3ZYPA

Cellulose induced protein, cip1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
218
Chain Sequence
b'EISDDFESGWDQTKWPISAPDCNQGGTVSLDTTVAHSGSNSMKVVGGPNGYCGHIFFGTTQVPTGDVYVRAWIRLQTALGSNHVTFIIMPDTAQGGKHLRIGGQSQVLDYNRESDDATLPDLSPNGIASTVTLPTGAFQCFEYHLGTDGTIETWLNGSLIPGMTVGPGVDNPNDAGWTRASYIPEITGVNFGWEAYSGDVNTVWFDDISIASTRVGCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIP1
molecule tags Metal binding protein
source organism Hypocrea jecorina
publication title The Crystal Structure of the Core Domain of a Cellulose Induced Protein (Cip1) from Hypocrea Jecorina, at 1.5 A Resolution.
pubmed doi rcsb
total genus 53
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2011-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zypA00
4ASMB 4XOGA 1AXKA 4ZXKA 5JOZA 3SH4A 1AX0A 3MW4A 5CBLA 3VKLA 1ENSA 4TZDA 4D69A 2VH9A 1VIWB 1OKQA 1UZYA 2W52A 1DHKB 1IS3A 1H9WA 3A4UA 4DQAA 1W6PB 4LBQA 2AENA 1AZDA 1TEIA 1LHNA 1MS8A 1Y7BA 2E51A 3Q9OA 4XXPA 4YW5A 3WDXA 1LGCA 1W6QB 1S1AA 2DVGA 3SISA 1GYKA 2A6YA 1IKPA 3ENRA 3O0XA 5GLUA 2ZZJA 1O4ZA 2E7TA 1G7YA 2AREA 4XE9A 4L8QA 1JW6A 2GMPA 5DG1A 1LHWA 3BIWE 3VUOA 5F5QA 3HN1A 3KM5A 1WBLA 4DRVA 1A78A 1BJQA 1CR7A 3APBA 3AXEA 4GA9A 4IQPA 5DUWA 1N47A 3N7LA 1SFYA 3OBTA 4YW4A 3OYWA 1IS5A 1JOJA 3LSEA 1WD3A 2AUYA 2GMEA 5IK5A 3ZSMA 3ZSJA 3ZVXA 1AXYA 1DQ0A 1LOEA 1SACA 1ZA4A 1AX1A 1KJRA 1GLHA 2ARXA 2AYHA 2PHWA 5JVVA 3TAYA 3AYEA 4M3CA 4LBKA 1LGNA 1V6KA 3B9CA 5GLWA 1KDMA 4XYXA 1FNZA 5JDBA 1YO8A 4MYEA 1QMJA 3VKNA 5LK5A 2VU9A 1H9PA 4M00A 1QOOA 2R49A 2GN7A 1SCSA 3WHUA 2ZACA 1S0JA 1WW7A 4XXAA 5GZDA 2P34A 4WVWA 1Q8QA 3NV3A 1N1YA 1V6LA 4XJWA 4JRAA 4BMBA 1YRZA 5EYYA 1LEMA 2ZMKA 2KM2A 3POWA 5CNAA 3N7KA 5T55A 1QKQA 1V6OA 5KXEA 2EXJA 1ZM1A 3N35A 3WDVA 3AZZA 3O12A 1GV9A 1V6NA 2DU0A 1UL9A 2ARBA 3QLQA 2W08A 3VKFC 2E6VA 3WV6A 5JMCA 2ZAAA 2JE7A 1FX5A 4FP2A 3M3CA 5E88A 4XJAA 4YG6A 3RQ0A 2A75A 3I8TA 5SV8A 4YLZA 2ZGSA 3FLTA 5AVAA 4YGEA 5DUUA 2ZGMA 2NMNA 1UPSA 1WLWA 2D6NA 2EXKA 1LULA 2YV8A 1DZQA 5DG2A 5CB7A 4XIOA 1LHVA 2D3SA 3N7JA 2GMMA 4PCRA 4YW2A 3ZYPA 3WNXA 3WVJA 2YY1A 1VALA 1HQLA 1MS4A 5IK7A 5KXCA 4FQ4A 1IOAA 4FOWA 2G4IA 3OJBA 3AK0A 2B7YA 2VXRA 2ZGQA 1V00A 2D44A 2R1DA 3AP7A 1DYKA 3WDUA 1AJKA 2WT1A 2BQPA 1G8WA 1DQ1A 1WBFA 3IPVA 5H9RA 1BYHA 3HR9A 5T52A 2VY0A 2WJSA 4Z8BA 2R0FA 2ZMNA 1C1LA 1ENRA 1GNZA 3MPPG 3ZSLA 4AGGA 1I1EA 2H0BA 4UW5A 2A71A 1NXD1 1UZZA 1G9AA 5DZGA 1GZWA 4WZFA 1AF9A 3I4IA 1W6MB 2DUOA 2EF6A 4R9DA 5T54A 3B01A 1Q8VA 1Q56A 3AFKA 2D3PA 1FAYA 5EYXA 3D4KA 1LCLA 1CVNA 1OQ1A 3MW3A 3OYWB 3ZYRA 1DQ2A 3AP9A 1HLCA 4XJ9A 4P14A 4BMEA 1GKBA 1AVBA 2D7FA 3V0AA 4YGDA 1C1FA 2ZBJA 2ZHMA 1WUVA 4FPJA 1D2SA 3TB0A 4Q8LA 4ATFA 5CAZA 4BLJA 2WKKA 4Q8KA 5T5JA 4DRRA 1BQPA 4YGCA 3ILRA 1JXNA 4XIKA 1N3PA 3O0VA 1MVEA 1LOAA 3INAA 2UU8A 2VW1A 3H0OA 1ULCA 4RL7A 3WG2A 5EWSA 2R1BA 3ILNA 3ILFA 1IS4A 3USUB 1MS0A 3AYCA 1QNWA 2UWBA 2JDZA 1GICA 1GZ9A 1MS5A 2DUPA 4FPCA 4GXLA 4M3CB 3T1MA 1MACA 4BQ1A 1B09A 1MS1A 1LOFC 5JOYA 1W6QA 2EXHA 2Z42A 3AP6A 4FOYA 4XBLA 3IKWA 3USUA 2NZ9A 3N7MA 1LOCA 4C1WA 1PZ9A 1WW4A 4JC1A 4AYUA 1Q8OA 1BZWA 3UJQA 5E8AA 2ZMLA 2VW0A 3L2YA 5BYNA 2DYCA 1Q8SA 1SLBA 1GZWB 1SBEA 3PVOA 4AWDA 4P9XA 3AZWA 4GWMA 1I3HA 1CIWA 1S0BA 3T1LA 1JHNA 4Q1RA 1W6OA 3POYA 1KRIA 3OY8A 3M3QA 2DTYA 1KQRA 1RINA 2DTWA 1CONA 3MW2A 4Y24A 3M1HA 1X50A 2NYYA 3AZXA 2D6OX 1N3QA 1G9DA 2CNAA 2DU1A 5HCFA 5JOWA 3KQRA 1V6JA 2P2KA 2UURA 5GJ6A 1SLAA 3AYAA 5L73A 3VKMA 5JOXA 1CJPA 1GBGA 1HQWA 2GNDA 1W6NB 5DUXA 1DGLA 2P3IA 4F83A 5FREA 1JUIA 3ZPYA 2FHRA 4FPYA 4K1ZA 4YM0A 1S0DA 2W39A 2ZGRA 1QF3A 2CTVA 2VW2A 3MEPA 2PHRA 2UWAA 2GALA 2JD4A 2YROA 3C2UA 4GALA 4PBOA 1UX6A 4GKXA 5JLVA 3PVEA 3AXDA 5F9TA 1A8DA 4YFZA 1ENQA 1WW5A 2EXIA 4XBNA 4WVVA 4GKYA 1O4YA 4YZ1A 4AVTA 1QDOA 4XMIA 1UN1A 1LHOA 5GZGA 1D0HA 1S0CA 2DVFA 4Y20A 4FOVA 3D5OA 5CA6A 1WLCA 4P9YA 3AYDA 3WDYA 1FNYA 1DLLA 1QU0A 3ASIA 4PBPA 3IM0A 2ZGNA 1DQ4A 1FV2A 3R05A 3WUCA 4YGBA 4XILA 2AR6A 2E53A 2ES3A 1QGLA 4Q2FA 1LGBA 1SLTA 4JCKA 2SBAA 1VAMA 2A70A 4TYSA 3T2TA 3A0KA 1SLIA 1UMZA 2SLIA 2CL2A 3WZ1A 3NV4A 2PHFA 5IK8A 4Q1PA 2YZ4A 2A3WA 3D6EA 3WCRA 2XG3A 1QOSA 1G9BA 5EXOA 5E89A 1WW6A 1GNHA 1CPMA 3V0AB 4ISRA 4I30A 4CTEA 1PZ8A 2DUQA 4ITCA 5GZFA 3RSJA 1MZ5A 4AVVA 2JE9A 4XJUA 3NV1A 4M3CF 1LEDA 1YIFA 4FPGA 4XHXA 2C5DA 5T5LA 3RMXA 5HCAA 3FFZA 2DWRA 4FPKA 4Y1VA 1A3KA 3GALA 3FLRA 5T5PA 5GZCA 2WNEA 3V64A 2JECA 4LBQB 4DPNA 2W68A 2TEPA 4U2AA 1KDKA 1FYUA 4XBQA 4DFSA 2ZGKA 1FATA 4FPOB 1ULDA 4Q27A 4KBBA 3RG0A 2EALA 3B00A 4XMAA 3WG1A 2A3YA 3SITA 4GWNA 1SBDA 3UJOA 3A0NA 3WDTA 4BM8A 4YZ5A 4R9CA 4XDQA 4NO4A 1LHUA 1WD4A 1Q8PA 4ZKTB 3FUOA 4M01A 4Y26A 1DIWA 1JYCA 2ERFA 5DZFA 4R9AA 2PELA 2CWSA 2D43A 3ZSKA 4XTMA 1Z0HA 4HL0A 1AX2A 1LENA 4HANA 4LBMA 2OUJA 1SLLA 2EIGA 1DBNA 3SH3A 3WCSA 1F31A 3ZXJA 5KXBA 1G9CA 4YZ2A 3ZXLA 4YM2A 3FBYA 2EAKA 4K21A 4UW6A 3AX4A 1YI7A 1CPNA 1CESA 1CQ9A 4FQZA 2ZKNA 4YG0A 3UL2A 2WT2A 1DYPA 1W6MA 4LBLA 1FV3A 2C9AA 1SCRA 4LBOA 4UW4A 4Y1YA 5DZEA 3WG4A 5IT6A 4Y1ZA 3O5SA 3B3QE 1HKDA 1APNA 2A6XA 2OW4A 1N3OA 4W65A 2RHPA 5GALA 5H9SA 3IMNA 3OPZA 4XJ8A 1HDKA 4CZSA 3IPVB 3BOPA 3OGGA 2WSUA 1EPWA 5H9QA 2E7QA 2PHUA 1OFSA 2A5ZA 1LU1A 1KJLA 2ZGTA 4P9WA 4BLIA 1U0AA 1GANA 5DUVA 2WQZC 1AXZA 1C57A 1LU2A 5IUQA 3CNAA 3ZXEA 2ZABA 3VV1A 1RITA 1N1SA 1W0OA 4XZPA 5GLVA 2WLQA 4FP3A 1YXWA 1S0IA 2GNTA 3V0BA 3SNMA 1JBCA 1ULEA 4BPZA 5DXDA 2NMOA 5GZEA 2OVUA 2AH2A 2YXSA 2UWCA 4H55A 1ULFA 2DVDA 4LBQD 3R4SA 2OUHA 4FPEA 4Y22A 4AGVA 3RS6A 4YG3A 4YM3A 1LECA 3U4XA 4ATEA 2ENRA 1MS9A 3HMYA 1QNYA 2A7AA 2GN3A 2A6ZA 3M3OA 4K1YA 2CWMA 2ZGPA 4LBJA 1H30A 4CRQA 1NLSA 4UW3A 3V65A 4RA0A 3NV2A 1F5FA 2D3RA 3AZVA 3DGTA 3DUIA 4XJZA 2Q5TA 3AJZA 4YW1A 5GLTA 1KITA 1LESA 3RRDA 1BXHA 2DURA 3BODA 5GLZA 5IK4A 1XQNA 3ATGA 2GNMA 2ZGUA 3M2MA 1WCSA 3NWKA 3PJQA 2A3XA 3WG3A 5GM0A 2I2SA 1F9KA 2PHXA 4ISQA 2GDFA 1S0EA 4K20A 2D6LX 5FRAA 3AZYA 3POSA 2JKBA 1S0FA 3ZXKA 2CY6A 1V6MA 3SH5A 2NP0A 1LOGA 1SBFA 1LODA 2D6KA 2R16A 1URXA 4FVVA 4SLIA 2WSVA 3M3EA 4Q26A 4YM1A 1VLNA 3LCPA 3JUUA 4DS0A 1JYIA 2DV9A 1UKGA 4NOTA 3JU9A 2VUAA 1JN2P 1DQ6A 3AP4A 1LOBA 4PQ9A 2CYFA 3AP5A 5HCBA 1VAVA 1S0GA 3WDWA 1MS3A 2ZHKA 2D6PA 5T5OA 1GZCA 2XB6C 1LOFA 3PVNA 4C1XA 4Y22B 4XTPA 3LSDA 3GNEA 4FOQA 4FPLA 1GSLA 2P37A 1W6NA 2JJ6A 2WT0A 3VKOA 1ONAA 2ZGLA 2ZA9A 2V73A 3WHTA 2FMDA 5KXDA 4AGRA 4YFWA 1G86A 4OZXA 4Y20B 3WUDA 3WOGA 4YZ4A 4BOWA 4Y1UA 1DQ5A 3SLIA 1WLDA 3B69A 4PF5A 1W0PA 1QOTA 4WV8A 1MZ6A 2R0HA 4FPHA 3R4UA 3N36A 1MVQA 1N1TA 4YZ3A 1CN1A 1ULGA 2A6VA 3QCWA 3UK9A 2ZHLA 2P3JA 4XHBA 1G9FA 1LJ7A 1W6PA 2LALA 2NM1A 3FUQA 3AJYA 3IN9A 3BTAA 2YMZA 2AGSA 1MR5A 2D6MA 1R1ZA 3O0WA 1V6IA 1LTEA 2V5YA 1QDCA 4Y1XA 2A6WA 2DVAA 2ZHNA 3WLUA 2DVBA 2HYKA 3RMYA 1N1VA 2LTNA 1UAIA 1Z78A 1RIRA 2ZGOA 5T50A 3N3HA 4AVSA 1W6OB 3OY8B 3FLPA 4M3CE 4LBNA 2P3KA 1C4RA 2PHTA 1AJOA 1IKQA 3OBRA 3PMEA 5H9PA 3W58A 3V0BB 1J1TA 1SLCA 2NN8A 2GNBA 3W59A 1BKZA 1DFQA 4YW3A 3ZXFA 1YYNA 1IS6A 4R9BA 1PZ7A 4U36A 4FPFA
chains in the Genus database with same CATH superfamily
1H4GA 2VO5A 2HWD2 1RVF2 4QWNA 3N4MA 1AXKA 1ZRFA 3ES1A 1ND3C 4JGZC 4QDQA 4AHYA 1XNBA 2WO3A 2YHJA 4XACA 3MW4A 5CBLA 4OI0A 3H1MA 4WM7A 4TZDA 1LKNA 1CAVB 5A1AA 2GP3A 4D69A 3KCYA 2W52A 1DHKB 2EA7A 3A4UA 3VBOB 1W6PB 4LBQA 1RHI1 2VZTA 3H9AA 3Q9OA 1BEV1 4XDOA 2JXAA 3WDXA 5KHJA 2RM21 3LFMA 3ZIWA 5IVEA 5APAA 1W6QB 3WDYA 1S1AA 2VTXA 5C71A 2BVVA 4XETA 2PHDA 1H6XA 1IKPA 3ENRA 1X36A 3I2GA 5DPNA 5FIXA 5GLUA 5GKAC 1R093 1F4HA 2ZZJA 2E7TA 4UFIA 1O5LA 5A3TA 2AREA 4CCKA 3KV4A 5DG1A 1IPJA 3K77A 3BIWE 1O5UA 3N9LA 2XBO1 5CKNA 3LOBA 2D40A 1KEXA 1PNFA 4GA9A 1MQTB 4XFCA 4UFKA 1H1MA 5DUWA 5FPXA 3JBG1 1HRV3 4HFSA 1PHMA 1JOJA 2VOWA 3LSEA 3GJAA 5IK5A 4FO9A 1OQDA 5D8AC 1XBFA 4C0HA 1AXYA 2P3YA 1SACA 2E63A 4PDWA 5FZIA 4FAGA 4E2QA 1AX1A 3LDKA 1XNDA 3TRSB 1GLHA 4NWVA 2PHWA 3UYJA 2Q1ZB 1V9U3 2JIJA 2XBO2 3AYEA 4LBKA 1AHSA 1LGNA 2HWF2 1IPKA 3PHMA 4JKMA 4ZPIA 4XYXA 4AQSA 4E2SA 4Q4V3 4PDWB 2WS91 3ZN5A 3I3MA 4MYEA 1WMEA 1CAUB 2Y6HA 4JKKA 1H9PA 1OF3A 2E26A 2OZJA 2ZX2A 1S0JA 1WW7A 2DCTA 5GZDA 5A7WA 3UKNA 3I59A 5FY4A 5CEHA 3S5QA 3H50A 1UYXA 3UETA 1C3HA 5D1IA 1HRV1 4QX1A 1FMD3 4QB6A 5EYYA 5FYSA 5T55A 1AUYA 2BBVA 3BTXA 1CAXB 2BV4A 1ZM1A 3VL9A 1GV9A 2DU0A 3C3VA 4NHMA 2ID4A 3OUIA 1J84A 5C4WA 2W08A 4J25A 2E6VA 4OYUA 3E5UA 4FP2A 5J7MA 4KGQA 3WW3A 1E57A 1CAVA 3H7JA 4LHLA 4OUSA 4W6YA 3VD7A 3WF1A 2VQAA 5JIAA 3NNFA 4ZU4A 1VBE2 3BN6A 4BQ5A 3ACIA 3VBOA 4CUAA 2TUNA 2XGXA 4IV3B 1RUI3 1JZ3A 2D6NA 5CB7A 1PVC1 4URTA 3MIGA 4XIOA 1LHVA 5JZGC 3RZJA 1BK0A 4PCRA 5I8TA 3ZYPA 3WNXA 4FBFA 1HQLA 1VBB3 2WWUA 1UIJA 4IDZA 5KXCA 3CJIC 1AL21 3I2FA 3S7IA 1J1LA 3TOJA 1UY4A 1QJU2 2VXRA 1VMJA 5LEJA 1BK1A 4E8CA 3CMGA 1DYKA 3ZM8A 4C91A 4E4SA 1AR83 3WDUA 2OIIA 4FXKB 3VBRC 1G8WA 1XE7A 4AK3A 3S57A 3WNOA 2RS51 3NMBA 4JKLA 3J9SA 5CFCC 2WJSA 2CHHA 3NJVA 2ZMNA 2N7GA 1GNZA 2PLV1 4YW6A 3ZSLA 2F6BA 1UZZA 1XE8A 3ELNA 3GGLA 3NAPA 1JU4A 1UY2A 1W90A 4QD2A 5BPXA 1EUUA 2Y0OA 3B01A 1I6XA 5EYXA 4AI2A 1OOPA 4HPKB 3D4KA 4NHYA 3ZMOA 1OQ1A 1D4VB 2J1EA 3MW3A 1CX4A 1Q3EA 1WMXA 2QQWA 2VMHA 1ZRIA 1HLCA 4AQTA 1PO13 1ZBA1 5JZGB 3U0ZA 4HK9A 1GKBA 1AVBA 3ZKYA 1SPPA 2RDSA 4YGDA 2ZHMA 1S2KA 2JDAA 4RGGA 5FY1A 2ZS6B 2CGNA 3OUJA 4P9GA 4DNYA 1QJU1 2WKKA 4JQTA 3P1IA 3RWNA 5JZGA 1RMU1 4B29A 3UKVA 1YQ2A 2HWC3 2ETEA 4JVAA 1U5ZA 3KV9A 4NPLA 5B4XA 3WG2A 4HT1T 5C8CB 1PM4A 2VMDA 1OVPA 4KH9A 3ILNA 4QPIC 4MO3M 4LO5B 2FDKA 3GBGA 3KGZA 1W9TA 1GZ9A 3DXTA 1MS5A 4RGAA 2QE3A 4M3CB 4FPCA 4GXLA 3RI9A 3VBRA 3WNLA 4Z2WA 1MACA 3PL0A 5L36A 1JYWA 4S2FA 3MHZA 2VUDA 1UZ0A 2L9LA 4Q4X1 2Z42A 5CFCA 3IKWA 2UY9A 2K2SA 3KV5A 2WNVB 1LOCA 2HWB3 1PZ9A 1WW4A 5CISA 3OPWA 5C3QA 5HXMA 5K0UB 5FK8A 1QJX1 2A73B 4XAAA 4CUBA 5KC5A 2VMFA 2DYCA 2JDMA 2WN2A 1TE1B 3JBG3 2JDKA 4OHXA 1R092 4YVSA 1ENXA 1ZYBA 4K6BA 2JB4A 1KRIA 4HONA 4D6SA 3ZSEA 1OVSA 5FZKA 1V9U1 2IWGB 3WP3A 2D6OX 3OBZA 1JOBA 3B94A 5F6KA 3PURA 1DYOA 4WM8B 4XFHA 3IDCB 3KQRA 4BA6A 5L73A 4DXRA 5D21A 1OKOA 2BW8A 3VGIA 3NO8A 1CWPA 2GNDA 3VBSC 4LEJA 2HWC1 3FHAA 2VUCA 2WO1A 5CG9A 3VDBA 3AL5A 4FFGA 3ZPYA 1YC61 4FPYA 4K1ZA 2HWF3 2W39A 2ZGRA 2GC2A 1QF3A 2VW2A 2ZJCA 2XBO3 4IV1A 4QXKA 2GALA 2F4LA 3C2UA 3HD8B 4ZXEA 1X82A 3OTFA 4Z2AA 5FWJA 3PVEA 3AXDA 2FMYA 2EAAA 5ABJC 1OH4A 5C9AB 1DGRA 3JBG2 5A3PA 4GB33 1PX3A 2BOIA 3LGRA 1NA1A 3CZJA 4GKYA 4HXCA 3J7HA 1XNKA 5L7OB 1LHOA 5GZGA 4EN6B 5CFDC 1RUC3 1SQ4A 4Y20A 4AI8A 1XSQA 1TMF1 2X5IB 1GQPA 4LHNA 2W3JA 4KMQA 2E33A 4Q0UA 5CA6A 4IV3A 5EP9A 5FWEA 1WCQA 4AFCA 2B9UA 2BUKA 3AFGA 3TNQA 2ZGNA 4KWJA 3J4UH 3R05A 4EYUA 4Y4RA 2Y6LA 1YFWA 5BNPA 3HJRA 5FZAA 5EPAA 1HN0A 2ES3A 1QGLA 5ERLA 1SLTA 1NQJA 3VBSB 4COUA 4Q4W1 1Z7S2 3Q8CA 3NV4A 5IK8A 1UO9A 4OULA 3D6EA 2A3WA 3K51A 2XG3A 1G9BA 2QQLA 1ODNA 1UOGA 1US2A 1WW6A 1CPMA 4IE4A 3H1YA 4GAZA 2I74A 1UD1A 1UMIA 4AVVA 3RSJA 5BNNA 1MEC2 4JQRA 1LEDA 4K3UA 1YIFA 4AVAA 4FPGA 1SEFA 5FMDA 5C3OA 1VBE3 4DY5A 4AEJA 1NLRA 1W2AX 3EXUA 5T5PA 1GU3A 3FE5A 4Q4Y2 3V64A 5A3UA 3LIHA 5F3IA 4DPNA 2W68A 3WF4A 5JWPA 4UBHA 4U2AA 4L9BA 1UXZA 2CGOA 3T2QA 4Q27A 3RG0A 1ULDA 2RR13 2JDPA 4FTBA 4BK4A 2VR4A 5D8AA 4XCBA 1GQHA 4HKWA 4GWNA 4E8DA 4GQ7A 3A0NA 4EWAA 3IB3A 4KG8A 1KFXL 3KF5A 3LQCA 4IV3C 3RYKA 4BM8A 2J1TA 5JMOA 3NNJA 1NE4A 2ET7A 2EIDA 2J1RA 1JZ8A 4I01A 2HYXA 2ZAHA 3I3QA 1Y9GA 4Y26A 1DIWA 4NN0A 1JYCA 1YJKA 2PELA 4IEYA 1STMA 4CXWA 1O3RA 1W3XA 3ZFEB 3TN92 1F35A 1L3JA 4RQPB 4LBMA 4HANA 3SH3A 2YFUA 1NCQB 1PO22 1X7NA 4H3WA 2HWE3 1A8MA 3DCQA 3SC7X 1YIPA 4RFT0 4I0BA 1CD3G 3ZPOA 4YZ2A 1YUDA 2VBPA 3LKJA 1KXGA 1BMV1 1GOHA 1OBNA 1VRBA 4E4HA 1BVVA 3GZAA 2G9GA 1CPNA 2JG8C 3GBWA 1CQ9A 3CKHA 4FQZA 1GWMA 2ZKNA 5LEKA 3AMQA 3W9AA 4A4AA 4DUVA 3OUHA 1XNAA 4WVZA 1FV3A 4Y1YA 1SCRA 2BERA 3WG4A 4MLOA 4BB3A 5DAQA 5C4WC 3CBNA 1BLZA 4CP0A 5AFEA 2A6XA 4W65A 2WNUA 4DEQA 2BJSA 1AYM2 2BGPA 2YU2A 4IEVA 2Q4SA 1XNCA 1QXJA 5FZMA 1O3SA 3U1XA 3OGGA 2WSUA 1EPWA 5FAXA 1EV11 2XJSA 1LU1A 2VOXA 2X53S 1O8PA 4CDXA 4BLIA 2OA2A 1U0AA 3Q8BA 2V5DA 5DUVA 1LU2A 3OCPA 4LO7A 5A3LA 2C6SA 1HX6A 2WFF3 3ZXEA 2ZABA 1W0OA 3W5NA 5I93A 1YXWA 4HMZA 4Q0QA 1C8M1 1Q43A 1R64A 5DXDA 1O91A 2NMOA 5A3OA 4CDUC 3CU7A 2UWCA 2WO2A 2DVDA 1L7LA 2OUHA 4FPEA 1R091 1NYWA 5FZ8A 1UU5A 4NE9A 4O9GA 3WP5A 1QJX3 3KF3A 1PIV2 3MFCA 2OZ6A 2ENRA 3VBFA 1D2QA 1PK6A 1R082 4QX3A 1ZREA 2IC1A 3I3DA 1RMU3 3M3OA 1POV1 1H30A 3WW1A 3PNAA 2X5IC 1Q5OA 4IEWA 1PGW2 4XW3A 3IIAA 3LA7A 3MLKA 3BYWA 4RA0A 3V65A 1F5FA 2D3RA 5BNNC 3OPTA 1HB1A 4PQQA 4QPWA 2J1AA 4AE2A 2WZR1 5JSRA 4XURA 1J59A 1BBT3 1OI6A 3ATGA 2GNMA 2P5BA 3I3EA 4QXCA 1D7PM 4LT5A 4WZCA 3VZLA 5FRAA 5BNNB 3H1WA 3ZFEC 2VTFA 2JKBA 5I0SA 3SH5A 4CDXC 1NX9A 2ET1A 5LRSA 1RUG2 1S2BA 1URXA 2ADEA 2WAOA 3M3EA 4ZS2A 4Q26A 2MPFA 5KHHA 2XH6A 4MG2A 3RJ2X 3J26N 3BPSA 1JYIA 1CGPA 5BV6A 3JU9A 2IUWA 1EAH3 5FYUA 1JN2P 3WNKA 4DINB 1A34A 1YQCA 2XWBB 2IXIA 4NHKA 1OLQA 4PQ9A 1QQP2 1S0GA 1MS3A 1W03A 2E7AA 5JOWA 3H8UA 3EBRA 1GZCA 2XB6C 1AL23 1LOFA 3E6DA 4LORA 4C1XA 4IL7A 1PK6C 4QQLA 1ZRRA 4UBGA 4FPLA 3LF7A 4J6GA 2P37A 1W6NA 2JJ6A 3I2KA 3ZFFB 1ONAA 2J1UA 3THDA 3HWJA 3DF0A 1OURA 1MPXA 1G86A 4Y20B 5J96B 3WOGA 5JR2A 2HLEA 3J7LA 3BI3A 1EYBA 2I07B 3NJZA 1WLDA 3B69A 2WWJA 1NCRA 1UXXX 1T6BX 4WV8A 4XAEA 1MZ6A 2VOVA 4FPHA 2V4VA 1K5MB 2DCZA 1N1TA 1OLRA 4XF3A 1QJEA 2A6VA 4LIUA 2V4AA 3QCWA 3VZJA 5A3NA 1PVXA 3OBAA 3KCCA 4XHBA 1JYNA 4LPLA 3E6BA 2DCJA 2KR2A 4BQWA 3AVSA 3CEWA 3T0AA 1RUH2 5CFDB 2GSYA 2LW8A 1COV2 4KU7A 4DXZA 1TZOA 1W2UA 2W1QA 4AAPA 1OA3A 1V6IA 1LTEA 4CP2A 5JXJA 2V5YA 3VBUA 1QDCA 2DVAA 1J3PA 3DYPA 4CCMA 1CIYA 2OPKA 4CUGA 5A7SA 3NJYA 4IV1C 4JHTA 5KWRA 2WFF1 5CU1A 4XUNA 1TNRA 1ALYA 1ODMA 1XU2A 3AM2A 5FO7B 3OY8B 4AVSA 1FPN3 2VC9A 2XVGA 2P3KA 4AXOA 1UOFA 4ARXA 4FTEA 5H9PA 1VBA1 3POIA 4QXBA 5LCWL 4Z1VA 4DUXA 4YW3A 3ZXFA 4AHXA 2YPJA 3BTZA 1YYNA 4N7IA 2OPWA 4QB2A 2VNRA 4U36A 1FPN2 1AR63 3PTYA 4FPFA 4HG6B 4XOGA 4ASMB 4YVWC 3PMSA 5CKQA 4ZXKA 2VZOA 5CZKA 3SH4A 1AX0A 2OQ7A 4LMFA 4D7TA 4K40A 1OC1A 3ALQA 3GCXA 4AI3A 1OKQA 3HBZA 1H9WA 2XONA 4DQAA 2XLAA 4CCNA 1TEIA 1Y7BA 2WA3A 5FPAA 2QDNA 4XF9A 4DO0A 1O6UA 5IVVA 5LA0A 4GJZA 2YPDA 4J1XA 3E5XA 4LO4B 1HW5A 4QGNA 3BVCA 1VBC3 4UAPA 4CDQC 1DZTA 3O0XA 4B3NA 1VB4A 3VBUC 1G7YA 5FY0A 3TYJA 2ARAA 4L8QA 1ND2A 4EN7B 1LHWA 3PDQA 1BVP1 5F5QA 2NPIA 4DRVA 3AMMA 4IQPA 4FSJA 1ZX5A 2BWCA 3AVRA 2JDNA 3N7LA 1F4AA 3OBTA 5FOBB 2VNVA 3OYWA 3RWKX 3JD72 5A6YA 2VJXA 1WD3A 4MV2A 1W8ZA 3HQUA 2WFF2 3VDDB 1LOEA 5FYTA 3VBHB 4CEYA 1ZA4A 3CIHA 1KJRA 2W95A 1GWLA 3WQ1A 3JXSA 4LA3A 5E16A 5J36A 1BMV2 4R52A 4N53B 4HKLA 2JDYA 1RHI2 3IAQA 2C4XA 4RHV1 4YWAA 4JDOA 5A7PA 3KS7A 2BFUL 4M00A 1HV0A 1QOOA 2BVBA 3WHUA 1WMFA 2BYVE 4CDWB 4CCCA 1QY4A 2RE9A 3I97A 4XXAA 2P34A 1Q8QA 1ZBE1 4JRAA 4AHWA 4BMBA 4JZRA 3MZHA 1YRZA 3G6JB 4KL1A 5CNAA 1FOD1 3HAGA 1H8VA 3N7KA 4F8AA 3HVDA 3ZXAC 2QBXA 1UU6A 3S5AA 3CO2A 2XOMA 3N35A 4XC9A 3WDVA 1V6NA 1YQ5A 2ILMA 5FXWA 3Q8FA 2ARBA 4ONUA 3ZN6B 4B4RA 1BBT2 3K4AA 3PUQA 1CAWB 5C3RA 4EN9B 3KSCA 5FPLA 3TN93 3MI8A 3WV6A 3D0SA 2JE7A 5L9VA 2WIIB 1LR5A 4XJAA 4YG6A 2MHFA 1CAUA 1OXCA 4N8MA 1RUJ2 4RD7A 5J09A 5SV8A 3S7EA 3HBKA 4QMAA 4CSWA 2ZGSA 3FLTA 4QGMA 5DUUA 5FP4A 1UF2C 2ZGMA 2NMNA 4JGYC 3ETQA 1UPSA 3P6BA 2XWJB 1MEC1 3WW4A 2WRAA 2D3SA 2F4PA 2WZ8A 3ZDVA 3WVJA 5C8CA 2QQPA 4NAOA 4NIIA 1K12A 4LJHA 2Z2SB 4FQ4A 4YYOA 2VPVA 1YQ8A 4N43B 1W8FA 2B7YA 4AI0A 2ZGQA 1V00A 3ACHA 4H7MA 4LOSA 4H7LA 4LO8A 5FMOS 5DABA 2AEZA 2BDRA 4AFBA 1AJKA 2B4KA 4BH9A 2WT1A 5ABJB 2QQIA 3HR9A 3T09A 2CU5A 3AL6A 3K4ZA 4OQ8A 4Z8BA 2R0FA 1I1EA 1ENRA 3MPPG 4RQPC 2H0BA 5B2GB 1NXD1 5DZGA 5IVJA 1JZ5A 4WZFA 1WKYA 1TQ5A 4M0NA 1W6MB 5T54A 4YSFA 1B35A 2JG9A 3WQ0A 1Q8VA 1H1AA 1Q56A 2IXJA 3AFKA 1REDA 2DF7A 5A1FA 2ZX1A 1H1IA 1CVNA 1LCLA 3OYWB 4XUPA 1QQP1 2GC1A 3ZYRA 1K5JA 3AP9A 4CPBA 3TEYA 3D8CA 4ES8A 1NXMA 2R042 1NAEA 4P14A 2VTXJ 3WW2A 2D7FA 4BMEA 3V0AA 4NAMA 1HB4A 2VQ0A 3PUSA 4G3YC 2JWPA 4FPJA 5CKMA 5JSOA 3P5BA 2QQMA 3T3YA 3OSDA 5T5JA 3K2OA 4B7EA 2HWC2 4GMP1 3POBA 5DDJ1 3O0VA 3LAGA 3SHRA 1H4HA 3INAA 4HBNA 3H0OA 5F5AA 1WA6X 5EWSA 2R1BA 3FC0A 1W2NA 2RM23 1QNWA 2UWBA 1RMU2 3AYCA 4BQXA 2VZVA 5JXGA 3MLJA 4LKSA 1AYM1 3T1MA 2BU9A 2PN5A 1MS1A 1LOFC 5JOYA 4YW7A 4XBLA 3CL1A 2P17A 4OFGA 5FMOL 3VB9A 4RN5A 4JC1A 1E5HA 3SQOA 4EROA 3PUHA 3RFRA 2ZMLA 2VW0A 2JG9C 2YBSA 4F7ZA 5BYNA 1VJ2A 4Q4V2 1Q8SA 2ZX3A 3ACGA 1GZWB 1T6GC 2H0VA 4N43A 1Y4WA 3D82A 1QEXA 1MEC3 1IZ3A 2IXKA 4MGZE 1S0BA 3T1LA 1OUSA 1YNAA 3OY8A 3O1SA 2YGMA 4NIAA 2DTWA 1CONA 3M1HA 3ZN4A 4XQDA 2NYYA 2X09A 1J83A 3ABZA 1GP5A 4NHLA 5A32A 4GULA 5FZ9A 3U14A 5GJ6A 1QJU3 1SLAA 2FCTA 3WNMA 3CDZB 1ZZ8A 4K8FA 1GBGA 1X8EA 4HZFA 2ZKLA 2R063 2K9ZA 3VDAA 4CP1A 3U75A 5LB6A 4OHVA 5FKCA 2P6HA 5A6ZA 3J8F3 2XHKA 3VHRA 4X6RB 3W20A 3SCHA 5LY2A 4CCDA 4Q8KA 2FQPA 2PHRA 2WLPA 4OCTA 3I2DA 4GALA 1VBB1 3MIFA 3J7NA 4HVQA 4OHYA 4AFAA 5JLVA 5FBZA 2V72A 3MGUA 4Q4W3 3OEBA 1SFPA 3IMMA 3OEAA 2Q8DA 3GHNA 1A8DA 4D8MA 1JODA 4YFZA 3RZKA 5C70A 2RJKA 2WABA 4QQHA 4WVVA 1OA2A 4IE0A 5FMCA 2W46A 2HEYF 4XMIA 1RJ7A 4DZGA 1UN1A 1OD5A 1D0HA 2DVFA 5J98B 4NIHA 2HBUA 4L92A 3D5OA 1X8MA 1QHDA 2Z79A 2RS53 3AYDA 4P9YA 3E97A 4OI4A 4PI0A 4PLNA 3UKTA 1DLLA 3LPGA 2C9KA 4PBPA 3IM0A 1WCUA 5CIRA 4DEVA 1W06A 3D0JA 2FDIA 4QB1A 4YGBA 3IT8A 3BPZA 4C8DA 5A7WB 2PAKA 4Q2FA 4RHV2 1VAMA 4IE6A 1VBD3 3A0KA 4NIDA 4HVOA 4CA9A 4XUOA 3B5LB 5L7OA 1D0GA 4IUGA 2G9ZA 1UNBA 2LM3A 4QX8A 3C7FA 4CDQA 4OLLA 2WS93 1PZ8A 4IV1B 5BNPC 2RJLA 2DUQA 1R1A3 1TMF2 4XJUA 3NV1A 4M3CF 1OLMA 5FY9A 5A33B 1NUKA 2C5DA 3ZXGA 1ULOA 3I59B 1S2EA 4CDQB 1NCQA 3FLRA 3GALA 5GZCA 2WNEA 3RPQA 2FDHA 2JECA 4KWLA 5F2SA 4B1MA 1W8WA 5LWBA 1EY2A 4Q29A 1KDKA 4GWJA 5FYCA 5FZ6A 5F3EA 1W9YA 2ZGKA 1RUE2 1VBB2 2C0ZA 4UF0A 5ANNA 4XMAA 3WG1A 5IVBA 2A3YA 2JE8A 4JGZB 2RVAA 4NHXA 5HXVA 4IEQA 5JIUA 4IEUA 5J37A 2P1BA 2WFPA 4R9CA 4NO4A 1LHUA 3S6PA 5I91A 1JS9A 1Q8PA 5D8AB 4OQ9A 2BGOA 3FUOA 1OF4A 5FP8A 3U10A 1PO21 4QQOA 3ZR6A 4R4XA 3WNNA 4R9AA 4K7JA 3UGFA 1JOPA 3J7MA 3ORJA 1JYVA 1AX2A 3GYDA 1DBNA 2ARCA 2JX9A 3WCSA 4SBVA 4LTAA 3ZXJA 5KXBA 2O0OA 1KS4A 1P8JA 3ZXLA 3ZIXA 3K3NA 1O4TA 4YM2A 1H2KA 2Y8KA 4YARA 3BKZA 1ND3A 5AVPA 3MF6A 4EZ4A 1QJX2 1KFUL 1SG3A 1CESA 1LRHA 1W8NA 4A7YA 1AR71 3UL2A 1E5IA 3JD73 4LO6B 1XB9A 5DZEA 5IT6A 4LBOA 5I0RA 1RUE1 2P4EA 2HWD1 2Z69A 4Y1ZA 2WUHA 1XXNA 2EICA 3BALA 2Q8OA 5IAVA 5GALA 2C26A 3VDCA 1N3OA 1OA4A 2RHPA 2XUMA 3P3PA 4ET7A 4Q4Y1 3WQ7A 2Q30A 4AF9A 4E2GA 1QWRA 2XHNA 4QQPA 3IPVB 4OHWA 1F8VA 3IWZA 5H9QA 1JYTA 2PHUA 4RR3B 5JAXA 4JGYA 2JDHA 1LB2A 1QJY2 3RVHA 1W05A 4LQRA 2WQZC 1EV13 1C57A 1S55A 5F6LB 4XF0A 4B4QA 4HK8A 1RITA 4XZPA 1OMIA 5JXIA 2WNUC 2ZOEB 4LITA 1S0IA 3TWIA 3V0BA 3ZFGB 5GZEA 4Q4W2 2OVUA 5FQ0B 4Y22A 4ZU7A 3AC0A 1RUF3 4LBQD 2O1QA 3R4SA 4AGVA 4YG3A 2RS11 4XFBA 1W9SA 4XFFA 5A80A 1DG6A 2R071 1LAJA 3ACLA 3HMYA 1QNYA 2A7AA 5LY1A 4LK7A 2MNGA 3EMRA 5FYYA 1HRI3 4K1YA 2CWMA 3C7EA 2XJUA 1RUNA 3N9OA 1ULPA 1CZTA 1RB8G 3F95A 3PVBB 3NV2A 4EWDA 4XJZA 2FDJA 4A6OA 4NRMA 3DUIA 4YW1A 1ZRDA 3AJZA 4QXHA 3M8LA 3FHIB 1LESA 4O7XA 4QGLA 1BXHA 5G04L 2DURA 1GP6A 1H0BA 2BTVC 3ACFA 3BB6A 1XQNA 3I2IA 3KCXA 2FCUA 5ANQA 3M2MA 4YVSB 3NWKA 1R1A2 1TMF3 5FZLA 3TEWA 3WG3A 4JTOA 3HT1A 5GM0A 5FUIA 3U37A 1F9KA 4ZU5A 1V0AA 1RUD3 4K20A 1JZ7A 1U5YA 1GR3A 3FZ3A 4D3WA 2EIEA 2RS33 3TEXA 1T2XA 2W47A 4A44A 2NP0A 1C8NA 4N7UA 5BNOC 1AR93 4AAXA 5KC6A 4KWKA 1MQTC 4YM1A 4A3ZA 3O14A 3KGLA 1W3VA 4NOTA 1K45A 2F17A 5L9RA 1ZBA2 2ORXA 3AP4A 1JTZX 5FZGA 3AP5A 2YB7A 2VBDA 1VAVA 2FD8A 3B02A 4WVMB 3GDBA 5EZWA 5T5OA 4Y4YA 4HSLA 2O8QA 2YG0A 5FJHA 4KI5M 1MZFA 2G1MA 3A23A 4XTPA 4Y22B 3O7OA 3LSDA 1OPOA 3GNEA 3KWVA 4FOQA 4QDSA 3VKOA 4AEDC 1EUTA 2XJTA 3F2ZA 5F3GA 2R041 4Q4V1 1DZRA 3DV8A 4HLTA 4TXWA 4FFFA 2D5FA 3KVBA 5FZDA 4YZ4A 1WCKA 2R072 1PIV1 5C5TA 1PMJX 2R32A 1LNSA 1QOTA 4MGYE 1UOJA 4P5HA 4BCUA 2R6QA 5EV7A 4OVEA 2XJPA 4META 1AR62 2XL7A 2K46A 5FZOB 3POFA 1UYZA 4BU2A 5FKBA 1FT9A 3QH7A 1LJ7A 1XSRA 2NM1A 3LEGA 5C3SA 3AJYA 4CCLA 3N9QA 2YMZA 1MR5A 4GB32 1EV12 4I02A 1NCRC 2VAUA 3MUY1 4Y1XA 3BU0A 1UCXA 2QQVA 2GH2A 2HYKA 1SZBA 2VVEA 3JCIA 5FTTC 1N1VA 4MH0E 2LTNA 1Z78A 2P6CA 4IE7A 4DUWA 3LDRA 4XZUG 2BWAA 5FMBA 4M3CE 1NKGA 1W0NA 4JRLA 1COV3 3LFIA 4QM8A 1C8M3 2PHTA 1AJOA 3PMEA 1Y9QA 4AEDA 4QU1A 5F3CA 1SLCA 2NN8A 2W94A 3O1VA 2CAUA 2R30A 2DFCA 1NE6A 3C7OA 3T4VA 2VVFA 5FBJA 3BTYA 4QPIA 3VBFB 4Q0VA 1OUXA 4DIQA 2VZ3A 1UQXA 1ENSA 2VH9A 2VL4A 5IATA 1UZYA 2JD9A 1HIXA 4BISA 5F7UA 1J3QA 5FY5A 4FXGB 2DBNA 1AZDA 3ZYFA 1LHNA 1MZEA 1MS8A 1YWKA 2E51A 1RUOA 4XXPA 4YW5A 4TTGA 5L7OC 5FZOA 1LGCA 1UU4A 2W91A 5A7NA 3I7DA 1BCXA 1HB2A 3V56A 3OD0A 1W99A 2BBAA 4S2HA 2VMGA 2X29A 1NOVA 1ND3B 2W1WA 1CAXA 5LBCA 2R043 1JW6A 4RYDA 3SCGA 1PM7A 3VUOA 4LHSA 3H3LA 2VOTA 3HN1A 1VBA2 3KM5A 3APBA 4E9KA 1CR7A 1KGYA 3AXEA 3HNBM 1UZWA 1N47A 3EB7A 1XC6A 2XQXA 4BIFA 4YW4A 1RUJ1 1UIKA 1VMFA 4CCEA 2GMEA 4UFMA 4NPRA 3PLQA 4LLFA 4OHZA 4A3XA 3VBSA 1DQ0A 1ZZCA 3GM8A 2E32A 4QPGB 4GMP0 2ARXA 2AYHA 5JVVA 3TAYA 3U4SA 5IFTA 2LS6A 4M3CA 3VBRB 4UYBA 4MHRA 1KDMA 3U11A 1ZBA3 2BNNA 2HEWF 3ZYGA 5JDBA 4CYDA 1RUH1 3ZYIB 1RUC1 5FCCA 4P9LA 5ABJA 4QAWA 1ZBE2 1QMJA 3A7QA 5FK7A 3VKNA 4LHKA 1K42A 5JI9A 1RTVA 2O14A 3ECQA 2R49A 4ZS3A 1JZ6A 1AR92 1UMHA 3MICA 3K46A 1V6LA 4XJWA 5A6QA 4OI1A 4EJRA 1JYXA 5FUNA 1PVC3 1LEMA 2ZMKA 3POWA 3M7AA 3OGRA 4V2VA 1W28A 4CU6A 1QKQA 1V6OA 2TBVA 4KU8A 1GZTA 2EXJA 2HJIA 2VCMA 5KXEA 3LB9A 3AZZA 2VBBA 1DGWA 5KBFA 2DFBA 3GHMA 4L2NA 5FYZA 1AR81 2MEV1 1I5PA 1FX5A 2IFRA 3PU3A 2WA4A 3ITQA 4XQ4A 3JQWA 5E88A 4PLMA 4CEWA 3RQ0A 2OT7A 5A7QA 2RS13 3I8TA 3NNLA 4YLZA 2VCAA 1HXS2 4CU8A 1D4M1 3R0RA 4YGEA 2WN3A 2GP5A 3HNYM 1WLWA 2VOKA 4Y5SA 2EXKA 2BOJA 1LULA 2YV8A 3J8F2 5DG2A 4YW2A 3N7JA 1RUI1 2GMMA 1YQ6A 2I45A 2YY1A 1VALA 4Q5OA 4UFLA 5IK7A 2HWE2 3KMHA 4FOWA 1DP0A 1UZVA 3OJBA 1ZZ7A 3NNMA 5FDBA 5FPZA 4GB31 2PQQA 4IW3A 5FXXA 5HI0A 1DCSA 5IW0A 5C8WA 2IXCA 2UYBA 2BQPA 4QHBA 3VZKA 1DQ1A 2YBKA 1YFXA 1HB3A 2B42B 3IPVA 2YC2A 3BCWA 3LDBA 4FI9A 5H9RA 2PFWA 5T52A 5IJRA 3O1PA 3RZHA 1C1LA 1GUIA 4AGGA 1FMD2 2ZEZA 1AYN3 1HJGA 1UOBA 2A71A 2CSGA 2Y6FA 5DMYA 1G9AA 1GZWA 1AF9A 1HV1A 5DN2A 3I4IA 1ZZBA 2DUOA 2HH9A 4R9DA 1SDDB 3DPRB 4WBBA 2QJVA 2D3PA 3K75B 3W21A 3QOPA 1DDLA 1C5HA 3N9PA 2B9VA 3CJIB 3R4DB 2CV6A 4BHPA 4W50A 1DQ2A 2VVDA 5IYYA 2HBTA 2VQUA 3JZVA 3OGVA 1C1FA 1WUVA 4I0AA 4Q4X2 1H2LA 3K4DA 4RQPA 2ZTNA 1PO11 3WF0A 3O1TA 3K3OA 3ST7A 3LE0A 4GMP3 3I54A 4ARYA 4BLJA 1B35C 4DRRA 1BQPA 5IVCA 4YGCA 4JDNA 5E1RA 4YPJA 4COVA 3MIEA 4XIKA 5CVRA 4AG4A 4CDXB 1MVEA 1LOAA 1HN1A 5FO9B 1O8SA 4LK6A 3NVCA 3DPRC 1ULCA 4RL7A 4XEZA 5FV3A 1VBA3 1RC6A 1X9PA 1IS4A 3ILFA 3NL1A 1MS0A 3NNGA 4JV4A 3USUB 1QQP3 3LEMA 1HRI2 2QQNA 4LR4A 2WINB 3VHPA 3BUCA 4A7KA 4ZZ5A 4BQ1A 5LBBA 2QFEA 2QVSB 3PJYA 4IERA 3WNPA 1TME2 1W6QA 4D7YA 4FOYA 2G9FA 2RS31 2XUEA 4QDRA 1NZIA 2GAUA 2ZZQA 1W8HA 5F2WA 1R1A1 3VD5A 4H2AA 3OD4A 2WZR2 5E8AA 3ZFFC 4EN0A 1RHI3 1PNGA 3PTRB 1SBEA 3PVOA 2A1XA 5FYHA 1QJY3 4UI9L 3AZWA 4L99A 1TME1 4QKBA 1FI2A 1TVGA 1W6OA 3L2HA 1WMDA 3LA3A 2JKXA 3M3QA 3POYA 4IEPA 2DTYA 3IDEA 4Y24A 4I09A 1N3QA 1RUD1 2ADDA 2CNAA 2DU1A 2WNOA 2AEYA 4P00B 4QT6A 5HCFA 1G9DA 3VHOA 2XDVA 1RUH3 2Z5WA 2WDBA 4V1PA 1V6JA 4NMIA 2UURA 5JOXA 3AYAA 3IDBB 3LZZA 1ZVFA 1FXZA 1VBD2 2B39A 2WNUB 1C8M2 1W6NB 5IVYA 5A7OA 5LBEA 4RHV3 4F83A 2PLV3 1JUIA 5FREA 4YM0A 1S0DA 3WDTA 1XPWA 3MEPA 4UT5A 3HN3A 4M4RA 2YROA 2BRTA 4PBOA 4W6WA 1PO12 1DGWX 5C7GA 1FOD3 3VN4A 2GC0A 5FY7A 4AHZA 4A2UA 4EN8B 2VNOA 3M4FA 3VLBB 5FLIA 2EXIA 3C7HA 2PXJA 4XBNA 3AMHA 1O4YA 2WO7A 5KHKA 1UPIA 1IQAA 2JG9B 2AZ5A 4URAA 1OHFA 1S0CA 5FPUA 3DEMA 4N53A 3KD4A 1VE0A 1C5IA 3AB0A 3AMNA 3ZFFA 3ASIA 3EHKA 3WUCA 1AR72 1VMHA 4XILA 2V09A 2AR6A 4GH4B 2DCYA 2QZ3A 4G9SB 1LGBA 5FYVA 5BNQA 2SBAA 2A70A 3T2TA 4TYSA 5I8YA 4PI2A 4JHZA 4CDUB 1H8TC 4HOOA 1UMZA 1JZ4A 2SLIA 2HWB2 2JDUA 4QQ2A 2OQ6A 2PHFA 1UYYA 3ETPA 1ASJ1 4MGQA 1QOSA 2YFZA 3USSA 5FZ1A 5E89A 4P9JA 1CAWA 1ZA7A 5L19A 3CLPA 4ISRA 4I30A 2WS92 1X33A 2ORZA 1RUI2 2BNMA 3C7GA 4CTEA 3JD71 2IXLA 1PO23 1MZ5A 1W9WA 2JE9A 1PX4A 2Y64A 3VHNA 3WF2A 5HV4A 1M06G 3IBMA 4XHXA 3O1RA 3H8RA 5EIYB 4QPYA 5HCAA 1NCRB 1S4CA 1L7QA 3SMHA 2DWRA 5CG8A 2VMIA 2OKXA 2VQTA 4ASLA 4OUMA 2XR4A 3WINE 1E5RA 3T0DA 2TEPA 1REEA 5HV0A 4XBQA 1FYUA 4DFSA 5JSPA 4FPOB 2CAVA 3GZEA 3T08A 1ASJ3 2JG8B 2PYTA 3SITA 2GU9A 4N53C 4BK5A 1SBDA 4BE3A 3TBDA 4YZ5A 4NUBA 2B46X 2YGLA 3WXPA 3SCFA 1RYYA 2RM22 4WM7B 5BNPB 3X29B 1WD4A 1NCQC 4CXXA 1VBC2 1YJLA 4EQVA 3KVAA 4M01A 2KA3A 1SDWA 2ERFA 5DZFA 4ZHNA 2WYFA 2CWSA 2D43A 3ZSKA 2FDGA 1XE0A 1H8TA 2NLRA 2CDOA 4V2WA 4NIGA 3U07A 1YLLA 1YHFA 2EIGA 5LATA 1RVF1 2PQSA 3HQXA 1G9CA 1FPN1 1JI6A 3ZLIA 4HVRA 4PIZA 1PGL2 4E27A 2EAKA 3H3ZA 3DL3A 1YI7A 5SV5A 3VDDA 3S30A 4YG0A 3LEKA 3UESA 2W5FA 3AMPA 1DYPA 1W6MA 4LBLA 2C9AA 3MF9A 1YFUA 3JB4C 1KD7A 3O5SA 4M4PA 4AEKA 4IEOA 1HKDA 2H6BA 3GXUA 2OW4A 3ZN6A 1NQDA 5H9SA 3WT3A 3MIBA 3KLSA 3OPZA 1XJAA 4LKFA 1HDKA 3OF1A 4MSVA 4XJ8A 1WA4A 3T30A 4CZSA 5CADA 1TG7A 5FP9A 2Q8CA 2E7QA 1OFSA 2A5ZA 2AC1A 1VBD1 4UWDA 5IHRA 4TN7A 1KJLA 2ZGTA 4M0HA 1GANA 5IUQA 2Y34A 1ND2C 3CNAA 2VZ1A 3O1OA 1N1SA 5GLVA 4EV0A 2WLQA 1EAH1 1ND2B 3SNMA 3MYXA 1JBCA 3DYMA 1ULEA 4BPZA 3S0MA 4H55A 2AH2A 4UW4A 4Y33A 5C4WB 2RDNA 4MUVA 3RS6A 3U4XA 4QKNA 4ATEA 4CEYC 4FFIA 1MS9A 1NT0A 2BZDA 1V9U2 4L97A 4BQYA 3H8XA 4R8HA 2VNGA 2A6ZA 2VMCA 4AFMA 2ZGPA 4LBJA 3LIGA 2PAMA 4AL9A 2VULA 3N9NA 3VDDC 2WNVC 4CRQA 1V70A 1PMIA 2WZEA 3KQ4B 2Q5TA 4XFIA 1OD3A 3RRDA 4DXSA 3BODA 3B7MA 1R081 3ZMNA 5BNOB 1RJ8A 4ZONA 1DU3D 3PJQA 2A3XA 3N9MA 4FCAA 3VBHC 3O1MA 4HSJA 2Q0AA 1K5MC 4RR3A 2GDFA 4CDWA 2D6LX 4GZ9A 4Q4X3 4AR2A 2CY6A 1LOGA 2ZEXA 4PT6A 1AYN1 1LODA 2R16A 2VM9A 2VCBA 4SLIA 3NW4A 4YNIA 1J58A 3MDPA 4IGQA 5CFDA 5LZ6A 1GQGA 2ZEYA 1VLNA 3JUUA 4BYYA 1UKGA 4QHOA 2D5HA 1LOBA 2XJVA 2YYOA 3NQHA 4CEYB 4Z07A 5HCBA 1AR73 3THPA 5K4LA 3JB8A 3GBFA 2IXHA 2E9QA 2ZHKA 2VZPA 4CEWB 5LA9A 4H14A 2VCCA 1SHWB 4ASKA 5BNOA 2YC0A 3HQRA 4J1WA 3MV01 1GSLA 1MQTA 2HWD3 5IWFA 1TNFA 2UY8A 2ZA9A 2V73A 1XU1A 4BOWA 3SEPA 3PUIA 3ZXDA 1DQ5A 3SLIA 4C90A 3I3BA 2WAAA 1W0PA 1RXGA 5J1XA 4ORFA 5B4NA 2QKDA 1PIV3 3R4UA 2GH8A 1UWWA 2Q1MA 1R083 1CN1A 1NG0A 1ULGA 1UW8A 2RG4A 1OFNA 2PLV2 2ZHLA 2P3JA 2MEV3 4RR3C 2ZX0A 4PIYA 4CDWC 3KHCA 2RS52 1W6PA 2VGDA 2LALA 1VRH1 4I3GA 1QH6A 3KZ4C 5KHGA 1POV0 2WL1A 2Y6KA 2AGSA 4MADA 2D6MA 1I5ZA 2VECA 2PHLA 3L9JT 3WLUA 1JMUB 1AL22 2ZHNA 3RMYA 4AI9A 4HN1A 1L7RA 1SMVA 5AFBA 5FLHA 2D98A 1UAIA 3VD3A 1XNTA 3N3HA 1W6OB 2W92A 3I49A 3VZNA 1GP4A 1UY0A 4UF0B 1AR82 2XLGA 1C28A 1IKQA 4G4FA 2R062 5HBAA 3I2OA 3P3NA 4W4ZA 2RDQA 5C9AC 1XYNA 2RV9A 2GNBA 1IG0A 1BKZA 1E5SA 2ZEWA 1VP6A 1XRUA 2J7MA 1WWYA 1IS6A 4R9BA 1PZ7A 4ATFA 4TLFA 2VUJA 1WGPA 1RXFA 4PLOA 3UV9A 5IFPA 5JOZA 1PK6B 2YDEA 4MXVA 1HXS3 1SPPB 3VKLA 1ACCA 3NRUA 4PF1A 1VIWB 2R073 4IEZA 4XVHA 1IGOA 1IS3A 1RUC2 5FPVA 4N9HA 4D7SA 4BQ2A 2C24A 2AENA 2Q1FA 3VZOA 4OZOA 2E31A 4LNVA 1W2OA 2D93A 1W8TA 1QJZA 2J22A 2WQ8A 2RMU2 5FYIA 1U5IA 2DVGA 3SISA 5FPBA 1OH3A 4UFHA 2PA7A 1GYKA 2QNKA 3RDIA 5A32B 3RZMA 2BP6A 2A6YA 1ZZ6A 2XKPA 5M0TA 1O4ZA 2FZ2A 4QX2A 2VXJA 1PMHX 5DAPA 4XE9A 5F1RA 5F32A 1PGSA 1QXRA 2GMPA 3RZGA 4AQ6A 4AVBA 4Y5Z0 2HWF1 1POQA 2QQOA 4JDMA 1WBLA 1A78A 1BJQA 5FP3A 1VBE1 4Q4Y3 2XXZA 1H8TB 4CDUA 1SFYA 2PMWB 4CUCA 2PAEA 1ZBE3 1IS5A 3POEA 2AUYA 5C9AA 2FCVA 3E5QA 4OMCA 4QKFA 1QJFA 3FMGA 3ZSMA 3ZSJA 3ZVXA 1WLTA 4N90A 3UNPA 3HOBA 2ATFA 1CX1A 2DDUA 2CGPA 4YRDA 1DGRN 3GJBA 2QUOA 4LIVA 1V6KA 3CQOA 5BY5A 1Z7S1 3B9CA 5GLWA 4AI1A 2X5IA 3H7YA 5FQ0A 5F5IA 1FNZA 4LLOA 1AYM3 4DMIA 1HRV2 4GJYA 4CCOA 1YO8A 4IEXA 4CP9A 1GMMA 5LK5A 2VU9A 4D6RA 5LW9A 2GN7A 1SCSA 2ZACA 5FR3A 4ES9A 3GZUC 5A6XA 4WVWA 3FHQA 3NV3A 1N1YA 5FY8A 5K7PA 3MFAA 5LRRA 3MBWA 4CP9B 2WC2A 4XUQA 1XYOA 2Y0IA 2KM2A 3MV11 3ZFEA 4GWIA 2ZPXA 4X6QB 2OXBA 3BOWA 2J1SA 3O12A 5A3WA 3WY6A 4AQ2A 1UL9A 1RUE3 3QLQA 1GOGA 3OGSA 4A7ZA 3VKFC 4Q0SA 5FZ4A 3KT1A 2ZAAA 3GCWA 4WM8A 3A21A 3M3CA 5JMCA 1OOPB 4HPKA 4K9SA 4NROA 5FZEA 3LWCA 2RJ2A 3GF6A 3IZOA 3URFA 2A75A 3H3UA 4KGGA 5I8SA 3EO6A 5DDJ3 2H6CA 3THCA 1IPSA 3QD6A 5AVAA 4D94A 5LA2A 3ME2A 3FJSA 3ZKUA 3CHXA 2ZXQA 5FZ0A 4FAHA 5ACA2 1DZQA 4HKOA 5FXZA 4AVCA 3A22A 1U5XA 4GIQA 4EZHA 3I2HA 5C5UA 3RI8A 1MS4A 2RR12 1VRH2 2ZCWA 4NWWA 5DDJ2 1IOAA 3NAPC 2G4IA 1CJDA 3AK0A 1YFYA 4MX3A 2IFWA 3WD5A 2W1UA 3H42B 2RMU1 1AR61 3RJRA 2WR9A 3FWEA 2D44A 2R1DA 3AP7A 4Q0PA 2HWB1 4L11A 1I9RA 1Y43B 3D3AA 2Q8EA 4AFDA 5A3MA 4LOTA 1WCDJ 1WBFA 3AKQA 1BYHA 3I2JA 3OG2A 5K9YA 2JB8A 1D4M3 2VY0A 5C6CA 5K8SA 4RS5C 2WWSA 3AKPA 4RSUA 4UW5A 2W87A 3HT2A 5JR7B 4D6QA 1Y9MA 4B1LA 4DXTA 3B9IA 2EF6A 4E4DX 2KD7A 5K0UA 5F39A 1FAYA 4P9IA 3DN7A 4XCAA 4WM8C 1YI9A 4CCJA 4RFRB 4NRPA 2Y26A 4LUKA 4HN0A 4XJ9A 1IQDC 5HCHA 4L0PA 3POGA 5EHDA 4B7KA 1W2TA 4CU7A 2ZBJA 5JXHA 2VZRA 4KG0A 2WYSA 4W6XA 4DOUA 1D2SA 1NY72 4Q8LA 4XQWA 3TB0A 5CAZA 2XJQA 2W1SA 2FDFA 4Z82A 1HRI1 3ILRA 1JXNA 1NY71 5LK7B 3VD9A 1N3PA 4X8NA 5D2AA 1KS5A 5CYYA 4LKEA 2UU8A 2VW1A 4FT8A 4GH4A 3NSTA 4IE5A 4YVWA 1XYPA 4O61A 5CFCB 3DXUA 3ROUA 5BXXA 4BQ3A 5KR7A 2JDZA 4O65A 1GICA 3VD4A 5ACA3 4QM9A 4YVSC 2DUPA 1VR3A 4D0QA 5AC92 4KQ7A 1B09A 4DB5A 3KV6A 1GNYA 2EXHA 3AP6A 3DECA 2VZUA 3QBQA 4RS5A 3USUA 2NZ9A 5FO8B 1NA1B 3N7MA 2OX0A 2WBKA 4C1WA 5FZHA 1X9TA 2YUEA 4AOCA 3E6CC 4AYUA 1Q8OA 1BZWA 3DPRA 3UJQA 3DKWA 3L2YA 2Y38A 3LD8A 3ZOIA 5F37A 1SLBA 4NVPA 3NAPB 1PGL1 3NKTA 4AWDA 3UGGA 2RS32 3ON7A 4P9XA 3RZLA 1H2MA 4GWMA 2KXLA 1I3HA 1CIWA 4B8EA 1JZ2A 1UYPA 1EPZA 1JHNA 4Q1RA 5TSWA 4P5YA 1AL0G 2X10A 1VAKA 4MOAA 1KQRA 1RINA 3MW2A 2QDRA 3RYRA 1X50A 3H8OA 2B45X 3AZXA 2IVIB 3VZMA 2D97A 2P2KA 1VBC1 3VKMA 5EJ3A 1NA1C 1CJPA 4MXWA 1CZSA 1HQWA 1JU3A 4RS5B 1W8OA 5DUXA 1DGLA 4BIOA 2P3IA 5EQUA 4OMDA 5FYBA 2FHRA 4EE2A 4FFHA 4JTNA 2CTVA 5C3PA 2UWAA 2JD4A 4MGIE 1UX6A 4GKXA 2JEMA 1GWKA 1J3RA 2QCSB 5F9TA 1F15A 3C8XA 1DF0A 4RGKA 4OI2A 1O3TA 1ENQA 1WW5A 4JX0A 5FOJB 3T2PA 3NKGA 4QU2A 4YZ1A 3PIGA 4GD4A 1QDOA 1WZXA 4LE4A 2XJRA 4AVTA 4CVUA 3T2OA 4QKDA 4FOVA 4I3PA 1WLCA 5C33A 4JAAA 4N9IA 2HEVF 1FNYA 1QU0A 2VG9A 2MEV2 4JGZA 2TNFA 4XUTA 1GOFA 3ZYJB 4PHZA 3W5MA 1DQ4A 1FV2A 5DAXA 4TLGA 3ZR5A 4AEMA 5AC93 1GFF2 1OLME 1ASJ2 4S2DA 3THTA 2E53A 4YVWB 3ZX7A 4LKDA 2Z4FA 4JCKA 3WF3A 3NJXA 2FZ1A 4QPIB 3WP6A 1SLIA 2CL2A 3WZ1A 1W8UA 2QQUA 3M70A 1VB2A 3MLLA 4Q1PA 4XPVA 2YZ4A 3BGAA 2EVXA 3WCRA 4BXSV 2C1FA 2QQKA 5EXOA 2EIBA 1GNHA 1RL3A 1CZVA 5FZCA 4AEDB 3V0AB 4PIXA 3UT0A 3CF6E 5G05L 1EP0A 1IG3A 3OGJA 4ITCA 5GZFA 5C8CC 2BEOA 3RYPA 5DAVA 2ZX4A 5T5LA 4MGKE 2Y6JA 5I0TA 3RMXA 3RNSA 3FFZA 3VBUB 4ZY9A 4FPKA 4Y1VA 1A3KA 2VE1A 1OPMA 3KHBA 4XDPA 2W2IA 1U12A 4LBQB 2BPA2 3SEEA 1F2NA 2B5HA 4QX5A 1BEV3 1JUHA 1ST8A 3R6SA 1FATA 5JUVA 4KBBA 5I0UA 2EALA 1TME3 2W9XA 3B00A 4PDWC 2YBPA 2XMLA 4DY3A 3UJOA 1H6YA 2AACA 4JGYB 5ISLA 4MXWB 3PU8A 3Q8AA 4WVMA 2G19A 3WR0A 1H2NA 4XDQA 2CDPA 1BEV2 1RUF2 4B4PA 2IZWA 2JG8A 4ZKTB 3AKTA 3FBMA 2J42A 3HEIA 3LA2A 5EJ1B 1RUG3 3WEZA 5IAXA 4AZZA 2YU1A 2B8MA 1O3QA 5FZ7A 1AR91 2WQ4A 2Y60A 4LXLA 4XTMA 1JH5A 1Z0HA 2IVJA 2VD7A 1LENA 4HL0A 4EWEA 2OUJA 1SLLA 5A1LA 4C0BA 3MUZ1 3RGBA 3FX3A 4O9EA 4CXYA 1F31A 4IGOA 3FN9A 4P08A 1Y3TA 5LBFA 3FBYA 4IGPA 4K21A 4NR1A 4IETA 3AX4A 4LUMA 4UW6A 1HJFA 2RDRA 5FZBA 2OS2A 5JPMB 1W39A 1HQNA 1YEWA 2WT2A 4XF4A 3T0BA 3MO4A 1QIQA 5FYMA 1BHGA 3HNMA 4A6SA 2VMEA 2X8KA 3CJXA 5L9BA 3ZFGC 4R4ZA 3POJA 4QX7A 1VRH3 3B3QE 1APNA 1QXPA 5F8PA 3B93A 3VBOC 5E6HA 4LULA 3KT7A 3IMNA 3GZTB 2HKXA 4S2GA 4XFGA 3BOPA 2R061 4MHUA 5FXVA 5IVFA 1ZNPA 1W04A 3ZO0B 2QTWB 3K48A 2BGCA 1JHJA 4BJ0A 1POV3 4P9WA 3VBFC 3TEZA 3VL8A 1AXZA 1W9FA 1UY3A 4XABA 5EFUA 3PUAA 5FZ3A 2X05A 3CJIA 1RUJ3 3HIFA 5FJKA 4MGTA 2R7EB 2RMU3 3JQXA 3VV1A 1DLCA 4BDVB 2XPJA 4NJ4A 2PTMA 4K8RB 4FP3A 3T4HB 2WZR3 2GNTA 4P02B 3E1F1 2BNOA 4N43C 4BZ4A 2YXSA 1ULFA 3EYPA 4YM3A 1LECA 3PIJA 4XFAA 3RZZA 2QZ2A 3ZYBA 2VZQA 3WSOA 4CPBD 2GN3A 5FUPA 4F3JA 4LE3A 5FZFA 4LA2A 4XF1A 4BQ4A 3ES4A 4E4ZA 5JCTA 1O59A 3U78A 1M4WA 3M3IA 1NLSA 1PGW1 4KNCA 4UW3A 1ZRCA 3AZVA 1OOPC 3DGTA 3G7DA 4X8PA 5K0UC 2GC3A 5GLTA 1FMD1 1KITA 3LOIA 4BXFA 5DAWA 3ZFGA 1OT5A 2JIGA 5IK4A 1VPHA 5EJZB 2ZGUA 1F5JA 1WCSA 2XL9A 4OUEA 3UGHA 4A42A 3IDAA 2WZPP 4NRQA 2I2SA 5LASA 2PHXA 1UY1A 4ISQA 1S0EA 5A33A 3TNPB 4IESA 3AZYA 3POSA 3QH6A 5AC91 1S0FA 3EJKA 2DBIA 3ZXKA 1V6MA 2WNVA 2XVKA 4QHZA 1QH7A 1SBFA 3MPBA 2VZSA 4QX0A 2D6KA 1NZCA 3IIIA 4FVVA 4UFJA 5KHIA 2WSVA 4I2OA 2HWE1 2K0GA 1A6CA 3LCPA 4MVTA 1COV1 3WP4A 4COZA 2XQRA 4TSVA 4DS0A 1NLQA 2DV9A 5HPOA 5I0DA 1IHMA 4CEWC 2VUAA 4GH4C 1DQ6A 2BFUS 5FLJA 3WQBA 1B35B 1RUD2 3VBHA 4Y5TA 4QPGA 1K5MA 1AYN2 1G6NA 2CYFA 3WDWA 3WX5A 4FTSA 2O8OA 2D6PA 3LEIA 1O7FA 3PVNA 5J3UA 3QACA 5T3NA 2J1VA 2WT0A 4Z92B 3ZDSA 2ZGLA 4TWTA 1UX7A 2YC4A 3WHTA 1UKRA 2FMDA 4AGRA 5KXDA 3AKRA 4YFWA 3FL7A 4OZXA 5JI7A 3WUDA 1RGSA 3LPFA 4AW7A 5FP7A 2LROA 4NPMA 4Y1UA 1REFA 3KT4A 2JENA 5F5CA 5FFOC 4KBZA 2JICA 5JPNB 4PF5A 3MIDA 4WM7C 3FFQA 4UXAA 2R0HA 2OYZA 5LA1A 2W0XA 3N36A 1MVQA 4W8JA 4YZ3A 5GLZA 3UK9A 1K3IA 2LRPA 2FBEA 3TN91 1EAH2 3SXWA 3SKVA 1G9FA 1Z7S3 2LUWA 3KB5A 4A45A 3O1UA 3FUQA 2NQYA 2RS12 4A41A 2XKOA 3IN9A 3BTAA 4I0WB 4MZUA 1RUF1 1XOYA 1YCIA 2Y6GA 3J8F1 4HETA 4Y3OA 1R1ZA 3O0WA 2DCKA 2XVLA 4INDA 2Y33A 3OOXA 1RUG1 4CU9A 1D4M2 4ZZ8A 3DYOA 2A6WA 2UYAA 4PJYA 2DVBA 1HXS1 2QQJA 3CZUA 4COWA 4IXLA 5A70A 1ZZ9A 2RR11 1RIRA 2ZGOA 5T50A 4QPGC 5DQ0A 3ZYHA 5J48A 1RVF3 3HPNA 1QJY1 1PVC2 3FLPA 1US3A 4COYA 4LBNA 5ACA1 2XLFA 3IAPA 1OQEA 3OB8A 3Q8EA 3BU7A 1C4RA 4BWOA 1OSGA 3DKQA 3OBRA 1BBT1 3MIHA 3BIEA 3EQEA 4UOJA 3SKJE 1SFNA 3W58A 4MGSA 5BUVA 3V0BB 1J1TA 3AKSA 4CE8A 3W59A 1DFQA 1FOD2 4KWUA 2GZWA
chains in the Genus database with same CATH topology
1H4GA 2HWD2 1RVF2 3N4MA 1AXKA 1ZRFA 3ES1A 1ND3C 4JGZC 4AHYA 1XNBA 2YHJA 3MW4A 5CBLA 4OI0A 3H1MA 4WM7A 4TZDA 1LKNA 1CAVB 4D69A 3KCYA 2W52A 1DHKB 2EA7A 3A4UA 3VBOB 1W6PB 4LBQA 1RHI1 3H9AA 3Q9OA 1BEV1 2JXAA 3WDXA 5KHJA 2RM21 3ZIWA 1W6QB 1S1AA 2BVVA 4XETA 2PHDA 1IKPA 3ENRA 1X36A 5GKAC 5GLUA 1R093 2ZZJA 2E7TA 1O5LA 2AREA 5DG1A 1IPJA 3BIWE 1O5UA 2XBO1 3LOBA 2D40A 1PNFA 4GA9A 1MQTB 4XFCA 1H1MA 5DUWA 5FPXA 3JBG1 1HRV3 4HFSA 1PHMA 1JOJA 2VOWA 3LSEA 5IK5A 4FO9A 1OQDA 5D8AC 4C0HA 1AXYA 1SACA 2E63A 4PDWA 4FAGA 4E2QA 1AX1A 3TRSB 1XNDA 1GLHA 4NWVA 2PHWA 2Q1ZB 1V9U3 2XBO2 3AYEA 4Q4X3 4LBKA 1AHSA 1LGNA 2HWF2 1IPKA 3PHMA 4XYXA 4AQSA 4E2SA 4Q4V3 4PDWB 2WS91 3ZN5A 4MYEA 1WMEA 1CAUB 1H9PA 2OZJA 2ZX2A 3UKNA 1S0JA 1WW7A 2DCTA 5GZDA 3I59A 3H50A 1C3HA 5D1IA 1HRV1 1FMD3 5EYYA 5T55A 1AUYA 2BBVA 1CAXB 1ZM1A 3VL9A 1GV9A 2DU0A 3C3VA 4NHMA 5C4WA 2W08A 2E6VA 3E5UA 4FP2A 5J7MA 4KGQA 3WW3A 1E57A 1CAVA 3H7JA 4LHLA 4OUSA 4W6YA 2VQAA 5JIAA 4ZU4A 1VBE2 3VBOA 2TUNA 2XGXA 4IV3B 1RUI3 2D6NA 5CB7A 1PVC1 4URTA 3MIGA 4XIOA 1LHVA 5JZGC 4PCRA 5I8TA 3ZYPA 3WNXA 4FBFA 1HQLA 1VBB3 1UIJA 5KXCA 3CJIC 1AL21 3S7IA 1J1LA 3TOJA 1QJU2 2VXRA 5LEJA 1BK1A 1DYKA 4E4SA 4C91A 1AR83 3WDUA 2OIIA 4FXKB 3VBRC 1G8WA 1XE7A 4AK3A 2RS51 3J9SA 5CFCC 2WJSA 2ZMNA 2N7GA 1GNZA 2PLV1 3ZSLA 2F6BA 1UZZA 1XE8A 3ELNA 3NAPA 4QD2A 5BPXA 2Y0OA 3B01A 1I6XA 5EYXA 4AI2A 1OOPA 4HPKB 3D4KA 3ZMOA 1OQ1A 1D4VB 3MW3A 1CX4A 1Q3EA 2VMHA 1HLCA 4AQTA 1PO13 1ZBA1 5JZGB 3U0ZA 4HK9A 1GKBA 1AVBA 4YGDA 2ZHMA 1S2KA 4RGGA 2ZS6B 2CGNA 4P9GA 4DNYA 1QJU1 2WKKA 3RWNA 5JZGA 1RMU1 4B29A 3UKVA 2HWC3 4JVAA 2ETEA 1U5ZA 3WG2A 4HT1T 5C8CB 4KH9A 3ILNA 4QPIC 4LO5B 3GBGA 3KGZA 1GZ9A 1MS5A 4RGAA 2QE3A 4M3CB 4FPCA 4GXLA 3RI9A 3VBRA 4Z2WA 5L36A 1MACA 4S2FA 4Q4X1 2Z42A 5CFCA 3IKWA 2UY9A 2K2SA 2WNVB 1LOCA 2HWB3 1PZ9A 1WW4A 5K0UB 1QJX1 2A73B 5KC5A 2DYCA 1TE1B 3JBG3 4OHXA 1R092 4YVSA 1ENXA 1ZYBA 4K6BA 1KRIA 3ZSEA 1V9U1 2IWGB 3WP3A 2D6OX 3B94A 5F6KA 4WM8B 4XFHA 3IDCB 3KQRA 4BA6A 5L73A 2BW8A 3VGIA 3NO8A 2GNDA 3VBSC 4LEJA 2HWC1 5CG9A 3ZPYA 4FPYA 4K1ZA 2HWF3 2W39A 2ZGRA 2GC2A 2ZJCA 1QF3A 2VW2A 2XBO3 4IV1A 4QXKA 2GALA 3C2UA 3HD8B 1X82A 3OTFA 3PVEA 3AXDA 2FMYA 2EAAA 5ABJC 5C9AB 1DGRA 3JBG2 4GB33 3LGRA 5L7OB 1NA1A 4GKYA 1XNKA 1LHOA 5GZGA 4EN6B 5CFDC 1RUC3 1SQ4A 4Y20A 4AI8A 2X5IB 1TMF1 4LHNA 4Q0UA 5CA6A 4IV3A 4AFCA 2B9UA 2BUKA 3AFGA 3TNQA 2ZGNA 4KWJA 3J4UH 3R05A 1YFWA 5BNPA 2ES3A 1QGLA 1SLTA 1NQJA 3VBSB 4COUA 4Q4W1 1Z7S2 3NV4A 5IK8A 4OULA 3D6EA 2A3WA 3K51A 2XG3A 1G9BA 1WW6A 1CPMA 3H1YA 1UD1A 2I74A 4AVVA 3RSJA 5BNNA 1MEC2 4JQRA 1LEDA 4K3UA 1YIFA 4AVAA 4FPGA 1SEFA 1VBE3 4DY5A 4AEJA 1NLRA 3EXUA 5T5PA 3FE5A 4Q4Y2 3V64A 4DPNA 2W68A 5JWPA 4UBHA 4U2AA 4L9BA 2CGOA 4Q27A 3RG0A 1ULDA 2RR13 4FTBA 5D8AA 1GQHA 4HKWA 4GWNA 4GQ7A 3A0NA 4EWAA 4KG8A 3RYKA 1KFXL 4BM8A 4IV3C 1NE4A 2ET7A 4I01A 2ZAHA 4Y26A 1DIWA 4NN0A 1JYCA 1YJKA 2PELA 4IEYA 1O3RA 3ZFEB 3TN92 1L3JA 4RQPB 4LBMA 4HANA 3SH3A 1NCQB 1PO22 1X7NA 4H3WA 2HWE3 1A8MA 1YIPA 4RFT0 4I0BA 1CD3G 4YZ2A 1YUDA 3LKJA 1KXGA 1BVVA 3GZAA 2G9GA 1CPNA 2JG8C 3GBWA 1CQ9A 4FQZA 2ZKNA 5LEKA 3AMQA 3W9AA 4WVZA 1FV3A 4Y1YA 1SCRA 3WG4A 5C4WC 4MLOA 4CP0A 5AFEA 2A6XA 4W65A 2WNUA 1AYM2 4IEVA 2Q4SA 1XNCA 1QXJA 1O3SA 3OGGA 2WSUA 1EPWA 5FAXA 1EV11 2XJSA 1LU1A 2VOXA 2X53S 4CDXA 4BLIA 2OA2A 1U0AA 5A3LA 5DUVA 1LU2A 3OCPA 4LO7A 1HX6A 2WFF3 3ZXEA 2ZABA 1W0OA 5I93A 1YXWA 4HMZA 4Q0QA 1C8M1 1Q43A 5DXDA 1O91A 2NMOA 4CDUC 3CU7A 2UWCA 2DVDA 2OUHA 4FPEA 1R091 1NYWA 1UU5A 4O9GA 3WP5A 1QJX3 3MFCA 1PIV2 2OZ6A 2ENRA 3VBFA 1D2QA 1PK6A 1R082 1ZREA 2IC1A 1RMU3 3M3OA 1POV1 1H30A 3WW1A 3PNAA 2X5IC 1Q5OA 4IEWA 1PGW2 4XW3A 3IIAA 3LA7A 3MLKA 4RA0A 3V65A 1F5FA 2D3RA 5BNNC 4AE2A 2WZR1 5JSRA 1J59A 1BBT3 1OI6A 3ATGA 2GNMA 4LT5A 4WZCA 3VZLA 5FRAA 5BNNB 3H1WA 3ZFEC 5I0SA 2JKBA 3SH5A 4CDXC 2ET1A 5LRSA 1RUG2 1S2BA 1URXA 5KHHA 3M3EA 4Q26A 2MPFA 2XH6A 3RJ2X 3J26N 1JYIA 1CGPA 5BV6A 3JU9A 1EAH3 4DINB 1JN2P 2XWBB 2IXIA 4NHKA 1OLQA 4PQ9A 1QQP2 1S0GA 1MS3A 2E7AA 3H8UA 3EBRA 1GZCA 2XB6C 1AL23 1LOFA 3E6DA 4C1XA 4IL7A 1PK6C 4QQLA 1ZRRA 4UBGA 4FPLA 4J6GA 2P37A 1W6NA 2JJ6A 3ZFFB 1ONAA 3HWJA 3DF0A 1G86A 4Y20B 5J96B 3WOGA 1EYBA 2I07B 3NJZA 1WLDA 3B69A 1NCRA 4WV8A 1MZ6A 2VOVA 4FPHA 1K5MB 2DCZA 1N1TA 1OLRA 4XF3A 3VZJA 2A6VA 3QCWA 1PVXA 3KCCA 4XHBA 3E6BA 2DCJA 3CEWA 1RUH2 5CFDB 2GSYA 4KU7A 1COV2 4DXZA 1W2UA 1OA3A 1V6IA 1LTEA 4CP2A 2V5YA 3VBUA 1QDCA 2DVAA 1J3PA 2OPKA 4IV1C 5KWRA 2WFF1 5CU1A 1TNRA 1ALYA 1XU2A 3AM2A 5FO7B 4AVSA 3OY8B 1FPN3 2XVGA 2P3KA 4AXOA 4FTEA 5H9PA 1VBA1 4Z1VA 4YW3A 3ZXFA 2YPJA 1YYNA 4N7IA 2VNRA 4U36A 1FPN2 1AR63 3PTYA 4FPFA 4XOGA 4ASMB 4YVWC 3PMSA 4ZXKA 3SH4A 1AX0A 4D7TA 4K40A 3ALQA 4AI3A 1OKQA 3HBZA 1H9WA 4DQAA 2XLAA 1TEIA 1Y7BA 2WA3A 2QDNA 4XF9A 4LO4B 4J1XA 3E5XA 4QGNA 1HW5A 1VBC3 4CDQC 1DZTA 3O0XA 4B3NA 1VB4A 3VBUC 1G7YA 3TYJA 4L8QA 1ND2A 4EN7B 1LHWA 1BVP1 5F5QA 2NPIA 4DRVA 3AMMA 4IQPA 4FSJA 1ZX5A 2BWCA 3N7LA 3OBTA 5FOBB 3OYWA 3JD72 1WD3A 4MV2A 2WFF2 3VDDB 1LOEA 3VBHB 4CEYA 1ZA4A 1KJRA 3WQ1A 4LA3A 5E16A 5J36A 1BMV2 4R52A 4N53B 4HKLA 1RHI2 4RHV1 4JDOA 3KS7A 2BFUL 4M00A 1HV0A 1QOOA 2BVBA 3WHUA 1WMFA 2BYVE 4CDWB 1QY4A 2RE9A 4XXAA 2P34A 1Q8QA 1ZBE1 4JRAA 4AHWA 4BMBA 3MZHA 1YRZA 3G6JB 4KL1A 5CNAA 1FOD1 3HAGA 1H8VA 3N7KA 4F8AA 3ZXAC 1UU6A 3CO2A 3N35A 3WDVA 4AHXA 1V6NA 2ILMA 3ZN6B 4B4RA 4ONUA 2ARBA 1BBT2 1CAWB 4EN9B 3KSCA 3TN93 3MI8A 3WV6A 3D0SA 2JE7A 2WIIB 1LR5A 4XJAA 4YG6A 2MHFA 1CAUA 1RUJ2 4RD7A 5J09A 5SV8A 3S7EA 4QMAA 2ZGSA 3FLTA 4QGMA 5DUUA 1UF2C 2ZGMA 2NMNA 4JGYC 3ETQA 1UPSA 2XWJB 1MEC1 3WW4A 2D3SA 2F4PA 3WVJA 5C8CA 2QQPA 2Z2SB 4FQ4A 4YYOA 2VPVA 4N43B 2B7YA 4AI0A 2ZGQA 1V00A 4H7MA 4H7LA 4LO8A 5FMOS 4AFBA 1AJKA 4BH9A 2WT1A 5ABJB 3HR9A 4Z8BA 2R0FA 1I1EA 1ENRA 3MPPG 4RQPC 2H0BA 5B2GB 1NXD1 5DZGA 4WZFA 1TQ5A 4M0NA 1W6MB 5T54A 4YSFA 1B35A 2JG9A 3WQ0A 1Q8VA 1H1AA 1Q56A 2IXJA 3AFKA 1REDA 2DF7A 2ZX1A 1H1IA 1CVNA 1LCLA 3OYWB 1QQP1 2GC1A 3ZYRA 3AP9A 3D8CA 4ES8A 1NXMA 2R042 4P14A 3WW2A 4BMEA 2D7FA 3V0AA 2VQ0A 4G3YC 4FPJA 5JSOA 5T5JA 4B7EA 2HWC2 4GMP1 5DDJ1 3O0VA 3LAGA 3SHRA 1H4HA 3INAA 4HBNA 3H0OA 5EWSA 2R1BA 3FC0A 3AYCA 2RM23 1QNWA 1RMU2 2UWBA 3MLJA 1AYM1 3T1MA 2PN5A 1MS1A 1LOFC 5JOYA 4XBLA 3CL1A 2P17A 4OFGA 5FMOL 4JC1A 4EROA 2ZMLA 2VW0A 2JG9C 4F7ZA 5BYNA 1VJ2A 4Q4V2 1Q8SA 2ZX3A 1GZWB 1T6GC 2H0VA 4N43A 3D82A 2IXKA 1MEC3 1IZ3A 4MGZE 1S0BA 3T1LA 1YNAA 3OY8A 2YGMA 2DTWA 1CONA 3M1HA 3ZN4A 4XQDA 2NYYA 4NHLA 5A32A 4GULA 5GJ6A 1QJU3 1SLAA 1ZZ8A 4K8FA 1GBGA 1X8EA 4HZFA 2ZKLA 2R063 2K9ZA 4CP1A 4OHVA 3J8F3 2XHKA 3VHRA 4X6RB 3SCHA 4Q8KA 2FQPA 2PHRA 2WLPA 4HVQA 3I2DA 4GALA 1VBB1 3MIFA 4OHYA 4AFAA 5JLVA 5FBZA 3MGUA 4Q4W3 3GHNA 1A8DA 4YFZA 2RJKA 4QQHA 4WVVA 1OA2A 2HEYF 4XMIA 1RJ7A 4DZGA 1UN1A 1OD5A 1D0HA 2DVFA 5J98B 4L92A 3D5OA 1X8MA 1QHDA 2Z79A 2RS53 3AYDA 4P9YA 3E97A 4OI4A 3WDYA 4PLNA 3UKTA 1DLLA 4PBPA 3IM0A 5CIRA 3D0JA 4YGBA 3IT8A 3BPZA 2PAKA 4Q2FA 4RHV2 1VAMA 1VBD3 3A0KA 4HVOA 5L7OA 3B5LB 1D0GA 2LM3A 4CDQA 4OLLA 2WS93 1PZ8A 4IV1B 5BNPC 2RJLA 2DUQA 1R1A3 1TMF2 4XJUA 3NV1A 4M3CF 5A33B 2C5DA 3ZXGA 3I59B 4CDQB 1NCQA 3FLRA 3GALA 5GZCA 2WNEA 3RPQA 2JECA 4KWLA 1EY2A 4Q29A 1KDKA 2ZGKA 1RUE2 1VBB2 2C0ZA 4XMAA 3WG1A 2A3YA 4JGZB 5HXVA 4IEQA 5JIUA 4IEUA 5J37A 2WFPA 4R9CA 4NO4A 1LHUA 3S6PA 5I91A 1Q8PA 5D8AB 3FUOA 3U10A 1PO21 4QQOA 4R4XA 4R9AA 4K7JA 1AX2A 3GYDA 1DBNA 2JX9A 3WCSA 4SBVA 4LTAA 3ZXJA 5KXBA 2O0OA 1KS4A 3ZXLA 3ZIXA 4YM2A 1O4TA 1H2KA 4YARA 1ND3A 5AVPA 3MF6A 1QJX2 1KFUL 1CESA 1LRHA 4A7YA 1AR71 3UL2A 4LO6B 3JD73 5DZEA 5IT6A 4LBOA 5I0RA 1RUE1 2HWD1 2Z69A 4Y1ZA 1XXNA 3BALA 2Q8OA 5GALA 1N3OA 1OA4A 2RHPA 2XUMA 3P3PA 4Q4Y1 3WQ7A 2Q30A 4AF9A 4E2GA 1QWRA 4QQPA 1F8VA 3IPVB 4OHWA 3IWZA 5H9QA 2PHUA 4RR3B 5JAXA 4JGYA 1LB2A 1QJY2 2WQZC 1EV13 1C57A 1S55A 5F6LB 4XF0A 4B4QA 4HK8A 1RITA 4XZPA 1OMIA