG A;  1FO1 A;  3CIG A;  2ID5 A;  4CIL A;  3E2J A;  2OMX A;  2WQX A;  2A0Z A;  3UL9 A;  3RW6 A;  2OMV A;  4WYK A;  3P72 A;  3TSR E;  4ECN A;  1OZN A;  2ELL A;  1KOH A;  1KOO A;  4OQT A;  1XKU A;  4HQ1 A;  4LI2 A;  3RW7 A;  5A5C A;  2Z65 A;  3OJA A;  4K17 A;  2JE1 A;  3ZYI A;  3WPC A;  3E3Z A;  4G8A A;  1P9A G;  5CMP A;  1OTN A;  3RFE A;  3W3G A;  3CVR A;  2OMT A;  3O6N A;  3G3A A;  4L3F A;  4R58 A;  1XEU A; 
#chains in the Genus database with same CATH topology
 3VQ1 A;  4R6A A;  2O6R A;  2OMY A;  2JQD A;  4PKI G;  4R5D A;  2R9U A;  3WPI A;  5D3I A;  2P1N B;  4MQW X;  3RGX A;  3WPE A;  2BEX A;  1Z7X W;  1OTO A;  4LXS A;  2UZX A;  2JE0 A;  3RJ0 A;  4V2D A;  4KNG A;  1XEC A;  4Q62 A;  3ZYJ A;  4IM6 A;  4R07 A;  3JB9 j;  4P8S A;  4Z64 C;  4PQ8 A;  4U06 A;  2Z7X B;  5AWA A;  2OMU A;  3ZYO A;  4PSJ A;  2CA6 A;  5AWC A;  4CNC A;  1W8A A;  1K5G C;  4FD0 A;  2V9S A;  3FXI A;  4FCG A;  3G06 A;  2Z82 A;  4TZH A;  4UFR A;  4NKH A;  3C6O B;  4R6F A;  2UZY A;  4FMZ A;  3SB4 A;  1G9U A;  4U7L A;  2WQW A;  4FDW A;  3A79 B;  2Z62 A;  4Q3I A;  2RA8 A;  4BV4 R;  4FS7 A;  3ULU A;  2WFH A;  2V70 A;  4V2C A;  4J0M A;  1DFJ I;  3UL7 A;  4LI1 A;  3G39 A;  4C2A B;  3WPD A;  1PGV A;  4QBZ A;  3RGZ A;  3WPH A;  2FT3 A;  4NZT M;  4RCA B;  2WQV A;  4QXE A;  4V2E A;  4KT1 A;  4LSA A;  2OMW A;  1OGQ A;  3GOZ A;  3UL8 A;  3BZ5 A;  4PER A;  4BSU A;  1M9S A;  4RCW A;  3WPF A;  3DZE A;  4YEB B;  1A9N A;  1ZIW A;  4M7E A;  5IJC A;  5AZ5 A;  1O6T A;  3WN4 A;  2Y5Q A;  4R0A A;  4LXR A;  2Q4G W;  5GS0 A;  4GLP A;  3WPB A;  3E6J A;  3VQ2 A;  3C6N B;  5IJB A;  3O53 A;  5HZL B;  3C6P B;  4H09 A;  4ARN A;  4B8C D;  5HDH A;  1FT8 A;  1M9L A;  5B0N A;  3W3L A;  3E4G A;  1A4Y A;  4Z8G A;  4AY9 X;  4R08 A;  4Q3G A;  4BSS A;  4XSQ A;  3OJA B;  1QYY A;  4R09 A;  4Z79 A;  5GMG A;  1O6S A;  4C2B B;  5GS2 B;  1GWB A;  4P91 A;  2O6S A;  5GMF A;  4CC4 A;  2WQU A;  3REZ A;  2BNH A;  4XGO A;  5B4P A;  5B0T A;  5GMH A;  4CNM A;  4KXF B;  3W3J A;  1LTX A;  1M0Z A;  2P1M B;  3W3N A;  3RIZ A;  4M7E C;  4CP6 A;  5AWB A;  3PMH G;  4I6J B;  4LSX A;  4NZR M;  4Z94 G;  1FQV A;  2XWT C;  4PEQ B;  4ARR A;  4NKG A;  2RR6 A;  1D0B A;  4GT6 A;  3M18 A;  3ZYN A;  5AWD A;  2Z7X A;  1IO0 A;  1H6U A;  3KJ4 A;  2OMZ A;  4R6J A;  3ULA A;  4QC0 A;  2IFG A;  3OGM B;  2P1O B;  1JL5 A;  2AST B;  3G04 C;  1DCE A;  1XCD A;  4ECO A;  4L3A A;  1P8T A;  3WPG A;  1M10 B;  3RFJ A;  2Z63 A;  3OGK B;  1YRG A;  1DS9 A;  3CIY A;  1XWD C;  4CC4 C;  4MN8 B;  2Z81 A;  1K5D C;  4BSR A;  3ULV A;  3RFS A;  4RWT C;  3W3K A;  4J4L A;  2XOT A;  1OOK G;  5CMN A;  2P1P B;  2P1Q B;  4LSC A;  1H6T A;  4R5C A;  1SQ0 B;  2Z64 A;  1O6V A;  4AW4 A;  1OTM A;  4LSX C;  3W3M A;  4R6G A;  2ASS B;  1FS2 A;  3M19 A;  2V9T B;  4U09 A;  3OGL B;  4FHO A;  1P8V A;  4U08 A;  3UN9 A;  1WWL A;  2Z66 A;  4WP6 A;  1U0N D;  3G3B A;  4Z61 C;  4XOS A;  4Y61 B;  5IYX C;  5LFN A;  2O6Q A;  5IJD A;  5GQR K;  5FTT B;  4EZG A;  1FO1 A;  3CIG A;  2ID5 A;  4CIL A;  3E2J A;  2OMX A;  2WQX A;  2A0Z A;  3UL9 A;  3RW6 A;  2OMV A;  4WYK A;  3P72 A;  3TSR E;  4ECN A;  1OZN A;  2ELL A;  1KOH A;  1KOO A;  4OQT A;  1XKU A;  4HQ1 A;  4LI2 A;  3RW7 A;  5A5C A;  2Z65 A;  3OJA A;  4K17 A;  2JE1 A;  3ZYI A;  3WPC A;  3E3Z A;  4G8A A;  1P9A G;  5CMP A;  1OTN A;  3RFE A;  3W3G A;  3CVR A;  2OMT A;  3O6N A;  3G3A A;  4L3F A;  4R58 A;  1XEU A; 
#chains in the Genus database with same CATH homology
 3VQ1 A;  4R6A A;  2O6R A;  2OMY A;  2JQD A;  4PKI G;  4R5D A;  2R9U A;  3WPI A;  5D3I A;  2P1N B;  4MQW X;  3RGX A;  3WPE A;  2BEX A;  1Z7X W;  1OTO A;  4LXS A;  2UZX A;  2JE0 A;  3RJ0 A;  4V2D A;  4KNG A;  1XEC A;  4Q62 A;  3ZYJ A;  4IM6 A;  4R07 A;  3JB9 j;  4P8S A;  4Z64 C;  4PQ8 A;  4U06 A;  2Z7X B;  5AWA A;  2OMU A;  3ZYO A;  4PSJ A;  2CA6 A;  5AWC A;  4CNC A;  1W8A A;  1K5G C;  4FD0 A;  2V9S A;  3FXI A;  4FCG A;  3G06 A;  2Z82 A;  4TZH A;  4UFR A;  4NKH A;  3C6O B;  4R6F A;  2UZY A;  4FMZ A;  3SB4 A;  1G9U A;  4U7L A;  2WQW A;  4FDW A;  3A79 B;  2Z62 A;  4Q3I A;  2RA8 A;  4BV4 R;  4FS7 A;  3ULU A;  2WFH A;  2V70 A;  4V2C A;  4J0M A;  1DFJ I;  3UL7 A;  4LI1 A;  3G39 A;  4C2A B;  3WPD A;  1PGV A;  4QBZ A;  3RGZ A;  3WPH A;  2FT3 A;  4RCA B;  2WQV A;  4QXE A;  4V2E A;  4KT1 A;  4LSA A;  2OMW A;  1OGQ A;  3GOZ A;  3UL8 A;  3BZ5 A;  4PER A;  4BSU A;  1M9S A;  4RCW A;  3WPF A;  3DZE A;  4YEB B;  1A9N A;  1ZIW A;  4M7E A;  5IJC A;  5AZ5 A;  1O6T A;  3WN4 A;  2Y5Q A;  4R0A A;  4LXR A;  2Q4G W;  5GS0 A;  4GLP A;  3WPB A;  3E6J A;  3VQ2 A;  3C6N B;  5IJB A;  3O53 A;  5HZL B;  3C6P B;  4H09 A;  4ARN A;  4B8C D;  5HDH A;  1FT8 A;  1M9L A;  5B0N A;  3W3L A;  3E4G A;  1A4Y A;  4Z8G A;  4AY9 X;  4R08 A;  4Q3G A;  4BSS A;  4XSQ A;  3OJA B;  1QYY A;  4R09 A;  4Z79 A;  5GMG A;  1O6S A;  4C2B B;  5GS2 B;  1GWB A;  4P91 A;  2O6S A;  5GMF A;  4CC4 A;  2WQU A;  3REZ A;  2BNH A;  4XGO A;  5B4P A;  5B0T A;  5GMH A;  4CNM A;  4KXF B;  3W3J A;  1LTX A;  1M0Z A;  2P1M B;  3W3N A;  3RIZ A;  4M7E C;  4CP6 A;  5AWB A;  3PMH G;  4I6J B;  4LSX A;  4Z94 G;  1FQV A;  2XWT C;  4PEQ B;  4ARR A;  4NKG A;  2RR6 A;  1D0B A;  4GT6 A;  3M18 A;  3ZYN A;  5AWD A;  2Z7X A;  1IO0 A;  1H6U A;  3KJ4 A;  2OMZ A;  4R6J A;  3ULA A;  4QC0 A;  2IFG A;  3OGM B;  2P1O B;  1JL5 A;  2AST B;  3G04 C;  1DCE A;  1XCD A;  4ECO A;  4L3A A;  1P8T A;  3WPG A;  1M10 B;  3RFJ A;  2Z63 A;  3OGK B;  1YRG A;  1DS9 A;  3CIY A;  1XWD C;  4CC4 C;  4MN8 B;  2Z81 A;  1K5D C;  4BSR A;  3ULV A;  3RFS A;  4RWT C;  3W3K A;  4J4L A;  2XOT A;  1OOK G;  5CMN A;  2P1P B;  2P1Q B;  4LSC A;  1H6T A;  4R5C A;  1SQ0 B;  2Z64 A;  1O6V A;  4AW4 A;  1OTM A;  4LSX C;  3W3M A;  4R6G A;  2ASS B;  1FS2 A;  3M19 A;  2V9T B;  4U09 A;  3OGL B;  4FHO A;  1P8V A;  4U08 A;  3UN9 A;  1WWL A;  2Z66 A;  4WP6 A;  1U0N D;  3G3B A;  4Z61 C;  4XOS A;  4Y61 B;  5IYX C;  5LFN A;  2O6Q A;  5IJD A;  5GQR K;  5FTT B;  4EZG A;  1FO1 A;  3CIG A;  2ID5 A;  4CIL A;  3E2J A;  2OMX A;  2WQX A;  2A0Z A;  3UL9 A;  3RW6 A;  2OMV A;  4WYK A;  3P72 A;  3TSR E;  4ECN A;  1OZN A;  2ELL A;  1KOH A;  1KOO A;  4OQT A;  1XKU A;  4HQ1 A;  4LI2 A;  3RW7 A;  5A5C A;  2Z65 A;  3OJA A;  4K17 A;  2JE1 A;  3ZYI A;  3WPC A;  3E3Z A;  4G8A A;  1P9A G;  5CMP A;  1OTN A;  3RFE A;  3W3G A;  3CVR A;  2OMT A;  3O6N A;  3G3A A;  4L3F A;  4R58 A;  1XEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...