3ZYOA

Crystal structure of the n-terminal leucine rich repeats and immunoglobulin domain of netrin-g ligand-3
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
397
structure length
391
Chain Sequence
b'SCPAACSCSNSRVICTRRELAEVPASIPVNTRYLNLQENSIQVIRTDTFKHLRHLEILQLSKNLVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQDTGQYTCMVTNSAGNTTASATLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4B
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 93
structure length 391
sequence length 397
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zyoA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3zyoA01
1F3JA 3O9WD 2PF6A 5I74C 3Q5TA 3DIFA 3BUYA 1FAIL 4KAQH 3HI1A 4X6BA 3B43A 3DV4A 3GUTB 4L8SA 1TENA 3TBWB 1DLHB 3IS1X 1PY4A 3JVGC 4Y1AE 4PY7A 3PE9A 1R0AH 1EHLH 1OY3B 4RSVA 5H35A 4ZOBA 4XNZB 1BQHB 1N64H 3KYKL 5IOPA 3TVMA 1TIUA 4ZAKA 2DQDH 5DZLA 4R6GA 1QLRA 3ROLA 2P7TA 3CH1A 1RU9H 5C9JA 2WQ8A 3LN4B 4BZ2H 4PYGA 4EI6B 1TZIB 4Y4HD 5E4EC 2BEXA 4JFHD 1TJIH 1HI6A 5CZVH 2P8LB 4P2QD 3WSQL 4JVPA 2X9XA 3S3SA 1PZUB 4NQSB 5CEZD 1EEUA 4O2EA 4R58A 1CLYL 1Q9KB 3V5DB 4LI1A 1JPTL 3CPLB 2J6EA 4BKLB 4A6YH 3OAYH 3RTQC 5BV7L 3W39A 5I73B 3DMMC 4IIQA 1KJ3H 3WJLA 3HA0A 3RNQB 3HAEB 3HMWL 4LSPL 3VG0H 5EU5B 1OAUH 3MMEB 4KVCL 2DIAA 4I3RH 3SKJL 4X0KB 5IT2L 4KU1A 2GT9B 4O5LH 3QI9D 4R08A 5ANME 4LCWA 1I9JL 1MHCA 1BOGB 2PO6B 1FNSH 1NFDE 1GGYA 4KKBC 1MAKA 4NC0B 2IAMB 5I75B 2GJ6B 4H8WL 2O5YL 4Q74A 3S35H 5INDB 2UZXB 3O2WL 1V3MA 1JMXA 2FYYA 4MB3A 2YD2A 3MLTB 1CK0L 4G9DA 3LKNB 5LBSL 5IHUH 2C7UB 1Z0NA 2EDKA 4KHTH 1DCEA 1PD6A 1IM9A 3MRIA 3DVGB 1FE8H 4R4BB 4KKCC 4YXKH 1WBZB 4ZFGH 4Z7NE 2OZ4L 1BX2B 4FZEL 2NY1C 4MD0B 2LFGA 2NXZB 2J7LA 3IKCA 2O61B 1WFUA 5TQ2H 2MCPL 1S7SA 4B53A 4XCEA 1F4HA 4BZ1L 4OV5A 5CJQL 4DN4L 1M71B 2FX9H 1G9NL 4I2XA 4JKPH 1CVSC 3GSXB 1F6AA 3ZDYF 2DAVA 3E2HC 2WLZA 3RUGE 4HCRA 2MWCA 1Q94B 4LVNB 5ESAB 1WT5A 4GLRH 2PETA 5A3IC 1VKXA 1LEIB 5F7DB 5HGBB 5C6PB 3DRQA 3PQYA 1BJ1J 2R4SL 4APQA 1MRCL 1BIIB 4R7NB 3GI8L 4X6DF 1KXTB 3C6PB 4MVBC 4HK3N 5CSZB 5FOBA 1NUFA 4TUOB 1N7ML 1XGQB 3QHFL 3BDYH 3O4LD 2DLHA 4HF5L 5D8JL 1DSFH 4QCIA 3VXRE 3BDBA 1Q9LB 5DK0B 3MLVH 4KK5D 1F3RB 4JPWH 3ZHKA 2NXYB 1FV1A 1RULL 1T1XA 5EOQL 1IC4H 5D2NB 4CADB 2EDEA 2H32A 1NEUA 1LK2A 1O0VA 2GTWA 1OTUC 4Q58C 4S0SD 1NGXB 4YHNA 3RNKB 5BMFH 1CDJA 3MLUL 4FFYL 5F88A 4M02A 4X9IA 3ES6A 3KR3H 3DVIA 1A6VL 4WW1B 2KL6A 3QR2A 1PEWA 4AY9X 1Q9OB 2H8PA 1D6EA 3G5VA 3BZEB 2VDQL 4W6XB 3PDGA 4GMSH 2D7TH 1T03L 4OZHB 4JHBA 1DQQA 3WN4A 1B3JA 2V5YA 3KYMB 2PYEE 3PGDA 3IETB 1HZHL 3DZEA 1A4KB 4XPBL 4KDWA 4ZPVB 2F8XC 1MOEA 4WO4A 4YDLC 1J10A 2DN7A 4EUPG 5BRZE 1T83C 4LF3A 4N8VA 1UGNA 3QDHA 4PJAB 4K94C 4PJXB 3U4BL 3WIHL 2R56L 2GW5A 4X7TB 2XN9A 4NQTA 2XKNB 2P5WA 5HZLB 4PTUA 4L29A 5FYJL 1AXSA 5F21B 4LMQI 1A1OA 3RWEB 4AIXA 4NZJA 4U6YB 1JPFA 4ENEC 5EUOA 2WP3T 1SBBA 4KJYB 1FDLL 3KPMB 4MB5A 1G7IB 1P84J 3K0WA 4Z7VE 5EZLA 1LE9A 1YEDA 4R6FA 1CGSL 4M5ZH 1I3RA 2BVPA 1G7JB 3UBXG 1QFWL 1DFBL 1A9EB 4XCFH 1KJ2H 5E95B 1QYYA 1AHWC 5CS7A 3ARGD 1WFTA 4U6TA 3OKNA 1XGRA 4FNLH 4LAJH 3PP3H 1J12A 1ZHLB 4DAGH 3LDBB 4WCYL 3MV11 3QDMB 3ESVF 5CJXA 1T80A 2ORBL 1J1OL 5HGGS 5DMJB 5L2KA 3SGKA 2IMMA 3RWIB 3IJSB 3E1F1 4HIHB 4KXZH 3FQWB 4NZTH 2X89D 4YHKL 3CU1A 5K9JH 1R5WA 1YEJL 1CU4H 1LP9A 5J11B 5JXEA 1A1NA 4JN1L 1NLDH 4D8PB 2V9TA 5GGQH 5TFSL 3M8OH 4MA3B 3T04D 2Q3AA 5LWYH 5FUOH 1BD2B 2WIMA 3C6LD 4NNYB 4U1NA 2I9LA 3VE0A 2MJWA 3MRKB 4TZHA 1I7RA 1KC5L 4UDTA 1A7QH 3X13B 4Z78A 3JV5A 4KV5E 3QYCA 3SHSA 3DNKA 4LFHG 5CLWA 5D7JC 4I3SL 4LSTL 3SO5A 2XOTA 2AK4D 4UTAH 1AGCB 3HR5A 5JOFA 1MCEA 1BEYH 1VGKB 1YUHB 4FQXA 1EO8L 4HIXL 3RL2B 3BWAA 5I1KH 2CXKA 3DXAE 2VR9A 5IROA 1F4YH 4QKXB 5CUSL 1S9WA 1G7HA 2MHAB 5KSAD 2HRPH 1NMAH 2DBJA 4A2MA 5EZOH 4JPIA 3MV01 4LNRB 3L9RB 3G6AA 4F9PC 1IKFH 3SJVD 1I1YA 2ZOKA 4KI5C 4XC1H 1IGJB 5KN5A 1D9KD 1YPZF 1NFDA 1SEQL 1KLFA 1PGRB 2IADB 1FJ1A 3LKOB 4JANB 5E1AB 2JB5L 3MLSL 4IJ3B 5CMPA 5D7SL 4OLXH 2X10A 2H26A 3ZT6A 4DUVA 1K3IA 3ILPB 4NQCE 1FFPB 3ARZA 1DBBL 1DQML 3VWJB 3GHEL 4KI1A 5JIIA 4ELMF 2BVYA 3EYVB 5JLZB 4KZEL 4PRAA 3RIFF 2W91A 4MD4A 3RWFA 4HFUH 3OJDA 5JHLL 5E5UB 4DVBB 4KTDH 3DUUA 4UT7H 1AJ7H 4PBVC 2ZKHH 1UJTA 4ODUB 3T2QA 2WQRA 1B6DA 2P8MB 4LLQA 1TFHA 3UYPA 5BW7A 3B6SB 1RSFA 3TYFB 1U95A 4JZJB 5JPNB 1IQWH 4LLDA 1JNLH 4QOKB 3BPLC 4P4KB 1BIHA 3NCEB 1CCZA 3QDGB 2C1OA 4NHUA 2J5LC 5CAYB 1A2YB 1UB5A 5IVXA 2O5XL 3BP5A 2OL3L 5D70L 3EJYC 4NOBA 2H2SD 4Y4FB 2AV1B 1K4CA 1DDHA 4LQFL 4C54A 4ECNA 5DSCB 4ARNA 2IG2H 1R5IA 3O6LL 1DVFB 5HHOD 2BP3A 5LXGL 1HQ4A 2VL5A 4JFFA 3JV6B 3HCVB 3TBSB 2H3NA 3DETC 5K9OB 5CFHA 2FATH 5LJYH 2XRAL 1JIBA 2VLKB 3MRQA 1T4KB 4LLUA 5TGBB 2X4OB 4TSCH 3VG9B 5B8CA 4LDLB 4UT6L 6FABH 1FO0L 2CO7B 4D9LL 4YEBB 1INDH 2VDKH 1MEXH 3LV3B 1UXSA 1DBMH 2DF3A 3RKDC 2MNUA 1U8QB 1E4WL 1M1SA 5DYOB 2DRUA 3MXWH 3C5ZA 4L8SC 1R3LB 3FQXA 3PWUA 5DK3A 1SJXA 3WNLA 2I9TB 1ZT1A 4E41E 4XCCL 3TT3H 4OJFL 2QTEA 2UYLA 3UTSB 3WKML 3MLYL 5FCUL 2OR9L 1KJVB 3D6GA 5FGCB 4TVPL 4PKIG 4S1SH 4PEQB 5DDHA 3TVMC 4FFVD 4XBGA 3G6JF 1TQBB 4ZAKC 1U42A 3TV3H 3WN5A 5DQ9B 1IQDA 3WS3A 1R3KA 4L4TA 1OAKL 4X80L 4YDIH 1M9SA 1OTMA 1VACA 4HMDA 4HUUA 3RI5K 4F80A 3IDXH 4AY0A 3MV8B 1MSPA 1NGYA 2CO6B 3N0PB 4JY5L 4PRHB 3EYFA 3HMXH 5CKAA 5JQ6L 1OVZA 2JB6B 4J12A 4IHOA 3LHPL 2PO6D 2GHWB 4JRWA 4OCWL 3GSUA 2IAMD 2GJ6D 3GB7B 2XYCA 3MNZA 1X7QB 4U6XB 5IP4A 3BRDA 4KJWD 4PV9B 2OX5A 4IIQC 1K6QL 3HC3H 1KNOB 1CGVA 2BVOA 3MLXH 2X5PA 3BHBB 3F6LA 2VDRL 2HT4D 5B22A 2DWDB 5FO7A 1FVDA 4ZFOA 3VXUE 3F8UB 3TT1L 5CP3H 4NQXB 3BD3A 1MFBL 3JB9j 4NKIH 4CC4A 4IRJC 5E8OA 4PUBH 4GT6A 4L4JA 2NXZD 3ZT5A 1S7WA 32C2B 3JTTA 5I18H 3QXWA 4W4OC 4WNQA 2ZPKH 4Z18A 3QG7H 3ARRA 3QIBC 5CJ8A 4JO2H 1UYWH 2EDOA 4P46B 4P9MH 1E0OB 4QEGA 4XP6H 4WIQA 1MCCA 4X5LA 4JFOB 1R3JA 2X4TA 5DMGC 1OCWL 1MJJB 4XP4L 4HLJA 4Z7WB 3AFLA 5D6CA 3VXOA 3QULA 3UJIL 3QUYB 3UYRL 4PGEA 1EK3A 4HJ0C 5TE6L 4CVWA 1KEML 3LD8C 4LDEB 4NSKA 2AK1H 4PJHE 4C4KO 1JP5A 3V2AR 1LO4L 3GGWB 5F9OL 4Y8DC 4LKXA 2VITA 3OKOA 1KPRB 4FTVA 1QBLL 3A0OA 3MCLL 4KMTH 4LPWA 5E6IA 4XRCA 3QCUL 1IC7L 1QFOA 2BNQA 4S2SB 1TCMA 2NXYD 4D0BA 3KJ6L 3T65A 3QUZB 1XCTA 3GJFA 1NGWB 3C09B 3MJ7B 2QQLL 4MWFB 5FV2A 3RDTB 4PGDA 4PRDB 3ABZA 3PWPE 3VFOB 3BKMH 4LLAA 1CQKA 3ALXA 2P44B 2XZCH 4MA8H 2NLJB 1GSMA 3GMMB 4Y5VC 5DMIL 4HS3A 1UJ3C 2Y1VA 4M00A 1VERA 5C0AE 2BMKA 3T4YB 1NC4A 4AQ1B 3QQ9C 4KDTC 1DS9A 1CXFA 4R0LC 1QLEL 2R2BB 1RFDL 4ODTH 4OF3A 1ODAA 1X4ZA 1IGTB 1P69B 1BZ7B 4L3EE 4KK8D 3G04A 3KPQA 3HC0A 1UQSB 2NR6D 4NQEA 4ZNEA 1XFPA 3FQNB 5ABDE 2QHRL 4G9FA 4HBQA 2OR8A 2XWTC 2B4CL 1KBGH 1IAOA 4AENA 3SOBH 4J3WA 5TDPA 5EU4A 2ZUQC 5A2LH 2Q1EA 4D0DA 3MFFA 1GGTA 1ERNA 4I18B 1IAMA 4ZS7H 1ZEAH 1TZGL 3ARWA 3EYUL 1WC7B 3BX7C 2I07A 1ETZB 1KXQE 4HK0B 2HLFD 1JWMA 2VTFA 1KFAL 2W65A 3Q48A 5BOZG 2FHCA 2A1WL 3O6MH 5IB3A 3AB0B 4XPAL 1G9MC 2EZ0C 1KJ2B 1EEYA 3WO4B 1O6TA 1A6TA 1L9MA 3CSYB 2VR5A 3TYGH 1LO3L 4M03A 1YECH 3UN9A 4F3FA 4Y5XA 4LGRB 3QDMD 3SY0A 3CX5J 3G9VA 5FYKD 4QTIH 3EOAB 2EIDA 2BJML 1EJOL 3CH8A 1OSZB 2V17H 4KDVA 5IGXH 4P23C 4XSQA 1U92B 2E3VA 4J4PA 3RIZA 1XF3B 3AC0A 1KGCD 1DL7L 2AKRB 1EAPB 3LCYA 4YE4L 1QFUH 2QSCL 3IDGA 4XVTL 2DDQH 2NPLX 1PW3A 3QUKB 1ZT7A 1P8TA 1I7UB 4KVNL 1BD2D 4D0CA 3QUXB 3V6OA 4WU7A 3T0XA 1MCIA 1T04B 5IFAH 5E8NA 5GZNC 4DEPB 3P3YA 2A74B 4GMTH 4UU9A 1J0IA 1QRNE 4GW4B 1EO7A 1INQA 5KTEH 3RZCA 4CN6A 3ZTJG 2X4QA 3ZL4H 4H88L 2ADJA 5EC1B 5CD5C 1NEZB 3OJAA 2R2EA 4U1IB 3WFDH 3KLHD 5FHAH 3V6ZB 3QRGL 2FEDD 5JO5A 5ESVA 1OB1B 4PGJA 4LCUA 1G0YR 4PLOB 2UVEA 5JTWA 1G6RH 3J7HA 3HE6B 3MACL 2VKWA 1RURH 1I75A 4HQQL 3MFGB 4QHLA 4XB8A 3OF6A 2HWZH 1PKQB 5IMMA 3ARUA 3TZVB 1XIWC 5GRZA 4N9GA 1TCRB 4K9EL 5FO8A 3NCJH 4LPUA 3DARA 2B8OT 4KKLC 4GRLC 2NW3B 5ITBL 4MX7A 2KH2B 4BK4A 3ZKXC 3TF7C 3RAJH 3EGSA 4M7EA 1LO2H 1ZE3C 2Q3ZA 3VWJD 5HYQB 1T1YB 5DFWH 4N0UE 4QXGH 4OTXH 4H26A 1AKJB 1DQTA 2HTLD 2YRPA 1KB5H 4XP1H 4HS6B 3ARDA 1SBSL 2JJWA 3RVWC 4NO3B 5IJCA 4ONOA 5HD8D 1ND0B 3OB0H 2R9UA 4PLNC 4EZGA 1LP9F 4DN3H 1J1XL 3EZ8A 3L5JA 5F7KC 1P9AG 3H0TA 5I1LA 4R2GC 1NCNA 4YXLH 3VGGA 4QOKD 4Z95H 5F6IC 3U2SB 4P4KD 5IMOB 1GHFH 4XOSA 3QDGD 3ZTNH 4OQTH 5I19H 2Y06L 4QHNA 2WFHA 2IBZX 4Y4FD 3B2UC 3ULUL 2F53E 3DYPA 3OG6B 4IMLA 3I9GL 3CFDA 3KLAB 4PD4J 1DVFD 3HC4L 4J6RH 43CAA 1DUZB 5A5CA 5LGHH 4XB7A 3ZE1F 5F3HB 3U9PH 3WDIA 2F74B 3NZ8A 3SGDI 3OR7B 4RGOL 4LASH 2VE6A 3SGEH 1HK6A 4LPTA 4XVUD 1T21A 3RL1B 4M5YH 5IKCB 2VLKD 2XZAL 1IVLA 4MNQA 2FJFB 3O2VH 3S5LA 1NFDF 3S35X 1AY1H 3ZZ1A 2HTKC 1H3VA 3KPLB 2CA6A 1BJ1H 5GGSB 1NDMB 3BPCA 5KAQF 4GXVH 3BISA 4WU5B 3VA6A 1C5CL 4M8QA 1RZKC 1FL3B 1YZZA 2QV2A 1U8OB 5SWSB 2YBRB 4F8TA 1VGEH 1B4JH 4OB5L 4YBHA 4M93C 5MEQB 3UTSD 2R0WH 2HFFB 3HUJA 5CBAA 5ERWB 1OLLA 2K9UA 4D9RD 1KCSL 5I8EA 4CMHC 1AC0A 2DQTH 4PGBA 3UTOA 1N5YL 4JAMB 4G8GB 4XMLH 5C0CB 3VXMA 3MROB 4KKAC 1MFCH 4Y19A 4JFHE 2OJZH 5FYKL 4P2QE 4OFPA 5E8PB 2XZZA 5CEZE 3QAZB 1HDMB 5E2VH 5I74B 3MV8D 2XXCB 4XWGH 4PRHD 3B5GA 3RY6A 5CZXC 2E5EA 2FBJH 5L2JB 4PJCA 1WWAX 1T0MB 5D1XC 5DLML 1MFEH 4PRIA 4XNXH 3KLSA 3QEUB 3P0VL 2VXTL 3R4DA 3D2UA 5ITFA 3WNPA 2AJXL 1MLBA 3WN5C 1KIPA 1NMBH 1FZMB 4UAOB 5IVXF 1CR9L 3HNVH 1LGVA 2KBGA 4HJGB 5DGQA 4YR6B 5HY9A 3VXSA 4NKHA 3OGCA 1M7DB 4MXWH 5E4EB 1WZKA 2ZOLA 2CIIA 4NRYA 3IDUA 1SQ0B 4PLJC 2CQVA 4KK9C 4IOFC 1T1WA 1N2RA 2I5YL 4NC2B 3NH7H 5KSUB 1GIGH 5FDYA 1JHTA 4XHJC 4GUPB 4D9QD 3L6FB 4YO0B 3PIQB 3TN0B 5B4MD 4C57C 4P46D 1S8DA 3CDFA 4LARH 4NQUA 4ONGL 4H5SB 5I1DA 5MERA 3T3MF 1JPSL 2VB5A 3QUYD 4XNMA 1EDQA 2A0LC 3CMOH 4WFGD 4PRPB 4ONHA 1KT2B 1J86A 2JE0A 3EAKA 3GIZL 2J6EH 4L4VA 3QH3B 4JQXC 1OF2A 1C12B 1CFSA 1OOAA 1CLZH 1F8TH 3S36H 2GAZB 2E8YA 4OD2B 1P8VA 3W3LA 4YBLC 1LILA 4HKBA 3MR9A 2EDWA 4ZOCA 3INUL 1OD7A 2Y7QB 2EH8H 5JOPD 1QRNA 5DFTA 4M1GH 2MQCA 2GSIB 4M7ZC 1RUQL 4LLMA 5JQHC 1U8PB 4OM0H 4ZO6A 2MMXA 3QUZD 2FB4L 1NCDH 1KTLA 4DGYL 1YMHA 2WUCH 1RZJH 1JWSB 3QXVA 4P59L 4PGCA 5ID1A 3EBAA 3RDTD 3O4LE 5IESL 1JZ8A 5JPMB 2VLLA 5C71A 2NY2B 3MJGX 4IDJL 4RAUA 5J1AB 3E2HB 4GSDH 4UMGA 5BZWA 1B9ZA 3WPIA 3VWKC 4PJBA 5E6IC 5HTSA 1JN6A 2ZNWA 3P30L 3BESR 4M9OA 1A14L 1U3ZA 1LEKA 3BH9B 4GS7C 2APBA 5CGTA 1QSEA 4N68A 3CVHA 4UQ3B 1QSFA 3HG1A 1BP3B 3MUGA 2VQUA 2MOVA 5HYIA 5K9QG 1JF6A 1FVCA 1HH9B 2FH8A 1F45A 1G7MB 1LVEA 3PL6B 4KAQL 2VDMH 1S9KC 3VFNA 2XFXB 3VFTB 3MJ9L 5I17A 2Z91B 4HCRH 1KELH 4K17A 1ZT4A 4HXAH 1MCSA 1HNGA 3HZVA 1FCGA 3R1GH 2H41A 3L95A 3V0VB 1FYTA 1OSPL 1Y6NR 3OAYK 4JY4B 1NKOA 1ES0B 2C26A 2DQDL 4Q2ZA 5EOTA 1PYWB 3MREA 3TA3C 3P11L 1E4JA 2ICWA 4BUGA 4BZ2L 2B0SL 3MV9A 1HHIA 3O8XC 5HI3D 4NM4H 3ARSA 1TJIL 3GNMH 3BKJH 4AT6A 4XVSH 4YFLI 5J57B 1IM3A 1CICA 1FZOB 5IB2A 4P5TB 3OGMB 4ZUSA 3QIUA 4KV5F 4KZDL 1MQ8A 5DWUL 1KJ3L 5SX4H 2A6DB 2VQ1B 3UJJH 2X4SB 1OAUL 1YN6B 1BAFH 3RJQB 3W5MA 4RAVA 2BNRA 3C87A 1H5BB 3AAZA 4I77H 4OD1L 1BWMA 5AWNL 8FABA 5FUZL 3WHXA 3FFDA 4YDLB 3BZFA 1HSAB 2DMBA 3OMZA 2WINB 3GSVB 2VZ1A 3ZO0A 1FGVH 3RWCB 1G9UA 2VQTA 4LU5L 3MRNA 4HH9A 3U9UB 3QUXD 5IQ7H 4X4XB 4I48B 5DUPH 3GBMH 1MRDH 1A6WH 2A9NL 1ZS8A 3PHSA 2EYTB 1FE8L 3IYLW 2CLRA 3AMLA 3MOBL 4DQOH 1X5IA 4NQDB 4YXKL 1CFBA 1JTOA 2ERJC 5EN2A 2IPTH 4I0PC 5DJAA 4C83B 1A6AB 4TVSa 5IJVA 4HIJA 5CSGA 1MCQA 1LDSA 1EGJL 5DMKB 2I60H 3MA7A 1YEGL 4D2NA 5C09B 3T0DA 2FX9L 1RZ8A 1E4KA 1NJ9B 3HE6D 3QFJE 4YC2C 4DFIA 3OKEB 1TVDA 2AK4E 1YPZB 3GO1H 1MHEB 2JJSA 4XHQA 1W8OA 3S98A 1QR1B 3T2OA 3OXSB 3TZVD 1C5DB 4DCQA 2X70A 2LAGB 2IBBA 3UBXA 1MQKL 1MIMH 4C2AB 1CVRA 1GOGA 2AV7A 4U3HA 4U1MA 2J3SA 5EO1B 4OKDA 3VXPB 1T0NB 5T1KA 3BE1L 2CGRL 4Z7QE 1RIVL 1TJHL 1JL8A 5BZDB 4H25B 3O45B 4CAGA 4BSWA 1A7NL 4G8FB 2GK0B 3R0MA 4X83A 5GS1A 3VW3H 4S1RH 2O93L 1NUNB 4P5KB 4LXRA 3SJVE 4MXQC 3MODH 2AJVH 5GQRK 5FDWB 1KB5B 2XQBL 3QIWB 1AKJD 1F4WL 3EIFA 1DSFL 3H3PL 5MP6H 4V2EA 1ITCA 3NAAH 5EIIB 1MPAH 1T5XB 2NY0C 2ZSWB 5IBTL 5LG1A 5F71A 4RX4A 2Z93A 4XAKD 5TE7L 3SO3B 3MRDB 3WNOA 2J8OA 4M7EC 1P7KA 3GBLA 1A02N 1N8ZA 4HC1H 1M7XA 5DF0A 3WUWG 5GS0A 5GISL 3MBEB 2X4UA 3VI4E 3WV0A 5JHDA 1HNFA 4EQ3A 5F93C 1RJYB 1H8OA 4FFWD 3SE9L 3IU3A 4TTDD 2HYMA 4UV4L 2QL1A 1F6FB 1HQRA 1HOCA 5ESQA 1G0DA 5CBEA 5I15H 3C5SA 2HH0H 4R90H 4CJ1A 1F58H 5I6XC 2P8PA 1XF5A 2Z35B 3CXDH 4PPTA 5K59E 4K8RL 3VDBA 4GAJL 1R5VA 4HEME 4M8VA 3SE8L 3BQUA 2L7JA 2OTWB 2W0FA 2NCMA 4FZ8H 3ZDXF 2MPAH 2CKBA 2DM4A 2A77L 4POZD 2ICWJ 4RRPG 2VDPH 2A6KA 3MRFB 5IEHB 3BZ4A 5F1OB 1I1FB 3PP3K 5HHOE 4ZUTA 1ITBB 4PIRF 1S7TB 2CRIA 3CDGA 1V5JA 3LEVH 3U4AA 4ZNCD 5LAXA 2A83A 1K5NA 1IEBB 1BZ9B 1EBPA 4HUWA 4HZLA 4MJIB 2DWEB 4HXBH 3T77B 1RMFH 4XXCC 5MENB 4QXTB 5KANG 5SWSD 3DO7A 3G6JB 3BO8A 2YXMA 3BKCH 1IGIL 5TQ0L 1GVIA 2NNAB 4R26L 3CXHJ 2OI9C 1RZFH 1MCLA 5J89A 4YFDB 3BIKA 1SMOA 4G8GD 3EKCA 5EU6B 5DVNA 5C0CD 1NUGA 2WBJD 5FA4B 4YHLH 4DVRH 5CCKH 4XBEL 3CSGA 4GXUM 3OKLA 4LCCC 2VXQL 1MFAH 4RA3A 4G6KL 5BS0A 3BW9B 3MBXL 3PV6B 3BP7A 2ITCA 5GGQL 3M8OL 5B0NA 3IVKB 5FUOL 3F7YA 3KPRA 3KJ4B 4LIQE 4JO1H 2E27L 3K1KC 5F6HJ 1A7QL 3L7FA 3RU8L 1FFOA 2CRYA 4TTGA 1RIHL 1U3HA 5IFHH 1JGLL 1F3JB 4PJGA 3DIFB 4OZFG 3BUYB 1WZ1H 2Z31C 3HI1B 4X6BB 4LVHC 3DV4B 4MDIA 3G9AB 4L8SB 2GJ6E 3ARBA 4KGLA 4UT9H 1BEYL 2Y9RT 1NMCC 2BXZA 2E6JA 2WQXA 35C8H 4NN5B 4PY7B 3IJYA 5H35B 3EOTH 4YAQA 3X3GH 1UM5H 2GJZA 5IOPB 1U0QA 5I71B 1S78D 1QD0A 5AWDA 1NMAL 1ZKAA 2EO9A 4U1SB 1EPFA 5IR1A 4P2OA 3TN0D 1QLRB 3ROLB 1OPGH 4DUXA 2P7TB 4P4RA 3CH1B 2FBOJ 5C9JB 1BFTA 3B9KA 3TJEH 3FRUA 4TSAH 2BZDA 3QXAA 1WBXA 2HFGH 1HI6B 4JM2A 5H37G 1EXUA 5KW9H 4JFYA 4X5XA 4CVUA 1PJ9A 2Y72A 4O2EB 4RWYL 1QBBA 2B5IC 4DZ8A 1GZPA 3HS0A 3J8F7 2OR7A 5IVZA 3ARGA 5DT1H 3V0WL 2DQJL 4PRPD 1MCOH 4OLXL 2XY2A 1A6ZA 2BHUA 1FIGH 3HKFA 3LQAC 4G8IA 3W39B 4IIQB 1B4RA 4NWUH 4LL9A 3HUJF 4NWTL 4Q6IA 2K1MA 4OT1L 4HFUL 5E99L 4QO1A 4XNQA 5IV2A 2F54A 2M8XA 4LCWB 4KKCD 2ICES 3L3IA 3CFCH 4MCZA 1OW0C 1GC1H 1CD0A 2E7MA 3KPPA 1WSST 3BEWA 5DEGA 4F7TA 5BV7C 4LVOC 2EEAA 5CJBA 1S7QA 2XICA 3H9HB 2FYYB 3ULVL 2X1QA 4PJCF 5T3XL 4OGXH 4MAYA 3QG6A 4G9DB 3FTGA 2JIXB 2EEBA 2NY2D 1IM9B 3GKWH 3SKOA 4ZUUA 1U36A 5DD1L 3QSKB 1CFTA 5DGRA 5D2NE 5DJDB 1K9TA 3LD8B 1X4YA 1OP5H 3IKCB 1S7SB 2IG2L 2P5EB 4XCEB 4OV5B 1JRHH 3HB3C 2LTQB 4PR5A 3MLZH 1EUTA 1DFJI 5EBGA 4I2XB 2VJXA 1YQVH 1F6AB 4U1JA 5JMRA 1UCBL 3PL6D 3WS6A 1F4AA 5C0DA 1FBIH 3DGGB 2YUXA 1QLFA 2CKNA 5DC9B 1WAAE 3WPDA 3CCHA 1VKXB 4RDQG 3C2SA 5GGVY 1VENA 3U46A 2VC2H 1EEZA 3DROA 1YYMH 3DRQB 1JK8B 2N7BA 4GW1A 1YNLL 1KPVA 4LSVH 4OZHE 4G42A 1TJGL 4APQB 3V52H 4M48L 5J1TC 2VDKL 3MGOA 3UP1A 5IJKA 4YX2L 2IH1A 3RVXC 3WJJA 5FOBB 4PJAE 4PJXE 1MIEH 1XZ0A 2D03H 1OAXH 3SN6N 4P5TD 4YWGH 4GQPH 4UDUA 5J6GA 2BVEA 1QZ1A 3H9ZA 4AM0A 1FV1B 1TPXB 1D7FA 1T1XB 4AG4H 4PJEE 2F8OA 2V2WA 1MH5A 4JN2A 3TV3L 3DURA 2H32B 1LK2B 2GTWB 3GJFH 4FXGA 4QYOA 4YHNB 5DD6A 1GCFA 1XECA 1N59A 5F88B 4RISH 5L8KB 5A1AA 1DUYA 3ES6B 2Y07L 25C8H 3SDDA 2ZNXA 2CD0A 1A7PH 5DUBA 4CDHA 4DZBA 5GGVH 1IJ9A 2H8PB 1OGAA 1D6EB 1NL0H 1JZ3A 2M1KA 3G5VB 1KCUL 5C9KA 4XZUA 3QDME 3HC3L 1LEGB 2ZUQB 4F58H 5J12C 3KXFA 1ZWIA 1DQQB 4QRPA 5FYKE 4ENED 4MS8D 1Q72L 4UUJA 3PGDB 2BRRL 3FHQA 4TUKL 5CLTA 4GRWH 4B0MM 1KGCE 3VRIA 1Y18A 2VDNL 4BM7A 4WO4B 4NQDD 1D0BA 1RJLA 2DICA 1ZTXL 4LF3B 1A9BA 4N8VB 3D0VA 5D1ZA 4I0CC 3FRPA 4LOUC 3TNNB 1GGIH 1I1AC 2XN9B 1BD2E 2DKSA 2P5WB 1B0GA 1YEFH 4PTUB 4ODHH 1T2QL 4L29B 3FB8A 1A1OB 2EDJA 4JO2L 1JPFB 4JEGB 5C09D 2BNUA 3O9WC 4MJ6B 4P9ML 4EIZC 4XP6L 5EUOB 2ZUUA 4GAGH 4YJZL 2VXSL 4OCLC 3C08H 1VESA 3NBNA 3F58L 3Q2CA 3A6CH 5FHBH 1VFBA 5EZLB 5IVOA 1LE9B 1YEDB 3VGBA 3CFJB 2EDDA 1JHLL 1I3RB 3K2UL 4IBLT 1E4XH 3LSOA 3LS5L 2FHBA 5DHXB 4ZUWA 2YWYA 4DGVH 2K7QA 4GKSA 4QBZA 2PXYA 2ADFH 3AGVA 3OKNB 1GZQA 1XGRB 3IRZA 5EU5A 3VRLE 3FHAA 2FWOA 4Y4HC 3GMLA 1AR1D 5E03A 3VH8A 1X5KA 3FN9A 4CU6A 3MUJA 5E70A 5L2KB 5DJXA 3TO2A 4RMQA 4Q0XL 2Z4QA 4WV1C 1VPOH 2DM2A 3QIWD 4F2MA 3DHMA 4KMTL 4NFDA 4BH7A 1BVKB 1RY7B 1R5WB 2ARJQ 1LP9B 1QNZH 1A1NB 4CU7A 1T22A 3W9EA 5IF0B 1J1PL 2V9TB 4JREC 3GMOA 1HN1A 4M7KH 4U1NB 3VE0B 2I9LB 3THML 3OX8A 5BXFA 3NVQA 1I7RB 1B0RA 2R0KH 4UDTB 2O5ZL 4B41A 4Z78B 3QI9C 1T2XA 3MBED 3KPNA 7FABH 4Q9RH 2YK1H 4LHUA 3HR5B 4MD0A 1KN4H 1P5VA 5I8OL 5JOFB 4JY6B 4FQXB 5FGSA 2O61A 3BWAB 2P1QB 3GMQA 4ODSH 4XMPH 1AR2A 1S9WB 4WDIA 1O6SA 1G7HB 3ARFB 2QQKL 2ZUTA 3I50H 3BN3B 4JPIB 4E42A 3S88L 1RUAH 4QOKE 3ZE2E 2D9QB 2BSTA 1FS2A 1LEIA 3B4NA 1JGDB 3QDGE 1I1YB 2ZOKB 2ITDA 2F58L 2X1PA 1KBGL 5KN5B 5HYSG 3SOBL 1FJ1B 2V5TA 1BIIA 3QWOA 1OD9A 3RGVA 1S7VA 4WI6A 2H26B 1I3GH 5LVEA 5I8KH 4TUOA 2QBWA 2RQ8A 2YD4A 4TNVF 3LRSA 4PRAB 4MD4B 3RWFB 4MJID 1HXMA 3STZA 3OJDB 5MEND 1I3VA 3GBNH 2VLKE 1L6ZA 1RQ5A 3DUUB 4P5MA 1DCLA 2DI8A 2W92A 3VFSA 3WLBA 3TYGL 1QYGL 1UM4H 5EORH 1V05A 5KSVA 2CRMA 4PGZA 3JV4A 5EU6D 2P1PB 4LLQB 3T08A 4JJHA 4HUVA 2WLYA 1U95B 3MXVH 2APFA 3U0WH 2H9GA 4LLDB 3CLEH 5DHVA 1DLFL 3EFFA 4KK5C 3UTSE 4K94L 1QFUL 1YC8A 5FGCE 3S96A 2XZQH 2EE6A 4DWHA 2C1OB 4D9RE 4NHUB 4OLYH 1UB5B 5IVXB 2LU3A 3BP5B 1T89C 3NCBB 4U6VL 1CLOL 1DDHB 1K4CB 3BJLA 1QHPA 3P9LA 1R5IB 4OLEA 2B1HL 1NGPH 3MV8E 4GMTL 4PRHE 1I85C 1WFNA 5EOCL 1NANI 1HQ4B 2VL5B 4JFFB 5KTEL 3FMGH 3ZL4L 1I8MA 3FQUA 4JG0L 5DK2A 4R6JA 2H3NB 3WFHA 1CGWA 3LPWA 4LSQL 3WFDL 4HD9A 3MRQB 4LLUB 4XNUL 4FQQB 1BQHG 5B8CB 3RX8A 3RIFK 1LDPH 1J0JA 1UXSB 1NANH 1EVTC 2GIYA 5DQDL 5EBMA 4GFTB 3C5ZB 3FQXB 3PWUB 1G7JA 1VFMA 5AG8A 4GG6B 3C5JA 2EDRA 2ZCKL 3CLFH 2UYLB 3RY4A 4H20H 4D9QE 2DI7A 4WY7H 1UACH 5F9DC 1G1YA 5DDHB 1JJUA 4XBGB 2LQRA 4HX1A 3SCMA 1ZGLP 3DSFH 4P2OC 3U7WH 3TP4A 2QR0A 1IQDB 3NZHL 3HAEG 1R3KB 3E6FA 4L4TB 4W81A 3RGXA 2J2ZA 1VACB 4Z7WE 4HUUB 4OSUH 2YN3A 1JHKH 3RBGA 1NGYB 1UVQB 3EYFB 4LCWD 4WFGE 4PJIA 1KCVH 4IHOB 5F9WC 3TLRA 3GSUB 1LO5A 2NZIA 2A73A 4MA3A 4MLSA 3ARGC 4KT1A 1RK1B 3S37H 5F7EH 2H1PH 1PG7H 2Z63A 3BD4A 1MCPH 4DN3L 1NBVH 2MCG1 3V4PH 4HH8A 4Q3IA 3VD5A 2BVOB 2W60A 2JIXD 5JOPE 3TIDA 3PABB 1ZLWH 4YXLL 1WICA 1IM9D 5FO7B 1FVDB 4ZFOB 4MMZC 4ZOEA 4ESKA 3LB6D 5C0JA 3BN9D 1W0VA 3RL2A 2PR4L 4PJGF 2B1AH 5E8OB 5I19L 5JA9A 3C6LC 4NZRL 1RK0A 4PQ8A 1A7RH 1S7WB 3JTTB 4NCC2 4PREA 2B2XH 4PJDA 2DMKA 2P5ED 5EZIH 2EIZB 1D6VL 2K3TA 1R3JB 2X4TB 4QF1A 5B3JE 4LASL 3DECA 5D6CB 3VXOB 3QULB 3MRHA 1YNKL 1AFVL 4PGEB 3B2VL 4EN3A 5JOEA 2YSSA 3F7RA 4NSKB 4MZ2A 5KSAC 3MUY1 3N1MC 4APQD 4PJFA 2EDXA 4RZCA 5CP7A 2Q87A 5E24E 4LKXB 2VITB 3OKOB 4U3CA 4GXVL 4FTVB 4CRPA 1F42A 3WS6C 1XEDA 4M6MH 1XF4A 1CG9A 4DJMA 1D9KC 1P4IL 2WIIA 4U31A 5L88H 3TC9A 1N4XH 4ZQKA 5E6IB 4XRCB 4HUKB 3MRGA 4K7PH 2E7CA 3QZWB 2BNQB 4D0BB 1NCBL 3T65B 2DQTL 3UDWC 1XCTB 4M62H 3GJFB 4U6HA 5F8QC 5T3ZH 1RI8A 4Y2DA 4ORGA 1CE1H 4HT1L 1XGPA 1G7PA 5E6ZA 5GRJL 3ZE0F 1HIML 2BX5A 1KIQA 4N8CH 3JBG7 4HAGA 4Z0BL 4XWGL 2F5BH 4NOFA 3RI5F 3B83A 2CSPA 2YZ1A 4WI9A 4HS3B 2P48B 4XNXL 4U0RC 3FN0L 2OSLA 3WYRA 2BMKB 2WWKO 4PJ5B 1NC4B 1NMBL 1IEAA 3HNVL 4XNYH 1BZQK 1YEIL 5TPWH 5DJ8A 3TPKA 4YEFA 3CVHH 3EYQD 1K5DC 4MXWL 3MC0A 3HCVA 5HVFB 2CMRH 3H9SA 3G04B 4WO4D 3HC0B 4UIKH 4EBQH 1U9KA 4NQEB 1OT2A 4G9FB 1WTGT 4KHXL 2H2SC 3B9AA 2XN9D 1IAOB 4AENB 4HMCA 4QTHA 2P5WD 1P84K 5TDPB 4H1LG 3MYZA 5EU4B 1SM3H 3U4EA 3MFFB 2W0LA 1M10B 4GO6B 1HHKA 4U1HA 4JPKH 4RWTC 1KLGA 2I07B 5SV4A 4XTRD 1HHHA 4LSXC 1RZ7H 2NY5C 1JWMB 2W65B 3WPGA 3S3PA 4A6YA 4XNZC 4GXUN 5IB3B 5DJCA 5GMFA 3VI4F 2Z62A 2K7PA 3L3JA 2PNDA 3ZDZF 1PEZA 1A6TB 3B8SA 5AUMA 4K3EL 4PG2C 5FKAA 3S36L 1K85A 5D1QA 1JPGA 4Y5XB 3LMJH 1FQVA 3SY0B 4LEXH 1PKQE 5L2KD 5HHXL 3UO1H 2Y5TA 4M7LL 1ORQA 4M1GL 5DA0B 3EDDA 1PBYA 1F90H 4G8EA 2EH7L 1X7QA 4FFVC 5JXED 3JUYA 4R5DA 5K59F 4RCWA 5I73C 4IM8A 2PXYC 1NCDL 1QKZH 3WFCH 1ZT7B 2XNAA 1L7IL 2WUCL 1MI5A 2EC8A 4K3HA 1D5ZA 5E8NB 4P9HH 4Y4KB 4NP4H 5T33H 1PSKH 1OAYH 2VSDA 4UU9B 3JZ7A 5DRWA 4EUPH 3RZCB 1INQB 2YPVH 2IAMC 1I8KA 5I75C 1MCWW 2X4QB 4XAKE 2ADJB 3U83A 5SX5K 4FQXD 3WUZA 4KJWC 1A0QL 4WHCA 4L1DA 2APWA 3OJAB 2J8UB 2R2EB 4NHCH 1MHPH 4YHPA 4QHKJ 5JO5B 5ESVB 2QJDA 4FQLL 3QWRA 4LCUB 5DMYA 2HT4C 3ARFD 1DP0A 3FO9A 4JFOA 3SDXB 3FOMA 2BVQA 5EWIH 3BZ5A 1LO0L 4QHLB 4L8CA 3A79B 3RVVD 5IMMB 5L8JB 2NXZC 4FQJH 5FO8B 3KDMB 5BQ7A 2EDYA 2AJUH 1WV7T 4RCAA 4Q9QH 4CVXA 2NY0B 3PHOA 4L9LA 4MX7B 4WI2A 3EGSB 3N06B 1KPRA 4YUEH 2FGWH 4ZUVA 4JPVH 2VKXA 4LVNC 4XVSL 4O58H 4HGMA 5T5NF 1X5HA 5TF1L 4KNGA 1FL5A 1IGYA 2ARJA 2V2TB 3RGZA 3NACL 4H26B 5AD0B 4CNCA 4XVJL 3U6RA 1P4LA 1JFQH 3ARDB 4OCSL 4LSSL 5JA8B 1KSRA 3G08A 1W2KT 3L5XH 4R6UA 2VLJA 3IFNL 3ZKMD 1DN0A 2R0LH 4C2BB 3WUWA 3VFOA 3H0TB 5I1LB 4JG1H 4WUKH 3GMRB 5F70A 1SY6L 1SMAA 5GS0H 2FX7H 4JFZH 5GRWA 5SWSE 5E5MA 2P45B 2BXYA 1HHGA 2RCSL 4ZG1A 1RVFH 2NXYC 1IBGL 4M6OH 3V6FA 1GGBH 5GMHA 2DIBA 1DQDH 4G8GE 2D7MA 4QHNB 5C0CE 3T2NH 3V4UH 1S7RA 3VFGH 3KPSB 3HZYA 4IMLB 2EDBA 3CFDB 3QXUA 4N8PA 43CAB 5IHBA 4JFFD 3RZWA 3IJHA 2CLVA 4PB0H 3NZ8B 1M05A 2VE6B 1YMME 1G9ML 2ARWA 1T21B 2CKBH 3FCTB 2BNHA 4RMRA 2OK0L 3QT2A 4K23L 4MNQB 3U30B 3NIGF 3D25A 3WEXA 3S5LB 2IH3A 1DZBA 5GGRY 1VB9A 3O3UN 2NTSP 2YC1A 2ENYA 5AWBA 4KK8C 4F9LA 2IPUK 3BPCB 1FPTH 4HS8L 5E2WH 4CNMA 2NR6C 5C0GB 4ISVA 4M8QB 4JB9H 2OMUA 3C5ZD 5AYUH 2XTJB 1MVUA 4IOSD 1V7ML 3WXVL 2HT2D 1A3LH 3HI5H 4FG6D 3ZDYE 3HUJB 3EUUA 5CBAB 2XXMB 1EBAA 5D71L 5I8EB 4PGBB 1RUKH 4UTBL 2ZUXA 3IT8D 4I9WE 3VXMB 2RR6A 2OP4L 3VI3E 4Y19B 5KVEH 3MODL 2HLFC 2VERN 4L4TD 1ZHBA 2EE2A 1ZVHA 1OAZH 4HPYL 3DYOA 3PGCB 3GRWA 1R3IH 3NAAL 4E9LA 4PRPE 4C4KT 3TPUA 1NMCB 3PXHA 4PJCB 4CBPA 1JMZA 3V5KA 4PRIB 4WEBL 3LDBC 4BQBA 1WAAF 3D2UB 5ITFB 3SGJA 4BUHA 1FH5L 1MLBB 3UTZA 1KIPB 4JFDA 2E7LA 5HY9B 3VXSB 2QQNH 4NO5A 3OGCB 2AI0H 2JJTA 2X4NB 1PLGL 1RIUH 2EE9A 2CIIB 4NRYB 4WWID 5J11C 3DTXA 2DQIH 5D72L 4EXPX 3TSRE 2WUBL 4QRSA 4U7MA 2OMXA 2YD3A 2WWMD 3H9YA 5C0RH 1T1WB 4V2CA 1MJ8H 1N2RB 2DL2A 1A6PA 4HLZG 1FFRA 1M6OA 4R90L 5CJ5A 1TNMA 1T6VN 5DUML 1JHTB 3CXDL 3UL9A 1Q8MA 3VRJA 1U3YA 1S8DB 3N50A 2P1MB 4K2UL 1MJUL 5I1DB 2DD8H 3MLRH 1I9RL 3W2DL 2FZ3A 4OQ1A 1NCAL 4WEMB 2VMFA 3A6BH 4G7YL 1IGMH 4KJPD 3KLHC 4UBDD 2DQEL 4XNMB 2NW3A 5HVHB 2FEDC 1TLKA 3QQ3A 2RFXA 3V5HA 4ONHB 5BOPA 1FNLA 2W9EH 3B3IA 4I1NB 4LVOB 4WENB 4L4VB 4RFOL 3ARVA 2Q8BH 4Z61C 1T1YA 1CFSB 1XH3A 4FTVD 4G5ZH 4HKBB 3MR9B 1BFOA 1X6LA 4ODBD 4FQHA 2J88L 1DBAL 3FXIA 4L5FL 3WCYA 4LCIH 4IJ3C 3EO9H 5HYJA 5E6ID 1XMWA 4R4ND 1ZLUH 1JF5A 1ORSA 2DM3A 3OJVC 2BNQD 4LLMB 1RZFL 5L7XH 4LLVA 4UQ2A 2ZUYA 3BGMA 4OFDA 1ULVA 3MV7A 5IYXC 5TE4H 1KTLB 3VWJC 4MQSB 3MNWA 1DN2A 1YMHB 3Q6GH 4K3JL 1BQSA 4LPXA 4PGCB 5ID1B 2HTLC 3GSNH 1V3JA 2VLLB 4E0RA 3Q5OA 5DEZA 2HKFL 4J3OC 4ONFL 3CK0H 1UEMA 4QRTA 4J4LA 3LOWA 5BZWB 4YLQT 4ZSOE 1I3UA 4PJBB 4TSBL 5CIPH 1BECA 1R6VA 1JN6B 1IE5A 1LK3L 5ICYA 2VDLH 4AMKL 4PJ5D 1NC4D 3TFKD 1QSEB 1XGYL 3CVHB 4Y2DC 1MF2H 3DX8A 1QSFB 3HG1B 4HPOH 3MUGB 5DEFA 3V95A 1MNUH 1FVCB 2LABA 3OJ2C 1URLA 4PJDF 4ZS6D 3QDJA 1RZKL 5I17B 3VRLF 2V7HA 5DJ6A 3VCLA 4NQED 1F4XL 3K8KA 35C8L 4G9FD 1HWHB 3HZVB 4Y4FC 3L95B 3L5WA 3SEPA 1N6QL 1FYTB 3IFPA 4GAYA 3X3GL 5BVPH 2Z9TA 1UM5L 4MXVF 1DVFC 3QUMA 1HKLL 1FC2D 4X5WA 5EOTB 1D5MA 3MREB 5HYFA 2R39A 1OPGL 4OD3L 4HWEL 2ICWB 3OKKA 1H0DA 1IRAY 2KDGA 3MV9B 4NQDE 4J23A 4TSAL 3KS0J 4PJFF 4AT6B 5I1GH 2WW8A 4XGZA 5KW9L 1IM3B 3UTTA 1CICB 1TVBA 2YPLA 3CX5K 4XVUC 5IB2B 4JRYA 3WIIH 4LSDA 5TDNA 3QIUB 4MB4A 1T66D 3VG9C 1Q0XH 3S7GA 2FX8H 1FIGL 3IU4H 4G8GA 5C09E 3GDBA 3H42H 1PX3A 3RX7A 1TETH 1YPZE 2BNRB 3AAZB 5M95B 3HMXA 8FABB 3VFPA 4QHMA 2W9DL 2GQHA 1FSKB 4GOSA 3FFDB 4J4PD 3BZFB 3T0EA 2IFGA 5E9DA 1I8LC 2IQ9H 3AU1A 3ZE2F 2WNGA 1TQBC 2OL3A 4Y5YA 1OP5K 1EFXA 3TH3T 2FEEI 4F8QA 4F15B 3MRNB 5FGBC 5D1QC 1HYRC 4HH9B 2PTUA 1E6JL 5SWQA 5DZOA 1DANT 4Z5RA 4GG8A 2N56A 4Z8GA 1KYOJ 1ZS8B 4F37F 2CLRB 5DTFA 5IHZA 2G60L 1WQVT 3HNTH 4ZFOL 5EN2B 3RZCD 2R15A 2CUIA 5LCVL 5JIPA 1FNEA 2VDOH 3MYJA 3SE4C 5DJAB 4FP8H 3T8XA 1FZJB 5IJVB 4HIJB 5KSUA 2COQA 4JHWL 1NEZG 1L0YA 3L6FA 1JRHL 3O2DA 3TN0A 1NCWL 3MA7B 5F96H 1FRGH 4Y7MA 3VFRA 1NSNH 5D6DA 1YQVL 3UZVB 4H5SA 1JTPA 1N6VA 3BP4A 1V8HA 5HDBF 5EO0B 4ZXBA 5L0QB 2NY7H 4U33A 3LRHA 2VC2L 4DCQB 1RHFA 3LKSA 3UBXB 4G6JL 1OZNA 2DQCH 2AV7B 3H3BC 4U1MB 2NY0D 1L0XA 5T1KB 1YNTA 1HH6A 4P46C 3GJFK 4PG9A 5IQ9B 4BSWB 5KVFL 3S9DB 3D9AH 5GS1B 1WWCA 1IC5H 1A3RH 3EYSL 4J3XA 3QUYC 2GI7A 1OAXL 1J5OH 4EDWH 3ARDD 3KPOA 2DQHL 4X4MA 4FRWA 4P2CG 2Z93B 4L9LC 5CEXA 1CZ8H 3P0YL 1FQ9C 5E2UH 1P7KB 2QADB 1N8ZB 3VDCA 1OT1A 4MJIE 2Z65A 3OB8A 4PS4H 1VADA 1ZOXA 5DRNA 2X4UB 5MENE 4WTWA 2R1WA 1U8MA 1AD9A 3G6JE 4QXUH 1JGVH 4PD4K 5FB8A 5JHDB 3ZTJH 3JWDH 1AI1H 3CSBA 3PJSA 4FQ2L 3QUZC 3IU3B 4R97B 4HJJL 1HQRB 5EU6E 1HOCB 5ESQB 4U1GB 5CBEB 4DK6A 2YWZA 3MOAL 4P2RA 2VXVH 5DJ2A 1W72L 3P77A 3RDTC 3C5SB 3KPSD 5EIVA 1HH9A 2P8PB 4YDJA 5JNYA 1XF5B 3BMWA 1EMTL 1IILE 3LN9A 3VFTA 3LKRA 1R5VB 1JL5A 3UL7A 2CDEA 1G84A 3BQUB 2W0FB 1GGIL 1JNJA 3AY4A 3LVEA 2CKBB 4M1DH 3OZ9H 4UZGA 1S5IH 1YEFL 4Z7WF 4ODHL 3QXTA 4MNQD 2A6KB 3VDAA 3BZ4B 1IKNA 3S37X 5B39G 1M0ZA 4ZUTB 1PG7X 5HHMB 3CDGB 1B0WA 1IAIH 1HWGB 1WITA 4Z8FL 5LAXB 1C5BH 2A83B 2DQGH 2LVEA 1K5NB 3BUTA 5FCSH 4HUWB 2ASSB 4HZLB 4P5TA 1DBJH 1HCFX 3F65A 1MREH 3DO7B 2XTJD 4OF0A 5F89A 4EKXA 4N0CD 5DJZA 3BT2L 4X7SH 5ADOH 5I30H 1EA9C 3D39A 4I18C 2FNBA 3BIKB 1LNUA 5HI3C 3VXMD 4GKNB 4F9LC 4Y19D 2HJLA 3DPBA 4HWBH 1DBKL 3OKLB 2HJFB 1VPOL 4KTEL 1YJDH 2DQUH 2DBLL 5T1MB 3U0TA 5BS0B 3D0LA 5DHVH 4POUB 5LGJA 2IPKA 4R8WL 3WO4C 1AGFB 3BP7B 1MCFA 2ITCB 4F33A 4AW4A 3JWOH 3GI9H 1FYHB 3PWLB 1CGTA 4PRID 3F7YB 3KPRB 4TULH 4NKOB 5B3JF 3D2UD 5ALBL 4CL7A 1GGCH 1D5IH 2OMNA 4KMLB 4NKQB 4GQ9H 4MA7H 3L7FB 4N1EA 1FFOB 2EICA 1N0XH 1U3HB 4RMTA 2OMWA 1DQJA 2Z82A 4LBEB 3VXSD 5J4MA 1ZGLA 4LCWE 1J0ZA 4Q9BA 4PJGB 4MQXD 4LLYA 1QPXA 3W3JA 4YHOH 3O4OC 4QY8A 3ARBB 3MRMA 4MSWA 4FQPA 1YEHH 1QFHA 2J8HA 2VZSA 3IJYB 3BOVA 4YAQB 3QUXC 1G6RA 4XPGL 2GJZB 2WQWA 4OAWA 3QO0A 5DJ0A 1PX4A 1NJ9A 1KCRH 4MMXC 5IR1B 5JR1L 1RUAL 2DTMH 4P4RB 5IWLC 2FL5A 3B9KB 2CDGA 3FRUB 5DC4B 1Z9MA 3QXAB 3QEQA 1WBXB 4AEFA 1BREA 1NLBL 4JM2B 1EXUB 3N85H 2ZCLL 5E2TH 3A67L 4XPTH 2Y25A 2YN5A 4JFYB 4X5XB 4DZ8B 2V70A 1GZPB 3D85A 3HS0B 4DKEH 5IVZB 2XTLA 3LEYL 2P5EE 1BVLA 2AJZA 5IB1A 5C1MB 4G8FA 1A6ZB 1I3GL 2P24A 4L4VD 4YHZL 4I2XE 1UT9A 3M1BA 3HE6C 4G8IB 5I8KL 4YHML 1T20A 2IFFH 3CSPA 2R0ZH 5CINH 2YD7A 2DKUA 4Q6IB 3TZVC 4LSUL 2L0DA 4Z7UA 5IV2B 4XNQB 2F54B 1ZLSL 4JCMA 3GBNL 5IVNA 3PQYE 5CJOL 5HGHA 3L3IB 1Y0LA 4MCZB 4WHDA 1B2WH 3ECBA 1RUPH 3BEWB 3KPPB 5DEGB 4F7TB 2C3XA 5T3ZD 1S7QB 2V5MA 1UM6L 3PGFL 3GSQA 3HB3D 2FD6H 3TJHD 4MAYB 3QG6B 4OLVL 3GSNB 3MXVL 1P9MA 3BSZL 2FIKA 3NFSH 1WCBA 2HFEA 1HHJA 1OM3L 4OQTA 5KJRL 2HLAB 4RMVA 5E08H 3GOZA 4U05A 2CJUH 1CFTB 4S0TD 5IW6A 1HEZA 4K71B 2VSCA 5J06A 1X5FA 4N9OB 1QSED 4PR5B 2OCFD 1QSFD 3HG1D 1FG9C 2EXWD 4QNPE 1J0HA 1CXKA 4X98B 2NY4B 4U1JB 3KYOA 4ZTPL 3FMGL 2E6PA 3FB6A 3WIFA 4EDXA 5EUKA 5C0DB 2OTWA 4FFWC 2M26A 4TTDC 1QLFB 3CCHB 1IAKA 3H3KA 1EEZB 3U46B 3DROB 3WHE0 5C0FB 1FYTD 4GW1B 2CK0H 5ADPH 4G43A 2EXYC 4CP6A 1CL7H 1A6UL 3MGOB 1Q0YH 4LDOB 4P3WA 1IEBA 4Z7OE 2IH1B 3MV9D 4MJIA 4XP9H 3RQ3A 3UX9B 1XZ0B 2XN9E 1CICD 1K8IA 2P5WE 5TDOA 3CLFL 4POZC 4UDUB 2XY1A 3QIUD 5J6GB 1C1EH 1RZIA 4H20L 2OTUA 2PW1B 3IFLL 4AM0B 5KVMC 2V2WB 3DV6A 3G6DL 4JN2B 2EC9U 3DURB 4PJ7A 5EUOE 4MA1B 3OAZH 2X41A 4FXGB 3V8OA 1X44A 5INCB 2BNRD 1KF9B 2WBKA 5DD6B 1FLTX 3ZMRA 4LK4A 5K9QI 5EA0H 2B7DT 1FORH 3OPZH 4M1CD 2YR3A 1DUYB 4LRNH 1A9NA 2D31A 3SDDB 3PV6A 1PKOA 4AEIL 5BCAA 5F1IA 4R5CA 5DUBB 1GPOH 4AL8L 4DZBB 1CGYA 5F7EL 2H1PL 2VAJA 3N9GH 3P73A 4XC3H 1OGAB 4OCMC 4YHYB 3AUVA 1NAKL 2WV3A 3L5HA 4XZUB 2RGSA 3AM8A 4ZDHA 3KXFB 4LRIA 5L2KE 4QRPB 5BJTA 2FJHA 3QAZC 4UUJB 2C9AA 1H3UA 5CEYA 5IMLB 3UAJD 3VRIB 1Y18B 1KENH 1LP9E 1RJLB 3ROOA 1PG7W 5FYLH 2D7NA 1A9BB 4DW2L 3D0VB 5D1ZB 2B1AL 1EERB 4H1LA 3ORJA 4HUMB 1CXHA 3SBWC 1B0GB 4Q97A 4G6MH 4UAOC 4U1SA 3FB8B 3LQAL 5T1DL 1NBQA 4HUNB 1PVHA 2BNUB 5EZIL 3SE3C 1LD9A 4OIIH 4TPRL 1P1ZA 5DJYA 1NH6A 2OBGA 4RGMB 3UL8A 1VFBB 43C9A 3VA2C 3M18A 2AABH 1BJ8A 3LSOB 1S78C 5J8OA 5T1KD 3ZE1E 4ZUWB 4GKSB 2PXYB 3HE7A 3TN0C 2BHYA 1GZQB 2VYRE 2Z7XA 4AIOA 1CTOA 4NGHL 5D6DC 2FWOB 3ZYJA 3GMLB 3VH8B 4YXHH 5DJXB 1J7VR 3TO2B 4X99A 4PV8A 5KVGH 2Z4QB 2CIKA 4L1HA 1S9XA 4F2MB 3GK8H 4BH7B 4K7PL 5MI0B 5E2JA 1I9IL 3SQOH 3IFOA 3EHBD 3H9HA 2AXHA 1T22B 3W9EB 4M62L 4RX4D 4HUXA 2PYFA 3GMOB 4HAFA 2R1XA 5DD5L 2JIXA 2QADD 3OX8B 5BXFB 3IDYB 1B0RB 3UZEA 5AZ2H 4UB0H 5GS0D 4N8CL 1JZ4A 3MRLA 3KPTA 1K2DA 1I4FA 3KPNB 4XCNA 5JHDD 2UY6A 3FQRA 1FAIH 1TQCB 1J05B 3I3BA 4LHUB 3BKYH 1AQKL 5DJDA 3NTCL 2R69L 5B38A 1YEKL 4OGYL 4MNHA 4NUGH 3IDJA 2P5EA 4R4FL 3GMQB 4YPJA 3T1FA 4G8AA 3TCLB 3KYKH 3GSRA 4WDIB 2NY2C 4E42B 2BCKA 1YY9C 1W8NA 3DGGA 2C5DC 3X11A 4DGIL 4UIKL 2BSTB 4EBQL 3E4GA 2DMCA 5IVXE 3BQUD 1JK8A 2ITDB 3VI3F 3WSQH 3UPRA 4G80A 1NGZA 3O6KL 4FQIL 3CIGA 2IANA 2EDQA 1QQDA 1JPTH 3QWOB 1KULA 3RGVB 1S7VB 1SM3L 5IEKA 4ZMAT 1F11A 1JNHA 2FO4A 4CMMA 5HHMD 5CD3A 1WIUA 3PL6C 1OL0A 1HSBA 1UWEL 3CXHK 4WGWB 4JPKL 5HJ3B 4JFFE 2FRGP 4J8RA 4LSPH 2GCYA 3LRSB 4KVCH 2YA1A 4RBPH 1KIUA 3SKJH 5FA3A 5IT2H 1RZ7L 5IBLD 1HXMB 3IF1A 4I8DA 5FAAA 3STZB 3NA9L 5CMAA 4JR9L 1I9JH 4WI7A 4JO3H 1AP2A 2MKLC 5EDXA 1C16A 2I24N 3A6OA 3V8CA 4P5MB 3DVFA 4F57L 4H8WH 2E8ZA 2O5YH 3VFSB 3WLBB 2PW2A 3S3JA 5KSVB 3T3ME 1A21A 3JV4B 4FMFA 3LMJL 4QGTA 4MZ3A 1CK0H 4DUWA 4WTZA 4HUVB 5LBSH 5EFIA 2DYPA 4P5TC 2H9GB 5DHVB 4LSAA 2EDLA 5BS0D 3EFFB 4JQVA 3S96B 1UH4A 2OZ4H 4XMKH 3CIYA 4FZEH 1LEGA 3KPRD 4FMKA 4MQWX 3RJDA 1QVOA 2N1KA 2YD9A 5I1AA 2MCPH 3GM0A 5ILTL 1H5BC 3P9LB 4L4TE 4BZ1H 1W0YT 4X6CA 5L9DL 1U3HD 3B8YA 2ADGA 3U7AA 1G9NH 3U0PA 1HYSD 1PSKL 1XR8A 2J1KA 3MLWH 1FGNL 2IC2A 3MJ9A 1I8MB 1MAJA 4FQ1L 3FQUB 1UH2A 3TNNA 1G7LA 3ARBD 4BK5A 5DK2B 4ZFFA 3REVA 3WFHB 5I66A 5KANI 3SDYL 3PWJA 2YD5A 1SEBA 1LTXA 5JW3L 2GK2A 2ATPA 2AVGA 4OIBA 4YDKL 4MJ6A 4TNVK 1WEJH 4MS8C 1JYNA 3P2TA 1MRCH 1TZHA 3IS0X 4BV4R 4P2OD 1BGXL 3UMTA 5EWIL 2AEPH 3B9KD 1BVZA 1VA9A 4U1LA 5EBMB 4E5XA 5CEZL 1N7MH 4IDLA 3CFJA 3QHFH 2ATKA 4JM2D 2V5RA 4HF5H 3ZKND 1QPPA 5FM8A 5D8JH 3C5JB 3KS0H 3EJZD 5F7NC 2J4WL 5HHVH 3VGFA 1RULH 2FGWL 1RZGA 1Q38A 5EH1A 4HX1B 3SCMB 5DQJA 2EDFA 2QR0B 4JPVL 4HBCL 3MX0A 2FO1A 3E6FB 3MLUH 4FFYH 4R07A 4ETQA 2F54D 4XAWL 1BVKA 2VISB 2Q8AL 4AEHL 3GRWH 4ZTOL 4PJIB 4KWUA 3RWJA 3L1OL 5GS2B 4FN0A 3L5XL 5DA4A 15C8L 5DRXA 5IF0A 1LO5B 2A73B 5F6HI 4RA0C 5EIQA 4O2CA 4HC1A 2R0LL 1AR1C 2VDQH 4FTVE 1T03H 1PY9A 4JG1L 4MAYD 4S1QL 5TH2A 2HVJA 2W60B 3QIWC 4G7VH 5GPRA 3TIDB 5GS0L 5HXMA 3OTTA 1HZHH 4OZFH 3DVNA 3U7YL 4XPBH 2AGJL 3BYTA 1RVFL 4P3CL 5DFVD 4JY6A 3RKPA 2BNQE 5C0JB 1GGUA 1W0VB 4HKJB 1MWAA 3U4BH 3WIHH 2R56H 3SO3C 3T2NL 1RK0B 2EIBA 2ZG3A 1INEL 1PFCA 4PREB 3ARFA 4PJDB 1QFWI 5FYJH 4PJ8A 3MBEC 3UYOD 4KFZC 1AGBA 5FF6B 3LS4H 2NY4D 1JGDA 5IK3B 1NPUA 4HDIA 4QF1B 5H37H 4WWKA 4PB0L 4XBPB 1KTDA 1JI2A 3ESUF 3MRHB 1X5LA 4PJ9A 4PJ5E 1CGSH 4EN3B 2YSSB 1QFWH 2MFNA 1DFBH 1U6AL 4PJFB 2CH8A 3BJ91 4KPHL 4RZCB 5CP7B 3MTRA 1FFNA 4G6AD 3QHZL 1DQLL 4WCYH 1YN7A 4QRQA 1FG2A 3KWWA 4NQEE 5HDQL 4ZNEE 1J1OH 3OAUH 1HE7A 1XF4B 1CG9B 3GMPB 4G9FE 1SYVA 2P43B 3QCTH 2WIIB 2VN4A 1K8DA 1A3LL 2GITA 4YHKH 4ZQKB 4WFED 3MRGB 1YEJH 4JN1H 4JM4L 1HKFA 3VXQA 5TFSH 3NMEA 4U6HB 1T1ZA 2GSGB 3OWEA 3T3PF 1J0KA 4Y2DB 4ORGB 1XGPB 3AS0A 1G7PB 4WEUD 4P2YA 4PYHA 2FT3A 1KC5H 5I1JL 1KIQB 1OAZL 1IGFH 2MTPA 1MHHB 4I3SH 2Z81A 3SDDD 1MRFL 3DO3A 3TBVA 4Y16A 4R3SA 3GJEA 3MRCA 4EI5A 3WLWD 2Y36L 2OSLB 1OGAD 4HIXH 2DL9A 1VEMA 4FXKA 1UG9A 3OKMA 1IEAB 5CUSH 3KXFD 4QRPD 1JV5A 5DJ8B 1AE6L 2AI0L 4OFVA 1OTSD 1A4JA 2Y5EA 5HPMA 3H9SB 2DQIL 3HR6A 2UVFA 3NPSB 4JZNA 5FO9A 4IMKC 3UJTL 4ZOAA 5D1ZD 4BJLA 5FK9A 5HYEA 4N8VG 3KJ4C 1U2CA 1SEQH 4QTHB 3RFZC 1KCKA 4FQQA 2JB5H 3MLSH 1G9EA 5GRUH 3E8UL 3V6OE 3CDCA 5GJSL 1UH3A 3QUMH 3U1SL 3U4EB 5D7IA 1HHKB 4KQ3L 2XI9A 4U1HB 2V9QA 1ACZA 1DBBH 1DQMH 4WW2A 2DD8L 3GHEH 1KLGB 3KHQA 1F97A 1HHHB 3A6BL 4GG6A 4NN5C 3L3DA 3MCKA 5JHLH 5GGTA 12E8L 1U0ND 1CS6A 2J8UE 4A6YB 5DJCB 1ZLUK 5EBWA 3RHWF 2W9EL 4U2ZA 5I71C 3EFDL 3L3JB 4HWZA 2PXYD 2HN7A 5AUMB 5F9JA 4BQCA 3SDXE 3ZDXE 5FKAB 5D1QB 1JPGB 1NCCL 1QR4A 2ZWLT 2IPUG 1UVQA 4PJ7F 2Y5TB 2F8VA 1II4E 1ORQB 5I76A 4EVNA 4G8EB 3I6GA 1RK1A 4Q9CA 4C55A 3VFVA 1K4DA 4N5EC 4W6YB 3HE7C 1XF1A 2BDNH 2OL3H 3WJLC 1CDUA 5D70H 5M7QA 2E9WA 2XNAB 3RFEA 1MI5B 3RIAF 3R06A 3PABA 3O6LH 1D5ZB 3EZJB 3UTQA 3C60A 5DRWB 4Z77A 5D4QA 1IAIM 4QRUA 4TN9A 1I8KB 4LHUD 5LQBH 3MNVA 2VDLL 3TO4A 1RZJC 2XRAH 2D3VA 3IDIA 4YHPB 3LPFA 4TNWK 2AP2A 1ZANL 3O2DH 2EIZA 4UT6H 2ZG2A 3TM6A 1NC2B 4D9LH 3FO9B 1BM3L 3FOMB 2BVQB 1DR9A 3PF2A 3LB6C 3BN9C 1E4WH 4M3JA 3Q1SL 2E9IA 4L8CB 4O51A 1AH1A 4HW6A 4KUCF 1BFVH 5BQ7B 3SDCA 4RCAB 4XCCH 5BVPL 4CVXB 4OJFH 1WWLA 5F7LB 3KPSE 5GHWL 2LTQC 3MLYH 5FCUH 1SVZA 2OR9H 3PHOB 4L9LB 4TVPH 3RGVD 4RMUA 3WL9A 5KAQG 2AERT 2SEBA 4ZUVB 3QDAA 4LSCA 4CJ0A 1WT5C 4LLWA 1OAKH 2FSEA 1FL5B 1IGYB 2ARJB 4K3DL 3WIIL 3U6RB 1P4LB 2KZWA 1CD1B 1P4BL 1U58A 3QZWA 4JY5H 3HTLX 2EYSA 3G08B 4MNQE 1OHQA 5F1NA 2FX8L 4APQC 1GAFL 2P1YA 2VLJB 3IXTA 3L3KA 4MAUH 3QEGH 8CGTA 3ULVA 1DN0B 5I1EL 2GY7B 3WUWB 4RQQA 5KSBB 5AWCA 1K6QH 4XPFL 1BQLL 2ZUSA 5C0ND 2VDRH 2XTJE 5E5MB 4UNVA 3SDAA 3K74B 3AREA 1HHGB 3HUJE 4NJ9L 1TPXC 5J3HC 3V6FB 3G5ZA 3S4SA 1MFBH 1QBML 3CFEA 4PJ5A 3W0WA 4LSRL 3DLQR 3G5YA 3VXME 1S7RB 2WBWB 1U8NA 1I8IA 4Y19E 4OI8A 3HZYB 5HI5D 3WPCA 1JPST 4TYUA 2ESVA 1U8IA 2R1YA 1OCWH 3IJHB 1CN4A 5F7MC 4PJCE 3GZKA 2CLVB 1XGTA 4XP4H 4ZPTA 2NY5L 1L0QA 1M05B 3K46A 4PRIE 4FQCH 3UJIH 3UYRH 2NYYD 4M7JL 2OMTA 4OUOA 5TE6H 1IT9H 2FDBP 1CDCA 5B39A 3D25B 4IOIA 3WEXB 3EYQC 2IH3B 2F15A 3F12A 1LO4H 3VXSE 1U93A 2YC1B 5F9OH 3P4OA 4WO4C 1R24A 4WHTB 4OZIA 4C56A 1OP3K 4ISVB 1QBLH 5JW4M 3Q0HA 1J11A 3MCLH 2KUTA 5D7KD 2CK2A 3MLPA 2AAVA 1MVUB 3HZMA 4KXFB 5EZJA 3RWHA 4OF5A 3QCUH 3G5XA 3KJ6H 1ADQA 1Z5LA 4LIQL 3D9AL 3SCMD 3QCVH 4M6NH 3NABH 2QQLH 4JE4B 4XTRC 4AEEA 1ZHBB 4WUUA 1A3QA 5IJBA 4YFLF 4EDWL 3EO0A 3T0WA 3QNYA 3O4OB 1OARL 1JGUL 3RFSA 4QNPF 2IQAB 5GS2D 3TPUB 3VFMA 4HHAA 4MQTB 5DMIH 4UINH 4L4VE 3V5KB 4I5BA 4L9DA 5E2UL 4HGWA 5CJXC 3UTZB 1EH9A 3SGKC 4LKCA 4Y4KA 4JFDB 4OGZA 2Z8RA 1PZ5A 3CU7A 1RFDH 1TXKA 2IWGA 2GUOA 4NO5B 4QXUL 4MQ7A 4ERSL 5DC0A 5CZKA 5HVWA 3JWDL 4X6CF 3OR6A 4LAQH 3DTXB 5JXEC 3WXWL 3HZKA 3U82B 2OLDA 2WM0A 4Z7OF 2VIRA 4AK1A 4QRSB 2J8UA 2QHRH 5T3ZE 2ZUWA 4U09A 2B4CH 1NKRA 4V2CB 1FHGA 5JDSA 4NZUL 4NKMA 3V4VL 1M6OB 3RTQA 4XI5D 3T09A 2OJEA 3CVIL 4KH2A 4O02L 5J13B 5FUCE 3SDXA 1UWXH 3UCRA 5C6TL 3GMNA 2Q7YA 1YY8A 3VRJB 4J2XA 2V9SA 1KIRA 3W82A 4PY8I 4PJBE 1ZHNA 4PBWD 5EUOF 4JHAL 1TZGH 3EYUH 1OAQL 4V1DA 3V79C 2FZ3B 1PDKA 3KDMA 4FQXC 4QWWD 2ADIA 3VD3A 3RVUD 1UWGL 5IROC 2FJGA 2A1WH 4EN3D 3QQ3B 4X6DA 2RFXB 5I9QB 1QSEE 1ROWA 5TJWK 3V5HB 3B3IB 1A5FH 1QSFE 2F19L 2NQCA 3ARFC 3HG1E 3TEUA 4WTXA 1X5XA 3IDNA 4M4RA 1CF8L 1FP5A 2VH5L 1IAIL 1XH3B 5DR5L 4P57A 1A7BA 1C5BL 2DQGL 4KRPB 3RVVC 2V2TA 5AD0A 2W07A 3FO0L 1KN2L 1J88A 1BFOB 2B39A 3NCMA 4FQHB 1AXIB 1B90A 2H45A 2BJMH 1EJOH 1FYTE 1T5WA 2AEIT 4JQIL 4NJAH 4Z0XB 2VO5A 5HYJB 3LPGA 3W81A 4LEOB 5JORA 5F3BA 1ORSB 1DL7H 5ADOL 4GRMA 2Q7NA 4LLVB 4UQ2B 2X9YA 4XVTH 3BGMB 3MV7B 3NFPA 4KVNH 3MNWB 3MV9E 3VJ6A 3GMRA 4OKVA 4Y2DD 4CGTA 5DD0L 4WFHE 5I1HH 3RPKA 1FC1A 1ZHKA 4JVUA 1BWWA 5ACMA 2YHGA 5DD3H 4FXLA 4E0RB 2X40A 4QRTB 3PNWA 1JYWA 2D7QA 3K3QA 4H88H 3GI9L 3BAEH 3UZQA 2JTDA 5C8JA 2AEQL 5ICYB 3ZKMC 4U08A 3LQZA 4UV7L 3KPSA 4U7SA 1D5IL 2A6IA 4PFEA 5BW7C 3QRGH 2BNRE 4MA7L 3WFEH 5DEFB 3DX8B 1OOKG 1N0XL 1QBAA 3MACH 3QJHA 4MD5A 4YHOL 5HGAA 2A9ML 4HQQH 5FYLD 3H9SD 2YS4A 3QDJB 2V7HB 5DJ6B 3VCLB 5ECJE 2C3VA 3TH2T 4V2DA 3FCTA 3JWNC 4K9EH 1CFQA 3X3FL 3I6LD 3L5WB 2JCCA 2W9LA 3IFPB 1TNNA 4GAYB 3QUMB 3QJFA 4X5WB 5ITBH 3IAQA 3CC5A 1D5MB 1Q1JL 4YEEA 5D9SA 1M7IA 3OKKB 1CXEA 1H0DB 5C0GA 3SGDH 3VD9A 4JFXA 5L6YL 5E94A 4JFEB 4JO4L 4XGZB 5E2TL 3UTTB 1TVBB 2YPLB 4WJ5A 4JRYB 5TDNB 3I75A 1SBSH 1AXTL 5B8CC 3CAFA 5DO2D 4XPHL 5C08B 2R8SL 5D1QD 5I1CL 5IFJA 1J1XH 4GH7B 4NN7B 3TBYA 5IMKA 3PGCA 3C5ZC 1AC6A 4I13B 3VFPB 4QHMB 2HT2C 4FG6C 5JUEH 3CUPA 4H0IA 4LGSB 1T83A 3T0EB 2IGFH 5E9DB 5C3TA 3AU1B 3QXDA 1HINH 2OL3B 3DUSA 3CDYA 4Y5YB 4RMSA 1J8HA 4QGYA 1XCQA 5C0BA 1EFXB 2Y06H 4R0AA 3EO1A 3D48R 3C8HA 5GSVA 2FD6L 1MI5D 1ZV5A 5SWQB 3ULUH 4O2FA 3I9GH 1P6FA 4GG8B 2X4NA 3O11A 4Z5RB 5SWZA 2CUMA 4NKDA 3NFSL 3C2AL 1GC1C 5A16A 5DTFB 4BFGA 5IHZB 3BPOB 2CJUL 1FNEB 3MYJB 1S7UA 4RGOH 3T8XB 4C58B 3BFOA 1IGCL 4H1LH 2F9BT 2P1OB 5D5MB 3NIDF 1AHWA 4NQVA 3QWRD 3KNBA 3VFRB 1NC2D 4NIKB 1MJ7L 1H3PL 5JHDE 3O3AA 3BP4B 2QKIA 3NN8A 4ZXBB 1C5CH 3D69A 5D7IF 3P0GB 4CC4C 2WWMC 3C9NA 3LKSB 4NCDA 3LZFH 4OB5H 2KQNA 3TO4C 2CK0L 3MUZ1 3HI6L 4QHUA 4NRZA 4GG6F 1YNTB 1N5AA 1I7ZA 2LAAA 4ELMA 1HH6B 1MFDL 4PG9B 1KCSH 4P91A 3C6NB 1ONQA 2G9HA 4OCRL 1N5YH 2IJ0C 1TITA 4NFCA 4UIMA 3DX6A 3NIFF 1VHPA 2UZIH 5FYKH 1F2QA 1SQ2N 3FAXA 4KJPC 5D7JA 4UBDC 2X2YA 1NCUA 1X5ZA 3N1GC 4G3YL 1C1EL 3HLAA 3KPOB 5KOVC 2HKHL 2AJYH 5AWAA 3I6KA 2AJSL 3KVQA 2VLJD 1I1CA 5HHME 5CEXB 4F37K 5D7LA 3W3NA 1BFSA 2AJXH 3FB7A 2R29L 1CR9H 5EA0L 1NAMA 4NN6B 2P47B 3G39A 1VADB 5DRNB 4LRNL 2R1WB 4BQ6A 1U8MB 3QFJB 1AD9B 3DRTA 2PTTA 2DQFA 4R4NC 5FB8B 3IDMA 4OCYL 1LWRA 1I9EA 2JELH 4JDVA 4F9PA 5DRZA 3I02A 1GPOL 1QHOA 3PJSB 3N9GL 4P49A 2BY3A 1LE5A 5F7HA 4NYLA 3VGHA 1XGUA 2I5YH 4P2RB 5DJ2B 5IB4A 3P77B 4ODWA 3DSNA 1TVHA 4WYKA 1AGEA 3RJ0A 4YDJB 5JNYB 5BO1H 5BS0E 3LKRB 5BVJA 1JZ6A 3WNNA 1EHLL 1R0AL 2CDEB 4BQ9A 3OBAA 3KPRE 1N64L 3PHQA 2R2CA 3Q5YA 3TFKC 2OXGA 1C7SA 2YMXH 3VGAB 2Z0BA 3GIZH 4KJQD 1RU9L 2ZSVA 1EV2E 1X5GA 2EEDA 5D96B 1MAMH 4ZS6C 1EFQA 4PJGE 3U79A 5CZVL 3G04C 3ISWA 2CUHA 3O3BA 5EC2A 1OWRM 3INUH 4YNYB 4HZAA 5F89B 4A6YL 4HG4J 4J1UA 4BSRA 2V2XB 1RUQH 5D93B 1UKTA 2HA1A 5DJZB 2VL4A 4XWOD 2FGZA 3VG0L 4I3GA 4WRLA 3D39B 1LNUB 4RNRA 4I3RL 4DGYH 2NW2A 2ZUVA 3QEHA 3FOLA 4O5LL 2HJLB 1ZSDA 5IESH 1FNSL 3GK8L 3MRRB 4IDJH 3TBTA 3U0TB 1EEQA 3D0LB 1T66C 3SQOL 5LGJB 1QRKA 3S35L 2IPKB 4F33B 3P30H 1YRGA 4CKVX 1A14H 5HBBA 4Y5XC 5IHUL 4KHTL 3CFKA 2G2RA 3BXNA 2W1NA 3F7QA 4JFDD 4EUPA 2F54E 1DQJB 2OMBA 1YDPA 1ZGLB 4J4PC 1CGXA 4ZFGL 3BDXA 1KXVC 1U8KA 4LLYB 4JVWA 3BKYL 3O3EA 4GRWF 1CXIA 2D7PA 4QY8B 3MJ9H 1FZJA 3MRMB 4MSWB 4N0RA 3ZE0E 3W11D 5TQ2L 4NUGL 4ALAH 1H6TA 4KK6C 1OSPH 2D0HA 4WFFD 5FYJD 1ZA6A 3V6OC 1G6RB 5DHYA 3MO1A 5HDHA 4JKPL 4OAWB 3QO0B 5DJ0B 5A2IH 2UWEA 2OTPA 3KAAA 4Y4KC 3ULAA 2NX5A 3P11H 4Y61B 1L7TH 1H3XA 2FL5B 2B0SH 5EO0A 3RZCC 4RBPK 2CDGB 1AO7A 3QEQB 3DHJA 5HDOA 4OZIF 1JYXA 2O26U 3D85B 3FT4A 4YZFF 4NT6B 4KZDH 1BVLB 2AJZB 4HWUA 3SKNA 5FV1L 5GXBB 5IQ9A 5IB1B 2P24B 2D4DA 1L9NA 3M1BB 5DWUH 1Z0MA 1T20B 3BDYL 3UPAA 4KRPD 5J1SC 2CRZA 4Z7UB 3KYNA 4OD1H 4OF7A 2VLRA 5AWNH 2FR4A 5FUZH 3MLVL 1U41A 5E8EA 5HI4D 3TH4T 4JPWL 2CR6A 4JO3L 5HGHB 5HYJD 1Y0LB 2WQUA 3CZFA 1KEGH 1JWUA 1IC4L 3ECBB 3ZSSA 5IB5A 2NY6B 4IRJA 3NCYS 3MV7D 5BMFL 2XWBA 4W4OA 4LU5H 3GSQB 1BHGA 2Y6SD 3QIBA 1H9VA 2BOBA 3KR3L 3H7LA 3ZDZE 3MGAA 2A9NH 2FIKB 3ARDC 3DX7A 1WCBB 2HFEB 3MOBH 4WFEE 4QRRA 1HHJB 2G75A 3KLDA 1D5BB 1HXYB 5IW6B 4OV6F 2AQ1A 4GLRI 4XMKL 1HEZB 1MWAH 1WBYA 2D7TL 4GMSL 4HLZH 1VEPA 1EGJH 1J8KA 2ELLA 3R8QA 2EC9T 2H2PD 5D2LA 5GS3A 2J8UF 1ZLVH 5JMOC 2EXYD 1EHAA 5KS9A 1YEGH 3EW3B 3MJ8A 3MLWL 1T3FA 3KYOB 1XAUA 3FB6B 3WIFB 4EDXB 5FEBA 5EUKB 3W3GA 2V6HA 3QDJD 5F9AC 3SDXF 3VMOA 1OGAE 2CR3A 3OKYA 1IAKB 4CUCA 2HT3D 1MQKH 1BQUA 1RUMH 1FLRH 5C0EA 3KXFE 1L4IA 4QRPE 1WEJL 3BE1H 2CGRH 4G43B 1RIVH 1TJHH 3IXAA 1A7NH 2AEPL 3JTSA 4FS7A 3RP1A 4JFED 4M5ZL 1NDGA 3UTTD 2XQBH 1F4WH 3H3PH 3EDKA 1K8IB 2YPLD 2DB8A 4JRYD 4XCFL 4Y5VA 5TDOB 1KJ2L 2KQMA 3QNZA 3U30C 1XR9A 4F7MB 1RZIB 5FECA 3C6OB 2OTUB 4FNLL 1UJ3A 1MVFA 5HHVL 2J12B 4UNUA 3L3GA 1H15A 4N1HB 5IBTH 4DAGL 5MEPA 3DV6B 5TE7H 5HDLA 5C08D 4MCYB 4PJ7B 4GKNA 4KDTA 4XH2A 1KLUA 2HJFA 4R0LA 1FNGA 2C3WA 2XV6B 1SY6A 3VFWA 5T1MA 4NZTL 1IEHA 5K9JL 5GISH 3LKQA 2DLEA 2XTJC 1CU4L 3GRWL 1U91B 4NO2A 2D31B 1AGFA 1NLDL 2IALB 1KYOK 2F5AH 4N0CC 3T0ED 4U7KA 4JZOA 3P4MA 3R0NA 5F1IB 3PWLA 4F7EA 5LWYL 5E9DD 3WHE1 2XWTA 3SE9H 4NKOA 3P73B 4UV4H 5GGRA 1EFXD 5HHNA 4YFEA 3LRGA 4ZDHB 4LBEA 4G7VL 5BJTB 5JW4Q 2FJHB 2X05A 1RHHA 3GEWB 4RIRA 2VAAA 1QO3A 4UTAL 2Z8VC 5CEYB 2BOCA 3RY6C 5A2FA 2AXGA 1GRWA 4BSVA 3REWA 4K8RH 3ROOB 4GAJH 5I1KL 3SE8H 3D3VA 1F4YL 2EKSA 3ALWA 2OMYA 4H1LB 5JW4N 1MCJA 2HRPL 3R8BB 4ARRA 2A77H 2QEJA 5EZOL 5DVKA 4M9PA 4PJEB 2JCCF 4U1KA 2YZ8A 4MQXC 1LD9B 3FN3A 3LS4L 1P1ZB 1IKFL 5DJYB 4BA8A 5J6HA 3BPNB 4XC1L 2RB8A 4ZXBD 4HIIA 2APVA 4M61A 4P23A 3L7EA 4C59B 4KXZI 43C9B 5GGTH 5T1LA 4J3TA 1A4YA 1IGIH 4TVPD 2PUQT 5TQ0H 3ZYIA 4OBSA 4R26H 3HE7B 2Z7XB 5C0IA 4Y8AA 4O9HH 3VXTA 4JJ5A 1E28A 3OAUL 4XBEH 3NIGE 3H7BA 2R4RH 3QCTL 4KTDL 4PV8B 4X99B 2VXQH 2CIKB 1S9XB 4UT7L 4G6KH 1AJ7L 5HVHC 2ZKHL 2X7LA 5IW3A 1H3TA 4XGOA 3MBXH 4Y1AA 3IFOB 1WISA 1Z9LA 1FO1A 4HUXB 2PYFB 1A22B 1Y6KR 3GSNA 2E27H 2R1XB 1IQWL 7CGTA 1JNLL 3RU8H 1EJ6A 1FN4A 1IGFL 3L3OA 1RIHH 1VCAA 3MRLB 1YY9D 5CIPA 1K2DB 1JGLH 1I4FB 3QFJD 2HLAA 4XCNB 4X4YA 3FQRB 4OZGB 2JE1A 1XIWA 2ENSA 1F3DJ 3K80A 4ETYA 5ISZB 5B38B 3LEXA 4L8DA 4MNHB 1IZJA 2XKSA 3FB5A 2MQ3A 3IDJB 1J0YA 4GRLA 3T1FB 3TJHC 1B6UA 4P2RD 2I27N 1JTTA 3GSRB 3RRQA 1SYSA 5FUCC 3GSOA 1X5YA 4X98A 1Z9OA 1C7TA 4OUUA 2BCKB 4BSUA 2L4OA 4RFEA 3X11B 1HILA 2XQYK 3VMPA 4ZD3H 2FATL 5F7YC 5KBNC 1GJIA 5ANMA 3UPRB 5C0FA 1VSCA 4G80B 1NGZB 4RWYH 4TSCL 2IANB 5J9PA 5GRUL 6FABL 1QQDB 1UKSA 3V0WH 2DQJH 2DKMA 1INDL 1MEXL 1RJCA 3QUML 1DBML 1PQZB