3ZYOA

Crystal structure of the n-terminal leucine rich repeats and immunoglobulin domain of netrin-g ligand-3
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
397
structure length
391
Chain Sequence
SCPAACSCSNSRVICTRRELAEVPASIPVNTRYLNLQENSIQVIRTDTFKHLRHLEILQLSKNLVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQDTGQYTCMVTNSAGNTTASATLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4B
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 93
structure length 391
sequence length 397
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zyoA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3zyoA01
4LAQL 1U8NA 1KB5A 3CZFB 3OKOA 4GUPB 4GQ9L 3EFFA 3L5XL 1EPFA 3QFJD 5B8CB 2KL6A 4GRWB 4NWTH 4RMSA 4L3AA 4WHTA 3TBSA 4KUCD 5GS0H 2Z92B 3ILQD 1KCUL 4C55A 4JFFB 3LB6D 4NDMB 4JVUA 1H0DA 1FL6B 3DWTA 1KB5L 4M1GH 6CGTA 4FN0A 4Z7UB 4CADA 1JWMB 3PDGA 1ZHLB 1OF2A 4MA7L 4HGWB 1HQRA 4K55A 1XR9B 2VLKE 2DTML 4PJ8A 5FIEA 1IJ9A 5DMJB 1LO5A 3VXUE 4OIIL 4XVJL 1GGYA 1WCBA 3RGVC 4OSUH 5FV2A 5DYOA 1GH7A 4P2RE 1I85C 3HMWL 2F58L 4D0CA 2XWBA 4PGCB 2AJ3A 4QXTA 2DM7A 3RL2B 4MNHA 5F7EH 1ED3B 3UBXG 2OL3H 4YXHL 1VFBB 1XF5B 4ODHL 5DR5L 4YHKL 4A6YA 3RIAK 1QYYA 1MIEL 5DEGB 2FIKA 3HNTH 5HD8C 3SDDA 4IRJC 3MNWA 4E42B 5MERB 3IDGB 5E6YA 3CXHK 4P23C 2IH3A 2X4NB 2GITA 4XPAH 4NO0B 4NOFA 4CDHA 4ERSH 3AM8A 4F58H 3U36A 5ID0A 4KZDH 4FFZH 3OX8B 1DJSA 1JPSL 3WN4A 4A6YL 1OL0A 1QPPA 4H0HB 1DQLH 3MLVH 3VQ1A 3BZFA 4HS8H 3PHOB 5F1NA 3RTQC 1NMAH 5FO8A 1Z5LB 4UV7H 1XGQB 5HHPA 4LEXH 4ONHB 4ZYKA 1KJ3H 3FT4B 2P45B 2JB5L 3K3QA 4G9FB 1JYXA 4YDKL 4MJ6B 1NC4D 1QLEH 2A9NL 2PW1B 1OPGH 2AJVH 1OD7A 3IFPB 1UM5H 4KKLD 4U7KA 4JQVC 2Z31B 5DEFB 2EYTB 5C07B 2FGWL 15C8H 1KJVB 2UYLB 3CMOL 1NDMA 5L7XH 3GK8L 4DN3H 4X6CE 3IS0X 1KTDB 1NCDL 5HHOA 4ELMF 1BBDL 2PCPA 1KXQE 1M6OB 2XKNA 2R2EA 3ABZA 4Y8DC 5MHSE 2P24A 3ZL4L 3HA0A 2A1WH 3M1BB 1M10B 2F74A 4J6RH 5C3LD 1EK3A 1H8SA 1UQSB 1S5HB 4MQ7A 3CPLB 4AMKL 1OB1B 1VGKB 3QZWA 2KPNA 2CDEB 4P3CH 4W6YB 4R6JA 1CLYL 4R08A 3QUYB 4UDUA 3BPLC 3RFJA 5BV7C 1T66C 1JNLH 1NBYB 3HZKB 3I3EA 1EVUA 3QH3B 4YZFE 5HHNA 2WLYA 4K23L 2BVQA 2VLKA 4KJQD 3VXUA 4O4YL 4NM8H 5GGQH 2PO6B 4XPBL 4LLVA 5TE7H 1M7DA 2H45A 2J5LB 3V4UL 4FTVE 3SPVA 2BVPA 5D6DC 1EZVX 4ZO6A 4XVUD 5C0EA 1RY7B 4DGIH 5I71C 1I3RB 1OVZA 1ACYL 1BWWA 3VCLA 3QHFH 3MRQA 4XHQA 4ELMB 3FO9A 1S7UB 3SO3B 5FXCH 3HC4H 5IW6B 4JFFE 3L3KB 2OTPA 3DPBA 3HZVB 4NN7C 2R0LL 1P7QD 2FATH 2XWTA 4XVSL 1JGEB 4D2NA 1VKXB 1CF8H 4ZUTA 7CGTA 2JE8A 2A83B 1AIFA 4WFGD 1LK2A 4WI5A 2MCPH 3CFIC 1QSED 2JE0A 1OCWL 1JK8B 4X6DE 2VO5A 2HKHH 1I7RB 4WO4D 3MV7B 1P69B 4U3CA 1HE7A 1UWEL 1CG9A 3VG9C 5IVXF 1T2JA 3CDGB 5AG9A 1EERB 1N0XH 1FBIL 1QSFD 1KPVB 2HJKB 5CP3A 3NPZB 3SKUD 5BZWB 1HHIB 3MXVL 2YRZA 4D0DA 3MV8B 4YC2B 2Y5TB 3WN5B 3QUKA 4GAFB 4XMLH 5CEXA 3GHBL 1L0XA 4ZO9A 2B1AL 2QLVB 1TCRA 4Z7WE 1WZ1L 4W6WB 5CINL 1JTPA 5JDSA 4YNYA 1R6VA 4UQ2A 1BQSA 4QNPF 1CLCA 4X6CA 2VE6B 2AEPH 1ZSDA 4KJYB 1T3FB 1MHCB 2R1XA 3OJDB 3THML 3UDWC 4CNIB 1FNSH 2HA1A 5H2BA 1KCLA 3TWCH 4BFBD 2VR5A 2FLBT 3RWIA 4XPTL 2YPLE 1OM3H 2F5AL 2IGFL 3MRFB 4GQPH 3C5SB 4GO6B 1TXKA 5HYJB 2LV4A 2DLIA 2PYFA 1Q9WB 4G9FE 4GBXB 5JPNA 1XIWC 2I9TA 4QRTB 2GTZA 3U4EB 1YDPA 4GXVL 4NGHH 2NW3A 2OR7A 4KVCH 5TPWH 2ZKHH 4LLMB 3HUJF 4PJ9B 3T0WA 4FRWA 5C07E 3PGCB 3WXVH 1RUKL 4P59H 3WL9A 4OQTH 1DEDA 4NNPH 5E4EB 2L7UA 4J3TA 1S3KH 5HY9A 2H3NA 1R3KB 4OCXH 4ZPVB 1N8ZA 3OR7B 4KROB 4X6FB 2W0PA 1TPXB 5F89B 4W4NA 3P4OB 3BWAB 1S7WB 1X5HA 3MLUL 4FZ8L 2Y06H 4FTVA 1QFWI 2VH5L 3TNNA 1FCCA 3CZFA 3CLFH 3MLSH 4GUPA 4LKXB 4YHPB 2D03L 3MCKB 3VWKC 4X6EB 2X05A 5IBUB 1CDIA 1F4XH 3ZE2F 2DBJA 3DHJA 3FAWA 2DYPB 4QTIL 4G3YL 4NSKB 1G6RH 4WI2A 3HC0B 4JFFA 1FGNL 1YYMH 2R2BA 4KJWD 1FL6A 1AC6A 1FNEA 2PW2A 4MVBD 3D9AH 1JWMA 4JANB 1ZHLA 1MCPL 4HGWA 5EZIH 1RUMH 1XR9A 2ZUUA 5JIPA 5KVGH 3L9RB 4I0CC 4TSCL 3LPWA 4F9PC 4X6DA 2DIAA 2OXGA 2YK1L 1K5GC 1OAUH 3G5VB 1NAKH 3P11L 4NQCB 3QUXC 3HUJB 2EZ0C 5A5CA 5CS7A 1NEZB 5ITFB 2V2WB 2E7HA 1DSFH 4HHAA 1A6AA 4NHCH 1JF1B 3WFHB 3RL2A 5GMHA 1U3HC 4ELME 4WUUB 1XCTB 4JFDD 1ED3A 3WKML 4QXGL 4F7EA 4ODVH 3VFGH 1D0BA 1CDUA 3RNKB 1VFBA 1XF5A 4WDIB 3IU4H 3FQTA 1AD9B 4OGXH 4Z7WA 2FD6L 1G7QB 1KACB 1RJYB 3VQ2A 4E42A 1E6OH 5MERA 5GGTA 3IDGA 4LPYA 4APQD 1KOOA 2ZG3A 2UZYA 4NO0A 4YR6B 4YFLF 1JWUA 4MA1C 5E8OB 1ZKAA 5K9OA 4K9EC 3MV7E 2B0SH 1MI5B 3T4YA 3B2UD 5D8JH 3AGVA 4NZRL 4POZD 1Z3GL 3R8BB 3VGHA 3B8YA 3VFTB 2YPLA 5GGTL 3PHOA 4PLKC 4DFHA 1Z5LA 4KKCD 4JN1H 1XGQA 3NGBC 4ONHA 3M8OL 1A47A 1MJ8L 3U0WL 3MV8E 3TM6A 1CDYA 1QBLL 2YRLA 4G9FA 2DI7A 4MJ6A 1E4WH 4L4TD 2VL5B 5GGUB 2PW1A 1KBGH 3IFPA 4L8SC 3DX8B 4LVNB 3C60D 5DJ2A 4FZEL 1XKUA 2Z31A 5DEFA 2YZ1A 5C07A 3B9DA 4YHML 1KJVA 2UYLA 4MHHI 1YEJL 5C0CB 2DDQL 4NQDB 2B2XH 1ZV5A 3QDAA 4ZAKD 5EIIA 4JZJA 3TZVD 3SJVE 1OGQA 5C2BL 3V7AG 5CSBA 2VLME 4JFED 2Y23A 1S5HA 2BZDA 3D39D 4QF1B 4XBPA 2OK0L 5HYJE 3CPLA 4FQXD 4PJCF 2R15A 2SEBB 2IBZY 4Y7MA 2P1QB 1VGKA 1GHFL 2CDEA 4QKXB 3MGTA 3QIBB 2X42A 1IM9B 3QUYA 2RB8A 4Y1AA 5CZVH 4YDIH 1K3IA 1NBYA 3HZKA 4H5SB 2UWEF 2VLLB 5EO1B 3O6ML 4G6MH 1BLNA 5J1AB 3BKMH 1ROWA 4HF5L 4MA8L 4XNZB 4QYOB 4I8DA 4L8DB 3WPHA 2KQMA 4XGOA 2R56H 4J1UA 1AO7E 5HYSG 2HT3C 2WUBL 1GAFL 1D5IH 3NCJH 4FQHA 4LQFH 1CD1A 4HQQL 4RGNC 1I3RA 3MV9A 5IBTL 2BSSB 4QNPE 5C0BD 2AK4D 2CLRB 2ICEB 1MQ8A 3OKKB 1S7UA 3L5IA 1WEJL 4U6VL 3G08B 3L3KA 4JM2F 4CVZB 3HZVA 5I1CL 4KWUA 3FO1B 2DN7A 3VGAB 4P46D 1VKXA 4UB0L 5D4QA 1ZEAH 2A83A 5ACMA 2P8MB 4PJCB 4BJLA 5BOZG 3AU1B 1VEMA 3UTTD 1G6VK 1CICB 5JW5B 4YAQA 4XPGL 5FF6B 2IANE 3MV7A 3VXRD 3KYNB 4NQCE 4HIIB 3HUJE 1OGAB 5MEND 3DYMA 3MLPA 1OP9A 1KPVA 5DJCB 1KGCD 3ULUC 5D96C 2UWEB 3SDYH 2B8OT 5BZWA 2CK0H 4G6JL 1HHIA 4NC2B 4WUUE 3MV8A 5J3HD 3DNKA 2FGZA 2D7TH 2Y5TA 3WN5A 3SGDH 3Q6GL 1KXTB 1T20B 4Y5XC 2MMXA 3T0AA 5GGSB 3TO4C 4LSQH 1CDBA 4OM1H 4WP6A 4Q9QL 3S98A 5AAMA 1A7NL 1ZHKB 1I1RA 1G9ML 4D9QD 1E4XL 4PGDB 4JG0L 2B5IC 4R26L 4KJYA 3MUJA 1KT2B 1T3FA 3OJDA 1QLRB 4LARH 4Y2DA 3SJVA 1QRND 3BW9B 5FGCB 1MI5E 2VTFA 2IPKB 2NXZB 4JM2B 5F8RC 4DZBB 3QDMB 4LSVL 4ESKA 12E8H 3S3PA 1H5BB 3KYMA 5FYJL 1OAQL 5EOCL 3QA3A 5HHQB 3MRFA 3NACL 5IV2B 4LNVA 3C5SA 5IGXH 1FQ9C 4AH2A 3VFWB 1M9SA 5HYJA 3CX5K 1INDL 2ZNXA 4PY8J 2XACC 1DZBA 1Q9WA 4GBXA 2VC2H 4XP4H 3OF6D 4F7PB 3EJJX 3OR6B 4J3WA 4N1EA 4QRTA 4XXCA 3V4PH 3JV4B 3QPQC 1MHHB 4HAFA 5IB5B 4KQ3H 4NRXA 5LQBL 3PGCA 4Y4FB 5KSAC 3EJZD 1FDLL 5C0CE 3WHXB 4NQDE 2ZSWB 1DBMH 3P72A 1F2QA 1MJ7L 2IG2L 2I9LA 1GGCL 2HG5B 4ZPVA 3OR7A 3C2SA 4X6FA 3WS3B 4KMQA 3P4OA 2J1KA 4EN3B 5FYJU 5C0RL 1S7WA 5FA3B 3V9FA 2XT1B 1AO7A 4RMRA 1XGUB 1I9RH 4KI5C 4WJ5A 4JFPA 5F7FA 4LKXA 4YHPA 3D2UB 4Y19A 1CZ8H 4P2OB 1FVEB 1Y18A 3MCKA 3NCFB 3RY6C 4X6EA 3A67L 1GC1C 3S5LB 2P8LB 4NSKA 4C56B 4S1DD 3HC0A 4M5ZL 4Q6YA 1ZT4A 1MLCA 3HAEG 4JANA 1HHGB 2GAZB 3JWDC 3QAZB 4FP8L 4BZ1L 4DN4H 1NFDF 2IANA 4R6AA 4Y4HC 4NKDB 2OMNA 3MFFA 1SEQL 4MS8D 4HKBB 4NQCA 2VITA 1NEZA 1NH6A 2V2WA 1JFQH 1RMFL 2VXSL 2XFXA 3QIWB 4B5EA 4NCC2 4OUUB 4DUWA 4WUUA 1O0VA 4PJ8D 4XPFH 2VERN 3SQOH 3RNKA 4Y4KC 1D9KA 5D5MB 3U30C 4WDIA 3UL9A 1IQDA 3O4LB 3HPJA 4MJ2A 2ENSA 2A6JA 5F96H 1AD9A 1G7QA 3MXWL 5KOMC 2IQAA 4LKCB 1HXMB 1OTSD 3ULVC 4ORZC 1TZGL 5TF1H 5JIHA 2MQCA 4PJCE 1HKLL 4ZFGL 4YR6A 2EDEA 4Z7NF 5C8JB 4LLWB 3WJJC 5E8OA 4ZG1A 2A9MH 4BSRA 2FECI 1J88A 1MI5A 1KCKA 4P9HH 5HYQA 4J12A 5L9DL 1OGAE 2FHBA 2HVKB 4C58B 1B4JL 4M48L 3S4SB 3QO1B 2UWEE 4JFZH 4ZFOB 3UPRB 1RFDL 1PGVA 1NL0H 2E27H 5GS1A 1DR9A 3SKOA 5CWSB 2R69L 5DD6A 3RDTB 1NFDB 25C8L 1MLBB 3P0GB 3OSKA 4LPWA 2VL5A 5GGUA 1YEDA 4FMKA 2BDNL 3DX8A 3K80A 1IEBA 3QI9C 1F4YL 2E9WA 1JGUH 3G6DH 2L7JA 3O3UN 3WS6C 1NBVL 4U0RC 5C7XH 3CXDL 5C0CA 5JQ6H 5HVWA 4C4KT 4NQDA 1P8TA 1T1XB 3F12B 4N8PA 5FGCE 3RZCD 3QDME 1KIRA 1TTUA 1T03L 4WEMB 1S8DA 8FABB 1OW0C 2X4UB 4M8QB 4OCRH 5F7DB 5C9JB 4X9HA 3WLWC 1KLUA 2SEBA 3RAJL 4GW4B 4XVTH 1JRHH 4JPKH 5F97E 5I1EL 3AY4C 3QIBA 5T5FH 3WO3B 1BFVH 4N8VB 5ITBL 4X9BA 1MH5B 4XX1G 1N5YL 1JGVL 4JFHD 1UM4L 5ERWA 4LLQB 4OLVH 3K74B 3OG4B 5IWLC 2BY1A 1AE6H 5EB9A 2BY0A 3MMEB 2RA8A 2XZAH 5EULV 4QYOA 4L8DA 2DQEH 1BFSA 4JR9L 3WIFB 1TJGL 5D7IF 3QCUH 1MWAB 2E8YA 5ID1B 3GI9H 5KSBE 2BSSA 1NMBL 2CLRA 2VXQL 3MCLH 1FG2A 2ICEA 5I8EA 1RU9H 2C9AA 3G04A 1QR1B 3OKKA 4RFNC 5C0IB 1IGFH 3LZFH 3B9KA 3N9GH 4I5BB 4C56E 3G08A 4CC4A 1BEYH 4EZMA 2XOTA 2YA2A 2R9HD 1ZIWA 4NP4L 2EDOA 3KJ4C 4P2RD 1CXHA 4Z78B 2D4DA 1Y6MR 4XNYH 4TOYL 4ZOBA 2P8MA 4PJCA 1IGYB 1MF2H 5J11B 1BQLH 4EDWH 4HUKB 4QHUA 5JW5A 1CICA 5FF6A 3KYKL 4JPVL 3KYNA 3GUTB 4JDVB 5F1OB 1OGAA 1EHNA 1XZ0B 3EYVA 4UIKL 5J12B 3UTSA 1AP2B 1N59A 5DJCA 1RHHB 4F9LC 5L2KB 2YN3A 1BVKB 2UWEA 3U1SL 3IU3A 5E2UL 2WQWA 3P73B 3MJ7B 2VZVA 2F54D 1DQML 4BUGA 5HVFB 1V3JA 4WU5B 2ZJSL 1G9NC 5D5ME 5HGHB 3O4LE 1T20A 2BCKB 5D7IB 1A3LH 5GGSA 5DD0H 1TTFA 1UWXH 4C83B 5GRVL 4FHBD 5DTFB 1ZHKA 1FZKA 4WWID 1Q8MA 1YEGH 4KDTA 1V5JA 2V70A 4UU9A 5DD5H 4PRDB 2AABH 3QULA 3NAAL 1QLRA 3D18B 4OLEA 2IPKA 4JM2A 4FS0A 4G43B 4DZBA 3QDMA 1MPAL 4Y16D 1VENA 4U1KA 4JKPH 5E8DH 4TSBH 1H5BA 3CVRA 1MCWM 2VDKL 5IV2A 3VFWA 5EOQH 5FECB 1I9IH 5I1GL 4WWKA 1NC2D 4RWYL 2DMBA 3MV01 4F8QA 1UM6L 3CU7A 3OB8A 5E9DB 1NFDE 3WIHH 2FO1A 4V2DA 4BV4R 2DQIL 3AUVA 5MHSD 2V2XB 2ZWLT 3WD5H 5I2IB 2A2QT 1ZLUK 5IB5A 4Y4FA 1ZHBB 1MCQA 3NA9L 1RIHH 3WHXA 3LAFA 3EYOB 5I15H 4OF7A 2ZSWA 4ZNEE 1AXIB 4LCIL 2QQKH 2J12B 2BP3A 2HG5A 3GRWH 5E2VL 3WS3A 4NZJA 2D2OA 3LHPL 4EN3A 5FA3A 5F7HA 4R07A 1T1YB 3GMRA 4MNQB 4GLPA 3LKRA 5I16B 1XGUA 1EEUA 2ILLA 3LRGA 4LGPB 1UYWL 4H1LH 5GISH 3D2UA 3ZO0A 4U2YA 3EYQD 4P2OA 3VRLE 1FVEA 5KSBA 4R9HA 2B7DT 3INUH 3V6BR 2FCBA 3IKCB 4QRRD 2X4OB 4Z7NE 1JN6B 4HKZB 5JW4M 1FO0H 1RAMA 2P8LA 3BP4B 3STZB 5I73C 1P5UA 3DI2B 3V0WH 4FTVD 3T0EA 1E27B 1V7NH 5KZCB 1UACH 2DTSA 3VI4F 1HHGA 3VXQB 2GAZA 4XH2B 1GIGH 5F9WB 4IM6A 2N4IA 2XNAB 1HHJB 5EBLA 2X1QA 3F8UB 2ERJB 2EDBA 4HKBA 4JFFD 4S1SH 3QUZD 5GRVK 1FGVH 1RPQA 2LE9A 1S7SB 2AJXH 4M7KL 3CLEH 4OFVA 2HFGL 3QIWA 2KKQA 1X5YA 2EKSA 1UZ6F 1YEKH 4KQ4L 4OUUA 3K0WA 4ODBD 4IMKC 2IAMB 4QEGA 4K3GA 5D5MA 3O4LA 3LQZA 3O3EB 3UROR 2FR4B 4EBQH 1J1PL 2GTWB 5D2NB 1HXMA 4WVRA 4R2GD 2Q76B 4ZO8A 4JZJC 5CIPH 4N1HB 4CJ0A 4LLWA 3UJIH 1HDMB 3C08L 1NGQH 1FFOB 3RKPA 2GI7A 4WV1C 1C5CL 2HVKA 3QHZH 1R24B 3S4SA 1SVZA 5L2KE 4ZFOA 3QXAA 1IM3B 3UPRA 1NCWL 5DVLA 3P77B 3RVUD 3M07A 1JE6A 5JXAH 1ZANL 4NO0D 3VXSB 5TF0A 5CWSA 3RDTA 1NFDA 1MLBA 3GMLB 5D7IE 1XGTB 4RA0C 2VDNH 2OL3B 3VXPB 4EXPX 4KK9C 5F93C 3IXAA 4PY7B 2DQUH 4ZFOL 3Q3GB 3I6KB 2YKLL 4U1SB 4ZNEA 2R1YB 1KN4L 3DVNB 1CD0A 3DI3B 1BOGB 3NFPB 5TQ2H 1Y6NR 3VD5A 2W1NA 1FN4B 4M8QA 4Q74A 5F7DA 4AL8L 5D71H 3STBA 4P3DB 1Q0YL 4C2AB 4CMMB 4AQOA 4PIRF 2NY3D 2WQ8A 1GYAA 3BDYH 5TH2A 1U8IA 5ALBH 3GKWH 5E9DE 1FLRL 35C8L 4HIJB 1LEKB 4PV9B 3HNSL 3F58H 4ZSOB 2HMID 2BY3A 1FNGA 2AJYL 4MXWL 4N8VA 3V4VH 1MH5A 1FRGH 2JB6B 1JYWA 3ILQC 3CH1B 2LVCA 4LLQA 1JHKL 3LB6C 1IVLA 4R97B 4MD0B 4UV4H 4GKSA 2BVEA 5D1ZB 3TJEL 4PP1C 5GZND 3BKCL 1DBBH 2IFFL 4F33A 3WIFA 3O6LL 3TPUB 4MNQE 5SWQA 4QXEA 1CBVL 6FABH 1MWAA 4I0KA 4MQXD 5ID1A 1T7XA 5EDXA 3DHMA 1G84A 3QQ3B 4J3SA 3VFNB 1QR1A 5C0IA 3NTCH 2PO6D 1B0RB 4I5BA 3I3DA 3UTPE 4CVXB 2VDQL 5E5UB 1MWAL 4L3EB 1C5DA 3WDJA 1LO4L 4Z78A 1J1OL 4QT5B 1W8AA 4F7MB 1IGYA 5I1IH 5CBEB 3X12B 4ZXBA 1QD0A 3TA3B 2R0ZH 1FSKC 1G7MB 3TVMC 4JDVA 5E5MB 1XZ0A 1J7VR 1X5ZA 2Z8WC 4HLZG 2H26A 2YEZB 1QSVA 1RHHA 5L2KA 3AB0B 1EO8H 5HYSA 3BN9C 4I48B 3P73A 1OAXL 3MJ7A 3PABA 4XXCC 5CEZH 2EIBA 3UC0L 2XN9A 4N0UB 5JR1L 4WU5A 3C6LA 4GH7B 5HGHA 3MV7D 5D7IA 4MAYC 4XC3L 4C83A 2PR4L 5DRWB 1KELH 4GSDL 5D2NE 4RAUB 4KKLC 3QXUA 4Y0GA 3EYSL 1A1MB 1OAZL 2LVEA 4PRDA 3FL7A 3WPIA 4ODXB 3D18A 5IG7B 5DZOA 4IOFD 2YR3A 1VDGA 1WCQA 2YUZA 4G43A 4NN6B 5I75C 5IQ7H 1VFMA 4ECOA 4WI3A 3VI4E 4Y89A 1C12B 1N26A 1PG7W 2K7QA 5E1HB 2LQRA 5BV7H 3N85H 4DAGH 1KEGL 5DHYB 4BZ2L 3VXSE 2AEQL 1KTRL 1U8HB 4PR5B 5E9DA 2QHRH 1LO0H 4HQ1A 5DT1H 2V2XA 1YEHL 4UOJA 1ZHBA 2R29L 1Z9OA 3QRGH 2DQCH 3KNBB 3FN0L 3MREA 1UZ6E 4XNXL 5HYJD 5DC0A 2DQGL 2EKJA 3VE0B 5CGMA 4GBXD 4PJEF 2FX7L 3RUGF 1B90A 2UUDK 4MNQA 4MJID 5FYKD 1WV7T 1Z9SA 1SJVA 4HWEL 4R0LB 4NJ9L 2DBLL 4GS7B 4PJ9D 5HDQH 2CJUL 1TVBB 3SOBL 4TVPD 2AJUL 3Q5OA 4NN5B 5DMGC 4LDEB 4MCZB 1D9KC 2X4OA 1JN6A 1DFBH 4GAJL 3VXOB 3BP4A 3O3AB 3STZA 4ZSOE 3ARFB 3S97C 1AGBB 4KNGA 3GJFH 4P3WA 3RVWD 4HH9B 1SBSL 1JL5A 4AEHH 1CGWA 3VXQA 4XH2A 3ARQA 4HXAH 1RZ7H 3KDMB 2XNAA 1HHJA 3I50H 1A0QH 2EYSB 3UAJD 2DYPD 2A0ZA 1IAIL 3C9NB 2OMBA 2EDDA 3AMKA 2Z63A 1WBXB 4UILH 2R4SL 5DQDH 3KPTA 1S7SA 3Q2CA 2GJ6D 1F3DJ 4ZMAT 4HG4K 5IBLD 1IL1B 2FH6A 4OLZH 1GOFA 5EU5B 5IMLB 1N7MH 2BX5A 5KVFL 1WBYB 2IAMA 4PJEB 3P40A 3RUGB 1EA9C 3R1GH 4O5LH 2FX8L 1GJIA 4L3EE 3EHBC 3O3EA 2FR4A 5GS0A 4MJ5B 4NM4L 1AHWC 3KPNB 4OFIA 1G6RB 2I26N 5D2NA 2X4SB 2Q76A 1BFTA 1P7HL 4KTEL 1G7HA 2AQ2A 1FE8H 1HDMA 3L5JA 2EDXA 5I66B 3GSWB 4NWTL 1PFCA 1FFOA 3VJ6B 1A6PA 3TIDB 5GS0L 3TBTB 2ZSVB 3LKSB 1R24A 1L7IH 4UQ3B 3TPKA 1RUQH 4M1GL 3RX7A 4PTUB 1Y0LB 3PWJA 3PNWB 3JUYA 5E00B 2R0KH 4L3FA 2XWJA 4N0UE 3VXSA 4N90E 1WQVT 1P7KB 4IMLB 1YJDC 1RK0A 3UX9B 4K71C 3VH8G 2I25N 1XGTA 4OSUL 2WNGA 5D93C 2OL3A 3VXPA 4QXWA 4LI1A 3FQUB 4CVWA 3Q3GA 4H26B 1I1AB 3DMMB 1D5BB 4FQPA 4U1SA 2R1YA 3ME0A 3UYRH 3DVNA 2JJWA 4NRZA 2AKRB 4Z94G 1P8VA 3SDCC 1NGPH 5F7EL 3CSPA 5C09B 1BOGA 2OL3L 2X89D 4GJTB 3NFPA 3MA9H 4TUOA 1LE5B 4DFIA 2BHYA 3DETD 2PTTB 3TF7C 5F1SA 1FN4A 32C2B 3HNTL 5C0CD 4P3DA 4G42B 5AWNH 2EDWA 1XCQB 3B9KC 3RBGA 1VPOH 3IJYB 5BO1L 3H2WA 4XPAL 4ERSL 4HIJA 4YEFA 4PV9A 1DQDL 4F58L 4ZSOA 4M9OA 4MXVF 4KZDL 4FFZL 3IAPA 3N1FC 4Z77B 4QXUL 2ICES 2JB6A 4JQIH 3CH1A 2M26A 1DQLL 4IM8A 3MLVL 4MD0A 1D3CA 1H8NA 4HS8L 5D1ZA 4O2FA 4UV7L 3TIEA 3PWNB 4LEXL 2GUOB 4NQEB 4UIMB 2WFHA 1KJ3L 2K3TA 3QBTB 4MWFB 5CP7A 1QLEL 1IM9D 2NXYC 1OPGL 2AJVL 4NC0B 1UM5L 2DQDH 3HRZB 4K17A 1K8IB 2W59A 15C8L 1FZMB 1E6JH 1I3GH 5L7XL 1VADB 3QQ3A 3BP7B 4FQ1H 3VFNA 4DN3L 4POYA 1B0RA 4CVXA 2VDPH 3D0LB 3H3KA 4K9EH 4L3EA 3GBMH 5IB1B 2A1WL 3UL8A 3MC0A 4J6RL 4LSTL 3ZKMD 4BKLB 4YK4B 5CBEA 4OF8A 3X12A 2X40A 3TA3A 3NMEA 1G7MA 1HXYB 1CVSC 4Q3GA 2IQ9H 1FORH 1KPRB 4P3CL 3FRPA 4U06A 4WWKC 2YEZA 3B2UC 1SM3H 1LTXA 4I4WB 4I48A 1JNLL 5F7KC 3RRQA 4POZC 2P5ED 2GKIA 4KJPD 1J86A 3PL6B 1FC1A 4N0UA 4O2CB 5HI5D 4WFED 4KKCC 4LDOB 4L9LC 4PJEE 1IAIM 3RUGE 4NM8L 5GGQL 4H0GA 4K3EH 4KZEH 5TE7L 4WW2F 2C1OB 3HE7B 5DRWA 1UXSB 2FL5A 3BZ5A 4RAUA 4BQ8A 2HJLB 2V5TA 4DGIL 3QNYB 3IFLH 5T1DH 2NPLX 3ARYA 4ODXA 3S36H 1R3IH 3QHFL 1WAAE 3T2NH 2EEBA 5C08B 4ZAKC 3HC4L 1OD9A 3TZVC 1FPTL 2P42B 3ARED 5FM8A 1C12A 3WFDH 2FATL 3OKNA 3LMJH 2J88H 4OTXL 2FWOB 1YA5A 4KKAD 1HYSD 1CF8L 1FYTD 2X4PA 3I2CH 5DHYA 3TT3H 3HR6A 4PR5A 2MCPL 3T0EC 3FB7B 5EZJB 2HKHL 4PRAB 2C7UA 2NXZD 4JM2D 1KCSH 3ARGC 4PP2A 4OGAC 3L6FA 2A73A 4B53A 4LFHG 4N1CA 1IBGH 4TZHA 2VZTA 1V3MA 5IEHB 4RZCB 1CGXA 3VE0A 4MD4B 3HC3H 4X98B 2YSSA 3ORJA 3CFJA 4KHXH 4ZTOL 1SEBB 2Q1EA 3BIBX 1MRDH 3MROA 3MODL 3LY6A 4RGMC 1RUPH 2A0LD 4PLJC 5BW7A 4R0LA 4WW2B 4XMLL 3B5TA 1IC7H 4XAWH 2Q8BH 5DZNA 1MJUH 1Z0NA 1MRFH 4YHOH 1KCVL 4MCZA 5E8PB 3VXOA 3H9SD 3ZKXC 3O3AA 2AEPL 3ES6B 2BXYA 4HJJH 3ARFA 4EN3D 1SQ0B 2G9HB 1FNSL 3TWCL 1T21B 2V5YA 3D2UD 1OM3L 4P46C 3ULUH 5JW4R 2EE2A 3KDMA 4OQTA 4JREB 4NQEE 4U1LB 5D1QA 2X2YA 2EYSA 3FCTB 3G5YB 4C56D 3C9NA 3BGFB 4NGHL 4KVCL 5TPWL 4CAGA 2ZKHL 5HDBE 1TCMA 5ENWB 5HGBB 3WXVL 4P59L 1IL1A 4OQTL 3ZTNH 4NNPL 5IMLA 5EU5A 3L5XH 3W2DH 2ESVB 4XP6H 1S3KL 1WBYA 4Q9RH 3BZDA 4PJEA 3RUGA 4AEIL 4NJAH 5C1MB 4OCXL 3AC0A 5JW4N 5J3HC 4HULB 3HG1D 4MQSB 4J0MA 3ZKQD 4MJ5A 1WISA 2Y06L 4TTDD 3KPNA 2W91A 2LAAA 1G6RA 2PXYD 1UB5B 3HTLX 2X4SA 1X44A 1DDHB 3RVTD 5EC1B 1VACA 3U7AA 3KJ6H 2VIRA 3CLFL 3VD7A 3MLSL 3QIWD 1NLDH 5B4MC 1N4XH 3UBXI 3BQUC 3VFRA 5I6XB 1EO5A 3W39A 5F3BB 1CFVH 5DSCB 4Y5YC 3VXTB 5I66A 5IHZB 1T5XA 3VJ6A 1CD9B 1WAAA 1F4XL 4MXVE 3TIDA 3TBTA 3LKSA 4AQ1B 4KK5D 3WBDA 5GMFA 1J10A 1G6RL 1JTOA 4N0FB 4UQ3A 1YYML 1MNUH 1CXEA 1TDQA 2ZCLL 5HHVH 3CD4A 4WGWB 1JWSB 3SDXF 3D9AL 2X1WL 3PNWA 3ZHDA 5ACZA 1A9EB 1NMCB 4JHWH 4OIBA 5GIRB 5EZIL 1P7KA 3UZQA 4IMLA 5KVGL 3IAQA 4YXHH 1MQKH 2QBWA 3S96B 1OAUL 1NAKL 3MJ8A 2V9TB 3C5ZA 3FQUA 3F7VA 1X4ZA 1I1AA 4HPOH 3VD4A 3KS0H 3DMMA 3O45A 2K1MA 5HGDB 1DSFL 3BI9X 3EJZC 2Q7NA 4NHCL 4ZOCA 3CFEB 5IVZB 2AKRA 4R8WH 1GC1H 5TDPB 3RDTD 1T83A 5C08E 4ODVL 3VFGL 1U92B 4LXRA 5GGVH 1YNTB 2AV1B 3U6RA 5INCB 1LE5A 3IU4L 5FYLD 2PTTA 3UJJH 4L8CA 1NCAH 3P4MB 5KTEH 32C2A 4JPWL 4LRIA 4G42A 4OGXL 1XCQA 1E6OL 1M71B 3JWDH 2BNQE 4WTWA 5GXBB 4W6XB 5GRUH 3M18A 1RJCA 5JOEA 4KRPB 4TUKH 1T89C 4RWHA 1MVUB 1PZUB 3F6LA 2B0SL 4LFHD 4Z77A 3KPLB 3ARBC 3F7YB 4S1DC 5D8JL 4LCYB 5GHWH 2FGWH 3HI6H 3D69B 5BVPH 5HI3C 3DGCR 3SDXB 1CFSB 3BHBB 1P1ZB 1QP1A 4JN1L 3PWNA 4CMHC 3X3GH 2GUOA 3CMGA 1BBDH 4NQEA 2MPAH 3GMMA 1YY9C 4IEFB 2DOCA 4Y5VC 1E4WL 1VGEH 1Q1JH 4MWFA 3IDUA 2CD0A 4F57H 5FUOH 1KBGL 3MOQA 3HRZA 4MS8C 3OGLB 3REZA 1K8IA 1FZMA 4HUVB 3ZYJA 1VADA 3ULVH 3C6LC 2X70B 4ZS7H 5FCUH 4KUZL 5KAQF 2B2XL 1U93A 4MQTB 4GLRH 4FFVD 1FFNB 2X1OA 5EUOF 3SDAB 1K9TA 1AC0A 5DHVH 5T33H 5LWYH 3JTSB 3Q1SL 1REIA 4QHNB 3IJHB 2VZ3A 1UJ3C 2BC4B 4OLXH 4BKLA 4JN2A 1YEIH 4NWUH 1YMMB 4BELD 5DJYB 5C6TH 4KHTH 1MCNA 4LPUA 4G8FB 4RDQF 1HXYA 3BGMB 4JRYA 4IBLT 3CSGA 1KPRA 3NZ8B 3S7GA 3BD5A 5B38B 3CDYA 3QG6B 1I9EA 1J0HA 5CZVL 4YDIL 4I4WA 3WFBH 2H1PH 1NCUA 2NY4B 1NCCH 2Z64A 5HVGB 3PL6A 2ESVE 3MJ9H 4D3CH 4O2CA 1FJ1B 3Q48A 4ZFZA 3OXRB 4G6ML 1A1OB 1V7MH 3BKML 2C1OA 2DM4A 5CKGA 1YECH 5F9OH 3VMPA 2WWKO 4OZFG 1UXSA 1D5IL 1GZQB 1P9MA 5HYFA 1TMCB 2QQLH 3NCJL 3JXAA 1NGYA 2IPUG 2XICA 3QNYA 4LQFL 3I3BA 3HPLB 2VN4A 3M19A 3MRIA 3KVQA 3RIZA 1B0WA 5EUOB 5C08A 2YXFA 1UWEH 4P2CG 4PJ5E 2NY1C 3RZCC 2ITCA 5B39G 4I3SH 3STLB 3T08A 3W3JA 4WFFE 2FWOA 5CGTA 3CFKB 1ZEAL 5EO0A 5CUSH 2NR6D 1FVCB 2BNQA 5DC4B 3FB7A 3BEVB 3IFOB 4ZO7A 4G7YH 1T7YA 5TJWK 5LGKA 1CYGA 3IETA 2XXMB 1LEGB 3N1GC 5IOPA 3T65B 1OAYH 3GSNA 4PTTA 1U3JA 5GQBA 5ESAB 5TDOB 4KC3B 4M7LT 3G6AB 1DVFB 4RZCA 3OKDB 5KVMC 3P9LA 4L5FH 3SDYL 2CK0L 2HVJB 4X98A 2G2RA 2Z8RA 1SEBA 5E9DD 4FA8A 3PWLB 2BJMH 2VL4A 2D7TL 4ZODA 4WUKL 4WW2A 4DKDC 3QEGL 5MEPA 3BPNC 2QKIB 4NBXB 2X7LB 4I0PA 4MA3B 4OM1L 3FB8B 2E7MA 5IMMA 4PB0L 5E8PA 2CH8A 3DX7B 3RHWF 4TULH 4M93B 5GPRA 3LPGA 4YDLB 5JXEA 3ES6A 3E6JA 3VRIB 4GXVH 4LARL 1C16B 2Z93A 2G9HA 1EMTH 4MNQD 3QRFM 4Z5RB 4F15C 1T21A 2RFXB 12E8L 5FUZH 1EGJH 3UZVB 1ZVSB 5DVOA 2VABB 2X10A 1N3NB 2R9HC 4IJ3C 4PG2A 4YHZH 4BK5A 3MV11 5IGXL 4CN1A 5E08H 4LCUB 4U1LA 4DWHA 3FCTA 2VC2L 4XP4L 4F80A 3UTPD 3V4PL 1G9NH 2FB4H 2O6SA 1MFDH 1YEFL 1BZ9B 5ENWA 5KZCD 5HGBA 1MCDA 4RWTC 1BECA 5BVJB 2YPKB 2HAZA 2ESVA 1XGRB 4H1LB 1DBML 3MRRB 5DA4A 1OARH 3IDXH 4N9GB 4LL9A 4ZD3H 1CGSH 4UTBL 4GOSA 2WBJD 1FO0B 1PY9A 2P48B 4YXLH 4ZUSA 3D85D 3LKPB 1DDHA 1I9JL 4ZUVB 4LBEB 4PRNB 5EC1A 4EZGA 5CSZB 5DRXB 3RPIA 5GSVA 1YMME 1CZ8L 5F3BA 5DSCA 3VXTA 5IHZA 5HXMA 4HX1B 4I18B 1KLGB 4PJ5A 2PUQT 4X4XA 4N0FA 3FFCD 3NBNA 5GS0D 1S7RB 4B8CD 4MMZC 3VXNA 1JWSA 1WBZB 1WGOA 5AD0B 2ASSB 5I9QB 4E9LA 2MSPA 2HWZH 5E4IA 1A9EA 5GIRA 3VMOA 5JA9A 5E03A 1HH9B 4DN4L 4WGVB 3S96A 4Z7VF 2QADC 3BP6B 4XTRC 2O6RA 2O93L 2V9TA 1DUYB 4HUMB 4EI5A 3L7FB 1JFQL 3O0RH 5B3NA 1HH6B 3CFEA 3QO0B 5IVZA 3VDBA 1S9VB 5T1LD 5TDPA 2YD8A 4KMLB 4DW2H 4EOWH 4BFEA 4XPFL 5CIPB 5EUOE 3SQOL 3V6FB 1YNTA 3ZSSA 2AV1A 2CIIB 4LMQI 5INCA 4L9DA 1JV5B 1ZLVH 5F96L 3EIFA 4JFYA 2BNRD 2Q7YA 3VMNA 1JTTA 3PWPB 1H8OA 5TF1L 2CIKB 1MJ8H 1JZ3A 4I2XB 4Y88A 5A2JH 4J3OC 4AIXA 2A9ML 1G7LA 1MVUA 3TN0B 5GRJH 4MN8B 3KPLA 2XZQH 4XNUL 4P9HL 4JO3H 4LCYA 4JLRB 4WW1A 4LSPH 1CFSA 3BHBA 3P9WB 3LS4H 4JFZL 2HFEA 4RRPA 1NL0L 3E6HB 2E27L 2EH7H 3IJSB 4Z7VB 3GSVB 3ZTJG 2H41A 2W0FB 1EAPB 1QTYT 2DLGA 3G6JE 2OBGA 3VGBA 4FXKB 4DUVA 2HLFD 2HLAA 1JGUL 3G6DL 2J6EH 3QUZC 4HUVA 3EUUA 5C7XL 3Q6FB 5D1ZD 4K7FA 3QNXB 4IRSA 1WT5A 3SDAA 4J3VA 2O26U 3VGFA 3JTSA 1HKFA 1BX2B 3KPMB 5GJTH 5ICYA 3IJHA 2D9CA 1HOCB 2BC4A 2NLJA 3RGVB 3GSUB 1YMMA 1NAMA 3KLAB 3O6MH 4OCRL 4YWGH 2VLRD 4P5KB 4R2GC 4HF5H 4XBGB 4WNQA 4XVTL 3QCVH 1JRHL 4G8FA 4JPKL 3BGMA 1JPGB 3H8NA 3KPSB 3NZ8A 5EUKA 3OAZH 5B38A 3D0VB 3QG6A 3FKUS 1C7TA 1EFXB 2GSIB 1BFVL 1IQWH 3OKEB 1IARB 2APVA 3MQIA 2G5BB 2BOCA 4HQQH 2E7LA 3AS0A 4HEME 1T0PB 2VQTA 5IHUL 1DANT 4OLVL 4HXBH 1FJ1A 1AE6L 2Y72A 3OXRA 1KFAH 3O6NA 1J1XH 1WEJH 4IRJB 2XZAL 4JB9H 2DQEL 3DUSA 4P23B 2XA8H 4M5YH 2ARWA 3QCUL 4L1HA 5DI8B 1GZQA 2V5MA 2W0LA 3BPOC 1A14H 3GI9L 5LXGH 3GDBA 3HPLA 4MZ2A 1HQ4B 2VLJA 3MCLL 1RU9L 2LU4A 1NSNH 1OZNA 2YD6A 3RTQB 3SB4A 5EUOA 3LZFL 3O8XC 3P4LA 3N9GL 2XZZA 4LF3B 1BEYL 4UT6H 3STLA 4Z95H 4Q62A 2XYCA 3CFKA 4MSWB 3ARDC 4G6JH 1TJHH 4XNYL 5SWZA 3DUHA 1FVCA 4IRZH 1MF2L 4YUEH 1BQLL 4EDWL 3KLHD 4U1JB 3BEVA 3ISWA 3IFOA 4KU1A 5K9QI 2NY3C 5ELIA 3MBXH 5I1LB 2WMPA 4JRXA 4HBCH 3HCVA 4QHMB 2R8SH 2FJHB 1U8LA 3BJLA 1LEGA 1OSZB 2HMIC 3T65A 4Q9QH 4S1QH 1C1EH 2D7PA 5DK2B 1GGUA 2NNAB 4TNVF 5ESAA 5TDOA 3G6AA 4M62H 3OKDA 2NYYC 5D1QC 4ELKB 2DM3A 3LCYA 2HVJA 3OAUH 4Y61B 5BMFH 1AXSB 1HHHB 1CWVA 4XNQB 5MEQA 3TFKD 5T3ZD 1N2RB 3EDFA 5SX5K 3G6JA 1K5NA 1TJIH 4HWZA 2WWMD 2QKIA 1A3LL 2X7LA 5DD0L 4P2QA 5FYJH 1MHPH 2V2TB 5EOCH 4Z7OF 3IT8D 1OY3B 1U91B 3PWPE 3DX7A 3BPLB 2IPTH 2YUVA 2WW8A 4YJZL 5BV7B 1D5MB 1JNNH 1YEGL 5DD5L 2AABL 4YXKH 1DP0A 1C16A 2M1KA 5DJZB 3OGCB 3O11A 4U1GC 3WIHA 5ISZB 3E0GA 1KXVC 4JKPL 5E8DL 4TSBL 3S8WA 4U1NB 1BIIA 1E4JA 4HK3J 1XEUA 1MCCA 5EOQL 1I9IL 1XFPA 3MRPB 4K8RL 1CQYA 2BERA 5DD1H 5BS0B 4MDJB 4BSJA 3IF1B 5I71B 2R2HB 4R4FH 5C0RH 4WTZG 4Z7VE 3WIHL 1MAMH 2VDLH 3GRWA 2QSQA 2EDJA 1BZ9A 4U4BA 3WD5L 3OXSB 5TE6H 2XRAH 3M17B 5D70H 4GT7A 1RIHL 2YPKA 3RWDB 4XC1H 4NN7B 1XGRA 1FQVA 5I15L 3PV7A 4NNYB 1JNJA 2HJFB 2QQKL 3DTXB 3GRWL 4DCQA 4UNVA 2VMFA 1A4KB 5EU7C 1RK1B 1F3JB 1FC2D 2ORBH 5L2JB 1VFAB 3T8XA 1PYWB 3LKPA 5DURD 4DVRL 4LBEA 4PRNA 4WFHD 2Y36H 3GJFB 5CSZA 5DRXA 2L4OA 1KIPB 5GISL 4KK6D 1T83C 3VG9B 3K4ZA 3INUL 4PRPB 5HZLB 1M7XA 2PN5A 1FO0L 4HX1A 1KLGA 1GXEA 3KPSE 4IOFC 3QP3A 4YC2C 1P4LB 4LRIC 3V0WL 1S7RA 1VB9A 3T2QA 1WBZA 1V7NL 1UACL 4F2MB 5AD0A 4P91A 1NUDA 5D7JD 1GIGL 2HN7B 1N6QH 3BP6A 2ZUXA 1F4HA 1DUYA 2ADJB 4S1SL 1CIUA 1FGVL 3L7FA 1BOYA 2AJXL 1HH6A 3CLEL 1RVFH 1A02N 3QO0A 3GMOB 3MTRA 4OI9A 1F11A 1YEKL 4RGOH 3FO0H 5CIPA 1FS2A 3V6FA 3SGEI 3NIGF 2CIIA 4GKNB 3FOLB 1JV5A 2IFGA 2NY2C 3PIQB 1X5XA 3V2AR 3PWPA 2BRRH 3DMMD 4U6YB 1JNHB 1W0YT 3TT1H 1QFPA 4X7EC 1U8OB 2FYYA 4LRNH 3UJIL 5CEZE 4LHQB 1BQHG 4QGTA 3GJEB 5C09D 3TN0A 1NGQL 2BDNH 5CEYB 1B6UA 5GRWA 2ICWI 1X5FA 3QHZL 4P99A 4WU7B 3TGXA 3EFDH 4JKWA 2XZCH 3CH8A 1YNKL 3E6HA 2CPCA 1QFWL 5FK9B 1YYLH 2FDBP 3U46B 4Z7VA 3GSVA 3FO2A 4BSVB 2W0FA 1EAPA 4HAGA 3RWCB 4EQ3A 3QIUD 4OLYH 1LILA 4LVHC 2VDNL 5ADPH 1ZTXH 7FABH 2DQUL 2YD1A 2YUWA 3S3SA 4NHUB 5HDOA 1H15B 1WUNT 2VOTA 4ETYA 5IBLC 4NQED 1KENH 4XCEA 3SBWC 3BMWA 1U8JB 2CUMA 3UJTH 2MQ0A 3KPMA 5M95B 4XGZB 3RWFB 5TQ2L 5BRZD 5EU6B 5CJXC 3RGVA 3GSUA 2Y6SD 3QUXB 5D71L 1EUUA 3QXWA 4J8RB 1I85A 4XBGA 5E2TH 3A6BH 5BS0E 5ALBL 3GKWL 1MCJA 1JPGA 2UY7A 4U05A 1YJDH 3EZJB 4O02H 1GRWA 3DX9B 2X9YA 1T22B 3F58L 3D0VA 1U3HB 1EFXA 2GSIA 3V4VL 1FRGL 3CCHB 2VZ1A 2G5BA 3JVGA 4MYWB 1T4KA 4EUPG 5BZDB 5DUPL 1BAFH 4UV4L 3D3VA 3C6SB 3PQYB 3SE9H 4IRJA 2CGRH 1DBBL 3FZUD 2YC1B 4P23A 2DLEA 5IJVB 3RGHA 5IROC 5DI8A 3VWJD 4MA1B 1AI1H 3WPFA 5T1KB 1ZLWH 3T77B 4Z7OE 2VRAA 5IFHH 4TOYH 4HJ0C 5T1MA 4PRPE 1ZLSH 3OHXB 2G75B 3RTQA 4I0PC 3NGBB 3NTCL 4LF3A 4DGYH 4QHLB 3HE7D 5MI0C 4LI2A 2YD9A 5JOPE 4LVNC 2GCYB 2EDFA 3DETC 4L8SB 3L1OL 4JQVA 3BH9B 4QY8B 1DQMH 1WIPA 5I1IL 1FZJB 2ZJSH 1S7TB 5C08D 3EYFB 2R0ZL 3KS0J 1G7PB 4QHMA 4E0RB 2FJHA 4G6AD 2APBA 4I77H 1OSZA 4RQQB 3TCLB 2NY0D 5JZ7C 5DK2A 2NNAA 5L6YH 4ELKA 1EO8L 3GSRB 3OZ9H 4LOUD 4LVEA 5CEZL 1BREA 4XNQA 4MAUH 4YHNB 1N2RA 2EDHA 2VYRE 1QBAA 3CNKA 1FZOB 5EZLB 4KFZC 3GIVB 4EVNA 1KELL 1EJ6A 2XKSA 2OJEB 5B39A 1F5WA 1D5MA 3ULUF 3V5HB 3MJGX 3OGCA 5DJZA 3RJQB 1QBMH 4H0IA 4XNZC 3MRNA 2VJXA 2QSVA 2W65B 5IQ7L 3MRJA 4KKBD 4PS4H 4OFYD 2YD3A 3AFLA 5D6DA 5I8OH 5BV7L 1JGDA 2P5WD 3N85L 3SE3C 4DAGL 3ZKMC 2A6KA 5JDJA 3MRPA 2D3VA 4BFGA 1A6ZB 3BDXA 4PD4J 2C4XA 4RGNB 5BS0A 3IF1A 5JXED 2R2HA 2QHRL 2Y4SA 1LO0L 2WQVA 5DT1L 3BKYH 3MLXH 3OXSA 3DGGB 1MFAH 2XY1A 3M17A 1UWGH 3RWDA 1G0XA 3QRGL 2DQCL 3FQNB 4NNYA 1LQSR 3TCXA 1IT9H 2CKBH 1EFQA 3LH2H 1A4KA 3K2MC 5HI5C 1F3JA 4EI5C 4FG6D 1VFAA 3NCYP 1PYWA 5JLZA 2EO1A 1U8QB 5DK3A 1CFTA 3JSSA 3QDJB 5HDQL 1FYHB 1KIPA 2DL9A 4UT7L 3RW6A 1NJ9B 4PRPA 2ESVD 1A7RH 4EQ2A 2VDOH 4I9WD 5D96B 1DFBL 2UVFA 1NFIB 1M7IB 4D0BB 1P4LA 5K33A 5DF0A 1ZGLM 5IK3A 4F2MA 4AEHL 3H3PH 3AREC 1TETH 3L3HB 3DIFB 4Y5XB 1EZVY 4HXAL 4FS7A 3TO4B 5JHDE 2Z91A 5CGYD 1RZ7L 4KI5F 1HYSC 2R4RH 3PQYE 3UO1H 2JIXB 2DWEB 3I50L 1A0QL 4PRIB 2G60H 2XA3A 1NGWB 3SO5A 2XG4A 1F90H 2WK2A 4YHLL 5C92A 2B5IB 2IH1B 4LHUB 3ROLB 3UDWA 3U48A 4UILL 5DQDL 5BJTB 1C5BL 1F6AA 1KB5B 2KH2B 2IBGA 4OLZL 2EC9T 1N7ML 4PKIG 1P9AG 4WHTB 1OLZA 4GKNA 4P5TC 3R1GL 5BQ7A 4O5LL 4RSVA 1L4IA 3FOLA 3HMXH 2JLLA 1I8IB 5AUMB 2K7PA 1XIWA 2A0LC 3T4AB 1H0DB 5F3HB 3PIQA 4U6YA 3OKLB 1JNHA 5EFIB 1HQRB 2EXYD 1U8OA 5KSAB 3BUYB 3GIZL 2FJFA 4R5CA 5IHBA 2EIZB 3BGAA 1FE8L 1LO5B 3GJEA 5FA4B 3QT2A 1U41A 2AXJA 4HC1A 3IKKA 4M3KB 5CEYA 1WCBB 3HLAB 1IC1A 2VQ1B 1K2DB 1L7IL 3HZMB 4WU7A 1TQBB 1RUQL 3SN6N 4ETQB 2XWBB 4QXTB 5FK9A 2R0KL 5EBGA 2WIIA 3ULVF 4RBPH 3DUUB 1HI6A 1BF2A 3U46A 3IRZA 2Y1VA 4BSVA 3VWKA 2E7LC 4TNVK 4P2YA 3WNMA 2YPVH 4U7MA 3D6GA 1M05A 4NHUA 4HS6B 1OTUD 1YMHB 1VESA 1JHTB 1H15A 4MMXC 4OF6A 1MUJA 3UYRL 1QFHA 2YA0A 4YQXH 1K3ZA 2GITB 2L0DA 3X13A 3KPRB 1TLKA 1U36A 3KLSA 3CIGA 1U8JA 5ANMA 1A6TB 3ZHKA 4NBZB 5ID0B 3V8CA 4G8GD 1TVHB 2HT4D 3L3IB 3GJFK 5IQ9B 3MA9L 4XGZA 3RWFA 2ZUQC 4U7SA 3CFCH 5I1KH 4Y4HB 4TTDC 4IDJH 3H42H 4IHOB 1ZMYA 2PXYC 4R58A 3QUXA 5AWNL 1YRGA 1FFQA 5HHMB 1VPOL 2NY5C 4R4ND 5LJYH 3BVNB 4RGNE 1AGDA 2IFFH 1NUFA 4YDJB 2IF7A 2YBRB 1BF8A 3DX9A 3SDAD 1CBVH 1T22A 1IFHH 1U3HA 5EU3B 4OV5A 4XCFH 3CCHA 4LSRL 2NX5D 4JQIL 4Y4KB 3A79B 3U30B 3R8QA 5BZDA 1WWBX 1NDMB 5JHDA 3PQYA 1J12A 3WIIH 5HHOB 4AM0A 2JJTC 2HTLD 5C9KA 3OPZL 2P24B 3EDDA 3T77A 3HI5H 3QDJE 2JK5B 5I74C 4RISL 2DQDL 2FECL 3GHEH 1CR9H 4ZNCD 1E6JL 3P2TA 2YMXH 1XCDA 4FQ1L 1Q72H 1Q0XH 3UCRA 3ULUE 1I7TB 4HV8B 1VCAA 3S37H 2VDPL 5ECJE 4K9EL 1SJEA 4QHLA 1KYOJ 3GBML 4UDUB 1QLFA 4CILA 2GCYA 3NIFF 3QCTH 4L8SA 3QI9B 4QY8A 4K8RC 1MCIA 3TBVB 5HHNB 4S0SD 5JR1H 1FZJA 2BVQB 4U0RB 4BQ6A 3AS3A 4PRIE 2NW2A 1R5IB 1ETZB 1G7PA 4LLVB 4HT1H 1M7DB 3IDMB 2IQ9L 1FORL 3BE1H 4RQQA 3TCLA 2BVPB 1T7WA 2DKSA 4JKMA 1J9CT 2XPGB 1HWGB 3LD8C 3OGOE 1SM3L 4UAOC 4S11A 4XBEH 1OAZH 3WJLC 3E1F1 4YHIB 4PGJA 2H2SD 3VCLB 3S88H 5D72H 1EEYB 4YHNA 4KGLA 5IKCB 3FO9B 3ROOB 4JO2L 5AYUH 1AXTH 1PG7H 4K3EL 4KZEL 5CJ8A 4P49A 3GIVA 5DFWH 1YN6B 4UDTA 1SMAA 5JNYB 1DUZA 1DVFD 2OJEA 3IFLL 2AEQH 4NYLB 4YFLI 1F8TH 2P7TA 5T1DL 1J8HD 3EAKA 2EDTA 3V5HA 1R3IL 4QRQB 3T2NL 4LGSB 4U1HB 5CKAA 3LRSA 2W65A 1JMXA 1F58L 1OP5H 3OL2A 5FCSH 2Z82A 4JO4H 5AZEH 1Z0MA 3WFDL 3LMJL 2J88L 1YQVH 3T1WA 1RZKC 4ODTH 5IT2H 1WFNA 4KMTH 4KI5E 1EH9A 1I3UA 3I2CL 5I18H 3O6FD 4D0DB 4YH6A 3UPAA 3PGFL 5C0FA 1KOHA 4LVOC 2GSGA 5IVNA 3F65A 4HWEH 3BYTA 1KCSL 2IEPA 4LP5A 4RFNB 3KWWB 2OMXA 3DGGA 4L4VB 4Y8AA 4PJGF 3JV5A 1IBGL 5JDSB 3FQNA 3FOMB 4UQ2B 1IILE 1UVQB 2ICCA 3KJ4B 3KPRE 1SQ2N 3HC3L 4XP5L 4RNRA 4H8WC 4KHXL 3QEUB 4AENA 2ZOKB 1HNGA 1MRDL 1QPXA 1RUPL 4HGKC 1U8QA 1IC7L 4XAWL 2Q8BL 3QDJA 1FP5A 1C7SA 2ZUTA 3MO1B 1MJUL 3RY5A 1MRFL 5J12C 4XMKH 3W11D 5HHME 3UMTA 5IW1B 3ULUA 4OCMC 4XB7A 1NFIA 2NZIA 2X41A 4X6DF 2I9TB 4D0BA 4HJJL 5EBWB 4M6MH 1YDPB 2NW3B 2ZUSA 5HVHC 5F7WC 1II4E 2WSKA 1BIHA 3DIFA 4Y5XA 3KYOB 3TO4A 1EXUB 1FL3B 4Z6AT 3ULUL 3VRJB 2JIXA 5HHOE 3ULVE 2DWEA 4K94C 1GGIH 5EZOH 4PRIA 1N8ZB 3JBG7 1NGWA 1ZWIB 3MUGB 3WFCH 3JWOC 4LHUA 1U42A 3ROLA 1MCFA 5BJTA 4PJGB 2JJSC 2C3WA 4Z7WF 5DC9B 5L0QC 4JVPA 5KANI 5C6WH 3ZTNL 4KTEH 3O4OB 3W2DL 1EHLH 3LEVH 4XP6L 3L95B 4Q9RL 4BQBA 3HE6D 4NJAL 2FEEL 3FMGH 4NPYB 1I8IA 5AUMA 1J0KA 3T4AA 5F3HA 2R2BB 2YWZA 1FNEB 2PW2B 3O9WA 3B9EA 1M4KA 1ONQA 3OKLA 3HAEH 5EFIA 3KJ6L 3V0VA 3LKNA 1NLDL 1N4XL 5KSAA 3BUYA 5A2FA 1DCEA 1UT9A 2EIZA 4XHJC 5D7LB 1CFVL 5FA4A 4X6DB 2CRMA 2OTWB 3WKNA 3EOYG 1ZS8B 3PDOB 3V95A 3HLAA 2VQ1A 1X5GA 1K2DA 1RJZA 3HZMA 5DD3H 1MNUL 5L8JB 3EYUH 5HHVL 3B9VA 3FHQA 5JW3L 4ETQA 4HHAB 3TJHC 1A6AB 2HH0H 4JHWL 2VXUH 1MFBL 4J4PD 3DUUA 3MBED 5ESQA 5EOCJ 4B7IA 4F7EB 3RY6A 3TN0D 1MQKL 3JVGC 2CLZB 1J8KA 1FIGL 4P4KD 1WZMA 3FQTB 3QWOB 1QSZA 5E6IA 5CD3A 5I73B 4YIQB 4HLJA 4Z7WB 4HS6A 1S9WA 4HPOL 1YMHA 4EXKA 1JHTA 5BO1H 3WHE0 2AVGA 5C3TA 2UZYB 3KPRA 5F9WC 1A6TA 1DQDH 1JWUB 2RIKA 4R8WL 1GC1L 4CU7A 5K9OB 1TVHA 4PJHF 3K7UA 4QXUH 5GGVL 3L3IA 5IQ9A 3T4YB 1XWDC 4J4LA 2WBJC 2ATPB 4Y4HA 3RGZA 5DO2C 3UJJL 2E9IA 1NCAL 3NIFE 5KTEL 2YPLB 4IHOA 3NA4A 2ZCHH 4XP1H 3U79A 3BVNA 3JWDL 1JIBA 4YDJA 2CUIA 1HINH 2DQJH 5GRUL 2YBRA 5EU4A 4TUKL 5EU3A 2D4FA 4B0MM 1CLZL 3MUY1 4L4VE 3MRMA 5DJ2B 4Y4KA 5GHWL 3RGVD 3HI6L 5BVPL 2EEDA 3OJ2C 3L5WB 5F1KC 1LK3H 3X3GL 3ULVA 1OWWA 5IIEB 2MPAL 5EIIB 4JZJB 4H25B 5DMKA 5I30H 3KPSD 2OZ4A 5B0TA 2COQA 1I1CA 3WJJA 1VGEL 1Q1JL 3GEWB 4EDXB 4F57L 5CMNA 1F42A 5FUOL 4AEFA 3HB3D 4LSTH 2JK5A 5DHVA 2X9WA 4PGEA 3GKZA 4WV1B 4KUCF 4FXGA 3WLBB 4F3FB 4XBPB 3ULVL 2ZOLB 4ZS7L 5FCUL 3R0NA 1I7TA 4HV8A 3FHAA 4I13B 2OZ4L 5F6HI 1ZHNB 1A21A 4P23D 4PJHB 3MGTB 3O2WH 3C8KB 5LKNA 3P30H 2AXFB 5T33L 4DTGL 5LWYL 4MD5B 2YS4A 3ETBF 3FT3B 4R7NB 4Y1AB 3NCCB 5CSGA 5J1TC 4OLXL 3QI9A 1K6QH 4ZPTB 3TBVA 2YZ8A 3O53A 1YEIL 4NWUL 4QLRA 3BZ4A 3WS6A 4EUPA 1BLNB 1B4RA 3MJ9A 4K2UH 5C6TL 4KHTL 4FQCH 5LCVH 1R5IA 1ETZA 3IDMA 4GRWH 4J1UB 4TNWF 2NZ9C 5DJ8B 4X7TB 2XPGA 4PJGE 4FQHB 2MJWA 3V52H 1OWRM 1OLLA 2BVOB 1IKFH 4AZ8A 2GEEA 1CD1B 2VR9A 3S34H 2H1PL 3WFBL 4IIQA 3MV9B 5I8CA 1NCCL 4YHIA 3MJ9L 4D3CL 4HD9A 3WSQH 4KXZI 1EEYA 1OW0A 5IKCA 1V7ML 5CEZD 3ROOA 2DS4A 3Q5TA 5DGRA 1FPTH 2YN5A 2Z8SA 3MYZA 1YECL 5F9OL 4OTXH 3ZE1F 1YN6A 3AY4A 5JNYA 2I5YH 2QQLL 2H32H 1WLHA 4NYLA 2P44B 1T04A 4M6OH 3AROA 5D7LE 5IWLA 4QRQA 4YAQB 4U09A 2OTUA 4NQSB 4U1HA 4P8SA 3JZ7A 1QRKA 3PV6B 1L6XA 4PY8I 5IR1A 4I3SL 1SMOA 4OCSL 3WUWB 5CUSL 1T66D 4ZTOH 4ZDHA 1VEOA 5E0QA 2BMKA 1I4FB 3MODH 3SCMD 1XECA 4G7YL 2GY5A 5ISZD 2B4CL 3KWWA 4PD4K 4L4VA 4HCRH 4S0TD 3V8OA 1KCVH 1OAYL 3FOMA 4X6BB 4XAKE 1UVQA 4L5FL 3W0WB 3KJ4A 2EIDA 2J8UF 4GKOA 5BS0D 3QEUA 4Y2DB 2ZOKA 1V3LA 3SJVB 2BJML 5SX4H 4WI6A 4I3RH 2HKFH 4NUJA 1UG9A 1AY1H 5DJ6A 3KYMB 3MO1A 4WI9A 5GS2H 3TVMB 3QA3B 4AJ0A 3N1PC 4R6FA 1EGJA 4AH2B 2I07A 4F9LA 5IW1A 4TULL 3ARPA 2V5RA 4IDLA 5EBWA 1EMTL 1EAJA 4JJ5B 4NRXB 5H94A 1YNLH 5FUZL 1EGJL 1A3RH 4MAYB 4BM7A 3KYOA 1EXUA 1FL3A 5IB2B 4YHZL 1NBQA 1FIEA 2IALB 4FQJH 3VRJA 5E08L 2I9LB 3DURB 4AEIH 1L9NA 1JJUA 1ZWIA 1S9XB 3MUGA 3MJ6A 4ONOA 4CNCA 1DN2A 1G9NL 2FB4L 2QHLA 1AO7B 1MFDL 2LAGB 4DGVH 3SKMB 3MYJB 2DMCA 4LHJB 4PJGA 4WJ5B 4JFPB 4JDZA 5I75B 4Y19B 1H6UA 1WIOA 1Y18B 1J5OH 3V0AC 5DJAB 3L95A 5F9AC 2BVTA 2J8UB 1M9LA 4WCYH 2DLTA 4N5ED 1OARL 3IDXL 4ZD3L 4PJHE 1CGSL 3LQAC 1XR8B 4NPYA 5GRXG 1ZT4B 1MLCB 2P4AB 2ZCLH 1U2HA 4YXLL 4Y1AE 1VHPA 4DUXA 4XMPH 2WWMC 4PG9B 3L3JB 2MWCA 2VNCA 2ZUVA 5SV3A 5D7LA 5J57B 2OTWA 2IANB 1ZS8A 2F9BT 3PDOA 4ZQKB 5E24E 2N56A 1MFCH 4QRPE 5J9PB 2ZCKH 2XKUA 3MFFB 4OB5H 2VITB 1Z9MA 1FG9C 4GS7C 5C0GB 3MV9E 2XFXB 4E5XA 2HWZL 3DROB 5L8LB 5IESH 2OMTA 3TO2B 2OQJB 1PAMA 1D9KB 4RCWA 2CLZA 3ZE2E 1OP3H 1IQDB 3OKYA 3HPJB 3QWOA 1ZT7B 5IMKB 2DWDA 3E2HC 2A6JB 4WEUD 4JPWH 1UZ8A 4YIQA 4BQ9A 2IQAB 2VR4A 3O0RL 2CXKA 4K7PH 1BMGA 1P7QB 3WHE1 4DW2L 3GSXB 4EOWL 5H35A 2FBJH 1QFUH 1IAII 5HYQB 2ATPA 2PTUA 4DQOH 5A2KH 1QSEB 4LPXA 2Y25A 5ETUA 4YX2L 2Z7XB 3LV3A 1PBYA 5GS1B 4KK6C 3SKOB 5DJXA 2H2PD 5DD6B 1QSFB 1JCKA 2BRQA 3VDAA 1YEDB 5GRJL 4IMKA 2XZQL 1IEBB 3UBXB 2YHGA 1BWMA 4JO3L 4JO1L 5EU6D 4LSPL 1UXWB 1FVDB 1U2CA 4XWOD 3ESUF 2V17H 5FYJE 3LS4L 1AHWB 5F1IB 2J6EA 4KUZH 3L5WA 2EZ0D 3W0WE 5D7JC 5IIEA 2QSCH 4H25A 2EH7L 1B2WL 5LVEA 4HKJB 5AWAA 4EDXA 3KXFA 1U3HD 3Q1SH 1UH4A 4K3JH 1KIRB 3RL1B 3ZE1E 1S8DB 5FYKH 4MX7A 4ALAH 1FL5B 4WV1A 1K8DB 2J6EL 1IC4H 3WLBA 4PB9H 4F3FA 1KLUB 2ZOLA 4TVPH 4F7CA 4V2CB 5CZKA 1B0GB 1ZHNA 3KPOA 1DANU 2BHZA 4PJHA 4FFYH 1KIQB 3C8KA 2AXFA 5IB3B 4OJFL 4MD5A 3FT3A 4R7NA 3SHSA 5FGRA 5T1KD 5GJTL 4LLDA 4K71B 5ERWB 5MEOB 4ZPTA 3VD9A 4UNUA 5D93B 1KYOK 3RI5K 4YWGL 3MLYH 3ESVF 4CGTA 1OTTC 1TNNA 4PLKD 4KT1A 5IFJB 5T5NG 2P47B 3QCVL 2A77H 1G1YA 4FQLH 4QRPA 5DJ8A 4X7TA 4XI5C 1BFOB 3SDCB 3BEWB 1IQWL 2BVOA 3IAGC 5C0AA 3SKNB 4Y19E 1KV3A 3B43A 4HXBL 1FG2B 5I8EB 3G04B 1KFAL 1J1XL 2J8UE 3PGDA 3B9KB 4V1DD 3NN8B 4JB9L 4UBDC 2N7BA 3T3PE 4NQUA 4TQEH 4IS6B 2XA8L 4M5YL 4B41A 3EO9H 1ZLVK 3QFJA 3QIUC 3QB7C 1A14L 1UKSA 2WM0A 5LXGL 4NQTA 4QHUB 5IVOA 1NSNL 1T0NB 3R0MA 4NQSA 4N5UA 1OOKG 3LSOB 3PV6A 3EYVB 2NTFA 5GMGA 4UT6L 4HLZH 5JMOC 4Z95L 3UTSB 1N59B 3CIYA 1A7OH 2NXYB 2Y07L 2BOBB 1MSPA 3IU3B 5A43C 5KSUB 2FIRT 3WUWA 4OI8A 1TJHL 3QWRD 2X4QB 5IJCA 2Y6SC 2F19H 4IRZL 4YUEL 1I4FA 4WUKH 5IJKC 3QEGH 3MBXL 3GSNH 1T80A 2XTJC 4HBCL 2R8SL 2YA1A 4PB0H 4S1QL 4JFDB 1C1EL 5LAXB 4X6BA 5DHXB 5KSBF 1FZKB 4M62L 2HT3D 3OBAA 3W0WA 4TRPH 2MCG1 2F8XC 5ABDE 4UU9B 3OAUL 4RGND 3QULB 4ENED 5BMFL 4M43H 3GGWA 5I1AA 3MRLB 4GRLD 4WIQA 2FEDC 5EA0H 5K9QG 1TJIL 4U1KB 3BRFA 1QSEE 4QHKI 1MHPL 1S7XB 3TVMA 4WI8A 3VWJC 5ADOH 3MNZA 1X4XA 4WWKB 4S1RH 3ZHLA 1JF6A 2IPTL 1CXKA 1JNNL 4TPRH 4YXKL 1QSFE 3IRPX 3O9WC 1U3ZA 1YEFH 4JJ5A 4MXQC 3GOZA 2CDFA 4L9LB 4CU8A 1UB6B 3HE7C 4MAYA 3C5JB 1MELA 3H7BB 3NIDF 4LSSH 5IB2A 4FQIL 4OZ4A 1NC4A 2IC2A 2IALA 3PHQA 4KVNH 3ZT5A 1E4KA 3HI1A 2ELLA 3DURA 4P0DA 4JY6A 4FQQB 3ULUD 4UTBH 5DD1L 4L29A 3F7QA 1S9XA 2CKBB 4R4FL 1CXLA 5D5MF 1MAML 2VDLL 1X5AA 3U9PH 3GMRB 3WFZA 9CGTA 5D3IA 3LKRB 5HSFA 3SKMA 3MYJA 3QZWG 3RBSA 1AGFA 1I9JH 5TE6L 5DUBB 2XRAL 3CK0H 4ZAKB 4NO3B 2J4WH 5D70L 3TZVB 4NQVB 2NY0C 5KSBB 4XC1L 5DJAA 5KJRH 2J8UA 2UY6A 1RZ8B 3WPEA 4LOUC 5E6IC 5IB4B 4WTXA 1X5KA 1XR8A 5F7MC 2ORBL 3SE4C 3MLWH 3T0EB 3LKQA 2N1KA 4PG9A 3L3JA 1R3LB 1M1SA 2Y36L 3ARGB 3OKMB 5KVDH 4XB8A 4R7DA 1ZA3A 4Z0BH 3B5GA 1G7IB 3I6GB 5EBLB 4ZQKA 5J9PA 3RVXC 4UMGA 4RGMB 2R1WA 5C0GA 3OV6A 5EORH 2EKSB 3DROA 3TO2A 1I8LC 4TNWK 3VGEA 2OQJA 1N6QL 3W9EB 2XXCB 5FOBB 2FSEB 3U4BH 5K9JH 4HK3N 1ZT7A 4PJIA 1X5LA 3LQZB 5IMKA 5C0BB 3ZKXB 1LP9F 2VQUA 2E6JA 4RFOH 1CK0H 2W9EH 3VRLF 1KG0B 1RVFL 4NRYA 4RMWA 3VFUB 4KI5D 1P7QA 3PG2A 3AVEA 4RGOL 3FO0L 4P46B 3GSXA 4JCLA 1DE4B 4XNUH 1WWWX 5IUSA 1QSEA 3UTSE 3SDDD 4KDWA 4WO4A 2Z7XA 4XCCH 1NDGB 1S5IH 3QXAB 3G06A 2BRRL 3TT1L 1T7ZA 4UTAH 8CGTA 1A2YB 5IF0A 3F7PC 4LCCC 3VFSB 4LRNL 1L0QA 1PX4A 1MFNA 3OG6B 1QSFA 4TUJB 4LNRB 1LD9B 4GKZA 5CFHA 3UBXA 1BHGA 3IXAB 4JFDE 1UXWA 1FVDA 3BXNA 3EFDL 1AHWA 2XZCL 5F1IA 3EJYC 4PRBB 3TBWB 2M8XA 1P4IH 5CGYC 1YYLL 1YZZA 1EBPA 1NUGA 1A7PH 4HKJA 3BQUB 4KTYA 3B83A 4Y5YB 3RL1A 3PXHA 1YPZB 4OLYL 4IIQC 1HN1A 1LP9B 4Y4KD 1FL5A 2ZG2A 5ADPL 1ZTXL 1K8DA 2F5BH 3B8SA 7FABL 1QRNB 3QHTC 3N1MC 3RWJB 3F5WB 2O5YH 4V2CA 5ALCH 3WNKA 1DN0B 3WYRA 5TH2B 1U8IB 1QA9B 5HHOD 1B0GA 1D5ZB 1KENL 5I1HH 5D7SL 2AQ3A 4QGYA 3UJTL 1KIQA 3U82B 3O41B 1DEEA 5IB3A 1FNGB 1ADQH 4TSAH 1NAMH 1P53A 5IHUH 5MEOA 5F7YC 5DFVC 1T1WB 3GSOA 4GKSB 4HBQA 4PBVC 5E94B 5IFJA 1A9NA 5GSRA 5E2TL 3A6BL 2EXYC 2OMVA 4F33B 2B4CC 1F2XK 3J7HA 5SWQB 1YJDL 4O02L 1CE6A 1BFOA 3SDCA 3BEWA 3GBNH 3T0BA 2D7NA 1WSST 4DZ8A 3SKNA 4XXDB 1BAFL 2R0WL 3B2VH 2DLHA 4H20H 2VLKD 4Y2OA 5EPMA 4JE4B 1KTKE 1HIMH 3SE9L 3VXUD 1F6LL 4HZLB 2CGRL 3NN8A 4X7DC 3HFMH 3D39E 4IS6A 3T0EE 3MOAH 1C5DB 2RCSH 1AI1L 2OMZA 4RFEB 3SE8H 3FXIA 4NT6B 5IFHL 3C6NB 3ARBB 4QRUA 1FH5H 1ZLSL 2AS5M 1OTUC 1P2CB 2NY5H 2WLZA 5E95B 4OV6F 4ZXBB 3BN3B 2O61B 1T0NA 4LLUB 1X4YA 1LEIB 4M03A 4BSWB 4CMHB 1SYSB 3LSOA 4DGYL 2OXHA 3FTGB 4PLNC 4YBQC 2H26B 4Y5VB 1J87A 3NIDE 2BOBA 5EOTB 5HYSB 1CXIA 5KSUA 3RX8A 3PABB 1WWLA 2X4QA 1QQDB 2XN9B 4YE4H 4JPIB 3C6LB 3QDGB 1P6FA 2OYPA 5C0BE 4MLIA 4I77L 4JFDA 5LAXA 2MQ3A 2BFVH 5L6YL 4KY1H 2CO7B 1UJ3B 3MR9B 3OZ9L 3MLTB 4PJDF 1WVZA 4MAUL 3MRLA 1ZA6B 3RFEA 4IOIB 2KZ1B 4L4VD 4R3SA 3H6JA 1S7XA 3KAAA 3UTTE 4YBLC 2VXVH 4PJBE 5FYLH 5L88H 5D1XC 3VA2C 4ZFFB 4K8RH 4R5DA 2RGSA 1RUAH 3QFDB 5MENE 1FO1A 1MIMH 2X9XA 2QQNH 3RIFF 3ALXA 4D9RE 1QBML 4L9LA 5E2WH 1UB6A 4CBPA 3CFDB 4PS4L 3C5JA 3H7BA 3CU1A 1UH2A 3MREB 5I8OL 4L4TA 3MX0A 5JHLH 4HIHA 2J8OA 4FQQA 4NZTH 1DS9A 2CKBA 1IKNC 1J05B 4X8JB 1I75A 3BKYL 3KPPB 1YPZE 3MLXL 1LP9E 4DVRH 3DARA 5DUBA 4ZAKA 4NO3A 1MFAL 3TZVA 4NQVA 1QYGH 1QRNE 1UWGL 2NY1B 3RZCB 3WO4C 4JFEA 1IT9L 2CKBL 4PJDB 1R3HB 1RZ8A 3BPCB 5IB4A 3LH2L 1FCGA 4OKVB 3D39A 3BDBA 4X4YB 1JHLH 4OFDA 4LASH 3SGKC 1R3LA 3ARGA 3OKMA 2Z62A 2UUDH 2V5SA 1RZKH 3G3AA 3ZT7A 2Y9RT 4LMQE 1IGMH 4Q6IC 1A7RL 1G7IA 3I6GA 5J0BA 2VDOL 4FQ2H 3MGOA 3SGDI 2EC9U 1IC5H 2D0FA 5F9JB 3V7AE 3TNMB 4JQXC 3H3PL 1TETL 5FKAA 2BSTA 1LO2H 3T2OA 2H8PB 3U7YH 2R4RL 3UO1L 3W9EA 5FOBA 5DDHA 2FSEA 4H8WH 4UOW0 3O6FC 2G60L 3G9VA 5C0BA 2AK4A 4P57B 3I02B 1F90L 5JUEH 3HMXA 1HSAB 1IGIH 1KG0A 2ADGB 3GMPB 4JFXB 4ECNA 3VFUA 2FO4B 2VUYA 4PREB 4XP9H 1AFVH 3HAEB 2DQHH 2NY6C 3ARWA 1G7HB 4P46A 1KC5H 4IJ3B 3B5HA 1A5FH 4U31A 4XZUB 1DE4A 3VW3H 2DD8H 4XWGH 3HMXL 4UI2A 4HIXL 2YD5A 5SWSB 3UTTA 4ORGA 3E6FB 4PPTA 3HHRB 4AY9X 1NDGA 3PWJB 4PJBA 4MQWX 1D6VH 2VSDA 1YNKH 4XAKD 1QFWH 4XCNA 1S7QB 1A2YA 2ED9A 2XN9E 2XWJB 4JFQA 5MENA 2ADFH 3VFSA 1XGYH 4TUJA 1RK0B 3QDGE 4K94H 3RVVD 4LNRA 3ZKSD 1LD9A 2Q87A 4CP6A 5ACLA 3JWOH 3NFNB 1PX3A 4YEBB 2F54B 1MCLA 2YPLD 3ZE0F 4PRBA 3TBWA 2VISA 1B6DA 4NRZB 1QUNA 2YUXA 4J3UA 4G9FD 5T3XH 1TQCC 3BQUA 1CVRA 4OI7A 1B3JA 4Y5YA 4TUOB 1YPZA 1LP9A 5FO9B 2Z31D 4DEPB 5C07D 3GZKA 5DS8B 1QRNA 4R6GA 2DMKA 2YPVL 1VERA 3RWJA 4WY7H 3F5WA 3OGMB 1DN0A 3W9DB 1QA9A 4YQXL 1D5ZA 3IDYB 1E0OB 1T7VA 5DVKA 1TTGA 3O41A 3HE6C 1NC2B 1JZ5A 3P9MA 3JTTA 3CFCL 2QADB 5I1KL 4O00A 1RIVH 5DUPH 5FHBH 4IDJL 3H42L 1T1WA 2P8PB 4OF0A 1IEAB 3PP3K 4O2FB 5E94A 3TIEB 5EWIH 1BZQK 2WQXA 5FHAH 1MVFA 5IBUG 2FBOJ 5CP7B 1IFHL 4LPCA 3QUYD 3GO1H 3VFOB 4XCFL 4Y1AD 4DK6A 1URLA 4XXDA 4KK9D 3L7EB 1FNLA 1V8HA 4JZOB 4PJDE 4GW5A 4G8EB 4HZLA 3WIIL 1DLFH 2QV2A 4J4PC 2NMSA 4QBZA 3MBEC 3V6OC 1RZGA 5M94B 2E7CA 3L5HA 1T89A 4HS3B 4RFEA 5DWUL 5B22A 3HI5L 4P4KC 1DBJH 4NT6A 3L1OH 5AZ2H 3S35H 3UXFA 4CNMA 3ARBA 3MV9D 1NEZG 3GHEL 5EBMB 4AIOA 1CR9L 2XQBH 3NH7H 3MUZ1 2G5RA 1P2CA 2YMXL 3DOSA 4JFHE 5F7LB 2O61A 1Q72L 1Q0XL 4LLUA 1LEIA 4BSWA 4QTHB 1SYSA 1B88A 3TV3H 3S37L 4LLAA 4MDIB 3FTGA 1NCNA 2FZ3B 2W9DH 1F45A 4Y5VA 1JBJA 5EOTA 3VFVB 4NNXB 5EC2B 4NUGL 3QCTL 3C8HA 1QQDA 1JMZA 3QUZB 4RBPK 4JPIA 3QDHA 3QDGA 1VFOA 4LQ1A 5C2UB 4HT1L 4PP1D 3QJFB 3BE1L 3OAYH 1IZKA 3V5KB 4OZFH 1E4KC 2FL5B 3K4DA 1KPUA 4B50A 2DM2A 5LFNA 4XBEL 3Q5YA 5F6IB 1UJ3A 1S7VB 3MR9A 1X7QA 3MLTA 3MV8D 3S88L 2H32B 5D72L 1Y6KR 4ONFH 1ZA6A 5HTSA 1JRHI 1JZ8A 5IEKB 4R2GB 4IOIA 5AYUL 1AXTL 4X9GA 1PG7L 3A0OA 4BQCA 3LDBC 5HDHA 4WYKA 1TNMA 5SWSE 3OKNB 1IAMA 4IOSD 4UT9H 5FYJD 3HB3C 2EE9A 2WV3A 4M4PA 3W0WD 4ZFFA 1J0YA 2X4PB 4M7ZC 1W2KT 3QFDA 4HSQA 3RKDD 1F8TL 4Y2DD 2Q3ZA 5MP6H 3SJVD 4AG4H 4Q9BA 2C7UB 5IM7A 1XT5A 4PP2B 1G9UA 3L6FB 2AERT 4CVUA 4FCGA 2F54E 2VLMD 1AJ7L 2A73B 3CFDA 3IYLW 1RZJC 4OF5A 4JO4L 5AZEL 3TVMD 2PNDA 5DRNB 1YQVL 4RAVA 4M1CD 2XG5A 4RIRB 4ODTL 5IT2L 4KMTL 3BPOB 3BN9D 2YSSB 3CFJB 4HH8A 5I18L 1J05A 5CLTA 3K1DA 4MGXA 3W3NA 4X8JA 1AH1A 3MROB 2CMRH 4KJQC 1BGXH 5DLMH 3KPPA 4X5XA 3HN3A 4H09A 3O8XB 4UT7H 4MAYD 2OS7A 3I6LE 3RZCA 4XVUC 1QKZH 2W60B 4LPVA 4OUOA 5GS2B 3BO8B 1ZGLP 1PKOA 3PP4H 3MACH 4PJDA 1R3HA 4U0QB 3BPCA 1XMWA 3ARDB 1PEZA 4KROD 1WAAF 1L7TH 5FV1L 3KGRA 4OKVA 1ITBB 1R0AH 3PJSB 1T1ZB 3C6OB 1AO7D 1KIUA 2NY3B 4X4YA 1ULVA 4X99B 4Y19D 2NQCA 5TGBB 2LTQC 4XMKL 2Z35B 3QQNA 5D1QB 2W9LA 3QUMH 4V2BA 1UCBH 4ODSH 2UZXB 4JG1L 4OD2B 4YHLH 4M6ML 2A6DB 4WO4C 1BVLB 1J11A 2GFBB 5F9JA 5JOFA 2HRLA 3TNMA 1C5BH 4PUBL 5J13C 3ZE0E 1FAKT 3J8F7 3N1QC 2H8PA 3FONB 4O2EB 2IAND 1GGIL 5EZOL 3ARTA 2DLFH 1CE1H 3WFCL 4P57A 3I02A 3P0VH 1FV1A 3CC5B 4NQCD 4UOW1 3DJ9A 4QRRE 3SCMC 3RGXA 2AV7B 4POUB 1HSAA 3AS2A 4U1GB 2ADGA 3GMPA 4JFXA 1VACB 4XX1E 2VIRB 2FO4A 4PREA 3GIZH 3HAEA 3VFRB 1EJOH 4RCAB 4WUUD 5DMGD 3W39B 1EHLL 3LEVL 4XZUA 1T5XB 4P2RA 1TVDA 4MB5A 3EOTH 4BH7B 1D9KD 5FDWB 3CVHH 3FMGL 3ZZ1A 3E3QC 1XF2B 1OP5K 3U9UB 4GRWE 5SWSA 3E6FA 1W0VA 1F3RB 1MAKA 2OI9C 3QQ9D 5ACZB 4YPGA 1SJHA 1S7QA 4M7EC 5IJBA 3QPXL 4HC1H 43C9A 5DVMA 5KANG 4Z7UE 1K5DC 3LEYH 4Q9CA 1MI5D 4QCIB 1J0IA 3MJ8B 1YN7B 3I75A 3NFNA 2F54A 3C5ZB 1D5XB 5HDBF 2AXHA 1ZAGA 3ARSA 5DD3L 1Q9KA 3F7VB 3EYUL 3PWVB 3O45B 2HH0L 2W07A 2VXUL 3E8UH 2Y7QB 1SY6H 3U6RB 3LQAH 5FO9A 2EICA 5T3ZH 1MJJB 1BD2B 2EO9A 4L8CB 5DS8A 5HDLA 3EHBD 4NFCA 5A40E 5FGBC 1EVTC 4NQDD 4Y16A 3W9DA 2Q3AA 3MRDA 3NVQA 3D87B 1ZXQA 2EIEA 3RQ3A 3G3BA 4N5EC 1NC2A 4LSRH 4G80B 3U83A 4KJWC 2WBKA 4WHCA 4MVBC 2P8PA 1IEAA 3CVIH 3E3ZA 2ZCHL 4XP1L 3RIFK 3DVIA 3GMMB 1HINL 2DQJL 1CXFA 1KJMB 3OPZH 3VDCA 2WINB 1W72A 3S5LG 3QIBD 3ZTJH 3VFOA 3ARZA 4RISH 2B1HH 5KOVC 1EO7A 2VUOA 3L7EA 4MJIB 1OGTB 2NY2B 4JZOA 2ICWA 4HK0B 3D25B 1U93B 5IVXB 1LK3L 4G8EA 4ZOAA 1UKQA 3QEHA 1UCTA 1W72L 2VWEC 3RWHA 5TQ0H 1CCZA 3A6OA 5I30L 4NC1C 4QRRA 4HS3A 3SDCD 3UP1A 2R9UA 3LKOA 3PE9A 1EV2E 4JN2B 2C1PB 4Z76A 5EBMA 5IW3A 2FRGP 3ZT6A 5GQRK 3AAZA 5C0ND 3EDKA 4APQC 3FB6A 3B9KD 4HKXB 4QTHA 5F44A 3S36X 4JRYB 3TYGH 1W0WB 4MDIA