3ZYPA

Cellulose induced protein, cip1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
218
Chain Sequence
EISDDFESGWDQTKWPISAPDCNQGGTVSLDTTVAHSGSNSMKVVGGPNGYCGHIFFGTTQVPTGDVYVRAWIRLQTALGSNHVTFIIMPDTAQGGKHLRIGGQSQVLDYNRESDDATLPDLSPNGIASTVTLPTGAFQCFEYHLGTDGTIETWLNGSLIPGMTVGPGVDNPNDAGWTRASYIPEITGVNFGWEAYSGDVNTVWFDDISIASTRVGCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIP1
publication title The Crystal Structure of the Core Domain of a Cellulose Induced Protein (Cip1) from Hypocrea Jecorina, at 1.5 A Resolution.
pubmed doi rcsb
source organism Hypocrea jecorina
molecule tags Metal binding protein
total genus 53
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2011-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zypA00
1AX2A 1AJKA 1BQPA 3W58A 5T5JA 1AF9A 3AZVA 1DZQA 3FUQA 4XTPA 4Q1RA 4Y22A 2Z42A 3MEPA 1WBFA 3POSA 4M3CE 4RA0A 3RMYA 1GSLA 2DVBA 2ZZJA 3VKNA 2VUAA 4YZ4A 3BIWE 4YM1A 1LGCA 4XOGA 1DLLA 3OYWB 1CN1A 4Y1UA 2A7AA 1MR5A 4YG6A 4C1XA 1WUVA 1APNA 1LEDA 1D2SA 1FX5A 2CTVA 3WDYA 4FQ4A 4JRAA 1HQLA 1QOSA 1W0PA 1J1TA 4CZSA 1LGBA 3ZSJA 1Q56A 1MACA 1S0JA 3AJYA 1KDMA 2JECA 4FPEA 3TB0A 3ZSKA 4FPLA 1DYPA 2AH2A 2GDFA 4WVWA 2WT1A 4DRRA 2VU9A 1AZDA 3TAYA 1G9DA 3HR9A 3AJZA 1GLHA 2RHPA 3ENRA 1DHKB 1ENSA 2EAKA 3MW4A 5IUQA 2GMPA 1IS6A 2ZGTA 3N36A 4FP3A 2D6LX 4PF5A 5GLVA 2EXJA 3BODA 1HKDA 1KDKA 3NWKA 1GBGA 2P2KA 1BYHA 1Z0HA 1YO8A 2D3RA 1SACA 4YGBA 2WJSA 4XBLA 1SLBA 4PQ9A 4U36A 2D3SA 1JOJA 1V6LA 4XJZA 4XJ9A 4C1WA 5DUUA 5KXEA 3AYCA 1VAMA 4M00A 1GZ9A 4XXPA 2NN8A 5HCBA 1W6NA 2GN7A 5EYXA 3VKMA 1G9BA 3WG4A 3IN9A 2LALA 3T2TA 1CR7A 3HMYA 2OUHA 2CWMA 1CONA 3N7JA 4LBOA 3D5OA 5DG2A 5IT6A 3WHUA 1FYUA 1QKQA 4XE9A 1X50A 4WV8A 5JOXA 2A5ZA 2JE7A 1MS8A 4YFZA 1HQWA 2PHWA 3DUIA 4UW5A 1QNYA 2UWAA 5DZGA 1LHNA 3A0KA 4XIKA 3WVJA 5E8AA 1N1SA 2ZBJA 3USUA 1ULEA 4XIOA 5T55A 3N35A 5DXDA 4Y1VA 4M3CA 4DS0A 2ZGNA 3VUOA 3SH3A 4FPHA 4UW3A 1IKPA 4YW5A 5JOZA 1ONAA 2TEPA 4XBQA 1SCRA 2R1BA 1W6QA 4BM8A 2VXRA 2OVUA 2CNAA 2YXSA 2E7QA 1PZ8A 4XBNA 4XHXA 1SBEA 2OW4A 4Q2FA 1G86A 2YZ4A 1DQ2A 4Q27A 1SBDA 3ASIA 3BTAA 3POWA 4YZ2A 3WUCA 1MS1A 5JOWA 2E6VA 3ILNA 3RS6A 4XJ8A 1AVBA 1QOOA 2D6OX 2W52A 4PBOA 4Q1PA 4TZDA 3AP7A 1YI7A 1D0HA 2I2SA 1LEMA 2GNDA 1FV2A 1LOGA 2JE9A 2DU1A 3FLPA 1ZA4A 3WG3A 1C1FA 4BLIA 3O12A 1UAIA 2DVAA 2A70A 4FPKA 1AJOA 5DZEA 1C57A 1LESA 2ZGUA 4YW3A 1S0GA 1DQ1A 4ZXKA 3N7LA 1S0EA 1MS5A 1RIRA 2VW1A 5DUVA 5GZDA 1CQ9A 1FATA 1WCSA 5GLUA 4BQ1A 2CWSA 2SLIA 3AP9A 3LSDA 4ISRA 3LSEA 5EWSA 2P3KA 5JMCA 5JOYA 2NP0A 2PHTA 5T50A 2DVDA 3IKWA 1LENA 4XILA 3M2MA 1MS9A 2ZACA 3MPPG 4FPJA 4GKXA 2GNBA 1V6OA 1OKQA 1QF3A 2AGSA 4UW4A 5DG1A 1S0CA 3ZSLA 1DQ4A 1WLDA 3O0WA 3B69A 1VALA 2OUJA 3ZXLA 4Y1YA 1H30A 3SITA 1W6NB 2UWCA 3NV4A 4DRVA 1RINA 1F31A 4GA9A 5H9SA 1LCLA 5E89A 1UMZA 1LJ7A 1GYKA 2HYKA 4FQZA 5GLZA 1WD4A 1SBFA 4P9XA 1MZ5A 4YG0A 1MS3A 4XHBA 1KRIA 2A75A 3A4UA 1C1LA 4BMEA 5KXCA 3LCPA 3ZYPA 5LK5A 3USUB 4K21A 1NXD1 4PBPA 1G9FA 1QMJA 1Z78A 4M3CB 2UWBA 1N1YA 3AZXA 3IM0A 4YFWA 3IPVB 2CL2A 4XJUA 4BPZA 1YRZA 1CJPA 2D3PA 3AZWA 1W6QB 1BKZA 5GALA 4XJWA 2WQZC 3N7MA 3O0XA 1ZM1A 3INAA 1LOFA 5GZCA 4FPCA 2KM2A 1AXYA 1KITA 4DFSA 2GNMA 2A6YA 1AX1A 1DQ0A 3RG0A 5DUWA 4YGCA 4U2AA 3WHTA 1FNZA 2WKKA 2ZGSA 2DVGA 4D69A 1ULDA 2A3WA 2DUOA 2YROA 2VY0A 3VKOA 1N47A 1VLNA 3GNEA 4GWMA 4YGDA 3UK9A 1U0AA 1S0DA 3OBTA 3PVEA 1GNHA 4CTEA 2ZGPA 4R9CA 2ES3A 5GLWA 3KM5A 3R4UA 2PHXA 3BOPA 3V0BA 1SLCA 1LODA 1S0FA 1WW5A 1UKGA 1DFQA 1N3OA 3R4SA 4Q8LA 2ZMLA 1A8DA 5CA6A 1LOBA 1NLSA 1SFYA 1WD3A 2JKBA 3CNAA 1FAYA 2UU8A 5IK4A 4R9DA 5DZFA 1O4ZA 4FPFA 2LTNA 1KJLA 1WBLA 5FREA 3MW3A 3T1MA 2AENA 2DU0A 3V0AA 2R0FA 1JHNA 2R49A 1V6KA 4P9WA 3JUUA 2ZKNA 2ZABA 1G8WA 2UURA 3AYEA 1VIWB 2PHUA 2ZHLA 1DQ5A 4YGEA 5JDBA 2WT2A 3T1LA 1H9WA 1LOEA 1LTEA 4NOTA 4XMAA 4Y20A 5H9RA 4RL7A 3RMXA 5H9PA 2FHRA 5T52A 5DUXA 2ZMKA 3IPVA 1I1EA 2VH9A 3ZXEA 2A3XA 1QOTA 1GV9A 2ENRA 2NZ9A 1ULGA 2R1DA 4LBLA 3SISA 2GALA 2D6PA 5KXDA 1LGNA 2DTYA 1VAVA 3FLRA 1IKQA 4Q26A 1MVQA 1URXA 3AYAA 4P9YA 2A3YA 3WLUA 4ZKTB 4OZXA 4FPYA 3POYA 3AP4A 3B01A 2E51A 1UL9A 2SBAA 5JVVA 2GMMA 2E7TA 5BYNA 3NV2A 3AFKA 3O0VA 2EXKA 1QDCA 1MZ6A 3WCRA 1CPMA 3ZXJA 1QNWA 1GICA 4I30A 1W6PA 1W6MB 3AZYA 3D6EA 4WZFA 1A3KA 1GKBA 3B00A 1JXNA 4R9BA 2NM1A 1YIFA 5AVAA 4HL0A 5CB7A 1ENRA 4H55A 2NYYA 3APBA 1N1VA 1DYKA 2ZA9A 1WW4A 2NMNA 4JCKA 1C4RA 3D4KA 2B7YA 5EYYA 4AGGA 4SLIA 4YZ5A 1F9KA 2EXIA 3QCWA 1N1TA 1CVNA 1CPNA 4LBQA 2AREA 2DUPA 3HN1A 4UW6A 1MS0A 1YXWA 2YMZA 2YV8A 3M1HA 2A6XA 5GZFA 5CBLA 1DBNA 4ITCA 3MW2A 3WNXA 1SLIA 1V6IA 2D7FA 2ZMNA 3AYDA 3WG1A 1OFSA 1CIWA 1N3QA 3V0BB 2CYFA 2DVFA 1AX0A 1LU2A 4Q8KA 5T5PA 1JW6A 5F5QA 4BLJA 3U4XA 3WDUA 1FV3A 2V5YA 3AP6A 3N3HA 3FBYA 4XXAA 3Q9OA 3OY8B 3SH5A 2YY1A 1LULA 1MS4A 3AXEA 2E53A 4Y1XA 1DGLA 2D6MA 2H0BA 4HANA 2ZGRA 1LHVA 3V0AB 3DGTA 5GLTA 4FPOB 1BJQA 2GMEA 1YYNA 2WSVA 4AGRA 2VW2A 1O4YA 2FMDA 5IK5A 3SNMA 3ZVXA 1SLAA 2P37A 2DYCA 3M3QA 2GN3A 4XZPA 2R0HA 5T5LA 3IMNA 3NV1A 3VKFC 4YG3A 2DWRA 3A0NA 3PJQA 4ISQA 3RRDA 2G4IA 2ZGMA 1GZWA 1W6MA 5EXOA 1GANA 2R16A 3W59A 4Y1ZA 1TEIA 3ILRA 5GZEA 4F83A 3AZZA 2EIGA 4Y26A 4FOVA 3UJQA 5JLVA 4NO4A 1PZ9A 4R9AA 3N7KA 3WOGA 1HDKA 5L73A 5GZGA 4YW2A 2JJ6A 2XG3A 4DPNA 2W68A 2DUQA 4FOWA 2ZGLA 1Y7BA 4FOQA 4YM2A 3WG2A 2WT0A 4M01A 3PVNA 2DURA 1IS4A 1WLCA 1W6PB 2D6NA 3O5SA 5HCAA 1OQ1A 1DIWA 1UZYA 3OPZA 3WDTA 4FVVA 5GM0A 3AXDA 5KXBA 1QGLA 3B3QE 1LHOA 3VV1A 1JYCA 1SLLA 1LHUA 3FUOA 4FPGA 1DQ6A 1F5FA 1S1AA 1S0IA 4XTMA 3ILFA 1ULCA 3OY8A 2BQPA 1W6OA 2PHRA 4FOYA 1QU0A 1AXZA 2A71A 1WLWA 1B09A 4ASMB 4LBQB 2W08A 4KBBA 3PVOA 3WDXA 4GXLA 1IS5A 3QLQA 1V00A 1V6MA 4P14A 3FFZA 3WCSA 4L8QA 1UZZA 4FP2A 1LOFC 1V6NA 4LBQD 2PELA 2V73A 3I4IA 1LECA 3OJBA 3PMEA 1IS3A 3UL2A 1XQNA 3UJOA 2P34A 4K1YA 1IOAA 3ZPYA 2D43A 5E88A 3M3CA 4XMIA 3AK0A 4K20A 5H9QA 4WVVA 3WUDA 2WNEA 1BXHA 1GZCA 3L2YA 4XJAA 4Z8BA 3M3EA 4XDQA 3SLIA 4ATFA 3R05A 4YZ3A 1HLCA 1Q8PA 2EF6A 2AYHA 2Q5TA 4AYUA 3OGGA 3VKLA 1JBCA 1V6JA 2A6VA 2ZGKA 4AVVA 4IQPA 2W39A 1JUIA 2A6WA 4AVSA 3C2UA 3RQ0A 4TYSA 5GJ6A 3OYWA 4Y20B 2C5DA 2DTWA 1WW6A 4LBKA 4GKYA 5CAZA 2DV9A 3ZXFA 4AVTA 3OBRA 1Q8QA 1UN1A 1Q8OA 3I8TA 1KJRA 3KQRA 3WZ1A 1AXKA 1GZWB 1G9CA 2C9AA 2ZHMA 2P3JA 3V64A 5FRAA 4Y22B 4BOWA 1ULFA 4YW4A 1UPSA 3AX4A 2D6KA 4LBNA 3GALA 2A6ZA 4BMBA 4MYEA 5T54A 2WLQA 3AP5A 2ARXA 2VW0A 1N3PA 5SV8A 2JD4A 4YW1A 4AWDA 4AGVA 1JN2P 1I3HA 4YM0A 5T5OA 1LOAA 3WDWA 3V65A 3SH4A 4LBMA 3ZSMA 1W0OA 4YLZA 1G9AA 4M3CF 4GALA 2ERFA 4ATEA 2ARBA 1UX6A 2PHFA 2XB6C 1BZWA 1GNZA 3H0OA 4K1ZA 4LBJA 1A78A 1SLTA 1G7YA 3M3OA 4JC1A 1WW7A 1RITA 1Q8VA 1PZ7A 4GWNA 4DQAA 2ZGQA 4W65A 2AUYA 1MVEA 1CESA 1W6OB 3FLTA 2ZHNA 1LU1A 1S0BA 2D44A 3WDVA 1ENQA 1EPWA 2AR6A 3B9CA 1SCSA 1FNYA 5CNAA 1QDOA 3JU9A 3WV6A 5IK7A 1KQRA 2ZAAA 1Q8SA 2ZHKA 4XYXA 1LOCA 2WSUA 2EALA 1JYIA 2CY6A 2ZGOA 4Y24A 3ZYRA 4YZ1A 2GNTA 3RSJA 5F9TA 2NMOA 1H9PA 3ATGA 2JDZA 4CRQA 5HCFA 4PCRA 2EXHA 1R1ZA 3NV3A 4YM3A 5IK8A 1LHWA 2P3IA 3ZXKA
chains in the Genus database with same CATH superfamily
2VZOA 2AEYA 2WBKA 1AJKA 4Q4W1 5I8SA 3W58A 1PK6B 4XTPA 5IVYA 4NHLA 3U75A 4BK5A 1W8HA 1NE6A 1NZCA 3MEPA 3T0BA 4OI2A 5KHKA 3AMQA 1WBFA 3CEWA 4M3CE 4MLOA 4IGOA 1GSLA 5DAVA 4AZZA 1GQGA 4BE3A 4EYUA 1ZYBA 5BNNC 3WP6A 3VGIA 4C8DA 1RUD2 2BUKA 4NWVA 4B1LA 3OYWB 3UKVA 1WUVA 1APNA 2VXJA 3FZ3A 1FX5A 3JBG2 3M8LA 2CTVA 5FYBA 4Q4Y3 3OGVA 5FZAA 3JB4C 3F2ZA 3K4ZA 3T3YA 4ZZ5A 2QZ2A 4DXZA 1QOSA 2XGXA 1J1TA 2XBO2 1UF2C 5D1IA 1LGBA 5C4WA 1Q56A 3WNKA 3ZSJA 5FO8B 3Q8AA 1S0JA 2J7MA 3TWIA 4FPEA 5CIRA 1AZDA 2C24A 4OHWA 1GLHA 1C8M3 1DGWA 3MW4A 3Q8BA 1OBNA 1IS6A 1FPN3 2GMPA 2ZGTA 2D6LX 3KWVA 3NO8A 4UFIA 3TN92 3ZDVA 4EE2A 5F5AA 3BODA 2ZXQA 4JKKA 1OLRA 1J83A 2ORZA 3QOPA 1JUHA 1VBE2 4QPGC 3LD8A 1GBGA 1EY2A 3QD6A 5FZCA 5FZBA 2QTWB 5HXVA 1YO8A 5A7NA 5JSRA 1W9FA 1ZRFA 1QQP1 3N9NA 2D3SA 1JOJA 3N4MA 1C28A 5DUUA 1UOJA 5FLHA 1VAMA 4AHXA 4CP2A 2NN8A 4AQSA 5HCBA 4KU8A 4AVBA 3H1MA 4CCCA 1DYOA 2JDHA 3POEA 5IYYA 4JRLA 3VHPA 3N7JA 5IT6A 1ZZ7A 2GP3A 4CDWC 4JQTA 1F5JA 3L9JT 1QKQA 3OSDA 3MDPA 4PI0A 5JOXA 2JE7A 2XBO1 1ZZ9A 5FP3A 1HQWA 2PHWA 2VOWA 1C8NA 3EB7A 3JD73 4UW5A 4GQ7A 2R072 1DGRA 5DAPA 3VBUC 3S0MA 3I59B 4XIKA 5E8AA 2ZBJA 4RYDA 4IEUA 3TOJA 2G9FA 1W8NA 3JQWA 2B4KA 2QQIA 2RS52 4UW3A 1IKPA 1RHI2 4WM8B 2TEPA 1RTVA 4KGGA 3TN91 1QJZA 5ACA2 4IEYA 2ZZQA 2XVGA 1NOVA 5LBBA 2VZVA 2YXSA 2E7QA 1PZ8A 1W9YA 3VBHB 4BA6A 1VBE1 1O5UA 1H4GA 1L7LA 1FMD3 4XAEA 4Q2FA 1G86A 5LRSA 4KG0A 4NAOA 1LRHA 1AL0G 2OX0A 1SBDA 4RHV3 1EP0A 3I3QA 3WNLA 5JOWA 4FCAA 3OGSA 3KF3A 4XJ8A 3OEAA 4XFCA 3WXPA 2BBAA 1D7PM 4Q1PA 4DB5A 3VBSC 1LEMA 1FV2A 3WG3A 2DU1A 1ZA4A 1ZZ6A 3OEBA 4BLIA 3THDA 1AJOA 1ND3B 2YPJA 1C57A 5FBZA 5JSOA 2TUNA 2ZGUA 2KXLA 1DQ1A 4ZXKA 5JZGC 2R071 3KCYA 4MSVA 3M3IA 1W8FA 1K12A 1W2TA 1RIRA 1ZZ8A 2VW1A 2C1FA 4AFCA 5FY9A 5ABJB 5BNOC 3NJXA 1NT0A 1ST8A 2SLIA 2RS51 3LSDA 5EWSA 1RHI1 1ND2C 2F17A 2JB4A 2P3KA 3K3NA 4N43C 4OHXA 5CFCB 1D2QA 4IEWA 5ACA1 4GB32 3MUY1 4KWJA 1AR82 4YVWA 4KH9A 2WAAA 5FZKA 2ZACA 4GKXA 4I01A 4IESA 1W39A 3E5UA 1V6OA 3KVBA 1OKQA 1QF3A 2YHJA 2Y6JA 3SCGA 4RR3A 4UW4A 3KGLA 2XWJB 3VHOA 1YFYA 2JICA 1VALA 4RGAA 4B7EA 4UWDA 1H30A 1HV1A 1RMU3 1XNDA 3SITA 4AF9A 4EZ4A 5FDBA 1AYN2 2VECA 2UWCA 2E63A 4FFGA 3W5NA 1ZBA3 4HVRA 4D7TA 3GCWA 2P1BA 1H2NA 1LCLA 2WO1A 2VPVA 1UYXA 2FZ2A 1LJ7A 1GYKA 1AR93 2HYKA 4FQZA 4LO7A 4P9XA 2HWF2 1MZ5A 5GLZA 2A75A 5KXCA 1U5ZA 2XJRA 4DNYA 2JD9A 3USUB 1C5HA 3GZEA 4WVZA 3N9LA 4KWLA 1G9FA 1QHDA 1Z78A 4MGSA 4MUVA 1N1YA 4A42A 3UNPA 3O7OA 3PTYA 4W6WA 4CXWA 5GKAC 1YRZA 1OVSA 4Z07A 2CDPA 1BKZA 2CV6A 5EP9A 3NSTA 3UV9A 4CPBD 4D6RA 5DDJ2 2DFCA 1OFNA 1OOPC 4IEVA 5FIXA 1XU2A 1LOFA 2KM2A 1AXYA 3VHNA 4N7IA 1W03A 2VE1A 3J8F3 4JDMA 3U11A 4COUA 3WW3A 5FFOC 4HG6B 1R1A2 1ZZBA 5ABJA 2WKKA 3GF6A 1COV2 2CU5A 2DVGA 1AYN1 1ULDA 4UFLA 3J4UH 4OQ8A 3GDBA 2A3WA 5CFDC 3PU8A 3D82A 1VBD2 2IXHA 1N47A 1VLNA 3VKOA 4YGDA 1S0DA 3BPZA 3PVEA 3VBFA 2ZGPA 2HWF1 2ES3A 4IDZA 1NX9A 3BTZA 1WA4A 3LDBA 4IL7A 3D8CA 3R4UA 4GMP0 1CAVB 1S0FA 1WW5A 4E4SA 1X9PA 1DFQA 1FI2A 2ZMLA 4PT6A 2BWAA 3O1SA 1NLSA 4JTNA 2QE3A 5CU1A 5C70A 1A6CA 1FAYA 4QWNA 4R9DA 5DZFA 4FPFA 2RM21 2E31A 4O9GA 1KJLA 1WBLA 4XUNA 3HQXA 5FREA 2Q4SA 4DINB 2PAEA 3NNMA 1UNBA 1X82A 3RGBA 4DIQA 3VD5A 1W2UA 2ARAA 2R0FA 1UW8A 1O8PA 4IE6A 5K8SA 1AR63 2Z4FA 1VBB2 2ZKNA 2ZABA 3VZLA 3AYEA 3NAPB 5A1LA 1YEWA 3K51A 4QAWA 5JWPA 1UX7A 1UZ0A 1R1A1 4XF9A 5JDBA 2HWC3 1H9WA 1LOEA 3T1LA 5A3TA 4XFHA 4BQ5A 2WFF2 2I74A 1POV1 1U12A 4DOUA 3NL1A 1HRV3 1VBD1 1I1EA 5A1AA 1GV9A 2ENRA 1K45A 2NZ9A 2IUWA 3ITQA 5F6KA 2GZWA 3KV9A 2GALA 4R4XA 3SISA 2WZR2 3G6JB 2D6PA 4LEJA 3WQBA 3ZOIA 4Q0QA 5D2AA 4IE7A 4EJRA 1RUI2 2P4EA 1VAKA 2RJKA 4Q26A 1XOYA 4FPYA 2G9ZA 2SBAA 2XJQA 3B01A 3LA3A 5BYNA 4XAAA 1U5IA 1UXXX 4N8MA 2W94A 2IXJA 5ANQA 4CEWC 1QNWA 2XVKA 1GICA 3LE0A 4I30A 3IAPA 4PDWA 3TNQA 4HK9A 5EHDA 4MH0E 4CDUB 5FYZA 1GKBA 2JXAA 1JXNA 2WS93 2Y6HA 3N9QA 1EAH2 1HV0A 3PUIA 1VBB1 4I0BA 2NM1A 1YIFA 1C5IA 1YHFA 3ECQA 3U14A 4H55A 1VMJA 4CXXA 4AAXA 2G19A 5EZWA 4BU2A 2ZA9A 3CJIC 1OH3A 4JCKA 1C4RA 4Y5TA 3SQOA 1H1AA 2ZEYA 4PLMA 3Q8EA 5FK8A 4YZ5A 2Q8DA 2Z5WA 5HV0A 4LBQA 2DUPA 4PIYA 2A73B 1YXWA 2YV8A 1ZZCA 3GBWA 2J1SA 1DBNA 3FFQA 1RUI1 3MW2A 3NAPA 4AFMA 1ZRIA 3PHMA 2ZMNA 1N3QA 3V0BB 1I6XA 2CYFA 1SPPA 2DVFA 4QU1A 4XFGA 3I2GA 4HKLA 1JW6A 5L7OC 2C9KA 3BCWA 3AP6A 3WDUA 3I49A 5FMBA 3OY8B 4L9BA 1PNGA 5FZEA 2WNVB 1HRI3 1OA3A 2VZQA 1H2LA 3H8XA 2AZ5A 1BMV2 3V0AB 5L36A 4D7SA 5EIYB 1EAH1 3O1VA 2FD8A 2JDAA 5A7QA 2HWD2 5FPBA 4HZFA 4QDRA 2D40A 1VRH3 2FMDA 3IDAA 4N53B 5IK5A 5CG9A 3ZLIA 2VTXJ 4XZPA 1UU4A 1NCQB 4AEDB 4CEYB 1HW5A 4O9EA 3WF4A 4YG3A 2DWRA 4ISQA 3L2HA 1TMF1 3E5XA 3MIBA 5EXOA 1CAWB 2WWSA 2YC4A 2R16A 1JYVA 4K8RB 4MHUA 3KB5A 3ILRA 5GZEA 5BNQA 4NE9A 4ES9A 2EIGA 1A8MA 4CSWA 1RJ7A 5F3IA 4Y33A 4P5HA 4BB3A 1VB2A 1WMDA 3GBGA 3ZFEA 3N7KA 3WQ0A 3LF7A 4Q0SA 4OVEA 2JDMA 4B4QA 2WN3A 2JJ6A 2MEV2 4FOWA 1OA2A 2QQMA 3I3DA 2CDOA 4XF3A 4YM2A 3OBZA 1NCRA 3U37A 4M01A 1IS4A 2VM9A 1ZREA 4H3WA 1UZYA 1BMV1 3CBNA 3FX3A 5GM0A 1RL3A 2KA3A 4GH4A 5L9RA 3LB9A 2R042 4I3PA 2Z69A 4EWDA 1F5FA 1YNAA 4D6SA 5BNPB 4QQHA 4D0QA 3UYJA 1GNYA 3B7MA 3O1MA 2K0GA 1Y4WA 2GH8A 3OY8A 4GWJA 5C33A 4XFIA 4UBHA 3B94A 2JG9B 2VCCA 3NNFA 3PJYA 3THCA 2LM3A 1WLWA 4QKFA 4AI1A 5A6ZA 4D94A 2RDSA 1RUE1 3KV5A 4NUBA 4KBBA 2RS13 1IS5A 1V00A 3LAGA 3PL0A 4FSJA 4ZS3A 1HB1A 1W9SA 4QPYA 4LO6B 4CYDA 4FP2A 1VB4A 1V6NA 4LBQD 4TSVA 3OJBA 3UL2A 3MLKA 5FP4A 2MEV1 2ATFA 3UJOA 1NCQA 2ZAHA 2P34A 4K1YA 3ZN6A 4COZA 3VD4A 3E6CC 2GH2A 4P5YA 4LJHA 3M3CA 4UYBA 2HWB2 4XMIA 4I02A 5H9QA 1W28A 1CAWA 5FYYA 2PLV3 2O0OA 2HBUA 3L2YA 4QB1A 4XJAA 1ZVFA 3M3EA 3VDDA 2J42A 3SLIA 3R05A 1PIV2 2Q5TA 2EF6A 2R041 4IERA 4OCTA 4X6RB 3DPRA 5JI7A 1YC61 2A6VA 3B5LB 4AVVA 2Y0OA 5APAA 4IQPA 5LW9A 4FI9A 1FT9A 4GD4A 3DKQA 3GCXA 4RQPC 4ZONA 1JUIA 4BJ0A 3J7LA 4QPIC 2QNKA 1S2EA 1PVC1 4UT5A 2DV9A 1UY1A 3UESA 4XACA 4EN6B 1CWPA 3WZ1A 2VJXA 1AXKA 1W3XA 4CP0A 2ZHMA 1JI6A 3HAGA 5F2SA 2VCAA 3SEEA 3O1OA 4Y22B 4E4DX 1ULFA 1OLMA 4Z92B 2D6KA 2GP5A 1HQNA 3GALA 2WUHA 5LB6A 2OXBA 4BMBA 4KI5M 1E5RA 5FUPA 2ARXA 4HLTA 5LA9A 4EN9B 5CEHA 2BNNA 2YPDA 2JD4A 4YW1A 4R52A 4YM0A 5T5OA 1JZ6A 1LOAA 2W95A 2X5IC 3V65A 4NIDA 2BNOA 4LBMA 4YLZA 1IZ3A 2HEWF 4M3CF 4AVAA 4CCLA 3C7OA 2BGOA 1PGSA 1GNZA 2W92A 3HEIA 1H1IA 4HMZA 1O3QA 1PIV1 2WNOA 4QX3A 2DCKA 1UYZA 1YI9A 2HWE3 2Z2SB 2FDKA 4E8CA 4CCKA 2BVBA 2GC3A 3ZR6A 4QT6A 4A7KA 1EV13 2AUYA 1CESA 1W6OB 1MQTB 5FJKA 5FY8A 4XFBA 1QJY1 2BRTA 1FXZA 1IGOA 4PI2A 1S2BA 3P5BA 5J96B 1JZ4A 5CNAA 3BIEA 4FTSA 3WV6A 4Q5OA 2ORXA 3VZOA 5C9AC 2YC0A 2ZAAA 4EZHA 1HXS2 4BZ4A 1E5SA 3ZYIB 4Q4V3 3TEYA 1JYIA 4Y24A 4YZ1A 2BFUL 3POJA 5FY1A 2CGPA 3LA7A 3VBOB 4BH9A 5HCFA 5JOZA 1R1ZA 5F5IA 3WNOA 1D4M1 3ZXDA 4K8FA 2R061 1AX2A 1BQPA 3VBRC 1WCQA 1AF9A 1RUF3 3FWEA 4J25A 3CZJA 4Q1RA 4Y22A 2IZWA 1GQHA 4RA0A 2MHFA 3BVCA 3POSA 2XL9A 2DVBA 3RMYA 5I0RA 2EIBA 3AL6A 3RZZA 5FJHA 4LO5B 2QQNA 4CU7A 4ES8A 4YZ4A 1W8OA 5K0UC 2ZCWA 2E7AA 4YM1A 3V56A 1R082 2WABA 3AB0A 1CN1A 3HT2A 4Y4YA 2XKOA 1M06G 2W5FA 3D0JA 3PVBB 4RS5C 2JKXA 5G04L 2WINB 4KWUA 3K4DA 4FQ4A 2IXLA 3WW1A 1GWKA 1BBT3 2W91A 1OSGA 2Y6FA 4CZSA 1JZ3A 4B4RA 3ZSKA 5AC91 3TB0A 5C3PA 5C71A 1QWRA 4FPLA 4DRRA 2JDNA 2TBVA 1Y43B 3OD0A 4LITA 3RJRA 3VZJA 1R092 3ETPA 1ULPA 2FCTA 2JDPA 2KR2A 3HR9A 4OI0A 1SDWA 1ENSA 2XQRA 2EAKA 4JAAA 4NAMA 4D3WA 4FP3A 5C8CA 3H3ZA 2WA3A 3CDZB 3KD4A 5KHIA 4Z2AA 1JYXA 3FHQA 4YVSA 1AL21 1UIKA 4LHNA 2V4VA 1KDKA 3VD9A 3BUCA 3NWKA 3WF2A 4D8MA 2LW8A 2P2KA 1BYHA 4G9SB 1SACA 2OIIA 3CIHA 4YGBA 5F6LB 1SLBA 4U36A 4XJ9A 4C1WA 4XJZA 5E1RA 3WY6A 4UBGA 3Q8CA 2WIIB 1W6NA 2CGOA 2X10A 1G9BA 3WG4A 4UFMA 1CR7A 2OUHA 2CWMA 4HVOA 1ASJ2 4IEXA 5DG2A 3FBMA 4QB2A 1FYUA 3LEGA 1ZBE1 5D8AC 4WV8A 4JTOA 2A5ZA 3C7FA 4YFZA 4KG8A 4YNIA 3DUIA 4QHBA 5HV4A 1QNYA 2PTMA 2RJLA 1QJU3 3AKQA 3GJAA 1REDA 5DZGA 4GMP3 1LHNA 4FFHA 3A0KA 5FPAA 1N1SA 1NA1B 4E8DA 3KQ4B 3GZUC 2QQKA 4N7UA 1R091 3OGRA 1PGL1 5C4WC 4COVA 4M3CA 5I0TA 3LEKA 4L92A 3C7GA 1SCRA 5LASA 1GMMA 1IPJA 1W6QA 2R1BA 2RDNA 1W8UA 2VD7A 1JYWA 4HOOA 5BV6A 4B7KA 4XHXA 3PTRB 4AFBA 2CGNA 5A6YA 1R64A 3H7YA 3PIJA 2E26A 3E1F1 4OZOA 1I5PA 3ASIA 3POWA 4DXTA 1MS1A 4NHMA 1GWLA 2D6OX 4CDQC 2W52A 4CU8A 2A1XA 3AP7A 2O14A 1D0HA 2I2SA 4Q0VA 4Q4W2 1UYPA 5FZGA 3ORJA 5JIUA 1H8TB 5F39A 1C1FA 4AI9A 1UAIA 2DVAA 2A70A 1I5ZA 4NJ4A 5FZIA 3ST7A 1TME3 3NNLA 1L7RA 2F6BA 1S0GA 3VL9A 1OHFA 3T0AA 1EUTA 1PK6C 1S0EA 2QKDA 3MBWA 4NPLA 4JGYA 2IFWA 1CQ9A 1FATA 3EJKA 1YFXA 2CWSA 2ZS6B 4GJYA 3BALA 4LHLA 3JB8A 4MGKE 1SFPA 5B2GB 4F3JA 2DFBA 2C6SA 2PHTA 2VOVA 3KHCA 1VBC3 4D7YA 1LENA 4CU6A 1IPKA 5C3OA 1PO21 3MPPG 5FZ3A 3H1YA 3OTFA 4YARA 1MEC3 2WNUB 1Y3TA 2JEMA 2JDUA 2DCJA 3ZIWA 3R6SA 3ZXLA 4XDOA 4XW3A 1O3TA 1XJAA 5E6HA 4YW6A 4GWIA 3VB9A 3AC0A 2WDBA 1QJX3 1PO13 3VDBA 5H9SA 3T30A 4CA9A 1UMZA 1O4TA 3W20A 1SBFA 4YG0A 1MS3A 5FWEA 1ZRDA 4XHBA 2FDGA 3AMMA 3A4UA 4A7ZA 1W8ZA 1JOPA 2RMU3 1QQP2 5LK5A 4K21A 1NXD1 1C8M2 4IETA 2RS33 4QM9A 3ZKYA 4PBPA 1QMJA 1FPN2 1K3IA 3E97A 4FXGB 1K5JA 4IXLA 4KGQA 1UO9A 4UFKA 4XJUA 4BPZA 1H8TA 3ACFA 1CJPA 2D3PA 1ZX5A 1QJFA 4XUPA 3TBDA 4XJWA 4AXOA 4F7ZA 3O0XA 1ZM1A 2NP0A 4IV1A 3INAA 3KSCA 4FPCA 3VD3A 2IC1A 5C8WA 3TYJA 3RG0A 2A6YA 1H4HA 4QQOA 3KCCA 4PIXA 2PAMA 4YGCA 3S7EA 5HCHA 4HETA 2AEZA 4LO4B 4UFHA 3RJ2X 3DECA 1FNZA 3ALQA 1XYOA 4OI4A 4D69A 4LK6A 2BVVA 4ARYA 5FOJB 3ACHA 2DUOA 4Q4Y1 2YROA 1XE0A 2VZPA 4GWMA 1U0AA 3T2QA 1W8WA 1GNHA 3JD72 5FV3A 3VLBB 4CCEA 4WM8C 4CTEA 2QDNA 4ZU5A 4BK4A 2WNUA 1JU3A 5AFBA 1OA4A 1J1LA 4NIGA 3OF1A 5FXZA 3VBHC 2HEYF 4M4PA 5FZ6A 2PHXA 1XE8A 3AL5A 5A3LA 1SLCA 1C8M1 2BYVE 2BJSA 1IHMA 2FDHA 1FPN1 1WD3A 3AM2A 3WP4A 2H6BA 2WZPP 2WO3A 5LZ6A 1NZIA 1VE0A 4LKSA 4Q4X3 1QEXA 5L9BA 1ACCA 3E6BA 1YQ5A 2O8OA 3P3PA 4YVWB 3IDCB 1FMD2 3DYOA 2AENA 2C4XA 1DGWX 3HQRA 1JH5A 2AACA 4RR3B 3ZFFA 3JUUA 3PUSA 2VBDA 5FZ0A 1PMHX 1VIWB 1DQ5A 1ND3C 1HIXA 5EJZB 2WT2A 2XVLA 2F4LA 4XMAA 4DUXA 3U4SA 3ZXGA 2RDQA 4A7YA 3SKVA 1CZTA 5H9PA 4B8EA 3X29B 4FXKB 4ONUA 4FBFA 4HBNA 1K5MA 4IE0A 2BWCA 1CAUA 1ODNA 3ZXEA 1YFWA 3NNGA 5FAXA 3ZDSA 5ABJC 5JR7B 2R1DA 2OPWA 3FHAA 2YC2A 2NLRA 3JD71 4W8JA 2VMCA 5CFCC 3A23A 4XUQA 5KXDA 4CDXA 1VAVA 1MVQA 1URXA 2J1UA 3AYAA 2A3YA 4JQRA 4MADA 4OZXA 4P9YA 3POYA 3ES4A 1J3PA 2ZJCA 1UL9A 1KEXA 1X8EA 2GMMA 5FMOL 3NV2A 4LK7A 3CQOA 4MVTA 5FO7B 3P6BA 4LPLA 1CPMA 3K46A 3EQEA 1DDLA 1FMD1 3AZYA 3D6EA 1FOD3 4WZFA 4CCDA 5AFEA 3MIDA 4E2QA 4RHV1 5C3SA 5CKNA 4Z1VA 1RMU2 3OD4A 5CADA 4I0WB 1NG0A 1O59A 1ZBA2 3ZYFA 2RVAA 2VAUA 2PAKA 2WWUA 2X53S 2B7YA 3UGFA 2PA7A 5EYYA 2VL4A 2XPJA 5FZLA 4SLIA 2NPIA 3H7JA 1AR92 2FMYA 2B45X 2QDRA 2IXKA 3QCWA 5FYVA 1WCDJ 1CVNA 3VBFB 5FZ7A 2YMZA 3M1HA 2A6XA 3K3OA 4L99A 4GIQA 1B35B 1AUYA 2FCUA 2ZX0A 2VNRA 4BYYA 4TTGA 3H8UA 4W4ZA 5F37A 2P5BA 2Y6LA 3CL1A 3C3VA 4BLJA 3U4XA 1FV3A 2V5YA 2YFZA 3I2DA 3N3HA 3FBYA 3ON7A 4R8HA 4XCBA 2RR13 4XXAA 5IVCA 1PM7A 3SH5A 1RGSA 3OGJA 1DGLA 1NKGA 4MXVA 2VMDA 5EJ3A 3J8F2 1WCKA 3OCPA 4YPJA 1ULOA 2GMEA 1RMU1 1RVF3 2VW2A 4L2NA 4D6QA 1YJKA 2VOTA 3VDCA 1ZBA1 2RR11 2P37A 1LB2A 2O8QA 2DYCA 4RD7A 1PHMA 1SZBA 2GN3A 2IFRA 5C5TA 3IMNA 2H0VA 4FAGA 2RM22 4NROA 5KC6A 3VKFC 1AR91 1OVPA 3A0NA 3PJQA 4AFAA 3K4AA 4FTEA 1GZWA 2BP6A 4CP1A 4DO0A 4GB33 3W59A 1Z7S3 1TEIA 2DCYA 4F83A 1GUIA 3AZZA 3I2HA 5FYTA 5K4LA 3S6PA 1GU3A 4NO4A 4Q0PA 1NXMA 1RUJ3 4R9AA 3H50A 5HXMA 1J84A 4HONA 3WOGA 4E2SA 5L73A 4CDWA 5FZ9A 4E27A 5J48A 3NAPC 4YW2A 2XG3A 4IV3B 1VBA3 2DUQA 2ZGLA 4A4AA 4YSFA 4FOQA 3WG2A 4JV4A 3T2PA 4KWKA 1H1MA 3LWCA 3VBUA 4FAHA 3PVNA 2VVFA 1GP4A 1WMEA 4PDWB 1AYM3 2VCBA 1DIWA 5J7MA 2PHLA 3OPZA 1AR62 3J8F1 5C8CB 4FVVA 1B35A 4OUEA 4HKOA 1W3VA 1QGLA 5KBFA 1POQA 1JYCA 1SLLA 4AI3A 2HBTA 3FUOA 1DQ6A 4FPGA 3FL7A 1O3SA 2YGLA 4S2FA 4XTMA 5B4XA 2WA4A 4AL9A 1HRV2 2VVEA 2BQPA 4IUGA 1SEFA 4LUKA 2WO7A 5J1XA 2BBVA 1YIPA 2B9VA 3HQUA 3KV4A 3LPGA 4H14A 2PN5A 4Z82A 1J3RA 4DEVA 1B09A 4ASMB 5A32A 4LBQB 2W08A 3KZ4C 4A44A 5LA0A 5FKCA 2XJVA 2YU1A 3PVOA 2WFPA 5DDJ3 3QLQA 1V0AA 3FFZA 4P9GA 4QXBA 2YDEA 1UWWA 1UZZA 5A6XA 4CDUC 3VBSA 1SPPB 4QHZA 3I4IA 2V73A 3FC0A 1LECA 3MPBA 3PNAA 1F2NA 5E88A 2BW8A 4NWWA 1NY72 2Y64A 4HSLA 4QXCA 3WUDA 4WVVA 4QU2A 2BDRA 3FE5A 1BXHA 1GOGA 1GZCA 2BZDA 2WS92 5LBCA 1AR61 4Z8BA 3S57A 1UCXA 1GP5A 3D3AA 4JX0A 4XDQA 2OT7A 2QQWA 4YZ3A 1HLCA 2PMWB 5BNOA 2AYHA 4ZZ8A 2D5HA 2HWC1 5FYUA 1JBCA 4TXWA 1ND2A 4N43A 5KHGA 2W39A 3F95A 4N9HA 1XSRA 2A6WA 5A3MA 5FYSA 1HRV1 4IV3A 4META 3RQ0A 2C5DA 4L11A 2YG0A 3WF1A 4GULA 3ZXFA 4AVTA 5FZ4A 4KNCA 1Q8QA 1QY4A 3I8TA 1UOFA 1KJRA 3KQRA 4NHYA 1BEV3 5TSWA 1TG7A 2C9AA 2P3JA 5EJ1B 4QMAA 2DBNA 2LROA 3I97A 5EFUA 3BOWA 4MHRA 4YW4A 1RB8G 2WNVC 1PMIA 2A6ZA 2R7EB 1MZFA 4X8NA 5T54A 5KC5A 1NUKA 4QD2A 3AP5A 1F4AA 3RZKA 1N3PA 1VMFA 3ZFEB 3ZKUA 5CISA 1TZOA 4A6SA 1WWYA 2OA2A 3H8RA 3KS7A 4Y4RA 5DPNA 4N53C 1HRI2 3HIFA 1NY71 3WDWA 3ZSMA 4AQ2A 1W99A 1NCRB 1HJFA 1TMF2 4GALA 2WS91 2ARBA 1UX6A 2PHFA 1NCQC 4AEDC 4CEYC 4QGNA 4GZ9A 2XB6C 5CVRA 1BZWA 5F5CA 4K1ZA 1SLTA 5KWRA 4GH4B 2Y6GA 2WZR3 3KF5A 3M3OA 4JC1A 1WW7A 4LO8A 1A34A 1NYWA 1Q8VA 1RITA 4GWNA 4HT1T 1JU4A 4DQAA 2AC1A 4QHOA 1Y9QA 4NPMA 4OYUA 5EQUA 3SCFA 3WP3A 3LOBA 5FZ8A 3FLTA 5FK7A 1LU1A 1OOPA 2W1SA 2D44A 3WDVA 3PUQA 1EPWA 4P9LA 4QXKA 1SCSA 1FNYA 4ZY9A 5CA6A 2QFEA 4CXYA 2UY8A 3JU9A 5IK7A 5FLJA 4ZU4A 4LLFA 1WCUA 5LCWL 1ZA7A 1LOCA 1GWMA 2OZJA 4AOCA 1OPOA 2X29A 3DKWA 1YFUA 4COYA 3KT4A 1H9PA 3OBAA 1UOBA 4LUMA 5HI0A 3U0ZA 2XMLA 3ZN6B 2YGMA 1HRI1 1T6GC 2FDJA 2XL7A 5BNPC 5T5JA 3AZVA 1DZQA 1RUE2 3VDDB 2JG9C 1J59A 4HPKA 2VMGA 1OPMA 1VRH1 4Q29A 4BIFA 3H9AA 1XRUA 3DPRB 1DZRA 5I91A 5JXIA 4IGPA 1NLRA 3VKNA 4ZU7A 1MZEA 2QQOA 2VUAA 4M0HA 3BIWE 2JG8B 1LGCA 3OUHA 4XOGA 4CUAA 1W04A 4Y1UA 1U5YA 2A7AA 2FQPA 4YG6A 1CZVA 1LEDA 4AR2A 2VZSA 3WDYA 1HQLA 1W0PA 4LIUA 4DUVA 4OULA 3AJYA 2JECA 2ADEA 5F1RA 2AH2A 4WVWA 2VU9A 3WNNA 4KQ7A 3GHMA 4OHVA 2QCSB 3AJZA 4IEZA 2RHPA 2HWD3 4QKNA 3ENRA 3KT1A 1DHKB 1PVC2 1V70A 1WMXA 2Y60A 4MGZE 5IUQA 4PF5A 1VP6A 4YW7A 2PLV2 5EV7A 1V9U3 4NVPA 2B42B 3DEMA 2QQLA 2WRAA 4K6BA 5FMDA 1BK1A 4BIOA 2FDIA 2D3RA 3ZN4A 2VNVA 2WJSA 1L3JA 2P3YA 3OB8A 4E4ZA 1V6LA 4XC9A 5BPXA 4XABA 4M00A 1GZ9A 1XBFA 4LIVA 2V5DA 3WD5A 4EN8B 5I0SA 2GN7A 2FCVA 4ASLA 3VKMA 1Q5OA 4Z2WA 2LALA 3T2TA 5C9AA 3HMYA 3P1IA 1IG3A 1CONA 3PLQA 4LBOA 1X7NA 4XE9A 5C3RA 1I9RA 2RS11 1MS8A 4G3YC 3N9MA 3T08A 3EMRA 1VRBA 1XNBA 2W1QA 3G7DA 4MGTA 3CJIA 3HNYM 4BISA 5IATA 2YYOA 4KMQA 4XIOA 2JG8A 5T55A 4Y1VA 5CZKA 4WM7B 3USSA 4A3XA 2ZGNA 4K3UA 4LKFA 1QH7A 3KT7A 3VUOA 1QJY2 1BVP1 1ONAA 1Y9GA 2KD7A 1M4WA 2PLV1 3A21A 4XBQA 3WSOA 4NHKA 4RFT0 4OI1A 2VXRA 2OPKA 5A7PA 1KS5A 4BQ4A 2OVUA 5JIAA 2CNAA 5FY5A 1MQTC 5FZOB 4RSUA 3RPQA 2OW4A 2QQUA 5E16A 5FYMA 1GP6A 3BTYA 2YZ4A 3PURA 3OPWA 1W2NA 4QM8A 3MIEA 1RUC3 4LMFA 3A7QA 1EV12 4XPVA 2E6VA 5L9VA 3ILNA 1RUNA 1AVBA 1D4M2 1QOOA 3MO4A 4PBOA 4ET7A 1YI7A 2FZ1A 2R062 4MGIE 5FQ0A 3VBOC 1JODA 1LOGA 3FLPA 4FFFA 4E9KA 3TEZA 1LAJA 3M7AA 3LFIA 5A80A 1AR73 2ZEZA 1JZ2A 4FPKA 2J1EA 1WA6X 3C7EA 3J7NA 4Q4V2 5DZEA 4JVAA 5JPNB 5FYHA 1LESA 5J09A 4PHZA 3N7LA 5D21A 4ZPIA 5GZDA 5DUVA 2VQTA 1IG0A 2P17A 1WCSA 5GLUA 3I2KA 4AI2A 4XFFA 4ZHNA 2B9UA 5FBJA 1S2KA 2FDFA 3AP9A 4ISRA 1RUF2 1UU6A 1OD3A 5BXXA 3ACGA 3S5QA 4AHYA 2DVDA 1T2XA 3IKWA 4TLFA 3BKZA 4YVSB 3ES1A 1MS9A 1QH6A 4FPJA 3WQ1A 2CSGA 2GNBA 1XNCA 3I2FA 1OC1A 2AGSA 2VZ1A 5DG1A 1S0CA 1OQDA 3ZSLA 5AC92 3HWJA 2HWE1 3AMNA 4QPIB 1O5LA 3BU0A 3B69A 4MXWB 3WNMA 2OUJA 2VQ0A 4RGKA 1EV11 4MO3M 4S2GA 4WM7A 1RUG3 1MPXA 3ACIA 1W6NB 1GR3A 3NNJA 5JUVA 2W87A 4JDOA 1RINA 1F31A 2QBXA 4GA9A 3ZPOA 1AL22 1BBT2 5FZOA 2VZUA 4Q4V1 3ZMNA 1WD4A 3UKNA 5A7WA 2ZX1A 5LBFA 1KRIA 3B02A 1XE7A 2BOJA 4P02B 1PX3A 2IWGB 1DG6A 4A3ZA 1XNKA 2RJ2A 3RI9A 3U78A 4M3CB 4O65A 2UWBA 3HNMA 3AZXA 1RUF1 5A1FA 3IPVB 2CL2A 3O1PA 4MV2A 1W6QB 3TRSB 1ZBE2 3N7MA 2XQXA 2Q1ZB 4LHKA 5I8TA 5B4NA 1QIQA 1KITA 1DQ0A 1HXS3 4A41A 3WHTA 4ASKA 1PGL2 4AVCA 3PDQA 2VZTA 2G9GA 2XUEA 3RZLA 2ZGSA 2BV4A 3ZYJB 3H3LA 1NA1C 4XDPA 5A33A 2VY0A 1OLME 3GNEA 1VR3A 4W6XA 2XLFA 5IFPA 1POV0 1BBT1 2EAAA 2IXIA 3OBTA 1NE4A 4NRPA 2ZX4A 4CUBA 2XKPA 1QJU2 2CAVA 1UKRA 2I07B 4QKDA 4PIZA 3ETQA 3IZOA 1HN1A 1EYBA 4KU7A 4QDQA 2HYXA 4RQPA 3KM5A 5GLWA 1RUH3 4QPIA 4CP9A 4CUGA 1KFXL 4MXWA 4XEZA 4JDNA 4JGYB 2UYAA 3I7DA 1N3OA 4HN0A 1A8DA 1SFYA 3BPSA 2WN2A 3ME2A 4BHPA 4OLLA 2Q1FA 4C90A 4EN7B 5JAXA 2LTNA 1GOFA 5F7UA 1O91A 2V72A 2XLGA 5JI9A 1UY4A 5A6QA 3MLJA 4V2VA 1H8TC 1JHNA 2R49A 1V6KA 2Y0IA 4P9WA 4BQWA 1G8WA 2UURA 2Z79A 2PHUA 4FO9A 4Y5SA 3CZUA 4LOSA 2K2SA 3AKRA 4MGQA 1W90A 4YGEA 4E4HA 2ET1A 1LTEA 1OUSA 1UXZA 4Y20A 3RMXA 2BFUS 2OKXA 1E5HA 5FZ1A 2FHRA 3N9OA 1JZ7A 3IPVA 2Q0AA 3O1TA 1LNSA 3RZGA 3HD8B 1QOTA 4M4RA 3RFRA 1PO22 5LA1A 1TME2 3NKGA 3ZFGB 4UXAA 4LBLA 3GJBA 2JWPA 1QJU1 1H2KA 4I2OA 1S4CA 3OG2A 4GMP1 2DTYA 3U07A 4IEOA 3FLRA 2PQSA 4B4PA 2V4AA 5J37A 2DCTA 2E9QA 3AP4A 5JVVA 3JZVA 3FN9A 2WNUC 1Y9MA 2E7TA 3I3EA 2ZPXA 1UYYA 3AFKA 2EXKA 1VBC2 3ACLA 4EROA 1QDCA 1QXJA 3JXSA 4Y5Z0 1SQ4A 2VTXA 4K7JA 5IWFA 3RI8A 3SXWA 2WC2A 1X9TA 1W6PA 3MZHA 1W6MB 1ASJ3 2P6CA 4IV1B 1UIJA 3B00A 5FZMA 2XHKA 4R9BA 5JSPA 4H7MA 2Y8KA 5IW0A 3DXUA 5CB7A 3DV8A 2HLEA 1ENRA 3PIGA 5FO9B 2NYYA 3CU7A 3C7HA 3VBRA 4PLOA 1D4VB 4LLOA 4QX2A 1DYKA 4W6YA 1WW4A 2CHHA 2NMNA 1PO12 2VMFA 4O7XA 1WZXA 5DN2A 2EXIA 2RDRA 1TME1 5A7OA 1BLZA 5GZFA 2AREA 3HN1A 3NW4A 4UW6A 1MS0A 1ENXA 1REFA 3THPA 1DF0A 4MGYE 5J98B 5CYYA 1SLIA 1BCXA 3AYDA 1CIWA 1O7FA 2RS32 3GZTB 5DAWA 5FYIA 1AX0A 4DEQA 3J7HA 3BTXA 5T5PA 4RS5A 1BHGA 5F5QA 3NJZA 4AI0A 2W1WA 4XQWA 2Y26A 1VBC1 2J1TA 4Q4Y2 4N90A 1LULA 1XNAA 2BU9A 2YU2A 2Q1MA 1MS4A 3I3BA 4Y1XA 1O6UA 1MEC1 4Q4W3 4OQ9A 2QUOA 3ZFGA 1OT5A 1LHVA 3CKHA 2MNGA 5GLTA 5IVEA 2J1RA 4FPOB 3ZFFB 4H7LA 1OH4A 4P9JA 1BJQA 1YYNA 5T3NA 1O4YA 4XQDA 2VUDA 3MV11 3JCIA 4C0BA 5F32A 5JPMB 1PX4A 3RZMA 1GFF2 1SLAA 3RDIA 1YQCA 5L19A 1QJX1 2EIEA 1PO11 5J3UA 1AHSA 2R0HA 1K5MB 5T5LA 1CAUB 4QX7A 3NV1A 3NQHA 4I0AA 2EVXA 1OUXA 5CKMA 1W6MA 3SKJE 1GANA 4DZGA 5IVFA 2BGPA 3AFGA 4HKWA 4MOAA 4Y1ZA 2XXZA 2RMU1 4CDXB 2W0XA 2LRPA 3HN3A 4XUOA 4YVWC 1H6XA 4Y26A 4FOVA 3UJQA 1EPZA 1YQ6A 2RS31 3HBKA 3VZNA 2VMHA 1PZ9A 3B9IA 4URTA 3DF0A 4RR3C 3MLLA 1HDKA 1H8VA 1RJ8A 2VUJA 4DY5A 1CX4A 1HB3A 3OPTA 4LULA 4Q4X2 5D8AA 4DPNA 2OQ7A 2WLPA 1QXRA 4V1PA 5LEKA 2D6NA 3CHXA 2XHNA 3WDTA 3IWZA 4JGZB 5KXBA 1IQDC 3GXUA 4UAPA 3WW4A 1UZVA 2WZEA 4L0PA 1S0IA 1XC6A 3ZX7A 1QQP3 2VULA 1ULCA 3MI8A 1WGPA 2PHRA 4FOYA 1RUD3 3QACA 3LIGA 1RC6A 4A2UA 1QU0A 5DAXA 1AXZA 5KR7A 4A45A 1O8SA 2E32A 5ANNA 4ARXA 4WVMA 3JBG3 3VD7A 4AQTA 5BNNB 3WDXA 1H6YA 2B5HA 4LA3A 4RHV2 2XBO3 4CDQA 1GZTA 4I3GA 5CG8A 1IQAA 1REEA 5A3PA 3MGUA 1LOFC 4C91A 3PMEA 4BXFA 1XQNA 1SHWB 1RUD1 4CUCA 5EPAA 4Q4X1 4CCMA 3WLUA 4ZS2A 1IOAA 1OLQA 4LT5A 5FOBB 1SDDB 1FOD2 3JBG1 1XNTA 5IAXA 3CMGA 1PK6A 4QB6A 3TN93 3LA2A 2RG4A 2VBBA 4LQRA 2R6QA 4AEMA 4AK3A 4FT8A 1Q8PA 1VBE3 3GYDA 3OGGA 3VBFC 1V6JA 4LKDA 1P8JA 5FUIA 2QQJA 3BU7A 4CCNA 4DUWA 4CPBA 1UY0A 1B35C 5A3WA 1TNFA 3ABZA 3C2UA 4URAA 4TYSA 5GJ6A 3OYWA 4AHZA 2DBIA 2PQQA 3URFA 1WW6A 4LBKA 5CAZA 4QPGB 3OBRA 4XF1A 1UN1A 1JHJA 3ZR5A 3MFAA 1GZWB 5FP8A 4JHTA 5K9YA 2WQ8A 5FRAA 3HOBA 2GC2A 2VG9A 2W3JA 4JGZA 3S30A 3IDBB 4UFJA 1UZWA 1WMFA 3SC7X 4MYEA 3TNPB 5A3UA 1J58A 2TNFA 2WLQA 2R073 4NRMA 2VW0A 5C5UA 2W9XA 5SV8A 3VZMA 2RR12 4CDWB 1US2A 1YLLA 3LDRA 4AWDA 2XJUA 2UYBA 3ROUA 3RYRA 2RS53 3VBUB 1FOD1 1RHI3 1D0GA 2VNGA 1JYTA 1PMJX 2ERFA 4PLNA 1YWKA 3EYPA 4ATEA 5ACA3 3LQCA 3NRUA 5C6CA 5BNNA 3AVSA 4LBJA 1A78A 1G7YA 2OS2A 3LPFA 1RVF2 2R30A 2YB7A 2XJSA 1PZ7A 2X05A 3FHIB 3IMMA 5I8YA 2ZX2A 1GQPA 4NIIA 2C0ZA 1DCSA 4RFRB 2ZHNA 3POFA 1S0BA 2F4PA 5FXWA 1ENQA 2AR6A 5FPXA 1Z7S2 3CLPA 5A32B 3WR0A 4QQ2A 3LKJA 4IV3C 3THTA 1LKNA 1KQRA 1VJ2A 1Q8SA 2ZOEB 1RXFA 3OOXA 4J6GA 1SMVA 4AW7A 5BUVA 4PDWC 1PVXA 3I59A 2CY6A 1RUJ2 2ZGOA 5F9TA 2GNTA 4QXHA 3S5AA 3VBSB 2FBEA 3ATGA 2JDZA 4CRQA 5C8CC 1VBA2 4WBBA 2EXHA 1W9TA 4LE3A 1LHWA 3D0SA 5I0DA 4QGMA 1T6BX 1UMIA 3AMPA 2X09A 4WM8A 5IVJA 4QPGA 4NIHA 4OMCA 1AYM2 1ODMA 4A6OA 5JZGB 1STMA 3FUQA 3T09A 3POBA 2ILMA 3VBHA 1AR83 2Z42A 3M4FA 2EA7A 1RVF1 5BNOB 2ZZJA 4GJZA 5F3GA 1RYYA 1ND2B 1G6NA 4N43B 4HSJA 3NJYA 1DLLA 4LR4A 3WF3A 4YYOA 5DAQA 3KV6A 1JYNA 1AYN3 1MR5A 4OMDA 4C1XA 2GC1A 3CF6E 5FMOS 1D2SA 1HB2A 4GB31 1Z7S1 5LRRA 1CJDA 3NVCA 1AR81 2QJVA 3LOIA 4JRAA 2J22A 4FTBA 1ND3A 1VPHA 2R32A 1KFUL 5BY5A 1MACA 3RNSA 3ZYBA 1KDMA 2HWF3 2HWC2 2ZKLA 4N9IA 1RUJ1 4EQVA 3K2OA 1DYPA 2GDFA 3K77A 2BERA 2WT1A 3BN6A 1PNFA 2G1MA 3TAYA 1G9DA 4OUMA 1VBA1 2L9LA 1CGPA 3GBFA 1NLQA 2JX9A 2Y6KA 4QDSA 2BNMA 3T4VA 3ZN5A 4CCJA 3RZJA 2WZ8A 3N36A 1U5XA 5GLVA 1AYM1 3RWNA 3UETA 3RYPA 5CFCA 5LY1A 2BPA2 5IJRA 2EXJA 1W2AX 3QH6A 1HKDA 5A70A 4JHZA 2RM23 5FPVA 1NAEA 3FJSA 3CJXA 5FCCA 2JIJA 3LEMA 1Z0HA 3A22A 4NIAA 4YRDA 4XBLA 2V09A 1UPIA 4PQ9A 4SBVA 4QX0A 1W2OA 2VQUA 5KXEA 3AYCA 4XXPA 1SG3A 3C8XA 5JMCA 3ZXAC 1R1A3 1US3A 1DLCA 1COV3 5EYXA 1OOPB 1OKOA 3IN9A 1BEV2 4KL1A 2WO2A 5IVBA 3ZFEC 5JZGA 1JZ8A 5FWJA 1POV3 3D5OA 3WHUA 1VBD3 1X50A 1EUUA 2MPFA 3KVAA 3BB6A 3FMGA 3KMHA 3MIHA 4UF0B 5DDJ1 3T2OA 3ZO0B 1NCRC 2UWAA 1OURA 4QX8A 5IAVA 3WVJA 3WNPA 3USUA 1OI6A 1OMIA 4COWA 5CFDB 5JXJA 3WP5A 1ULEA 2LS6A 3N35A 1COV1 4GH4C 4H2AA 5DXDA 3VL8A 2IXCA 2GU9A 3DYPA 4DS0A 3SH3A 4FPHA 2GSYA 4YW5A 5HPOA 1S55A 4NMIA 3EXUA 2J1AA 4BM8A 4I09A 1TQ5A 3GZAA 2JIGA 4AEJA 4XBNA 2K9ZA 1SBEA 3JQXA 4HPKB 4UOJA 4LKEA 3E6DA 1DQ2A 4Q27A 2VQAA 3WW2A 5JMOA 3RWKX 4LE4A 3H42B 4OHZA 1VBB3 3BTAA 5HBAA 4YZ2A 4S2HA 3WUCA 3RS6A 4AE2A 2Y33A 2LUWA 3MIFA 4TZDA 2WYSA 3MHZA 4C0HA 2GNDA 1BEV1 3HPNA 2BTVC 2JE9A 5G05L 2WFF3 4ORFA 5JXGA 1CX1A 3O12A 2PYTA 2Y38A 1C3HA 4OFGA 3UT0A 1XB9A 1W05A 4YW3A 2K46A 1NQDA 1VRH2 1MS5A 2VGDA 3WF0A 4OHYA 1RUI3 1CAVA 5DQ0A 3VDDC 1CIYA 5F3EA 3IAQA 2VNOA 4BQ1A 3S7IA 5F3CA 2WYFA 3DPRC 4MZUA 2WFF1 3LSEA 5JOYA 1UY3A 2BEOA 5T50A 3P3NA 2JG8C 4XILA 4BQ2A 3M2MA 4TWTA 2XLAA 4UF0A 1RXGA 3BI3A 1DU3D 3H1WA 4LORA 2WZR1 3QBQA 1DQ4A 2WL1A 1WLDA 3O0WA 5DABA 5FY4A 1EAH3 1DP0A 5CFDA 3I2IA 2DF7A 2PXJA 3UKTA 4Y1YA 4NRQA 4CEWB 1X8MA 3MF6A 3PU3A 4Q0UA 3NV4A 4P9IA 5FYCA 2YBKA 4LXLA 1JMUB 4DRVA 3EBRA 5C9AB 2OQ6A 5E89A 3IBMA 4X8PA 2Q8OA 4CCOA 3VDAA 4EV0A 3J9SA 3I2OA 4QQPA 1TMF3 1IPSA 3IT8A 4UI9L 5JXHA 1C1LA 4BMEA 3CJIB 3LCPA 2YBPA 3ZYPA 4IEPA 2Q30A 4LOTA 3MIGA 1KXGA 4G4FA 3IM0A 4YFWA 1V9U2 4DXRA 3O1RA 3AZWA 4QPWA 1L7QA 3IIAA 5GALA 1UQXA 2WQZC 2RS12 2GC0A 4TN7A 1UU5A 2ARCA 5FZDA 5FXXA 4CDUA 3KCXA 5GZCA 4P08A 1ALYA 5L7OB 4IE4A 4DFSA 1Q3EA 2GNMA 1AX1A 3RVHA 1ZRRA 2EICA 5DUWA 4U2AA 4DMIA 1JS9A 3T4HB 3R4DB 1WKYA 2ET7A 4O61A 1BVVA 4AI8A 2W1UA 3PMSA 5A3OA 3VN4A 4XQ4A 1UOGA 3K75B 2BGCA 1YJLA 5FQ0B 4S2DA 3UK9A 4WM7C 2XJPA 4LTAA 4PQQA 3M70A 4R9CA 1QXPA 3WT3A 2QVSB 1JZ5A 1BK0A 1RUE3 1W8TA 1VMHA 4EWAA 1YQ2A 5FR3A 5LEJA 1F8VA 3HJRA 1RUOA 2HWD1 3BOPA 3V0BA 1LODA 4CEWA 1UKGA 2VUCA 3R4SA 2UY9A 4Q8LA 4R4ZA 5A7SA 3WX5A 1LOBA 1PGW2 2B39A 2JKBA 2VZRA 3CNAA 1KD7A 4B3NA 2UU8A 3NJVA 4X6QB 3SHRA 5FPUA 4XVHA 4BXSV 1V9U1 5IK4A 1O4ZA 2MEV3 2VTFA 2JB8A 4QGLA 2WNVA 3MW3A 3T1MA 2DU0A 3V0AA 2BOIA 4AHWA 2E33A 3GM8A 5DMYA 4HVQA 2VC9A 1RUC2 1TVGA 2ZHLA 3AKSA 3POGA 2R043 4N53A 5H9RA 4NOTA 2WWJA 5FXVA 4RL7A 2JE8A 3LGRA 2WAOA 4QX1A 4AG4A 5T52A 2IVIB 5DUXA 2ZMKA 3PUAA 4AEDA 4CEYA 3RZHA 1AR72 1X36A 2VH9A 2A3XA 3KGZA 1OQEA 1PVC3 1ULGA 4BDVB 2PFWA 3LZZA 2GAUA 4NHXA 3AMHA 2N7GA 4XUTA 3MF9A 4XETA 5A7WB 3O14A 5L7OA 1LGNA 2HWE2 3U1XA 4TLGA 4IE5A 4YVSC 1IKQA 1XPWA 4ZKTB 3DCQA 3WQ7A 4HFSA 2E51A 2Q8EA 1KGYA 1PGW1 1DZTA 2YFUA 1W9WA 3O0VA 4HXCA 4LA2A 4XF0A 2XJTA 2VMIA 1MZ6A 3WCRA 3ZXJA 2XH6A 4E2GA 4PF1A 3MV01 3EHKA 2VBPA 3WEZA 1YQ8A 4BWOA 2HWB3 3ELNA 1CZSA 1A3KA 4WZCA 3GGLA 1RUC1 5JR2A 5FY7A 5AVAA 1PIV3 4HL0A 1RUG2 4PJYA 5IVVA 5KHJA 4NR1A 5BNPA 3APBA 1N1VA 4J1WA 4HN1A 3D4KA 2XWBB 1AR71 5A33B 4EWEA 1OXCA 2JG9A 4AGGA 2OYZA 1ZRCA 1F9KA 5FZHA 2HWB1 1F35A 1H0BA 1N1TA 1QJY3 4BQXA 1CPNA 5C7GA 2D98A 4NN0A 2VVDA 2ZEXA 4GAZA 5FTTC 2VR4A 5CBLA 3O1UA 3N9PA 4RQPB 4ITCA 3SEPA 5IFTA 4HK8A 3WNXA 4CP9B 4JZRA 1V6IA 2D7FA 5F2WA 3WG1A 1OFSA 4Q8KA 1JTZX 1LU2A 3PUHA 4RGGA 1NQJA 5M0TA 3ZIXA 2OZ6A 5AVPA 5LA2A 3Q9OA 5FP7A 2ETEA 3BGAA 4QKBA 3BYWA 2ZTNA 2YY1A 1D4M3 3H8OA 3AXEA 2E53A 2H0BA 2D6MA 2R063 3AKPA 3NKTA 2ZGRA 4HANA 2H6CA 5CKQA 4BQ3A 3RYKA 3AVRA 3DGTA 4CU9A 3OUIA 3IIIA 2D5FA 1E57A 3EO6A 3VHRA 2WR9A 2WSVA 4AGRA 1XYPA 2HKXA 1RUG1 3CO2A 3MUZ1 2DDUA 4J1XA 5FMCA 2X5IB 3SNMA 1YCIA 3ZVXA 3OUJA 4AEKA 4DY3A 3M3QA 3TEWA 1PM4A 3DN7A 3IDEA 2NQYA 2IVJA 2YUEA 4KBZA 4JGYC 5LATA 2D93A 4QQLA 1F15A 2WQ4A 3B93A 3RRDA 4LHSA 2G4IA 5FP9A 2VOKA 2ZGMA 1K42A 5FY0A 1HN0A 4EN0A 2Y34A 1RUH2 2VOXA 3HNBM 3VZKA 2HEVF 1DGRN 3DYMA 3U10A 2ZX3A 3T0DA 2RE9A 5JLVA 1XYNA 4DXSA 4BQYA 3H3UA 5AC93 1H2MA 1O3RA 3I2JA 2VMEA 3DL3A 4ZXEA 3J26N 5GZGA 4AQ6A 2EIDA 4XCAA 5LWBA 2W68A 1Y7BA 3E5QA 5JCTA 2WT0A 5FZFA 2DURA 5HCAA 1WLCA 1W6PB 3HT1A 3O5SA 2PHDA 1OQ1A 1HXS1 1AL23 3AXDA 3B3QE 3W21A 1LHOA 3KHBA 3VV1A 3ZFGC 4IW3A 1LHUA 4CE8A 1XSQA 1S1AA 3VBRB 1W0NA 3Q8FA 3ILFA 1WLTA 2XDVA 1W6OA 3UGGA 1MQTA 1OF4A 1R083 1CD3G 2W2IA 4NPRA 2A71A 3ZYHA 1ZNPA 2VO5A 4IGQA 5F8PA 5FKBA 4K40A 2QQPA 3KLSA 1RUH1 1HB4A 1ZBE3 4GXLA 3IB3A 5K0UB 3K48A 1V6MA 4P14A 3WCSA 4F8AA 4L8QA 2XOMA 5LK7B 2O1QA 2CAUA 2QZ3A 2X5IA 4IV1C 3VBOA 4AAPA 1HJGA 2PELA 3W5MA 2HJIA 4RS5B 1IS3A 4P00B 2B46X 1R081 2W47A 1R093 2JDYA 3HVDA 2W46A 2D43A 3ZPYA 3I3MA 3QH7A 2ADDA 1XU1A 3AK0A 4K20A 1OF3A 2ID4A 2WNEA 3LDKA 4INDA 4XURA 1UD1A 4ATFA 2JDKA 4AYUA 1CAXB 3VKLA 2ZGKA 3ZYGA 1J3QA 3DXTA 3I54A 3LIHA 4JKLA 2B8MA 3R0RA 4XZUG 4AVSA 4CVUA 5I93A 2VZ3A 4Y20B 5KHHA 2DTWA 1GOHA 5A3NA 4BCUA 4GKYA 3UGHA 1Q8OA 1MEC2 1G9CA 1TE1B 1SFNA 2DCZA 3V64A 1XXNA 3MFCA 4BOWA 3MICA 4B1MA 3AKTA 4M0NA 1UPSA 3AX4A 4LBNA 5FPLA 1HX6A 4RN5A 5LY2A 2VCMA 4AFDA 2RV9A 4K9SA 3SCHA 1OD5A 3TEXA 3LFMA 2I45A 4FFIA 3ZFFC 1UMHA 1QJX2 2ZEWA 4AGVA 1F4HA 5D8AB 1JN2P 1I3HA 1QJEA 1YUDA 3SH4A 4XF4A 1W06A 4B29A 1W0OA 1G9AA 1ASJ1 2XONA 1E5IA 1UY2A 2P6HA 2YBSA 3GHNA 4L97A 5FUNA 1K5MC 2JENA 2C26A 3ZSEA 2QQVA 3HBZA 5LBEA 1PO23 2RMU2 3H0OA 3J7MA 5K0UA 3W9AA 5C4WB 4Y3OA 4LNVA 4V2WA 2J1VA 3MYXA 2X8KA 5FLIA 2XUMA 4MX3A 3ZM8A 5K7PA 5ISLA 4CDXC 1TNRA 2ZGQA 5C3QA 1JOBA 4W65A 3POIA 1MVEA 5FPZA 5SV5A 3ZMOA 2D97A 4JKMA 5ERLA 4YWAA 3NMBA 4W50A 4MG2A 1X33A 3B9CA 5J36A 2HH9A 1QDOA 4WVMB 4OUSA 5IHRA 1KS4A 2XR4A 1Q43A 4IEQA 2ZHKA 3LEIA 4XYXA 2WSUA 1LR5A 1CAXA 2EALA 4CDQB 4XFAA 3ZYRA 3RSJA 1NA1A 2NMOA 3WINE 4JGZC 5I0UA 4PCRA 3NV3A 4QX5A 3SMHA 4YM3A 5IK8A 2Q8CA 2P3IA 3ZXKA
chains in the Genus database with same CATH topology
4Q4W1 1AJKA 5I8SA 3W58A 1PK6B 4XTPA 4NHLA 1NE6A 1NZCA 3MEPA 5KHKA 4OI2A 3AMQA 1WBFA 3CEWA 4M3CE 4MLOA 1GSLA 1GQGA 4BE3A 1ZYBA 5BNNC 3WP6A 3VGIA 1RUD2 2BUKA 4NWVA 3OYWB 3UKVA 1WUVA 1APNA 3FZ3A 3M8LA 1FX5A 3JBG2 2CTVA 4Q4Y3 3JB4C 2QZ2A 4DXZA 1QOSA 2XGXA 1J1TA 2XBO2 1UF2C 5D1IA 1LGBA 5C4WA 1Q56A 3ZSJA 5FO8B 3TWIA 1S0JA 4FPEA 5CIRA 1AZDA 4OHWA 1GLHA 1C8M3 1DGWA 3MW4A 2GMPA 1IS6A 1FPN3 2ZGTA 3NO8A 2D6LX 3TN92 3BODA 1OLRA 3QOPA 1JUHA 1VBE2 4QPGC 1GBGA 1EY2A 3QD6A 5HXVA 5JSRA 1YO8A 1ZRFA 1QQP1 2D3SA 1JOJA 3N4MA 1C28A 5DUUA 4AHXA 5FLHA 1VAMA 4CP2A 2NN8A 4AQSA 5HCBA 4KU8A 4AVBA 3H1MA 4JRLA 3VHPA 3N7JA 5IT6A 1ZZ7A 4CDWC 1F5JA 3L9JT 1QKQA 3MDPA 5JOXA 2JE7A 2XBO1 1ZZ9A 1HQWA 2PHWA 2VOWA 1C8NA 3JD73 4UW5A 3VBUC 4GQ7A 2R072 1DGRA 3S0MA 3I59B 4XIKA 5E8AA 2ZBJA 4IEUA 3TOJA 2G9FA 3JQWA 2RS52 4UW3A 1IKPA 1RHI2 4WM8B 2TEPA 1RTVA 4KGGA 3TN91 1QJZA 5ACA2 4IEYA 2ZZQA 2XVGA 1NOVA 2YXSA 2E7QA 1PZ8A 3VBHB 4BA6A 1VBE1 1O5UA 1H4GA 1FMD3 4Q2FA 1G86A 5LRSA 4KG0A 1LRHA 1AL0G 1SBDA 4RHV3 1EP0A 5JOWA 4FCAA 4XJ8A 3WXPA 4XFCA 4Q1PA 4DB5A 3VBSC 1LEMA 1FV2A 3WG3A 2DU1A 1ZA4A 1ZZ6A 4BLIA 1AJOA 1ND3B 2YPJA 1C57A 5FBZA 5JSOA 2TUNA 2ZGUA 2KXLA 1DQ1A 4ZXKA 5JZGC 2R071 3KCYA 4MSVA 3M3IA 1RIRA 1ZZ8A 2VW1A 2C1FA 4AFCA 5ABJB 5BNOC 2SLIA 2RS51 3LSDA 5EWSA 1RHI1 1ND2C 2P3KA 5JMCA 4N43C 5CFCB 4OHXA 2NP0A 1D2QA 4IEWA 5ACA1 4GB32 4KWJA 1AR82 4YVWA 4KH9A 2ZACA 4GKXA 4I01A 4IESA 1W39A 3E5UA 1V6OA 1OKQA 1QF3A 2YHJA 3SCGA 4RR3A 4UW4A 3KGLA 2XWJB 3VHOA 1YFYA 2JICA 1VALA 4RGAA 4B7EA 1H30A 1HV1A 1RMU3 1XNDA 3SITA 4AF9A 5FDBA 1AYN2 2VECA 2UWCA 2E63A 1ZBA3 4HVRA 4D7TA 1H2NA 1LCLA 2VPVA 2FZ2A 1LJ7A 1GYKA 1AR93 2HYKA 4FQZA 4LO7A 4P9XA 2HWF2 1MZ5A 5GLZA 2A75A 5KXCA 1U5ZA 2XJRA 4DNYA 3USUB 1C5HA 4WVZA 4KWLA 1G9FA 1QHDA 1Z78A 4MUVA 1N1YA 3O7OA 3PTYA 4W6WA 5GKAC 1YRZA 4Z07A 1BKZA 2CV6A 3UV9A 3NSTA 5DDJ2 2DFCA 1OFNA 1OOPC 4IEVA 1XU2A 1LOFA 2KM2A 1AXYA 3VHNA 4N7IA 3J8F3 4JDMA 3U11A 4COUA 3WW3A 5FFOC 1R1A2 1ZZBA 5ABJA 2WKKA 3GF6A 1COV2 2DVGA 1AYN1 1ULDA 3J4UH 2A3WA 5CFDC 3D82A 1VBD2 2IXHA 1N47A 1VLNA 3VKOA 4YGDA 1S0DA 3BPZA 3PVEA 3VBFA 2ZGPA 2HWF1 2ES3A 1WA4A 4IL7A 3D8CA 3R4UA 4GMP0 1CAVB 1S0FA 1WW5A 4E4SA 1DFQA 1FI2A 2ZMLA 2BWAA 1NLSA 4JTNA 2QE3A 5CU1A 1A6CA 1FAYA 4R9DA 5DZFA 4FPFA 2RM21 4O9GA 1KJLA 1WBLA 5FREA 3HQXA 2Q4SA 4DINB 2PAEA 1X82A 1W2UA 2R0FA 1UW8A 5K8SA 1AR63 2ZKNA 1VBB2 2ZABA 3VZLA 3AYEA 3NAPB 3K51A 5JWPA 1R1A1 4XF9A 5JDBA 2HWC3 1H9WA 1LOEA 3T1LA 4XFHA 2WFF2 2I74A 1POV1 1U12A 4DOUA 3NL1A 1HRV3 1VBD1 1I1EA 1GV9A 2ENRA 2NZ9A 5F6KA 2GZWA 3SISA 2GALA 4R4XA 2WZR2 3G6JB 2D6PA 4LEJA 4Q0QA 4EJRA 1RUI2 1VAKA 2RJKA 4Q26A 4FPYA 3B01A 2SBAA 2XJQA 3LA3A 5BYNA 1U5IA 2IXJA 4CEWC 1QNWA 2XVKA 1GICA 4I30A 4PDWA 3TNQA 4HK9A 4MH0E 4CDUB 5C8CA 1GKBA 2JXAA 1JXNA 2WS93 4I0BA 5C9AC 1EAH2 1HV0A 1VBB1 2NM1A 1YIFA 1C5IA 1YHFA 3ECQA 4H55A 5EZWA 2ZA9A 3CJIC 4JCKA 1C4RA 1H1AA 4PLMA 4YZ5A 2Z5WA 4LBQA 2DUPA 4PIYA 2A73B 1YXWA 2YV8A 1ZZCA 3GBWA 1DBNA 3FFQA 1RUI1 3MW2A 3NAPA 4AFMA 3PHMA 2ZMNA 1N3QA 3V0BB 1I6XA 2CYFA 2DVFA 4XFGA 4HKLA 1JW6A 5L7OC 3BCWA 3AP6A 3WDUA 3OY8B 4L9BA 1PNGA 2WNVB 1HRI3 1OA3A 1H2LA 2AZ5A 1BMV2 3V0AB 5L36A 4D7SA 1EAH1 2HWD2 4HZFA 2D40A 1VRH3 2FMDA 4N53B 5IK5A 5CG9A 4XZPA 1UU4A 1NCQB 4AEDB 4CEYB 1HW5A 4O9EA 4YG3A 2DWRA 4ISQA 3L2HA 1TMF1 3E5XA 3MIBA 5EXOA 1CAWB 2WWSA 2R16A 3KB5A 3ILRA 5GZEA 5BNQA 4ES9A 2EIGA 1A8MA 1RJ7A 4P5HA 1VB2A 1WMDA 3GBGA 3ZFEA 3N7KA 3WQ0A 4Q0SA 4OVEA 4B4QA 2JJ6A 2MEV2 4FOWA 1OA2A 4XF3A 4YM2A 1NCRA 4M01A 1IS4A 1ZREA 4H3WA 1UZYA 1BMV1 3FX3A 5GM0A 1RL3A 2KA3A 4GH4A 3LB9A 2R042 4I3PA 2Z69A 4EWDA 1F5FA 1YNAA 5BNPB 4QQHA 3B7MA 2K0GA 3OY8A 2GH8A 5C33A 4XFIA 4UBHA 3B94A 2JG9B 3PJYA 2LM3A 1WLWA 4AI1A 4D94A 1RUE1 4KBBA 2RS13 1IS5A 1V00A 3LAGA 4FSJA 4QPYA 4LO6B 4CYDA 4FP2A 1VB4A 1V6NA 4LBQD 4TSVA 3OJBA 3UL2A 3MLKA 2MEV1 2ATFA 3UJOA 1NCQA 2ZAHA 2P34A 4K1YA 3ZN6A 4COZA 3E6CC 2GH2A 3M3CA 4XMIA 2HWB2 5H9QA 4I02A 1CAWA 2PLV3 2O0OA 3L2YA 4XJAA 1ZVFA 3M3EA 3VDDA 3SLIA 3R05A 1PIV2 2Q5TA 2EF6A 2R041 4IERA 4X6RB 3DPRA 5JI7A 2A6VA 3B5LB 4AVVA 2Y0OA 4IQPA 1FT9A 4RQPC 1JUIA 4QPIC 2QNKA 1PVC1 2DV9A 4EN6B 3WZ1A 1AXKA 4CP0A 2ZHMA 3HAGA 4Y22B 4E4DX 1ULFA 4Z92B 2D6KA 1HQNA 3GALA 4BMBA 4EN9B 2ARXA 4HLTA 2BNNA 2JD4A 4YW1A 4R52A 4YM0A 5T5OA 1LOAA 2X5IC 3V65A 2BNOA 4LBMA 4YLZA 1IZ3A 2HEWF 4M3CF 4AVAA 1PGSA 1GNZA 1O3QA 1H1IA 4HMZA 1PIV1 2DCKA 1YI9A 2HWE3 2Z2SB 2BVBA 2GC3A 4QT6A 4A7KA 1EV13 2AUYA 1CESA 1W6OB 1MQTB 4XFBA 1QJY1 1FXZA 1IGOA 1S2BA 5J96B 5CNAA 4FTSA 3WV6A 3VZOA 2YC0A 2ZAAA 1HXS2 4BZ4A 3ZYIB 4Q4V3 1JYIA 4Y24A 4YZ1A 2BFUL 2CGPA 3LA7A 3VBOB 4BH9A 5HCFA 1R1ZA 1D4M1 3ZXDA 4K8FA 2R061 1AX2A 1BQPA 3VBRC 1AF9A 1RUF3 3FWEA 4Q1RA 4Y22A 2IZWA 1GQHA 4RA0A 2MHFA 3POSA 3RMYA 2XL9A 2DVBA 5I0RA 3RZZA 4LO5B 4ES8A 4YZ4A 5K0UC 2ZCWA 2E7AA 4YM1A 3V56A 1R082 3AB0A 1CN1A 3HT2A 4Y4YA 2XKOA 1M06G 3PVBB 3D0JA 4RS5C 2WINB 4FQ4A 2IXLA 3WW1A 1BBT3 1OSGA 4CZSA 4B4RA 3ZSKA 5AC91 3TB0A 1QWRA 4FPLA 4DRRA 3RJRA 2TBVA 1Y43B 3OD0A 3VZJA 1R092 3HR9A 4OI0A 1SDWA 1ENSA 4JAAA 2EAKA 4D3WA 4FP3A 3H3ZA 2WA3A 3KD4A 5KHIA 4YVSA 1AL21 1UIKA 4LHNA 1KDKA 3NWKA 2P2KA 1BYHA 4G9SB 1SACA 2OIIA 4YGBA 5F6LB 1SLBA 4U36A 4XJ9A 4C1WA 4XJZA 5E1RA 3WY6A 4UBGA 2WIIB 1W6NA 2CGOA 1G9BA 3WG4A 1CR7A 2OUHA 2CWMA 4HVOA 1ASJ2 4IEXA 5DG2A 3FBMA 1FYUA 1ZBE1 5D8AC 4WV8A 4JTOA 2A5ZA 4YFZA 4KG8A 4YNIA 3DUIA 4QHBA 1QNYA 2PTMA 2RJLA 1QJU3 3AKQA 5DZGA 1REDA 4GMP3 1LHNA 3A0KA 1N1SA 1NA1B 1PGL1 3GZUC 4N7UA 1R091 5C4WC 4COVA 4M3CA 5I0TA 4L92A 1SCRA 2R1BA 1IPJA 1W6QA 5BV6A 4B7KA 4XHXA 4AFBA 2CGNA 3H7YA 3ASIA 3POWA 1MS1A 4NHMA 2D6OX 4CDQC 2W52A 3AP7A 4Q0VA 1D0HA 2I2SA 4Q4W2 5JIUA 1H8TB 1C1FA 1UAIA 2DVAA 2A70A 1I5ZA 3ST7A 1TME3 2F6BA 1S0GA 3VL9A 1OHFA 1PK6C 1S0EA 2QKDA 4JGYA 2IFWA 1CQ9A 1FATA 3EJKA 1YFXA 2CWSA 2ZS6B 4LHLA 3BALA 3JB8A 4MGKE 5B2GB 4F3JA 2DFBA 2PHTA 2VOVA 1VBC3 4D7YA 1LENA 1IPKA 1PO21 3MPPG 3H1YA 3OTFA 4YARA 1MEC3 2WNUB 1Y3TA 2JEMA 2DCJA 3ZIWA 3R6SA 3ZXLA 1O3TA 4XW3A 1QJX3 1PO13 5H9SA 1UMZA 1O4TA 1SBFA 4YG0A 1MS3A 1ZRDA 4XHBA 3AMMA 3A4UA 4A7ZA 2RMU3 1QQP2 5LK5A 4K21A 1NXD1 1C8M2 4IETA 2RS33 4QM9A 4PBPA 1QMJA 1FPN2 3E97A 4FXGB 4IXLA 4KGQA 4XJUA 4BPZA 1H8TA 1CJPA 2D3PA 1ZX5A 3TBDA 4XJWA 4AXOA 4F7ZA 3O0XA 1ZM1A 4IV1A 3INAA 3KSCA 4FPCA 5C8WA 2IC1A 3TYJA 3RG0A 2A6YA 1H4HA 4QQOA 3KCCA 4PIXA 2PAMA 4YGCA 3S7EA 4HETA 4LO4B 3RJ2X 1FNZA 3ALQA 1XYOA 4OI4A 4D69A 2BVVA 5FOJB 2DUOA 4Q4Y1 2YROA 4GWMA 1U0AA 1GNHA 3JD72 4CTEA 3VLBB 4WM8C 2QDNA 4ZU5A 2WNUA 5AFBA 1OA4A 1J1LA 3OF1A 3VBHC 2HEYF 2PHXA 1XE8A 5A3LA 1SLCA 1C8M1 2BYVE 1IHMA 1FPN1 1WD3A 3AM2A 3WP4A 2H6BA 2WZPP 4Q4X3 3E6BA 2O8OA 3P3PA 4YVWB 3IDCB 1FMD2 2AENA 1DGWX 1JH5A 4RR3B 3ZFFA 3JUUA 1VIWB 1DQ5A 1ND3C 1HIXA 2WT2A 2XVLA 4XMAA 3ZXGA 4A7YA 4B8EA 5H9PA 3X29B 4FXKB 4ONUA 4FBFA 4HBNA 1K5MA 2BWCA 1CAUA 3ZXEA 1YFWA 5FAXA 3ZDSA 5ABJC 5JR7B 2R1DA 3JD71 2NLRA 5CFCC 5KXDA 4CDXA 1VAVA 1MVQA 1URXA 3AYAA 4P9YA 2A3YA 4JQRA 3WLUA 4OZXA 3POYA 3ES4A 1J3PA 2ZJCA 1UL9A 1X8EA 2GMMA 5FMOL 3NV2A 4MVTA 5FO7B 1CPMA 3EQEA 1DDLA 1FMD1 3AZYA 3D6EA 1FOD3 4WZFA 5AFEA 3MIDA 4E2QA 4RHV1 4Z1VA 1RMU2 3OD4A 5CADA 4I0WB 1NG0A 1ZBA2 2X53S 2PAKA 2B7YA 2PA7A 5EYYA 2XPJA 4SLIA 2NPIA 3H7JA 2QDRA 1AR92 2FMYA 2B45X 2IXKA 3QCWA 1WCDJ 1CVNA 3VBFB 2YMZA 3M1HA 2A6XA 4L99A 4GIQA 1B35B 1AUYA 2ZX0A 2VNRA 4BYYA 3H8UA 3CL1A 3C3VA 4BLJA 3U4XA 1FV3A 2V5YA 3I2DA 4R8HA 3N3HA 3FBYA 4XXAA 2RR13 1PM7A 3SH5A 1RGSA 3OGJA 1DGLA 4MXVA 5EJ3A 3J8F2 1WCKA 3OCPA 2GMEA 1RMU1 1RVF3 2VW2A 4L2NA 1YJKA 1ZBA1 2RR11 2P37A 1LB2A 2O8QA 2DYCA 4RD7A 1PHMA 2GN3A 2IFRA 3IMNA 2H0VA 4FAGA 2RM22 5KC6A 3VKFC 1AR91 3A0NA 3PJQA 4AFAA 4FTEA 1GZWA 4CP1A 4GB33 3W59A 1Z7S3 1TEIA 2DCYA 4F83A 3AZZA 3S6PA 4NO4A 4Q0PA 1NXMA 1RUJ3 4R9AA 3H50A 3WOGA 4E2SA 5L73A 4CDWA 4E27A 5J48A 3NAPC 4YW2A 2XG3A