3ZYQA

Crystal structure of the tandem vhs and fyve domains of hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) at 1.48 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
216
structure length
216
Chain Sequence
GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) at 1.48 A Resolution
rcsb
source organism Homo sapiens
molecule tags Signaling
molecule keywords HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
total genus 73
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zyqA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zyqA02
2YHOA 3ZNIA 1RMDA 3RPGC 3ZPV1 4PTBA 5KH9A 2IDAA 4HFGA 2YHNA 4BBQA 2KM4A 4WA6A 3C6WA 2YT5A 3EB6A 3PUQA 5AIUA 2LXHC 3O33A 2KGGA 1MM3A 3O36A 2XEUA 4LLBA 4S3OC 2VPGA 2KWJA 2VJEB 4FO9A 2D8SA 2LGVA 5TDRA 2MOWA 4LKAA 1E4UA 1EDUA 2CT2A 4R2YA 3LQIA 1WEEA 1X4UA 3LDZA 5FB1A 5JG6A 1WGMA 2VPBA 5H1TA 1XGWA 5B77A 5FB0A 2VP7A 3T6RA 3O7AA 1CHCA 5D1LB 1Z2QA 3GV4A 3N9NA 5C11A 2QICA 3N9QA 3G2VA 4WZ2A 2JMJA 4I7BA 4L7XA 2VJFB 2L43A 3MHSA 2UZGA 2JRJA 2LGGA 4Q6FA 4V3KC 1ZBDB 5AITA 5CMWA 4Q94A 2PUYA 1WESA 1JPLA 4R7EA 2E6SA 2MD8C 5C13A 4S3OB 4FK5A 1WEMA 1WEOA 3ZYLA 1LF8A 1JWGA 3N9LA 1WILA 3N9OA 1G25A 3KV5A 4BHWA 2PNXA 1U6GB 3HCSA 2ECVA 4WZ0A 2CKLB 4TKPB 3O35A 3RRUA 1WEUA 3ZTGA 5G0FA 3KNVA 4W4UA 3ZYKA 5KH3A 1BORA 4CA1A 5G04B 3T7LA 5LOZA 1VYXA 4GNGA 3LRQA 4GNDA 4WZ3B 5TDWA 4FJCA 2YQMA 5EYAF 4UP0A 3ZYQA 2LV9A 4I7DA 2E6RA 4QF2A 4ZQLA 4PPEA 2YQLA 1WEQA 2CSZA 2K17A 3EB5A 4FIPA 3U5PA 5J3XA 2OXQC 3ONLA 3G2UA 5G05B 3SOXA 1HYJA 3KQIA 3D9LA 1X5BA 1VD4A 1LDJB 2G45A 2MIQA 5H1UA 3HCUA 2XB1A 4YBSA 2F42A 4Q96A 4F52B 3G2TA 3U5MA 1WFKA 3G2WA 4A49A 2KYUA 3O37A 5TBNA 2MA6A 2EODA 2F6JA 2AN6A 3SOUA 3D9KA 1XWHA 1Z60A 3N9MA 2H0DA 5DKAA 1X4IA 1LDKC 2ECTA 4I7CA 4LJNA 2V8SE 2CKLA 3CLJA 2KR4A 3O34A 3RTRB 3HTKC 1Z6UA 3VK6A 4NN2A 2ECIA 2JMIA 3U5OA 2LXPC 1WEPA 2QY7A 4AUQB 5B79A 5LCWB 4MVTA 4GB0A 4YABA 2M6MA 3U5NA 5B78A 2LDRA 2C2LA 3NG2A 3ZVZB 3M63A 2JMDA 1VFYA 4AYCB 2CSYA 1N87A 2LGLA 3G2SA 3LQHA 1HF8A 4N3WA 1EYHA 1FBVA 4V3LC 4GNFA 4GZDA 3L1ZB 3ASLA 3SHBA 3D9OA 1DVPA 4C9ZA 5B75A 4YBMA 3C5KA 1ELKA 1SZ9A 2VNFA 5FERA 2EA6A 1HFAA 5LKUA 3D9JA 1JWFA 2F6NA 2QIZA 3QZVA 5LKZA 5LKTA 2ECJA 2QJ0A 3SOWA 4B7YC 2Y43A 4R8PK 1K2FA 2BAYA 1JM7B 1HYIA 1JUQA 1WEVA 3DPLR 3MHHA 2DCPA 2KFTA 4A4BA 2M3HA 4X3GA 2MNYA 4ZDTA 2L0IA 2DIWA 1V87A 4L58A 4JXTA 1FP0A 3LQJA 2HDPA 4UI9B 4FLBA 3PHDA 3KV6A 4LADB 2L5UA 4NACA 2RI7A 2ECNA 5D1MB 1T1HA 3L11A 2EGPA 1PY1A 2G43A 2LRIC 3HCTA 2FUIA 2K16A 2KU3A 2L0TB 2VJFA 4YBTA 2BF0X 2MT5A 1UJKA 2L0BA 5H9MA 1IYMA 5KH7A 2VPDA 1H0AA 3V43A 2RSDA 5FEYA 1MM2A 2I50A 3ZVYA 2M85A 3M62A 4GNEA 2MNZA 4UP5A 2YUCA 3D9PA 2K1JA 3ZYMA 2L75A 3ZPVE 2FUUA 5D1KB 2HYED 4AYCA 2MUMA 2KWKA 2KWOA 5B8DA 2Y1NA 2Y1MA 3M99A 2M1RA 5LKXA 4IC3A 2YURA 4LK9A 3ONKA 3O70A 2K4DA 4FU3A 2YSJA 2ECWA 5TABA 1JM7A 1VDYA 2ECGA 5H1VA 2LN0A 2DX8A 2FSAA 2MA5A 5TRBA 3D9NA 1X4JA 2YW8A 4ZUXU 1WE9A 1WEWA 3I2DA 3PURA 5B76A 2ZETC 2KIZA 2YSMA 5I3LA 2L80A 4B86C 3DQVR 2H0DB 4CCGX 2YYRA 4GZCA 3L1XA 4IC2A 2YU4A 3N9PA 3FL2A 4YATA 4YADA 1HG2A 3IHPA 1HX8A 4MSXA 4A4CA 2KE1A 2LQ6A 2KREA 1JOCA 1UJJA 4N4FA 1INZA 2C2VS 2VJEA 1HG5A 4YAXA 2KGIA 2LGKA 3D9MA 2G6QA 4YC9A 4QF3A 1F62A 4AVXA 5CMYA 5J08A 3RPGB 3D9IA 4A0CD 5DINA 2MD7B 4P5OB 2LO6A 2YREA 3GL6A 4AP4A 4O64A 5LP0A 4XI1A 2KWNA 1MHQA 1WIMA 1SZAA 2VPEA 1WENA 2NAAA
chains in the Genus database with same CATH superfamily
3DXKG 2YHOA 3ESKA 3AS5A 3QK0A 5AQ9A 2XQ0A 2WQ6A 4LERA 5G55A 3JQ1A 1FVFA 5FT9A 4EZLA 1H6PA 1Y6IA 2YT5A 1OXJA 5CHEE 3FUJA 1U2VG 3LS8A 1ELWA 1WY6A 4CDNA 4YDYA 2RFAA 2XEUA 2WB2A 1NI1A 3EJNA 3CHPA 4S3OC 4HOUA 4GTRA 4IRUA 1OWMA 3GZ2A 2VJEB 4D10C 3UXGA 2CRRA 2XEHA 3ESLA 4A1GA 1EDUA 4URKA 4XX5A 4UQXA 4HNAD 3LXUX 3LDZA 5FB1A 3HDXA 1WG0A 4XI0A 5FJYA 5G04C 5FB0A 2VP7A 4UQZA 2GRQB 4GYOA 1N11A 1BD8A 1CHCA 3Q7AA 3N9NA 2QICA 3E34A 2JM3A 3G2VA 1FT2A 2JMJA 4I7BA 4A3VA 3QAQA 5KWDA 4CYMD 2L43A 3VTYA 5EN5D 3EIQC 1FCHA 3R7RA 5AJLA 1HZ4A 2OVBA 5AITA 3TWUA 5CMWA 1G3NB 2EQXA 3Q49B 3MJWA 3URZA 2E6SA 4UUCA 2XPZA 5AQBA 3EDTB 4XKBA 5CEDB 5ENOD 3CHMA 3TGOA 2A5UA 1TNUA 4FJYA 1WEOA 1Z3XA 1ZU2A 2XZDG 3FH8A 3UT8A 3ZYLA 3MEKA 1JWGA 2WXOA 3N9LA 1TNOA 4HI8A 4EPZA 3SNXA 3HXDA 3MDBC 3PREA 4KBQA 1NA3A 4U04A 1WEUA 3ZYKA 4MRUA 4GA0A 4CA1A 1IQRA 2CHXA 3BQOA 3GZSA 2R59A 3PE3A 3LRQA 2F37A 4WZ3B 5B1AE 2AXUA 5EYAF 3NQPA 2XZTG 4TUUA 2J08A 4EZJA 4PPEA 4BETA 2WXIA 3EB5A 5FQ7A 1NZNA 2AXVA 4DK5A 2RR4A 1N4SA 5FIOA 3LVQE 3FM8C 3U5PA 3LKUA 2ONDA 4Q69A 3ONLA 5BPPA 4H7YA 4JA7A 1OWOA 4H9DA 2PQRA 2BEDA 1S64A 4BTAA 5T4YA 4A55A 3FDHA 4JHJA 5BXOA 5H1UA 3HCUA 1D9SA 5HS0A 4GCOA 4Q96A 4Z68A 3NF1A 2EIJE 4J8EA 4L2YA 2DZNA 2Q7FA 1QBQA 2KYUA 5TBNA 2P9LG 2ILRA 3QKYA 4BT8A 2AN6A 3ZUVB 2GRLA 2Y1LE 3N9MA 4L2LA 1LDKC 4U63A 2QFCA 3DPYA 2CHZA 2XENA 1OCZE 4CT4A 4KZCA 2ZGGA 4FA6A 2QYJA 2WXLA 2HO1A 2ECIA 2JMIA 3U5OA 2WXGA 2QYUA 1WEPA 5ITZF 2QY7A 4HBDA 2GRMA 3E4BA 4AUQB 3ZPJA 4NURA 5SVYA 4DRXE 3PNTB 2VGYA 3AU4A 4GTPA 3CIAA 3LEWA 2GRRB 4F1SA 2R5SA 4I6JA 1S0PA 3QARA 2P57A 4N3WA 4BSZB 3FTSA 4GZDA 4KVOA 3QJZA 1D8DA 1H2UA 3D9OA 2KKYA 3OTNA 4I9CA 3CVVA 5A7DB 4B8CB 3Q75A 5FERA 5FQ4A 2XHEA 4OYSA 1WM5A 3QDNA 5LKZA 3U9WA 2QJ0A 4GZ3A 3JUEA 4C9BB 3PNLB 4R8PK 1HYIA 1WEVA 1E7UA 3DPLR 2PZIA 3MHHA 3FP3A 4HOQA 3C3OA 4FLHA 4JXTA 3LQJA 3FHEA 3AG4E 2JABA 4GMRA 4JW1A 4JB8P 1AP7A 4FHJA 4TXPA 3GYZA 1OY3D 4HI9A 1PY1A 2G43A 2X6FA 3ISMC 2K16A 2KU3A 3R7QA 3NZSA 1YYHA 4A63B 2MT5A 5KH7A 2VPDA 3FH7A 3GZ1A 3APCA 3V43A 4I9EA 5ANLA 4N3BA 2RSDA 3LY8A 3ASDA 5ENSD 5FEYA 1MX2A 5CCLA 2YUCA 2K1JA 2L75A 4ANUA 4PS3A 3AU5A 1N9AA 5FTPA 1E8YA 5A6CA 5CBOA 2KWOA 4XIFA 4ATGA 2Y1MA 4B89A 4TXQA 2IF4A 4IC3A 1DCQA 3O70A 1QZ2A 3UPVA 2KBXA 5HQ8A 4N3AA 4J0UA 4J6IA 2MYOA 5FZQA 1Y8MA 2FSAA 3L6AA 3P2BA 3KAEA 4TV3A 4U0UA 3I2DA 4GMLA 3PRZA 4EBAA 3ULQA 4RQIA 4HQDA 4WWNA 3DSUA 4UI9J 2L80A 4B86C 3DQVR 3TWTA 4C48B 5EILA 2X6JA 2YYRA 4JPSA 2YHEA 1OUVA 3GW4A 4IC2A 3F6QA 2FO7A 3EHMA 2PNNA 3DRAA 3E30A 1HX8A 4PH4B 5BT1A 2XOZA 4L23A 4N4FA 4AOFA 3MA5A 5KJKA 1TNBA 4L7TA 2C2VS 2VJEA 1HG5A 2VGEA 2LGKA 3FU3A 3O4ZA 2UWJG 2DSMA 1F62A 1YCSB 5CMYA 5J08A 3RPGB 2XRYA 4CEMA 2IO3C 4A0CD 5ENQD 2XPYA 4L9PA 1BU9A 4GTTA 2IEJA 5LX8A 4IYPA 4XI1A 1MHQA 3CSTA 4DX1A 1SZAA 1WENA 2HYZA 4G11A 3APDA 3C3RA 4J8DA 3SHFA 3ZNIA 2XEVA 1DCEA 3SFYA 3MCXA 4NQ0A 1H2TC 3ASOE 5FWQA 3SO8A 2R02A 4BBQA 2LAHA 3MKRA 1MQSA 3WXXA 3C6WA 2DYSE 3FUEA 5AIUA 3LY7A 4X8QA 3PEUB 2GRNB 2L9BA 3O48A 4EECA 4LLBA 2VPGA 3T8KA 2F0YA 2AWIA 5B3SE 4HOSA 2D8SA 2LGVA 2D8UA 4OGCA 3FTZA 3B95A 4R2YA 1A5EA 3QNKA 3CR3A 3OXGA 1KLXA 1WEEA 1X4UA 5JG6A 3RO2A 1E90A 1TN8A 3QOUA 4CZ2D 4TXRA 2VPBA 5H1TA 1XGWA 2LAIA 5ENPD 1HO8A 3B7RL 3IKOB 2X38A 1HE8A 3LVRE 2F8XK 5CCMA 4N5CA 3VTXA 4BY6A 3O7AA 2GRPB 3FUIA 4IN3B 2RG8A 4KXKB 4DX7D 2CHWA 4MKTA 2CFUA 3FFLA 3ZNGA 3ZXSA 3MHSA 4TRQA 4QFVA 3ZKJA 4BTBA 3FTVA 3UIOC 4GZ5A 2CG3A 2XGSA 5KBAA 2DVWA 3NAWA 2PUYA 2VSYA 4JC8A 4DI4A 2CONA 3Q5MA 3ABKE 3LY9A 2J9QA 1LF8A 4MBGA 5KCMA 5EIBE 5SVIA 2CKLB 3UINC 2A5EA 3CKCA 3O35A 3EU9A 3ZN3A 4XI9A 4DX2A 3ZTGA 4W4UA 1RZ4A 3IHVA 5KH3A 4U7EB 1N94A 5G04B 3KD7A 3ASNE 3BUAA 1VYXA 1SVXA 5CRVA 4LNUD 4FJCA 3DSXA 4HORA 2YQMA 4I7DA 2QC9A 4FP7A 3SFZA 2CRWA 4QF2A 4WAFA 1WEQA 4YDWA 2CSZA 3CK9A 4U0ZA 4N2QA 3DBSA 1OCCE 3CQCB 2NC9A 5BV0A 3HXEA 2YINA 2ETBA 3APFA 4PUCA 3MYVA 3UT4A 5G05B 5HRYA 3Q79A 1VD4A 4FULA 2G45A 2J4BA 3B7SA 1FPPA 3KS2A 4YBSA 1KT1A 1TJFA 4PDXA 5IY5E 1LD8A 3OXFA 1WFKA 3G2WA 2J09A 5A23A 3O37A 2BTDA 3FUFA 5KJMA 4LSZE 2KCKA 5T8IA 4BEPA 2XP0A 5CEAA 2H0DA 4Z0RA 4GAAA 5CECB 3ASHA 3DDTA 3UI2A 2YQ8A 1N52A 4UI9C 5ENRD 1KZPA 4LJNA 4A1SA 1HXIA 2V8SE 5BW8C 5C1DA 2E2EA 2YHCA 4I1OB 3CLJA 1V54E 4EBAG 3TWSA 3QWPA 3HTKC 4JEHA 2IY0C 2KXPC 4U07A 1HS6A 2L6BA 4O6FA 1N0RA 4MVTA 4GB0A 4JA9A 3TWRA 4YABA 2WXFA 2WXHA 3L22A 2R17C 2M6MA 4CCAA 5B78A 2UY1A 3HIZA 4DUIA 3V31A 3UTMA 2P9UG 3FWVA 2LGLA 1MZCA 4J7WA 3LQHA 1HF8A 1EYHA 2AW6A 3VLDA 2P9NG 3ASLA 3VLEA 3TJPA 4MLPA 3ENEA 2B6CA 4C9ZA 3NOGD 5SVXA 5B75A 4YBMA 3C5KA 1SZ9A 2V4LA 4I1MA 2VNFA 2ETCA 2EXUA 4UI9K 3ZW3A 4O60A 3D9JA 4APOA 4AY6A 3QZVA 2LNIA 5LKTA 4N3CA 2ECJA 3SOWA 4GPMA 1O1RA 4JHKA 1K2FA 3QWVA 4GA1A 4BT9A 3CVWA 4A3TA 2M3HA 4X3GA 1U3DA 2MNYA 2L0IA 2DIWA 5JHBA 4L58A 3U66A 4OVVA 2LUHA 2R2LA 1T1HA 4ILGA 3L11A 2EGPA 1H6KA 3DSWA 5LCWC 2HE0A 3UM1A 1MBMA 3HCTA 3UIPC 2FUIA 4RG6A 2L0TB 4RSYA 3TXNA 3ML8A 1IHGA 4WNEA 2VQ2A 3L9TA 5KNHD 3PZ3A 1NA0A 1NL4A 3E37A 1TJCA 3CK8A 4CDRA 3ZXPA 1MM2A 2I50A 5JJTA 5EIDA 3ZYMA 5E75A 2KATA 4AYCA 4EZKA 2KWKA 1IKND 2LXMA 4AJWA 3FUMA 3CGHA 4TUMA 4IULA 4LK9A 3ONKA 5J90A 2ZXWE 2J07A 4J8SA 3IXEA 1JCRA 1JM7A 2VJ8A 5H1VA 4CGVA 4JD2G 1KZOA 3SZ7A 3D9NA 4XE0A 4GTSA 5I3LA 2V5FA 2OEWA 4C0EA 3DEPA 3Q15A 5AARA 3CVUA 3S7BA 5CERB 4UWHA 4FHKA 2OVFA 3EHQA 3ZHEA 3N9PA 3T9KA 5ENNA 4YADA 4MSXA 4A4CA 2KE1A 2LQ6A 2QZAA 3ZRHA 1JOCA 2X6HA 3D9MA 1FT1A 4YC9A 4B0ZA 2KZTB 1K8KG 5DINA 4LNBA 4BESA 1W3BA 2LO6A 4O64A 2EINE 5LP0A 1LD7A 4F7AA 4F3VA 2NAAA 3PZ2A 4DLOA 3AS8A 4JVSA 4UQYA 3PS6A 3ZPV1 4PTBA 5KH9A 2IDAA 5EKQD 4HFGA 4I43A 4WA6A 2ETAA 4JL0A 3MGBA 5C2YA 2EGMA 3EB6A 4J8YA 1MM3A 3KSLA 2I1KA 1H19A 2X6KA 1V55E 2FFWA 2DBAA 4UWFA 2KWJA 4UWLA 3LYAA 4B93B 4FO9A 3MZLB 2WQHA 2V5QC 5TDRA 4K0RA 3CVPA 4LKAA 2CT2A 3LQIA 3ZEFA 5AAOA 4RLYA 3Q4AB 4ME2A 1RW2A 2DJAA 1WGMA 3PLWA 1TNYA 4XZ4A 2KC7A 3PZDA 1SW6A 3DPDA 2AVPA 1JCQA 3CHRA 2EIME 3CVYA 3SD5A 5C11A 4WNFA 3UKRG 4E6HA 4KZ0A 3Q78A 2VJFB 3W9FA 4DX5D 2I2OA 2RFMA 4EQFA 2JRJA 2JLBA 3RAUA 2PM6A 3LJUX 2LGGA 4V3KC 2LAUA 1TN7A 5EYPF 4O1OA 1MX4A 3OAWA 4WNGA 1JPLA 1OWNA 1Z6TA 4DI3A 4G8KA 3AG3E 2MD8C 1OCRE 4G2VA 4GTOA 5C13A 2J8SD 1B89A 1Z5SC 5ARFA 4B8AA 1O5MA 5ANRA 4AM9A 1WILA 3N9OA 1G25A 3EIJA 3SBTB 4BHWA 3IHYA 3HHMA 3FUHA 1U6GB 3HCSA 2VGXB 3QWWA 4UWGA 3TG4A 4R7LA 4Y6WA 3CQGB 4HRLA 3RRUA 3EHRA 4U95D 1N4QA 4ZFHA 3PEVB 2BUGA 3FUKA 3KNVA 1E96B 2ZU6B 4GZ6A 3NBNB 1NFIE 4ABNA 5LOZA 5HKPA 2WQ7A 3S7DA 4OVUA 5AIJA 5TDWA 3OXLA 3FUNA 2LV9A 4FC8A 2X3MA 3BEEA 1QQEA 3SFXA 2H6HA 2IQCA 1KT0A 4HVBA 2E6RA 4LEUA 2YQLA 3TAXA 4FJZA 3FAOA 3HG0D 1ZBPA 4I2ZA 3SBSA 2AJAA 2FEZA 3W9GA 4GTMA 4V3IA 3E33A 4L1BA 4XKCA 5J3XA 2F8YA 3R9AB 3AG2E 5DIZA 4C0MA 1MYOA 4AV7A 1HYJA 3DSVA 3DSTA 3BU8A 2JUNA 1LTXA 1PAQA 4F6RD 1K1BA 2UY1B 4QQ4A 1E8ZA 3MKQB 4W9RA 1K3ZD 2F42A 3BG1B 4GMJA 3TWVA 1X81A 4I2WA 3U5MA 3HYMB 5BV1A 2WXRA 4K03A 2DWZA 4DJAA 3SOUA 1XWHA 3HVEB 3JQ0A 5BUZA 2XCBA 2ECTA 4AY5A 4WWOA 4EHMA 3H7HA 2PQNA 2KR4A 2P58C 4H7XA 3RU0A 1O1TA 2H6GA 2R05A 4NN2A 2EIKE 4G24A 2CFZA 5LCWB 3KSQA 3RO3A 3ZFWA 3U5NA 2NXPA 2LDRA 2C2LA 5EX0A 2C0MA 3L17A 3NG2A 3ZVZB 3AAAC 4YVQC 2JMDA 4F53A 1VFYA 2VSOE 2DYRE 3G2SA 5FZSA 2P9PG 3FTXA 5CRUA 4P29A 1FBVA 4V3LC 4GNFA 3UQ3A 3L13A 3SHBA 2RKKA 3KEZA 5T3RA 3NOCD 4GPKA 1DVPA 2MRIA 1ELKA 2FD4A 2L7PA 1HU3A 5FINA 1UN9A 4KVMA 2EA6A 3UT7A 3FTUA 2XOCA 2LSVA 4PS8A 1HFAA 5LKUA 2F6NA 4N2SA 1YMPA 2XGOA 4B7YC 3SI5A 2Y43A 5LCWJ 3MV3B 3DWDA 4BSXA 4ANWA 2KKXA 3I4RB 1JM7B 1U3CA 1H6OA 3CVLA 2DCPA 2CG2A 1Z3YA 2PL2A 1P5QA 4ZDTA 2XEEA 2M13A 1FP0A 3V2XA 3SGHA 1IYGA 4UWKA 4UI9B 3Q7FA 3UX4A 5AN8A 3KV6A 3Q1DA 4LADB 2L5UA 1SA5A 3JCKC 4PS7A 4NACA 1FVHA 2WXJA 4KT6B 3Q9NC 3L08A 2H6IA 2WXPA 3CK7A 3PVLA 2WPVA 3NB2A 2BF0X 3FEYA 4YBTA 3ZGQA 3IEGA 4BX8A 5H9MA 1BI8B 4G26A 1YA0A 3RRNB 2HR2A 1N54A 2IONA 2WXQA 4ANXA 1MJ0A 3VLFA 2MNZA 3M62A 4GNEA 1ELRA 2KZTA 3D9PA 3ZPVE 4OAUC 4G1TA 5AQAA 4DLQA 3EUVA 4KMOA 4LG6A 3B7UX 3IBEA 3EU5A 4YDEA 3M99A 5BXUA 2YVRA 2VSXE 2IJGX 4APFA 1O1SA 4NIKA 2IQJA 3B7BA 4FU3A 5JA4D 1SA4A 2YSJA 2IOSA 2I1JA 4O1PA 1VDYA 3ABME 2ZGDA 3RRMB 2KCLA 5KNGA 5TRBA 3WG7E 1X4JA 4ZUXU 2FF4A 1WEWA 2OWAA 3PURA 1OT8A 5B76A 2YSMA 2HM8A 5JHAA 1E7VA 2WVIA 1N95A 5SVIB 4YNDA 3E2DA 4CCGX 2VSNA 4GZCA 3L1XA 2YU4A 2XCCA 4HB5A 1HG2A 3AG1E 3S7JA 3UUXA 1EPUA 4HS2A 3ABLE 3X2QE 3PH0C 3R9MA 4YAXA 4HRMB 2KGIA 4QF3A 4AVXA 1N0QA 3TWQA 3D9IA 5JMND 2OV8A 3FTYA 4P5OB 3SUBA 3EHNA 3GL6A 2OEVA 1OWPA 3JXIA 2J49A 2KWNA 1MX6A 1TN6A 4WNDA 5CBNA 1IHBA 3TG5A 4HLEA 2HDPA 4GTVA 5E76A 3KDEC 3UM3A 2J4DA 2LSUA 1RMDA 5D0QD 3HRAA 2M63A 3RPGC 2EILE 3T5VA 3ZVVA 2YHNA 2AXZA 2KM4A 3I5PA 4DPRA 3SQVA 3LDYA 2VYIA 3LPZA 3LJ3A 4GCNA 3CHOA 3PUQA 4LUNU 2LXHC 3TWXA 4JZYA 2KGGA 3O33A 3O36A 1JCSA 4RVBA 3LJNA 3I3NA 2WXNA 3C3QA 3ML9A 4K5CA 1QNFA 2MOWA 1E4UA 3O47A 1TEZA 5KJLA 3HXCA 3Q9UC 4BX9A 3B13A 2VGXA 3S7FA 4N5QA 2WM9A 3SF4A 3PE4A 1SQMA 3CVQA 1UN8A 5B77A 3D3MA 4N39A 2WMOA 4I6EA 2DZOA 3T6RA 5B1BE 4I6GA 1KPSB 1IQUA 1GW6A 2H6FA 1UW4B 5D1LB 2VTBA 1Z2QA 3GV4A 3N9QA 3UKUG 3ASFA 5D0OD 2XPIA 3U64A 2FI7A 3DWLG 4WZ2A 4L7XA 5M72A 3JYSA 3C5RA 5BNWA 2UZGA 5DBKA 4GA2A 4Q6FA 2XGMA 3P1UA 3FTWA 2P9SG 3L16A 3Q73A 1ZBDB 1L5JA 3JUIA 2WMNA 4Q94A 2IO2C 1WESA 1HH8A 2C0LA 4R7EA 3CEQA 3CHSA 5KJNA 4S3OB 3LCAA 4U8YD 4G25A 4FK5A 1Q2ZA 5FZRA 3J5QB 1WEMA 2B0OE 3MKQA 1WAO1 3KV5A 3AS4A 2V0PA 3Q47B 2CSVA 2PNXA 5HI7A 3T8MA 2GROB 2ECVA 4WZ0A 4ATZD 4TKPB 1BLXB 3UM0A 2FULA 2R03A 3CKBA 2XS8A 4KYOB 5G0FA 3C98A 3FEHA 3HVEA 1BORA 3UMVA 3T7LA 2BKKB 4B94A 2NSZA 3MX3A 3M7KA 4ILIA 4GNGA 3FY4A 3DSSA 4LRZA 2E61A 5G05J 4GNDA 2Y4TA 5G2NA 2Y4UA 4OGEA 5EDSA 4UP0A 4K5BA 2MKEA 2GGFA 3ZYQA 3HXFA 1XNFA 1K1AA 3L54A 3RKVA 1UOHA 4K5AB 5G05C 3SY2A 3KEAA 4ZQLA 2K17A 2V4HC 4FIPA 5H7PA 3DEOA 2BKGA 4NRHB 4WUYA 2WXMA 3RJVA 2ZISA 3TL5A 4ACLA 2OXQC 4F1PA 1OWLA 4GTQA 3G2UA 4U0SA 3SOXA 4I17A 3ULEG 3KQIA 3U3WA 3D9LA 2XS1A 4AEZC 1X5BA 3V79K 1LDJB 2MIQA 3MV2B 1PC2A 2XB1A 4F52B 5D2MC 4J8FA 1E8XA 3G2TA 2OOEA 2I6HA 2I9CA 4A49A 4I1AA 2MA6A 2EODA 2F6JA 3FU6A 3CVNA 3JXJA 2NYJA 5LFAA 3D9KA 1Z60A 1E8WA 4RG9A 3S2AA 5DKAA 2KCVA 4M7CA 1X4IA 1AWCB 4WWPA 4GU5A 4FADA 4I7CA 2CKLA 4GB9A 2PM7A 4BERA 3O34A 3RTRB 2A4ZA 3B7TA 3FU5A 1Z6UA 3VK6A 3D9HA 3CV0A 2LXPC 3FEXA 1D8EA 3ZU7B 5B79A 4DX6D 4AP2A 3ZIMA 4AIFA 3U4TA 2IU1A 1EF1C 3NZUA 3M63A 4AYCB 2FBNA 5G04J 3FULA 2CSYA 1N87A 3FANA 5ARGA 1N4RA 5AENA 3FUDA 1QYMA 3ASGA 2XRZA 1TNZA 3L1ZB 5D66A 2IOLA 4LNGA 2L6JA 4ILHB 4CRWA 3AJIA 2XOYA 3J5PA 3HXBA 4JEUA 2P9KG 2Y3AA 1JWFA 2QIZA 3RK6A 5EX3A 5FQ6A 3QC1A 2E0IA 2MHKA 2BAYA 4OAVB 1TYQG 1JUQA 4ZHBA 2KFTA 1N4PA 4A4BA 4HLLA 1V87A 4Y6CA 4O62A 3ZHEB 4HOTA 3V30A 4E85A 3CVXA 4CT0A 4FLBA 3PHDA 1UG3A 4U8VD 3E32A 1BPOA 2RI7A 4Z0OA 2ECNA 5D1MB 4BWRA 4HXIA 5K3QA 2LXLA 2LRIC 1OCOE 3CHQA 2VJFA 1UJKA 2ZIRA 2L0BA 1TR4A 3TXMA 3FU0A 3TWWA 1IYMA 4ANVA 1H0AA 3V2OA 3ULYA 1IXVA 3PZ4A 4GYYA 5FQ8A 3ZVYA 2M85A 1S70B 4G23A 3UM2A 4UP5A 1A17A 4YDOA 3T5XA 4MS6A 4QQIA 2FUUA 5D1KB 1S63A 4JHRA 2HYED 3FH5A 2YNQA 2MUMA 2OCCE 5B8DA 4XEIG 2Y1NA 3L82A 2M1RA 1WDYA 2GW1A 2FO1E 5LKXA 1NP7A 3PUKA 2YURA 2IFUA 2K4DA 3RIBA 4ACKA 5AYWD 2X6IA 2ECWA 5TABA 2RD0A 3I4GA 2ECGA 2LN0A 2DX8A 4CDMA 3CSFA 2MA5A 5ENTD 3PDNA 3PZ1A 2Y69E 2YW8A 1WE9A 3K9IA 5JJ6A 4GYWA 2ZETC 2KIZA 3N71A 1BI7B 3QB2A 1DC2A 2H0DB 4AXHA 5EYLA 4CGWA 1ZB1A 3FL2A 2JEKA 4G8LA 4YATA 4U8HA 3IHPA 3PUJA 4HRNA 1DNPA 2P9IG 2KREA 1UJJA 3RSEG 1H2VC 1INZA 2G6QA 2Y0BG 4YVOA 3FJUB 3C72A 5JJ7A 5AQ7A 2VTBB 2MD7B 4LCTA 2YREA 3BG0B 3IV0A 5AJDA 4AP4A 4M3OA 4U96D 1WIMA 2P2CP 4BFRA 2VPEA 3DXMG 2WXKA
chains in the Genus database with same CATH topology
4G11A 3APDA 3AS8A 5E76A 4DLOA 4J8DA 4JVSA 2J4DA 2LSUA 2XEVA 4UQYA 3SHFA 2YHOA 3ZNIA 1RMDA 3ESKA 5D0QD 3MCXA 3AS5A 2M63A 1H2TC 3PS6A 4NQ0A 3RPGC 3QK0A 4PTBA 2XQ0A 5KH9A 2WQ6A 3ZPV1 2IDAA 4LERA 5EKQD 4HFGA 3T5VA 5FWQA 3ZVVA 2YHNA 5G55A 2AXZA 1FVFA 3JQ1A 2KM4A 4BBQA 3I5PA 4DPRA 4I43A 4WA6A 2LAHA 3MKRA 1MQSA 2VYIA 5FT9A 3WXXA 4EZLA 1Y6IA 3C6WA 3LPZA 3LJ3A 2YT5A 3FUEA 4JL0A 3MGBA 4GCNA 5C2YA 5CHEE 3CHOA 3FUJA 3EB6A 3LS8A 3PUQA 5AIUA 4LUNU 1ELWA 2LXHC 1WY6A 4JZYA 4CDNA 3LY7A 1MM3A 2KGGA 3O33A 3O36A 4RVBA 2XEUA 3PEUB 2WB2A 2L9BA 2I1KA 1H19A 2X6KA 3EJNA 3I3NA 3CHPA 3O48A 4EECA 2DBAA 4LLBA 4HOUA 4S3OC 4IRUA 2VPGA 1OWMA 2AWIA 4UWFA 2KWJA 3GZ2A 4UWLA 2WXNA 4D10C 2VJEB 3ML9A 3LYAA 4HOSA 4FO9A 3MZLB 2WQHA 1QNFA 2D8SA 2LGVA 5TDRA 4K0RA 3ESLA 3CVPA 2MOWA 4LKAA 5LKTA 3FTZA 4A1GA 1E4UA 1EDUA 2CT2A 4URKA 3LQIA 3QNKA 4R2YA 3ZEFA 3CR3A 4XX5A 3OXGA 4UQXA 1TEZA 5KJLA 3LXUX 1KLXA 1WEEA 4BX9A 3B13A 1X4UA 3LDZA 3Q4AB 2VGXA 3HDXA 4ME2A 3S7FA 5FB1A 5JG6A 3RO2A 1E90A 3QOUA 2WM9A 1WGMA 3SF4A 4XI0A 2VPBA 3PE4A 2KC7A 4XZ4A 5H1TA 5FJYA 5G04C 1SQMA 1XGWA 1UN8A 3CVQA 5B77A 2LAIA 3D3MA 1HO8A 3B7RL 3IKOB 2X38A 3PZDA 4N39A 1HE8A 3LVRE 2WMOA 3DPDA 4I6EA 2AVPA 4N5CA 3VTXA 4UQZA 5CCMA 2VP7A 5FB0A 3T6RA 4BY6A 4I6GA 3CHRA 4GYOA 3CVYA 3O7AA 3SD5A 1CHCA 1IQUA 3FUIA 4IN3B 1GW6A 5D1LB 1UW4B 2RG8A 2VTBA 4KXKB 1Z2QA 3GV4A 3N9NA 5C11A 2CHWA 2QICA 3N9QA 4MKTA 4WNFA 3ASFA 2CFUA 2XPIA 5D0OD 3U64A 3G2VA 3FFLA 2FI7A 4WZ2A 4E6HA 2JMJA 4KZ0A 4I7BA 4A3VA 4L7XA 3QAQA 3ZXSA 5M72A 3JYSA 3RRNB 2VJFB 5BNWA 2L43A 3MHSA 2I2OA 3VTYA 4EQFA 2UZGA 2JRJA 5DBKA 2JLBA 3EIQC 4TRQA 2PM6A 4QFVA 4GA2A 1FCHA 2LGGA 4Q6FA 3R7RA 2XGMA 3P1UA 3FTVA 4BTBA 3FTWA 5AJLA 4V3KC 1HZ4A 2OVBA 4GZ5A 3L16A 2CG3A 1ZBDB 2XGSA 1L5JA 3JUIA 5AITA 2WMNA 5CMWA 4Q94A 3OAWA 2PUYA 4WNGA 1WESA 1JPLA 2EQXA 1HH8A 2C0LA 3Q49B 4R7EA 1OWNA 1Z6TA 3MJWA 3CEQA 2VSYA 3CHSA 4JC8A 3URZA 2E6SA 4DI4A 4DI3A 2XPZA 2MD8C 3Q5MA 3EDTB 4G2VA 4XKBA 5KJNA 5C13A 4S3OB 3LCAA 1B89A 4G25A 4FK5A 3LY9A 5FZRA 5ARFA 3CHMA 4B8AA 1WEMA 3TGOA 2A5UA 4FJYA 2J9QA 1WEOA 5ANRA 1Z3XA 1ZU2A 3UT8A 3FH8A 3ZYLA 1LF8A 4AM9A 3MEKA 1JWGA 2WXOA 3N9LA 1WILA 3N9OA 1G25A 3MKQA 1WAO1 3EIJA 5KCMA 3SBTB 3AS4A 4EPZA 2V0PA 3Q47B 3KV5A 4BHWA 3IHYA 3SNXA 4A4BA 3HHMA 2PNXA 3FUHA 5HI7A 1U6GB 3HCSA 2VGXB 3QWWA 3T8MA 2ECVA 4UWGA 3TG4A 3PREA 4WZ0A 2CKLB 4TKPB 4R7LA 4Y6WA 4KBQA 3CKCA 3CQGB 3RRUA 2FULA 3ZN3A 1NA3A 4U04A 3O35A 4XI9A 1WEUA 3CKBA 3PEVB 4KYOB 2BUGA 5G0FA 3ZTGA 3FUKA 3KNVA 3ZYKA 4W4UA 3C98A 3IHVA 3HVEA 5KH3A 1E96B 4MRUA 2ZU6B 3UMVA 1BORA 4GA0A 4CA1A 5G04B 3T7LA 1IQRA 4B94A 4GZ6A 2NSZA 3KD7A 3MX3A 4ILIA 4ABNA 2CHXA 3GZSA 3FY4A 2R59A 3PE3A 5LOZA 2WQ7A 1VYXA 4LRZA 3LRQA 5G05J 4GNDA 3S7DA 4WZ3B 4OVUA 5AIJA 4FJCA 3OXLA 5TDWA 2Y4TA 4HORA 5G2NA 2Y4UA 2AXUA 2YQMA 5EDSA 5EYAF 4UP0A 3FUNA 2GGFA 3ZYQA 3NQPA 4FC8A 2LV9A 2X3MA 3BEEA 1QQEA 4I7DA 1XNFA 3L54A 2IQCA 4FP7A 3RKVA 1KT0A 4TUUA 3SFZA 2J08A 4HVBA 2E6RA 5G05C 4EZJA 4QF2A 4ZQLA 4PPEA 4WAFA 4LEUA 2YQLA 1WEQA 2WXIA 2CSZA 3CK9A 3TAXA 2K17A 5FQ7A 3EB5A 4FJZA 1NZNA 4U0ZA 4N2QA 4FIPA 2AXVA 3DBSA 4DK5A 1ZBPA 4I2ZA 3CQCB 3SBSA 2NC9A 4NRHB 2FEZA 5BV0A 4WUYA 4V3IA 4L1BA 2WXMA 2YINA 3LVQE 3RJVA 4XKCA 3APFA 3U5PA 3LKUA 4AP4A 4PUCA 2ONDA 3MYVA 5J3XA 3R9AB 4ACLA 3TL5A 4Q69A 2OXQC 3ONLA 5BPPA 4H7YA 1OWLA 5DIZA 3UT4A 3G2UA 4JA7A 4C0MA 1OWOA 4U0SA 5G05B 4AV7A 3SOXA 4I17A 1HYJA 3KQIA 3U3WA 3D9LA 2PQRA 4AEZC 1X5BA 1VD4A 4BTAA 5T4YA 1LDJB 4A55A 4FULA 2G45A 2MIQA 3FDHA 3MV2B 4JHJA 2J4BA 1PAQA 3B7SA 5H1UA 3HCUA 3KS2A 1PC2A 2UY1B 2XB1A 1E8ZA 4GCOA 3MKQB 4YBSA 4W9RA 1KT1A 1TJFA 4PDXA 2F42A 4Q96A 4F52B 3BG1B 4GMJA 4J8FA 1E8XA 3NF1A 3G2TA 4I2WA 3OXFA 3U5MA 4J8EA 3HYMB 4L2YA 2OOEA 2I6HA 2Q7FA 2I9CA 3G2WA 5BV1A 2WXRA 2J09A 1WFKA 4A49A 4K03A 5A23A 2KYUA 3O37A 4DJAA 5TBNA 4I1AA 2MA6A 2BTDA 2ILRA 3QKYA 2EODA 2F6JA 3FU6A 3CVNA 4BT8A 3FUFA 5LFAA 2AN6A 3SOUA 5KJMA 2KCKA 2GRLA 3D9KA 5T8IA 1XWHA 1Z60A 1E8WA 2H0DA 3N9MA 4RG9A 3HVEB 3JQ0A 3S2AA 4L2LA 4GAAA 5DKAA 5BUZA 2KCVA 2XCBA 3ASHA 1LDKC 1X4IA 4WWPA 2YQ8A 2ECTA 4GU5A 4AY5A 4FADA 1N52A 4I7CA 4WWOA 4U63A 4UI9C 4LJNA 4A1SA 1HXIA 2V8SE 2QFCA 5BW8C 2CHZA 2E2EA 5C1DA 2CKLA 2PQNA 2YHCA 4GB9A 4I1OB 4CT4A 2PM7A 3CLJA 2KR4A 4KZCA 2P58C 4H7XA 4EBAG 3RU0A 3QWPA 3O34A 3RTRB 2A4ZA 3B7TA 3HTKC 3FU5A 4FA6A 1Z6UA 3VK6A 2WXLA 4JEHA 4NN2A 2HO1A 2ECIA 2JMIA 3U5OA 4G24A 2WXGA 3CV0A 2LXPC 1WEPA 4U07A 2CFZA 1HS6A 2QY7A 2GRMA 3FEXA 3E4BA 4AUQB 5B79A 4O6FA 3ZPJA 4NURA 4AP2A 5LCWB 3ZIMA 4MVTA 4GB0A 4AIFA 4JA9A 3PNTB 4YABA 2WXFA 2WXHA 3L22A 2R17C 2IU1A 3U4TA 3RO3A 3ZFWA 2M6MA 1EF1C 4CCAA 2NXPA 5B78A 2LDRA 2C2LA 2UY1A 5EX0A 3U5NA 3HIZA 2C0MA 3L17A 3NG2A 2VGYA 3ZVZB 3NZUA 3AU4A 3CIAA 3M63A 4YVQC 2JMDA 4F53A 3FWVA 2VSOE 2FBNA 1VFYA 4AYCB 5G04J 3FULA 3LEWA 1N87A 4F1SA 2CSYA 2R5SA 2LGLA 3G2SA 5ARGA 4I6JA 1S0PA 5AENA 5FZSA 3LQHA 1HF8A 3QARA 3FTXA 3FUDA 4N3WA 1EYHA 2AW6A 4P29A 1FBVA 3VLDA 3ASGA 2XRZA 4V3LC 4GNFA 3UQ3A 3FTSA 3L13A 4GZDA 3L1ZB 3ASLA 3VLEA 4KVOA 3SHBA 3TJPA 2IOLA 3KEZA 3QJZA 5T3RA 2L6JA 4ILHB 4CRWA 1H2UA 3D9OA 4MLPA 4GPKA 3ENEA 1DVPA 3OTNA 4I9CA 4C9ZA 2MRIA 5B75A 4YBMA 3C5KA 1ELKA 1HU3A 1SZ9A 3CVVA 5A7DB 2V4LA 4I1MA 4B8CB 2VNFA 5FERA 1UN9A 4JEUA 4KVMA 5FQ4A 4UI9K 2EA6A 3ZW3A 3UT7A 3FTUA 2XHEA 4OYSA 2LSVA 4PS8A 1HFAA 1WM5A 3D9JA 5LKUA 2Y3AA 1JWFA 4APOA 2F6NA 3QDNA 4AY6A 4N2SA 2QIZA 3RK6A 3QZVA 2LNIA 5LKZA 4N3CA 3U9WA 2XGOA 2ECJA 3SI5A 2QJ0A 4GZ3A 5EX3A 2Y43A 5FQ6A 3MV3B 5LCWJ 4JHKA 4BSXA 3QC1A 4C9BB 2E0IA 2MHKA 3PNLB 3I4RB 4ANWA 1K2FA 1U3CA 2BAYA 3QWVA 1JM7B 4GA1A 1HYIA 1JUQA 4BT9A 1WEVA 1E7UA 3CVLA 3CVWA 2PZIA 3DPLR 3MHHA 2DCPA 2CG2A 1Z3YA 2PL2A 3FP3A 4A3TA 2KFTA 4HOQA 1U3DA 1P5QA 2M3HA 2MNYA 4X3GA 4ZDTA 2L0IA 2DIWA 5JHBA 4Y6CA 1V87A 3ZHEB 4HOTA 4FLHA 4L58A 4JXTA 1FP0A 4E85A 3SGHA 1IYGA 4UWKA 3FHEA 3LQJA 4UI9B 3CVXA 3UX4A 4CT0A 4FLBA 3PHDA 1UG3A 3U66A 3KV6A 4LADB 2L5UA 3JCKC 4JW1A 4OVVA 4PS7A 4NACA 1BPOA 4FHJA 1FVHA 2RI7A 3GYZA 2WXJA 2ECNA 5D1MB 4BWRA 4KT6B 4ILGA 1T1HA 2EGPA 1H6KA 3L11A 4HXIA 5LCWC 1PY1A 2G43A 3L08A 2LRIC 3HCTA 2X6FA 2WXPA 3CK7A 3PVLA 2FUIA 2K16A 2KU3A 2WPVA 4RG6A 2L0TB 4RSYA 3CHQA 3R7QA 2VJFA 3NZSA 2BF0X 3FEYA 3TXNA 4YBTA 2MT5A 3ML8A 1IHGA 1UJKA 3IEGA 2VQ2A 4WNEA 3ZGQA 4BX8A 3TXMA 2L0BA 3FU0A 5H9MA 4B7YC 1IYMA 1NA0A 5KH7A 4G26A 4ANVA 1YA0A 2VPDA 1H0AA 2HR2A 1N54A 3FH7A 3APCA 3GZ1A 1TJCA 4I9EA 2IONA 2WXQA 3CK8A 5ANLA 3V43A 4N3BA 2RSDA 3LY8A 4CDRA 4ANXA 3ASDA 4GYYA 5FEYA 1MM2A 5FQ8A 2I50A 5JJTA 3ZVYA 2M85A 3M62A 3VLFA 5CCLA 2MNZA 4G23A 4GNEA 4UP5A 2YUCA 1A17A 1ELRA 2KZTA 3D9PA 3T5XA 4MS6A 2K1JA 3ZYMA 2L75A 4ANUA 2FUUA 3ZPVE 4PS3A 5D1KB 4G1TA 5E75A 4JHRA 2HYED 3FH5A 2KATA 4AYCA 3AU5A 2YNQA 4EZKA 2MUMA 4DLQA 5FTPA 2KWKA 1E8YA 5A6CA 2KWOA 4XIFA 4AJWA 5B8DA 4ATGA 4KMOA 2Y1NA 2Y1MA 3FUMA 3B7UX 3IBEA 4B89A 3M99A 2M1RA 2GW1A 3CGHA 5LKXA 1NP7A 2IF4A 3PUKA 4IULA 2VSXE 2YURA 4IC3A 4LK9A 2IFUA 3ONKA 5J90A 2IJGX 4APFA 3O70A 1QZ2A 3UPVA 2J07A 4FU3A 2K4DA 3RIBA 4ACKA 2YSJA 5AYWD 4J8SA 5HQ8A 2IOSA 2I1JA 4N3AA 2X6IA 2ECWA 4J0UA 4J6IA 5TABA 3SOWA 2RD0A 3I4GA 1JM7A 1VDYA 2VJ8A 2ECGA 5H1VA 4CGVA 5FZQA 2LN0A 1Y8MA 2DX8A 3RRMB 4CDMA 3CSFA 3SZ7A 2KCLA 2FSAA 2MA5A 5TRBA 3D9NA 3PDNA 3L6AA 4R8PK 1X4JA 2YW8A 4ZUXU 3P2BA 1WE9A 3KAEA 2FF4A 3K9IA 5JJ6A 1WEWA 4TV3A 4GNGA 4U0UA 3I2DA 3PURA 4GMLA 4XE0A 3PRZA 4EBAA 4GYWA 3ULQA 5B76A 2ZETC 4WWNA 2KIZA 2YSMA 2HM8A 5I3LA 4UI9J 2L80A 5JHAA 4B86C 3N71A 3DQVR 2V5FA 1E7VA 3QB2A 2WVIA 4C0EA 3Q15A 3CVUA 4YNDA 2H0DB 4AXHA 3S7BA 2X6JA 4CCGX 2VSNA 2YYRA 4UWHA 4JPSA 4GZCA 3L1XA 2YHEA 4CGWA 1OUVA 4FHKA 2OVFA 3GW4A 4IC2A 3ZHEA 2FO7A 3EHMA 2YU4A 2XCCA 5ENNA 3FL2A 2JEKA 2NAAA 3N9PA 4YATA 4YADA 1HG2A 4U8HA 1HX8A 3PUJA 3S7JA 3UUXA 2KE1A 2LQ6A 1DNPA 3IHPA 4MSXA 4PH4B 4A4CA 3ZRHA 1EPUA 4HS2A 2KREA 5BT1A 1UJJA 1JOCA 4L23A 3PH0C 4N4FA 2X6HA 4AOFA 3MA5A 5KJKA 1H2VC 4L7TA 1INZA 2C2VS 1HG5A 2VJEA 4YAXA 2KGIA 3FU3A 3D9MA 2LGKA 3O4ZA 2G6QA 2UWJG 4YC9A 4QF3A 4YVOA 1F62A 4AVXA 5CMYA 5JJ7A 5J08A 3RPGB 2XRYA 4B0ZA 4CEMA 2KZTB 3D9IA 2VTBB 5DINA 4A0CD 2OV8A 2MD7B 3FTYA 4P5OB 2XPYA 4LCTA 1W3BA 2LO6A 3EHNA 2YREA 3GL6A 3BG0B 3IV0A 5AJDA 1OWPA 5LX8A 4O64A 4M3OA 5LP0A 2J49A 4IYPA 2KWNA 4XI1A 4WNDA 1MHQA 4F7AA 3CSTA 1WIMA 3TG5A 4F3VA 1SZAA 4BFRA 4HLEA 1WENA 2VPEA 2HDPA 2HYZA 2WXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHO A;  3ZNI A;  1RMD A;  3RPG C;  3ZPV 1;  4PTB A;  5KH9 A;  2IDA A;  4HFG A;  2YHN A;  4BBQ A;  2KM4 A;  4WA6 A;  3C6W A;  2YT5 A;  3EB6 A;  3PUQ A;  5AIU A;  2LXH C;  3O33 A;  2KGG A;  1MM3 A;  3O36 A;  2XEU A;  4LLB A;  4S3O C;  2VPG A;  2KWJ A;  2VJE B;  4FO9 A;  2D8S A;  2LGV A;  5TDR A;  2MOW A;  4LKA A;  1E4U A;  1EDU A;  2CT2 A;  4R2Y A;  3LQI A;  1WEE A;  1X4U A;  3LDZ A;  5FB1 A;  5JG6 A;  1WGM A;  2VPB A;  5H1T A;  1XGW A;  5B77 A;  5FB0 A;  2VP7 A;  3T6R A;  3O7A A;  1CHC A;  5D1L B;  1Z2Q A;  3GV4 A;  3N9N A;  5C11 A;  2QIC A;  3N9Q A;  3G2V A;  4WZ2 A;  2JMJ A;  4I7B A;  4L7X A;  2VJF B;  2L43 A;  3MHS A;  2UZG A;  2JRJ A;  2LGG A;  4Q6F A;  4V3K C;  1ZBD B;  5AIT A;  5CMW A;  4Q94 A;  2PUY A;  1WES A;  1JPL A;  4R7E A;  2E6S A;  2MD8 C;  5C13 A;  4S3O B;  4FK5 A;  1WEM A;  1WEO A;  3ZYL A;  1LF8 A;  1JWG A;  3N9L A;  1WIL A;  3N9O A;  1G25 A;  3KV5 A;  4BHW A;  2PNX A;  1U6G B;  3HCS A;  2ECV A;  4WZ0 A;  2CKL B;  4TKP B;  3O35 A;  3RRU A;  1WEU A;  3ZTG A;  5G0F A;  3KNV A;  4W4U A;  3ZYK A;  5KH3 A;  1BOR A;  4CA1 A;  5G04 B;  3T7L A;  5LOZ A;  1VYX A;  4GNG A;  3LRQ A;  4GND A;  4WZ3 B;  5TDW A;  4FJC A;  2YQM A;  5EYA F;  4UP0 A;  3ZYQ A;  2LV9 A;  4I7D A;  2E6R A;  4QF2 A;  4ZQL A;  4PPE A;  2YQL A;  1WEQ A;  2CSZ A;  2K17 A;  3EB5 A;  4FIP A;  3U5P A;  5J3X A;  2OXQ C;  3ONL A;  3G2U A;  5G05 B;  3SOX A;  1HYJ A;  3KQI A;  3D9L A;  1X5B A;  1VD4 A;  1LDJ B;  2G45 A;  2MIQ A;  5H1U A;  3HCU A;  2XB1 A;  4YBS A;  2F42 A;  4Q96 A;  4F52 B;  3G2T A;  3U5M A;  1WFK A;  3G2W A;  4A49 A;  2KYU A;  3O37 A;  5TBN A;  2MA6 A;  2EOD A;  2F6J A;  2AN6 A;  3SOU A;  3D9K A;  1XWH A;  1Z60 A;  3N9M A;  2H0D A;  5DKA A;  1X4I A;  1LDK C;  2ECT A;  4I7C A;  4LJN A;  2V8S E;  2CKL A;  3CLJ A;  2KR4 A;  3O34 A;  3RTR B;  3HTK C;  1Z6U A;  3VK6 A;  4NN2 A;  2ECI A;  2JMI A;  3U5O A;  2LXP C;  1WEP A;  2QY7 A;  4AUQ B;  5B79 A;  5LCW B;  4MVT A;  4GB0 A;  4YAB A;  2M6M A;  3U5N A;  5B78 A;  2LDR A;  2C2L A;  3NG2 A;  3ZVZ B;  3M63 A;  2JMD A;  1VFY A;  4AYC B;  2CSY A;  1N87 A;  2LGL A;  3G2S A;  3LQH A;  1HF8 A;  4N3W A;  1EYH A;  1FBV A;  4V3L C;  4GNF A;  4GZD A;  3L1Z B;  3ASL A;  3SHB A;  3D9O A;  1DVP A;  4C9Z A;  5B75 A;  4YBM A;  3C5K A;  1ELK A;  1SZ9 A;  2VNF A;  5FER A;  2EA6 A;  1HFA A;  5LKU A;  3D9J A;  1JWF A;  2F6N A;  2QIZ A;  3QZV A;  5LKZ A;  5LKT A;  2ECJ A;  2QJ0 A;  3SOW A;  4B7Y C;  2Y43 A;  4R8P K;  1K2F A;  2BAY A;  1JM7 B;  1HYI A;  1JUQ A;  1WEV A;  3DPL R;  3MHH A;  2DCP A;  2KFT A;  4A4B A;  2M3H A;  4X3G A;  2MNY A;  4ZDT A;  2L0I A;  2DIW A;  1V87 A;  4L58 A;  4JXT A;  1FP0 A;  3LQJ A;  2HDP A;  4UI9 B;  4FLB A;  3PHD A;  3KV6 A;  4LAD B;  2L5U A;  4NAC A;  2RI7 A;  2ECN A;  5D1M B;  1T1H A;  3L11 A;  2EGP A;  1PY1 A;  2G43 A;  2LRI C;  3HCT A;  2FUI A;  2K16 A;  2KU3 A;  2L0T B;  2VJF A;  4YBT A;  2BF0 X;  2MT5 A;  1UJK A;  2L0B A;  5H9M A;  1IYM A;  5KH7 A;  2VPD A;  1H0A A;  3V43 A;  2RSD A;  5FEY A;  1MM2 A;  2I50 A;  3ZVY A;  2M85 A;  3M62 A;  4GNE A;  2MNZ A;  4UP5 A;  2YUC A;  3D9P A;  2K1J A;  3ZYM A;  2L75 A;  3ZPV E;  2FUU A;  5D1K B;  2HYE D;  4AYC A;  2MUM A;  2KWK A;  2KWO A;  5B8D A;  2Y1N A;  2Y1M A;  3M99 A;  2M1R A;  5LKX A;  4IC3 A;  2YUR A;  4LK9 A;  3ONK A;  3O70 A;  2K4D A;  4FU3 A;  2YSJ A;  2ECW A;  5TAB A;  1JM7 A;  1VDY A;  2ECG A;  5H1V A;  2LN0 A;  2DX8 A;  2FSA A;  2MA5 A;  5TRB A;  3D9N A;  1X4J A;  2YW8 A;  4ZUX U;  1WE9 A;  1WEW A;  3I2D A;  3PUR A;  5B76 A;  2ZET C;  2KIZ A;  2YSM A;  5I3L A;  2L80 A;  4B86 C;  3DQV R;  2H0D B;  4CCG X;  2YYR A;  4GZC A;  3L1X A;  4IC2 A;  2YU4 A;  3N9P A;  3FL2 A;  4YAT A;  4YAD A;  1HG2 A;  3IHP A;  1HX8 A;  4MSX A;  4A4C A;  2KE1 A;  2LQ6 A;  2KRE A;  1JOC A;  1UJJ A;  4N4F A;  1INZ A;  2C2V S;  2VJE A;  1HG5 A;  4YAX A;  2KGI A;  2LGK A;  3D9M A;  2G6Q A;  4YC9 A;  4QF3 A;  1F62 A;  4AVX A;  5CMY A;  5J08 A;  3RPG B;  3D9I A;  4A0C D;  5DIN A;  2MD7 B;  4P5O B;  2LO6 A;  2YRE A;  3GL6 A;  4AP4 A;  4O64 A;  5LP0 A;  4XI1 A;  2KWN A;  1MHQ A;  1WIM A;  1SZA A;  2VPE A;  1WEN A;  2NAA A; 
#chains in the Genus database with same CATH topology
 3DXK G;  2YHO A;  3ESK A;  3AS5 A;  3QK0 A;  5AQ9 A;  2XQ0 A;  2WQ6 A;  4LER A;  5G55 A;  3JQ1 A;  1FVF A;  5FT9 A;  4EZL A;  1H6P A;  1Y6I A;  2YT5 A;  1OXJ A;  5CHE E;  3FUJ A;  1U2V G;  3LS8 A;  1ELW A;  1WY6 A;  4CDN A;  4YDY A;  2RFA A;  2XEU A;  2WB2 A;  1NI1 A;  3EJN A;  3CHP A;  4S3O C;  4HOU A;  4GTR A;  4IRU A;  1OWM A;  3GZ2 A;  2VJE B;  4D10 C;  3UXG A;  2CRR A;  2XEH A;  3ESL A;  4A1G A;  1EDU A;  4URK A;  4XX5 A;  4UQX A;  4HNA D;  3LXU X;  3LDZ A;  5FB1 A;  3HDX A;  1WG0 A;  4XI0 A;  5FJY A;  5G04 C;  5FB0 A;  2VP7 A;  4UQZ A;  2GRQ B;  4GYO A;  1N11 A;  1BD8 A;  1CHC A;  3Q7A A;  3N9N A;  2QIC A;  3E34 A;  2JM3 A;  3G2V A;  1FT2 A;  2JMJ A;  4I7B A;  4A3V A;  3QAQ A;  5KWD A;  4CYM D;  2L43 A;  3VTY A;  5EN5 D;  3EIQ C;  1FCH A;  3R7R A;  5AJL A;  1HZ4 A;  2OVB A;  5AIT A;  3TWU A;  5CMW A;  1G3N B;  2EQX A;  3Q49 B;  3MJW A;  3URZ A;  2E6S A;  4UUC A;  2XPZ A;  5AQB A;  3EDT B;  4XKB A;  5CED B;  5ENO D;  3CHM A;  3TGO A;  2A5U A;  1TNU A;  4FJY A;  1WEO A;  1Z3X A;  1ZU2 A;  2XZD G;  3FH8 A;  3UT8 A;  3ZYL A;  3MEK A;  1JWG A;  2WXO A;  3N9L A;  1TNO A;  4HI8 A;  4EPZ A;  3SNX A;  3HXD A;  3MDB C;  3PRE A;  4KBQ A;  1NA3 A;  4U04 A;  1WEU A;  3ZYK A;  4MRU A;  4GA0 A;  4CA1 A;  1IQR A;  2CHX A;  3BQO A;  3GZS A;  2R59 A;  3PE3 A;  3LRQ A;  2F37 A;  4WZ3 B;  5B1A E;  2AXU A;  5EYA F;  3NQP A;  2XZT G;  4TUU A;  2J08 A;  4EZJ A;  4PPE A;  4BET A;  2WXI A;  3EB5 A;  5FQ7 A;  1NZN A;  2AXV A;  4DK5 A;  2RR4 A;  1N4S A;  5FIO A;  3LVQ E;  3FM8 C;  3U5P A;  3LKU A;  2OND A;  4Q69 A;  3ONL A;  5BPP A;  4H7Y A;  4JA7 A;  1OWO A;  4H9D A;  2PQR A;  2BED A;  1S64 A;  4BTA A;  5T4Y A;  4A55 A;  3FDH A;  4JHJ A;  5BXO A;  5H1U A;  3HCU A;  1D9S A;  5HS0 A;  4GCO A;  4Q96 A;  4Z68 A;  3NF1 A;  2EIJ E;  4J8E A;  4L2Y A;  2DZN A;  2Q7F A;  1QBQ A;  2KYU A;  5TBN A;  2P9L G;  2ILR A;  3QKY A;  4BT8 A;  2AN6 A;  3ZUV B;  2GRL A;  2Y1L E;  3N9M A;  4L2L A;  1LDK C;  4U63 A;  2QFC A;  3DPY A;  2CHZ A;  2XEN A;  1OCZ E;  4CT4 A;  4KZC A;  2ZGG A;  4FA6 A;  2QYJ A;  2WXL A;  2HO1 A;  2ECI A;  2JMI A;  3U5O A;  2WXG A;  2QYU A;  1WEP A;  5ITZ F;  2QY7 A;  4HBD A;  2GRM A;  3E4B A;  4AUQ B;  3ZPJ A;  4NUR A;  5SVY A;  4DRX E;  3PNT B;  2VGY A;  3AU4 A;  4GTP A;  3CIA A;  3LEW A;  2GRR B;  4F1S A;  2R5S A;  4I6J A;  1S0P A;  3QAR A;  2P57 A;  4N3W A;  4BSZ B;  3FTS A;  4GZD A;  4KVO A;  3QJZ A;  1D8D A;  1H2U A;  3D9O A;  2KKY A;  3OTN A;  4I9C A;  3CVV A;  5A7D B;  4B8C B;  3Q75 A;  5FER A;  5FQ4 A;  2XHE A;  4OYS A;  1WM5 A;  3QDN A;  5LKZ A;  3U9W A;  2QJ0 A;  4GZ3 A;  3JUE A;  4C9B B;  3PNL B;  4R8P K;  1HYI A;  1WEV A;  1E7U A;  3DPL R;  2PZI A;  3MHH A;  3FP3 A;  4HOQ A;  3C3O A;  4FLH A;  4JXT A;  3LQJ A;  3FHE A;  3AG4 E;  2JAB A;  4GMR A;  4JW1 A;  4JB8 P;  1AP7 A;  4FHJ A;  4TXP A;  3GYZ A;  1OY3 D;  4HI9 A;  1PY1 A;  2G43 A;  2X6F A;  3ISM C;  2K16 A;  2KU3 A;  3R7Q A;  3NZS A;  1YYH A;  4A63 B;  2MT5 A;  5KH7 A;  2VPD A;  3FH7 A;  3GZ1 A;  3APC A;  3V43 A;  4I9E A;  5ANL A;  4N3B A;  2RSD A;  3LY8 A;  3ASD A;  5ENS D;  5FEY A;  1MX2 A;  5CCL A;  2YUC A;  2K1J A;  2L75 A;  4ANU A;  4PS3 A;  3AU5 A;  1N9A A;  5FTP A;  1E8Y A;  5A6C A;  5CBO A;  2KWO A;  4XIF A;  4ATG A;  2Y1M A;  4B89 A;  4TXQ A;  2IF4 A;  4IC3 A;  1DCQ A;  3O70 A;  1QZ2 A;  3UPV A;  2KBX A;  5HQ8 A;  4N3A A;  4J0U A;  4J6I A;  2MYO A;  5FZQ A;  1Y8M A;  2FSA A;  3L6A A;  3P2B A;  3KAE A;  4TV3 A;  4U0U A;  3I2D A;  4GML A;  3PRZ A;  4EBA A;  3ULQ A;  4RQI A;  4HQD A;  4WWN A;  3DSU A;  4UI9 J;  2L80 A;  4B86 C;  3DQV R;  3TWT A;  4C48 B;  5EIL A;  2X6J A;  2YYR A;  4JPS A;  2YHE A;  1OUV A;  3GW4 A;  4IC2 A;  3F6Q A;  2FO7 A;  3EHM A;  2PNN A;  3DRA A;  3E30 A;  1HX8 A;  4PH4 B;  5BT1 A;  2XOZ A;  4L23 A;  4N4F A;  4AOF A;  3MA5 A;  5KJK A;  1TNB A;  4L7T A;  2C2V S;  2VJE A;  1HG5 A;  2VGE A;  2LGK A;  3FU3 A;  3O4Z A;  2UWJ G;  2DSM A;  1F62 A;  1YCS B;  5CMY A;  5J08 A;  3RPG B;  2XRY A;  4CEM A;  2IO3 C;  4A0C D;  5ENQ D;  2XPY A;  4L9P A;  1BU9 A;  4GTT A;  2IEJ A;  5LX8 A;  4IYP A;  4XI1 A;  1MHQ A;  3CST A;  4DX1 A;  1SZA A;  1WEN A;  2HYZ A;  4G11 A;  3APD A;  3C3R A;  4J8D A;  3SHF A;  3ZNI A;  2XEV A;  1DCE A;  3SFY A;  3MCX A;  4NQ0 A;  1H2T C;  3ASO E;  5FWQ A;  3SO8 A;  2R02 A;  4BBQ A;  2LAH A;  3MKR A;  1MQS A;  3WXX A;  3C6W A;  2DYS E;  3FUE A;  5AIU A;  3LY7 A;  4X8Q A;  3PEU B;  2GRN B;  2L9B A;  3O48 A;  4EEC A;  4LLB A;  2VPG A;  3T8K A;  2F0Y A;  2AWI A;  5B3S E;  4HOS A;  2D8S A;  2LGV A;  2D8U A;  4OGC A;  3FTZ A;  3B95 A;  4R2Y A;  1A5E A;  3QNK A;  3CR3 A;  3OXG A;  1KLX A;  1WEE A;  1X4U A;  5JG6 A;  3RO2 A;  1E90 A;  1TN8 A;  3QOU A;  4CZ2 D;  4TXR A;  2VPB A;  5H1T A;  1XGW A;  2LAI A;  5ENP D;  1HO8 A;  3B7R L;  3IKO B;  2X38 A;  1HE8 A;  3LVR E;  2F8X K;  5CCM A;  4N5C A;  3VTX A;  4BY6 A;  3O7A A;  2GRP B;  3FUI A;  4IN3 B;  2RG8 A;  4KXK B;  4DX7 D;  2CHW A;  4MKT A;  2CFU A;  3FFL A;  3ZNG A;  3ZXS A;  3MHS A;  4TRQ A;  4QFV A;  3ZKJ A;  4BTB A;  3FTV A;  3UIO C;  4GZ5 A;  2CG3 A;  2XGS A;  5KBA A;  2DVW A;  3NAW A;  2PUY A;  2VSY A;  4JC8 A;  4DI4 A;  2CON A;  3Q5M A;  3ABK E;  3LY9 A;  2J9Q A;  1LF8 A;  4MBG A;  5KCM A;  5EIB E;  5SVI A;  2CKL B;  3UIN C;  2A5E A;  3CKC A;  3O35 A;  3EU9 A;  3ZN3 A;  4XI9 A;  4DX2 A;  3ZTG A;  4W4U A;  1RZ4 A;  3IHV A;  5KH3 A;  4U7E B;  1N94 A;  5G04 B;  3KD7 A;  3ASN E;  3BUA A;  1VYX A;  1SVX A;  5CRV A;  4LNU D;  4FJC A;  3DSX A;  4HOR A;  2YQM A;  4I7D A;  2QC9 A;  4FP7 A;  3SFZ A;  2CRW A;  4QF2 A;  4WAF A;  1WEQ A;  4YDW A;  2CSZ A;  3CK9 A;  4U0Z A;  4N2Q A;  3DBS A;  1OCC E;  3CQC B;  2NC9 A;  5BV0 A;  3HXE A;  2YIN A;  2ETB A;  3APF A;  4PUC A;  3MYV A;  3UT4 A;  5G05 B;  5HRY A;  3Q79 A;  1VD4 A;  4FUL A;  2G45 A;  2J4B A;  3B7S A;  1FPP A;  3KS2 A;  4YBS A;  1KT1 A;  1TJF A;  4PDX A;  5IY5 E;  1LD8 A;  3OXF A;  1WFK A;  3G2W A;  2J09 A;  5A23 A;  3O37 A;  2BTD A;  3FUF A;  5KJM A;  4LSZ E;  2KCK A;  5T8I A;  4BEP A;  2XP0 A;  5CEA A;  2H0D A;  4Z0R A;  4GAA A;  5CEC B;  3ASH A;  3DDT A;  3UI2 A;  2YQ8 A;  1N52 A;  4UI9 C;  5ENR D;  1KZP A;  4LJN A;  4A1S A;  1HXI A;  2V8S E;  5BW8 C;  5C1D A;  2E2E A;  2YHC A;  4I1O B;  3CLJ A;  1V54 E;  4EBA G;  3TWS A;  3QWP A;  3HTK C;  4JEH A;  2IY0 C;  2KXP C;  4U07 A;  1HS6 A;  2L6B A;  4O6F A;  1N0R A;  4MVT A;  4GB0 A;  4JA9 A;  3TWR A;  4YAB A;  2WXF A;  2WXH A;  3L22 A;  2R17 C;  2M6M A;  4CCA A;  5B78 A;  2UY1 A;  3HIZ A;  4DUI A;  3V31 A;  3UTM A;  2P9U G;  3FWV A;  2LGL A;  1MZC A;  4J7W A;  3LQH A;  1HF8 A;  1EYH A;  2AW6 A;  3VLD A;  2P9N G;  3ASL A;  3VLE A;  3TJP A;  4MLP A;  3ENE A;  2B6C A;  4C9Z A;  3NOG D;  5SVX A;  5B75 A;  4YBM A;  3C5K A;  1SZ9 A;  2V4L A;  4I1M A;  2VNF A;  2ETC A;  2EXU A;  4UI9 K;  3ZW3 A;  4O60 A;  3D9J A;  4APO A;  4AY6 A;  3QZV A;  2LNI A;  5LKT A;  4N3C A;  2ECJ A;  3SOW A;  4GPM A;  1O1R A;  4JHK A;  1K2F A;  3QWV A;  4GA1 A;  4BT9 A;  3CVW A;  4A3T A;  2M3H A;  4X3G A;  1U3D A;  2MNY A;  2L0I A;  2DIW A;  5JHB A;  4L58 A;  3U66 A;  4OVV A;  2LUH A;  2R2L A;  1T1H A;  4ILG A;  3L11 A;  2EGP A;  1H6K A;  3DSW A;  5LCW C;  2HE0 A;  3UM1 A;  1MBM A;  3HCT A;  3UIP C;  2FUI A;  4RG6 A;  2L0T B;  4RSY A;  3TXN A;  3ML8 A;  1IHG A;  4WNE A;  2VQ2 A;  3L9T A;  5KNH D;  3PZ3 A;  1NA0 A;  1NL4 A;  3E37 A;  1TJC A;  3CK8 A;  4CDR A;  3ZXP A;  1MM2 A;  2I50 A;  5JJT A;  5EID A;  3ZYM A;  5E75 A;  2KAT A;  4AYC A;  4EZK A;  2KWK A;  1IKN D;  2LXM A;  4AJW A;  3FUM A;  3CGH A;  4TUM A;  4IUL A;  4LK9 A;  3ONK A;  5J90 A;  2ZXW E;  2J07 A;  4J8S A;  3IXE A;  1JCR A;  1JM7 A;  2VJ8 A;  5H1V A;  4CGV A;  4JD2 G;  1KZO A;  3SZ7 A;  3D9N A;  4XE0 A;  4GTS A;  5I3L A;  2V5F A;  2OEW A;  4C0E A;  3DEP A;  3Q15 A;  5AAR A;  3CVU A;  3S7B A;  5CER B;  4UWH A;  4FHK A;  2OVF A;  3EHQ A;  3ZHE A;  3N9P A;  3T9K A;  5ENN A;  4YAD A;  4MSX A;  4A4C A;  2KE1 A;  2LQ6 A;  2QZA A;  3ZRH A;  1JOC A;  2X6H A;  3D9M A;  1FT1 A;  4YC9 A;  4B0Z A;  2KZT B;  1K8K G;  5DIN A;  4LNB A;  4BES A;  1W3B A;  2LO6 A;  4O64 A;  2EIN E;  5LP0 A;  1LD7 A;  4F7A A;  4F3V A;  2NAA A;  3PZ2 A;  4DLO A;  3AS8 A;  4JVS A;  4UQY A;  3PS6 A;  3ZPV 1;  4PTB A;  5KH9 A;  2IDA A;  5EKQ D;  4HFG A;  4I43 A;  4WA6 A;  2ETA A;  4JL0 A;  3MGB A;  5C2Y A;  2EGM A;  3EB6 A;  4J8Y A;  1MM3 A;  3KSL A;  2I1K A;  1H19 A;  2X6K A;  1V55 E;  2FFW A;  2DBA A;  4UWF A;  2KWJ A;  4UWL A;  3LYA A;  4B93 B;  4FO9 A;  3MZL B;  2WQH A;  2V5Q C;  5TDR A;  4K0R A;  3CVP A;  4LKA A;  2CT2 A;  3LQI A;  3ZEF A;  5AAO A;  4RLY A;  3Q4A B;  4ME2 A;  1RW2 A;  2DJA A;  1WGM A;  3PLW A;  1TNY A;  4XZ4 A;  2KC7 A;  3PZD A;  1SW6 A;  3DPD A;  2AVP A;  1JCQ A;  3CHR A;  2EIM E;  3CVY A;  3SD5 A;  5C11 A;  4WNF A;  3UKR G;  4E6H A;  4KZ0 A;  3Q78 A;  2VJF B;  3W9F A;  4DX5 D;  2I2O A;  2RFM A;  4EQF A;  2JRJ A;  2JLB A;  3RAU A;  2PM6 A;  3LJU X;  2LGG A;  4V3K C;  2LAU A;  1TN7 A;  5EYP F;  4O1O A;  1MX4 A;  3OAW A;  4WNG A;  1JPL A;  1OWN A;  1Z6T A;  4DI3 A;  4G8K A;  3AG3 E;  2MD8 C;  1OCR E;  4G2V A;  4GTO A;  5C13 A;  2J8S D;  1B89 A;  1Z5S C;  5ARF A;  4B8A A;  1O5M A;  5ANR A;  4AM9 A;  1WIL A;  3N9O A;  1G25 A;  3EIJ A;  3SBT B;  4BHW A;  3IHY A;  3HHM A;  3FUH A;  1U6G B;  3HCS A;  2VGX B;  3QWW A;  4UWG A;  3TG4 A;  4R7L A;  4Y6W A;  3CQG B;  4HRL A;  3RRU A;  3EHR A;  4U95 D;  1N4Q A;  4ZFH A;  3PEV B;  2BUG A;  3FUK A;  3KNV A;  1E96 B;  2ZU6 B;  4GZ6 A;  3NBN B;  1NFI E;  4ABN A;  5LOZ A;  5HKP A;  2WQ7 A;  3S7D A;  4OVU A;  5AIJ A;  5TDW A;  3OXL A;  3FUN A;  2LV9 A;  4FC8 A;  2X3M A;  3BEE A;  1QQE A;  3SFX A;  2H6H A;  2IQC A;  1KT0 A;  4HVB A;  2E6R A;  4LEU A;  2YQL A;  3TAX A;  4FJZ A;  3FAO A;  3HG0 D;  1ZBP A;  4I2Z A;  3SBS A;  2AJA A;  2FEZ A;  3W9G A;  4GTM A;  4V3I A;  3E33 A;  4L1B A;  4XKC A;  5J3X A;  2F8Y A;  3R9A B;  3AG2 E;  5DIZ A;  4C0M A;  1MYO A;  4AV7 A;  1HYJ A;  3DSV A;  3DST A;  3BU8 A;  2JUN A;  1LTX A;  1PAQ A;  4F6R D;  1K1B A;  2UY1 B;  4QQ4 A;  1E8Z A;  3MKQ B;  4W9R A;  1K3Z D;  2F42 A;  3BG1 B;  4GMJ A;  3TWV A;  1X81 A;  4I2W A;  3U5M A;  3HYM B;  5BV1 A;  2WXR A;  4K03 A;  2DWZ A;  4DJA A;  3SOU A;  1XWH A;  3HVE B;  3JQ0 A;  5BUZ A;  2XCB A;  2ECT A;  4AY5 A;  4WWO A;  4EHM A;  3H7H A;  2PQN A;  2KR4 A;  2P58 C;  4H7X A;  3RU0 A;  1O1T A;  2H6G A;  2R05 A;  4NN2 A;  2EIK E;  4G24 A;  2CFZ A;  5LCW B;  3KSQ A;  3RO3 A;  3ZFW A;  3U5N A;  2NXP A;  2LDR A;  2C2L A;  5EX0 A;  2C0M A;  3L17 A;  3NG2 A;  3ZVZ B;  3AAA C;  4YVQ C;  2JMD A;  4F53 A;  1VFY A;  2VSO E;  2DYR E;  3G2S A;  5FZS A;  2P9P G;  3FTX A;  5CRU A;  4P29 A;  1FBV A;  4V3L C;  4GNF A;  3UQ3 A;  3L13 A;  3SHB A;  2RKK A;  3KEZ A;  5T3R A;  3NOC D;  4GPK A;  1DVP A;  2MRI A;  1ELK A;  2FD4 A;  2L7P A;  1HU3 A;  5FIN A;  1UN9 A;  4KVM A;  2EA6 A;  3UT7 A;  3FTU A;  2XOC A;  2LSV A;  4PS8 A;  1HFA A;  5LKU A;  2F6N A;  4N2S A;  1YMP A;  2XGO A;  4B7Y C;  3SI5 A;  2Y43 A;  5LCW J;  3MV3 B;  3DWD A;  4BSX A;  4ANW A;  2KKX A;  3I4R B;  1JM7 B;  1U3C A;  1H6O A;  3CVL A;  2DCP A;  2CG2 A;  1Z3Y A;  2PL2 A;  1P5Q A;  4ZDT A;  2XEE A;  2M13 A;  1FP0 A;  3V2X A;  3SGH A;  1IYG A;  4UWK A;  4UI9 B;  3Q7F A;  3UX4 A;  5AN8 A;  3KV6 A;  3Q1D A;  4LAD B;  2L5U A;  1SA5 A;  3JCK C;  4PS7 A;  4NAC A;  1FVH A;  2WXJ A;  4KT6 B;  3Q9N C;  3L08 A;  2H6I A;  2WXP A;  3CK7 A;  3PVL A;  2WPV A;  3NB2 A;  2BF0 X;  3FEY A;  4YBT A;  3ZGQ A;  3IEG A;  4BX8 A;  5H9M A;  1BI8 B;  4G26 A;  1YA0 A;  3RRN B;  2HR2 A;  1N54 A;  2ION A;  2WXQ A;  4ANX A;  1MJ0 A;  3VLF A;  2MNZ A;  3M62 A;  4GNE A;  1ELR A;  2KZT A;  3D9P A;  3ZPV E;  4OAU C;  4G1T A;  5AQA A;  4DLQ A;  3EUV A;  4KMO A;  4LG6 A;  3B7U X;  3IBE A;  3EU5 A;  4YDE A;  3M99 A;  5BXU A;  2YVR A;  2VSX E;  2IJG X;  4APF A;  1O1S A;  4NIK A;  2IQJ A;  3B7B A;  4FU3 A;  5JA4 D;  1SA4 A;  2YSJ A;  2IOS A;  2I1J A;  4O1P A;  1VDY A;  3ABM E;  2ZGD A;  3RRM B;  2KCL A;  5KNG A;  5TRB A;  3WG7 E;  1X4J A;  4ZUX U;  2FF4 A;  1WEW A;  2OWA A;  3PUR A;  1OT8 A;  5B76 A;  2YSM A;  2HM8 A;  5JHA A;  1E7V A;  2WVI A;  1N95 A;  5SVI B;  4YND A;  3E2D A;  4CCG X;  2VSN A;  4GZC A;  3L1X A;  2YU4 A;  2XCC A;  4HB5 A;  1HG2 A;  3AG1 E;  3S7J A;  3UUX A;  1EPU A;  4HS2 A;  3ABL E;  3X2Q E;  3PH0 C;  3R9M A;  4YAX A;  4HRM B;  2KGI A;  4QF3 A;  4AVX A;  1N0Q A;  3TWQ A;  3D9I A;  5JMN D;  2OV8 A;  3FTY A;  4P5O B;  3SUB A;  3EHN A;  3GL6 A;  2OEV A;  1OWP A;  3JXI A;  2J49 A;  2KWN A;  1MX6 A;  1TN6 A;  4WND A;  5CBN A;  1IHB A;  3TG5 A;  4HLE A;  2HDP A;  4GTV A;  5E76 A;  3KDE C;  3UM3 A;  2J4D A;  2LSU A;  1RMD A;  5D0Q D;  3HRA A;  2M63 A;  3RPG C;  2EIL E;  3T5V A;  3ZVV A;  2YHN A;  2AXZ A;  2KM4 A;  3I5P A;  4DPR A;  3SQV A;  3LDY A;  2VYI A;  3LPZ A;  3LJ3 A;  4GCN A;  3CHO A;  3PUQ A;  4LUN U;  2LXH C;  3TWX A;  4JZY A;  2KGG A;  3O33 A;  3O36 A;  1JCS A;  4RVB A;  3LJN A;  3I3N A;  2WXN A;  3C3Q A;  3ML9 A;  4K5C A;  1QNF A;  2MOW A;  1E4U A;  3O47 A;  1TEZ A;  5KJL A;  3HXC A;  3Q9U C;  4BX9 A;  3B13 A;  2VGX A;  3S7F A;  4N5Q A;  2WM9 A;  3SF4 A;  3PE4 A;  1SQM A;  3CVQ A;  1UN8 A;  5B77 A;  3D3M A;  4N39 A;  2WMO A;  4I6E A;  2DZO A;  3T6R A;  5B1B E;  4I6G A;  1KPS B;  1IQU A;  1GW6 A;  2H6F A;  1UW4 B;  5D1L B;  2VTB A;  1Z2Q A;  3GV4 A;  3N9Q A;  3UKU G;  3ASF A;  5D0O D;  2XPI A;  3U64 A;  2FI7 A;  3DWL G;  4WZ2 A;  4L7X A;  5M72 A;  3JYS A;  3C5R A;  5BNW A;  2UZG A;  5DBK A;  4GA2 A;  4Q6F A;  2XGM A;  3P1U A;  3FTW A;  2P9S G;  3L16 A;  3Q73 A;  1ZBD B;  1L5J A;  3JUI A;  2WMN A;  4Q94 A;  2IO2 C;  1WES A;  1HH8 A;  2C0L A;  4R7E A;  3CEQ A;  3CHS A;  5KJN A;  4S3O B;  3LCA A;  4U8Y D;  4G25 A;  4FK5 A;  1Q2Z A;  5FZR A;  3J5Q B;  1WEM A;  2B0O E;  3MKQ A;  1WAO 1;  3KV5 A;  3AS4 A;  2V0P A;  3Q47 B;  2CSV A;  2PNX A;  5HI7 A;  3T8M A;  2GRO B;  2ECV A;  4WZ0 A;  4ATZ D;  4TKP B;  1BLX B;  3UM0 A;  2FUL A;  2R03 A;  3CKB A;  2XS8 A;  4KYO B;  5G0F A;  3C98 A;  3FEH A;  3HVE A;  1BOR A;  3UMV A;  3T7L A;  2BKK B;  4B94 A;  2NSZ A;  3MX3 A;  3M7K A;  4ILI A;  4GNG A;  3FY4 A;  3DSS A;  4LRZ A;  2E61 A;  5G05 J;  4GND A;  2Y4T A;  5G2N A;  2Y4U A;  4OGE A;  5EDS A;  4UP0 A;  4K5B A;  2MKE A;  2GGF A;  3ZYQ A;  3HXF A;  1XNF A;  1K1A A;  3L54 A;  3RKV A;  1UOH A;  4K5A B;  5G05 C;  3SY2 A;  3KEA A;  4ZQL A;  2K17 A;  2V4H C;  4FIP A;  5H7P A;  3DEO A;  2BKG A;  4NRH B;  4WUY A;  2WXM A;  3RJV A;  2ZIS A;  3TL5 A;  4ACL A;  2OXQ C;  4F1P A;  1OWL A;  4GTQ A;  3G2U A;  4U0S A;  3SOX A;  4I17 A;  3ULE G;  3KQI A;  3U3W A;  3D9L A;  2XS1 A;  4AEZ C;  1X5B A;  3V79 K;  1LDJ B;  2MIQ A;  3MV2 B;  1PC2 A;  2XB1 A;  4F52 B;  5D2M C;  4J8F A;  1E8X A;  3G2T A;  2OOE A;  2I6H A;  2I9C A;  4A49 A;  4I1A A;  2MA6 A;  2EOD A;  2F6J A;  3FU6 A;  3CVN A;  3JXJ A;  2NYJ A;  5LFA A;  3D9K A;  1Z60 A;  1E8W A;  4RG9 A;  3S2A A;  5DKA A;  2KCV A;  4M7C A;  1X4I A;  1AWC B;  4WWP A;  4GU5 A;  4FAD A;  4I7C A;  2CKL A;  4GB9 A;  2PM7 A;  4BER A;  3O34 A;  3RTR B;  2A4Z A;  3B7T A;  3FU5 A;  1Z6U A;  3VK6 A;  3D9H A;  3CV0 A;  2LXP C;  3FEX A;  1D8E A;  3ZU7 B;  5B79 A;  4DX6 D;  4AP2 A;  3ZIM A;  4AIF A;  3U4T A;  2IU1 A;  1EF1 C;  3NZU A;  3M63 A;  4AYC B;  2FBN A;  5G04 J;  3FUL A;  2CSY A;  1N87 A;  3FAN A;  5ARG A;  1N4R A;  5AEN A;  3FUD A;  1QYM A;  3ASG A;  2XRZ A;  1TNZ A;  3L1Z B;  5D66 A;  2IOL A;  4LNG A;  2L6J A;  4ILH B;  4CRW A;  3AJI A;  2XOY A;  3J5P A;  3HXB A;  4JEU A;  2P9K G;  2Y3A A;  1JWF A;  2QIZ A;  3RK6 A;  5EX3 A;  5FQ6 A;  3QC1 A;  2E0I A;  2MHK A;  2BAY A;  4OAV B;  1TYQ G;  1JUQ A;  4ZHB A;  2KFT A;  1N4P A;  4A4B A;  4HLL A;  1V87 A;  4Y6C A;  4O62 A;  3ZHE B;  4HOT A;  3V30 A;  4E85 A;  3CVX A;  4CT0 A;  4FLB A;  3PHD A;  1UG3 A;  4U8V D;  3E32 A;  1BPO A;  2RI7 A;  4Z0O A;  2ECN A;  5D1M B;  4BWR A;  4HXI A;  5K3Q A;  2LXL A;  2LRI C;  1OCO E;  3CHQ A;  2VJF A;  1UJK A;  2ZIR A;  2L0B A;  1TR4 A;  3TXM A;  3FU0 A;  3TWW A;  1IYM A;  4ANV A;  1H0A A;  3V2O A;  3ULY A;  1IXV A;  3PZ4 A;  4GYY A;  5FQ8 A;  3ZVY A;  2M85 A;  1S70 B;  4G23 A;  3UM2 A;  4UP5 A;  1A17 A;  4YDO A;  3T5X A;  4MS6 A;  4QQI A;  2FUU A;  5D1K B;  1S63 A;  4JHR A;  2HYE D;  3FH5 A;  2YNQ A;  2MUM A;  2OCC E;  5B8D A;  4XEI G;  2Y1N A;  3L82 A;  2M1R A;  1WDY A;  2GW1 A;  2FO1 E;  5LKX A;  1NP7 A;  3PUK A;  2YUR A;  2IFU A;  2K4D A;  3RIB A;  4ACK A;  5AYW D;  2X6I A;  2ECW A;  5TAB A;  2RD0 A;  3I4G A;  2ECG A;  2LN0 A;  2DX8 A;  4CDM A;  3CSF A;  2MA5 A;  5ENT D;  3PDN A;  3PZ1 A;  2Y69 E;  2YW8 A;  1WE9 A;  3K9I A;  5JJ6 A;  4GYW A;  2ZET C;  2KIZ A;  3N71 A;  1BI7 B;  3QB2 A;  1DC2 A;  2H0D B;  4AXH A;  5EYL A;  4CGW A;  1ZB1 A;  3FL2 A;  2JEK A;  4G8L A;  4YAT A;  4U8H A;  3IHP A;  3PUJ A;  4HRN A;  1DNP A;  2P9I G;  2KRE A;  1UJJ A;  3RSE G;  1H2V C;  1INZ A;  2G6Q A;  2Y0B G;  4YVO A;  3FJU B;  3C72 A;  5JJ7 A;  5AQ7 A;  2VTB B;  2MD7 B;  4LCT A;  2YRE A;  3BG0 B;  3IV0 A;  5AJD A;  4AP4 A;  4M3O A;  4U96 D;  1WIM A;  2P2C P;  4BFR A;  2VPE A;  3DXM G;  2WXK A; 
#chains in the Genus database with same CATH homology
 4G11 A;  3APD A;  3AS8 A;  5E76 A;  4DLO A;  4J8D A;  4JVS A;  2J4D A;  2LSU A;  2XEV A;  4UQY A;  3SHF A;  2YHO A;  3ZNI A;  1RMD A;  3ESK A;  5D0Q D;  3MCX A;  3AS5 A;  2M63 A;  1H2T C;  3PS6 A;  4NQ0 A;  3RPG C;  3QK0 A;  4PTB A;  2XQ0 A;  5KH9 A;  2WQ6 A;  3ZPV 1;  2IDA A;  4LER A;  5EKQ D;  4HFG A;  3T5V A;  5FWQ A;  3ZVV A;  2YHN A;  5G55 A;  2AXZ A;  1FVF A;  3JQ1 A;  2KM4 A;  4BBQ A;  3I5P A;  4DPR A;  4I43 A;  4WA6 A;  2LAH A;  3MKR A;  1MQS A;  2VYI A;  5FT9 A;  3WXX A;  4EZL A;  1Y6I A;  3C6W A;  3LPZ A;  3LJ3 A;  2YT5 A;  3FUE A;  4JL0 A;  3MGB A;  4GCN A;  5C2Y A;  5CHE E;  3CHO A;  3FUJ A;  3EB6 A;  3LS8 A;  3PUQ A;  5AIU A;  4LUN U;  1ELW A;  2LXH C;  1WY6 A;  4JZY A;  4CDN A;  3LY7 A;  1MM3 A;  2KGG A;  3O33 A;  3O36 A;  4RVB A;  2XEU A;  3PEU B;  2WB2 A;  2L9B A;  2I1K A;  1H19 A;  2X6K A;  3EJN A;  3I3N A;  3CHP A;  3O48 A;  4EEC A;  2DBA A;  4LLB A;  4HOU A;  4S3O C;  4IRU A;  2VPG A;  1OWM A;  2AWI A;  4UWF A;  2KWJ A;  3GZ2 A;  4UWL A;  2WXN A;  4D10 C;  2VJE B;  3ML9 A;  3LYA A;  4HOS A;  4FO9 A;  3MZL B;  2WQH A;  1QNF A;  2D8S A;  2LGV A;  5TDR A;  4K0R A;  3ESL A;  3CVP A;  2MOW A;  4LKA A;  5LKT A;  3FTZ A;  4A1G A;  1E4U A;  1EDU A;  2CT2 A;  4URK A;  3LQI A;  3QNK A;  4R2Y A;  3ZEF A;  3CR3 A;  4XX5 A;  3OXG A;  4UQX A;  1TEZ A;  5KJL A;  3LXU X;  1KLX A;  1WEE A;  4BX9 A;  3B13 A;  1X4U A;  3LDZ A;  3Q4A B;  2VGX A;  3HDX A;  4ME2 A;  3S7F A;  5FB1 A;  5JG6 A;  3RO2 A;  1E90 A;  3QOU A;  2WM9 A;  1WGM A;  3SF4 A;  4XI0 A;  2VPB A;  3PE4 A;  2KC7 A;  4XZ4 A;  5H1T A;  5FJY A;  5G04 C;  1SQM A;  1XGW A;  1UN8 A;  3CVQ A;  5B77 A;  2LAI A;  3D3M A;  1HO8 A;  3B7R L;  3IKO B;  2X38 A;  3PZD A;  4N39 A;  1HE8 A;  3LVR E;  2WMO A;  3DPD A;  4I6E A;  2AVP A;  4N5C A;  3VTX A;  4UQZ A;  5CCM A;  2VP7 A;  5FB0 A;  3T6R A;  4BY6 A;  4I6G A;  3CHR A;  4GYO A;  3CVY A;  3O7A A;  3SD5 A;  1CHC A;  1IQU A;  3FUI A;  4IN3 B;  1GW6 A;  5D1L B;  1UW4 B;  2RG8 A;  2VTB A;  4KXK B;  1Z2Q A;  3GV4 A;  3N9N A;  5C11 A;  2CHW A;  2QIC A;  3N9Q A;  4MKT A;  4WNF A;  3ASF A;  2CFU A;  2XPI A;  5D0O D;  3U64 A;  3G2V A;  3FFL A;  2FI7 A;  4WZ2 A;  4E6H A;  2JMJ A;  4KZ0 A;  4I7B A;  4A3V A;  4L7X A;  3QAQ A;  3ZXS A;  5M72 A;  3JYS A;  3RRN B;  2VJF B;  5BNW A;  2L43 A;  3MHS A;  2I2O A;  3VTY A;  4EQF A;  2UZG A;  2JRJ A;  5DBK A;  2JLB A;  3EIQ C;  4TRQ A;  2PM6 A;  4QFV A;  4GA2 A;  1FCH A;  2LGG A;  4Q6F A;  3R7R A;  2XGM A;  3P1U A;  3FTV A;  4BTB A;  3FTW A;  5AJL A;  4V3K C;  1HZ4 A;  2OVB A;  4GZ5 A;  3L16 A;  2CG3 A;  1ZBD B;  2XGS A;  1L5J A;  3JUI A;  5AIT A;  2WMN A;  5CMW A;  4Q94 A;  3OAW A;  2PUY A;  4WNG A;  1WES A;  1JPL A;  2EQX A;  1HH8 A;  2C0L A;  3Q49 B;  4R7E A;  1OWN A;  1Z6T A;  3MJW A;  3CEQ A;  2VSY A;  3CHS A;  4JC8 A;  3URZ A;  2E6S A;  4DI4 A;  4DI3 A;  2XPZ A;  2MD8 C;  3Q5M A;  3EDT B;  4G2V A;  4XKB A;  5KJN A;  5C13 A;  4S3O B;  3LCA A;  1B89 A;  4G25 A;  4FK5 A;  3LY9 A;  5FZR A;  5ARF A;  3CHM A;  4B8A A;  1WEM A;  3TGO A;  2A5U A;  4FJY A;  2J9Q A;  1WEO A;  5ANR A;  1Z3X A;  1ZU2 A;  3UT8 A;  3FH8 A;  3ZYL A;  1LF8 A;  4AM9 A;  3MEK A;  1JWG A;  2WXO A;  3N9L A;  1WIL A;  3N9O A;  1G25 A;  3MKQ A;  1WAO 1;  3EIJ A;  5KCM A;  3SBT B;  3AS4 A;  4EPZ A;  2V0P A;  3Q47 B;  3KV5 A;  4BHW A;  3IHY A;  3SNX A;  4A4B A;  3HHM A;  2PNX A;  3FUH A;  5HI7 A;  1U6G B;  3HCS A;  2VGX B;  3QWW A;  3T8M A;  2ECV A;  4UWG A;  3TG4 A;  3PRE A;  4WZ0 A;  2CKL B;  4TKP B;  4R7L A;  4Y6W A;  4KBQ A;  3CKC A;  3CQG B;  3RRU A;  2FUL A;  3ZN3 A;  1NA3 A;  4U04 A;  3O35 A;  4XI9 A;  1WEU A;  3CKB A;  3PEV B;  4KYO B;  2BUG A;  5G0F A;  3ZTG A;  3FUK A;  3KNV A;  3ZYK A;  4W4U A;  3C98 A;  3IHV A;  3HVE A;  5KH3 A;  1E96 B;  4MRU A;  2ZU6 B;  3UMV A;  1BOR A;  4GA0 A;  4CA1 A;  5G04 B;  3T7L A;  1IQR A;  4B94 A;  4GZ6 A;  2NSZ A;  3KD7 A;  3MX3 A;  4ILI A;  4ABN A;  2CHX A;  3GZS A;  3FY4 A;  2R59 A;  3PE3 A;  5LOZ A;  2WQ7 A;  1VYX A;  4LRZ A;  3LRQ A;  5G05 J;  4GND A;  3S7D A;  4WZ3 B;  4OVU A;  5AIJ A;  4FJC A;  3OXL A;  5TDW A;  2Y4T A;  4HOR A;  5G2N A;  2Y4U A;  2AXU A;  2YQM A;  5EDS A;  5EYA F;  4UP0 A;  3FUN A;  2GGF A;  3ZYQ A;  3NQP A;  4FC8 A;  2LV9 A;  2X3M A;  3BEE A;  1QQE A;  4I7D A;  1XNF A;  3L54 A;  2IQC A;  4FP7 A;  3RKV A;  1KT0 A;  4TUU A;  3SFZ A;  2J08 A;  4HVB A;  2E6R A;  5G05 C;  4EZJ A;  4QF2 A;  4ZQL A;  4PPE A;  4WAF A;  4LEU A;  2YQL A;  1WEQ A;  2WXI A;  2CSZ A;  3CK9 A;  3TAX A;  2K17 A;  5FQ7 A;  3EB5 A;  4FJZ A;  1NZN A;  4U0Z A;  4N2Q A;  4FIP A;  2AXV A;  3DBS A;  4DK5 A;  1ZBP A;  4I2Z A;  3CQC B;  3SBS A;  2NC9 A;  4NRH B;  2FEZ A;  5BV0 A;  4WUY A;  4V3I A;  4L1B A;  2WXM A;  2YIN A;  3LVQ E;  3RJV A;  4XKC A;  3APF A;  3U5P A;  3LKU A;  4AP4 A;  4PUC A;  2OND A;  3MYV A;  5J3X A;  3R9A B;  4ACL A;  3TL5 A;  4Q69 A;  2OXQ C;  3ONL A;  5BPP A;  4H7Y A;  1OWL A;  5DIZ A;  3UT4 A;  3G2U A;  4JA7 A;  4C0M A;  1OWO A;  4U0S A;  5G05 B;  4AV7 A;  3SOX A;  4I17 A;  1HYJ A;  3KQI A;  3U3W A;  3D9L A;  2PQR A;  4AEZ C;  1X5B A;  1VD4 A;  4BTA A;  5T4Y A;  1LDJ B;  4A55 A;  4FUL A;  2G45 A;  2MIQ A;  3FDH A;  3MV2 B;  4JHJ A;  2J4B A;  1PAQ A;  3B7S A;  5H1U A;  3HCU A;  3KS2 A;  1PC2 A;  2UY1 B;  2XB1 A;  1E8Z A;  4GCO A;  3MKQ B;  4YBS A;  4W9R A;  1KT1 A;  1TJF A;  4PDX A;  2F42 A;  4Q96 A;  4F52 B;  3BG1 B;  4GMJ A;  4J8F A;  1E8X A;  3NF1 A;  3G2T A;  4I2W A;  3OXF A;  3U5M A;  4J8E A;  3HYM B;  4L2Y A;  2OOE A;  2I6H A;  2Q7F A;  2I9C A;  3G2W A;  5BV1 A;  2WXR A;  2J09 A;  1WFK A;  4A49 A;  4K03 A;  5A23 A;  2KYU A;  3O37 A;  4DJA A;  5TBN A;  4I1A A;  2MA6 A;  2BTD A;  2ILR A;  3QKY A;  2EOD A;  2F6J A;  3FU6 A;  3CVN A;  4BT8 A;  3FUF A;  5LFA A;  2AN6 A;  3SOU A;  5KJM A;  2KCK A;  2GRL A;  3D9K A;  5T8I A;  1XWH A;  1Z60 A;  1E8W A;  2H0D A;  3N9M A;  4RG9 A;  3HVE B;  3JQ0 A;  3S2A A;  4L2L A;  4GAA A;  5DKA A;  5BUZ A;  2KCV A;  2XCB A;  3ASH A;  1LDK C;  1X4I A;  4WWP A;  2YQ8 A;  2ECT A;  4GU5 A;  4AY5 A;  4FAD A;  1N52 A;  4I7C A;  4WWO A;  4U63 A;  4UI9 C;  4LJN A;  4A1S A;  1HXI A;  2V8S E;  2QFC A;  5BW8 C;  2CHZ A;  2E2E A;  5C1D A;  2CKL A;  2PQN A;  2YHC A;  4GB9 A;  4I1O B;  4CT4 A;  2PM7 A;  3CLJ A;  2KR4 A;  4KZC A;  2P58 C;  4H7X A;  4EBA G;  3RU0 A;  3QWP A;  3O34 A;  3RTR B;  2A4Z A;  3B7T A;  3HTK C;  3FU5 A;  4FA6 A;  1Z6U A;  3VK6 A;  2WXL A;  4JEH A;  4NN2 A;  2HO1 A;  2ECI A;  2JMI A;  3U5O A;  4G24 A;  2WXG A;  3CV0 A;  2LXP C;  1WEP A;  4U07 A;  2CFZ A;  1HS6 A;  2QY7 A;  2GRM A;  3FEX A;  3E4B A;  4AUQ B;  5B79 A;  4O6F A;  3ZPJ A;  4NUR A;  4AP2 A;  5LCW B;  3ZIM A;  4MVT A;  4GB0 A;  4AIF A;  4JA9 A;  3PNT B;  4YAB A;  2WXF A;  2WXH A;  3L22 A;  2R17 C;  2IU1 A;  3U4T A;  3RO3 A;  3ZFW A;  2M6M A;  1EF1 C;  4CCA A;  2NXP A;  5B78 A;  2LDR A;  2C2L A;  2UY1 A;  5EX0 A;  3U5N A;  3HIZ A;  2C0M A;  3L17 A;  3NG2 A;  2VGY A;  3ZVZ B;  3NZU A;  3AU4 A;  3CIA A;  3M63 A;  4YVQ C;  2JMD A;  4F53 A;  3FWV A;  2VSO E;  2FBN A;  1VFY A;  4AYC B;  5G04 J;  3FUL A;  3LEW A;  1N87 A;  4F1S A;  2CSY A;  2R5S A;  2LGL A;  3G2S A;  5ARG A;  4I6J A;  1S0P A;  5AEN A;  5FZS A;  3LQH A;  1HF8 A;  3QAR A;  3FTX A;  3FUD A;  4N3W A;  1EYH A;  2AW6 A;  4P29 A;  1FBV A;  3VLD A;  3ASG A;  2XRZ A;  4V3L C;  4GNF A;  3UQ3 A;  3FTS A;  3L13 A;  4GZD A;  3L1Z B;  3ASL A;  3VLE A;  4KVO A;  3SHB A;  3TJP A;  2IOL A;  3KEZ A;  3QJZ A;  5T3R A;  2L6J A;  4ILH B;  4CRW A;  1H2U A;  3D9O A;  4MLP A;  4GPK A;  3ENE A;  1DVP A;  3OTN A;  4I9C A;  4C9Z A;  2MRI A;  5B75 A;  4YBM A;  3C5K A;  1ELK A;  1HU3 A;  1SZ9 A;  3CVV A;  5A7D B;  2V4L A;  4I1M A;  4B8C B;  2VNF A;  5FER A;  1UN9 A;  4JEU A;  4KVM A;  5FQ4 A;  4UI9 K;  2EA6 A;  3ZW3 A;  3UT7 A;  3FTU A;  2XHE A;  4OYS A;  2LSV A;  4PS8 A;  1HFA A;  1WM5 A;  3D9J A;  5LKU A;  2Y3A A;  1JWF A;  4APO A;  2F6N A;  3QDN A;  4AY6 A;  4N2S A;  2QIZ A;  3RK6 A;  3QZV A;  2LNI A;  5LKZ A;  4N3C A;  3U9W A;  2XGO A;  2ECJ A;  3SI5 A;  2QJ0 A;  4GZ3 A;  5EX3 A;  2Y43 A;  5FQ6 A;  3MV3 B;  5LCW J;  4JHK A;  4BSX A;  3QC1 A;  4C9B B;  2E0I A;  2MHK A;  3PNL B;  3I4R B;  4ANW A;  1K2F A;  1U3C A;  2BAY A;  3QWV A;  1JM7 B;  4GA1 A;  1HYI A;  1JUQ A;  4BT9 A;  1WEV A;  1E7U A;  3CVL A;  3CVW A;  2PZI A;  3DPL R;  3MHH A;  2DCP A;  2CG2 A;  1Z3Y A;  2PL2 A;  3FP3 A;  4A3T A;  2KFT A;  4HOQ A;  1U3D A;  1P5Q A;  2M3H A;  2MNY A;  4X3G A;  4ZDT A;  2L0I A;  2DIW A;  5JHB A;  4Y6C A;  1V87 A;  3ZHE B;  4HOT A;  4FLH A;  4L58 A;  4JXT A;  1FP0 A;  4E85 A;  3SGH A;  1IYG A;  4UWK A;  3FHE A;  3LQJ A;  4UI9 B;  3CVX A;  3UX4 A;  4CT0 A;  4FLB A;  3PHD A;  1UG3 A;  3U66 A;  3KV6 A;  4LAD B;  2L5U A;  3JCK C;  4JW1 A;  4OVV A;  4PS7 A;  4NAC A;  1BPO A;  4FHJ A;  1FVH A;  2RI7 A;  3GYZ A;  2WXJ A;  2ECN A;  5D1M B;  4BWR A;  4KT6 B;  4ILG A;  1T1H A;  2EGP A;  1H6K A;  3L11 A;  4HXI A;  5LCW C;  1PY1 A;  2G43 A;  3L08 A;  2LRI C;  3HCT A;  2X6F A;  2WXP A;  3CK7 A;  3PVL A;  2FUI A;  2K16 A;  2KU3 A;  2WPV A;  4RG6 A;  2L0T B;  4RSY A;  3CHQ A;  3R7Q A;  2VJF A;  3NZS A;  2BF0 X;  3FEY A;  3TXN A;  4YBT A;  2MT5 A;  3ML8 A;  1IHG A;  1UJK A;  3IEG A;  2VQ2 A;  4WNE A;  3ZGQ A;  4BX8 A;  3TXM A;  2L0B A;  3FU0 A;  5H9M A;  4B7Y C;  1IYM A;  1NA0 A;  5KH7 A;  4G26 A;  4ANV A;  1YA0 A;  2VPD A;  1H0A A;  2HR2 A;  1N54 A;  3FH7 A;  3APC A;  3GZ1 A;  1TJC A;  4I9E A;  2ION A;  2WXQ A;  3CK8 A;  5ANL A;  3V43 A;  4N3B A;  2RSD A;  3LY8 A;  4CDR A;  4ANX A;  3ASD A;  4GYY A;  5FEY A;  1MM2 A;  5FQ8 A;  2I50 A;  5JJT A;  3ZVY A;  2M85 A;  3M62 A;  3VLF A;  5CCL A;  2MNZ A;  4G23 A;  4GNE A;  4UP5 A;  2YUC A;  1A17 A;  1ELR A;  2KZT A;  3D9P A;  3T5X A;  4MS6 A;  2K1J A;  3ZYM A;  2L75 A;  4ANU A;  2FUU A;  3ZPV E;  4PS3 A;  5D1K B;  4G1T A;  5E75 A;  4JHR A;  2HYE D;  3FH5 A;  2KAT A;  4AYC A;  3AU5 A;  2YNQ A;  4EZK A;  2MUM A;  4DLQ A;  5FTP A;  2KWK A;  1E8Y A;  5A6C A;  2KWO A;  4XIF A;  4AJW A;  5B8D A;  4ATG A;  4KMO A;  2Y1N A;  2Y1M A;  3FUM A;  3B7U X;  3IBE A;  4B89 A;  3M99 A;  2M1R A;  2GW1 A;  3CGH A;  5LKX A;  1NP7 A;  2IF4 A;  3PUK A;  4IUL A;  2VSX E;  2YUR A;  4IC3 A;  4LK9 A;  2IFU A;  3ONK A;  5J90 A;  2IJG X;  4APF A;  3O70 A;  1QZ2 A;  3UPV A;  2J07 A;  4FU3 A;  2K4D A;  3RIB A;  4ACK A;  2YSJ A;  5AYW D;  4J8S A;  5HQ8 A;  2IOS A;  2I1J A;  4N3A A;  2X6I A;  2ECW A;  4J0U A;  4J6I A;  5TAB A;  3SOW A;  2RD0 A;  3I4G A;  1JM7 A;  1VDY A;  2VJ8 A;  2ECG A;  5H1V A;  4CGV A;  5FZQ A;  2LN0 A;  1Y8M A;  2DX8 A;  3RRM B;  4CDM A;  3CSF A;  3SZ7 A;  2KCL A;  2FSA A;  2MA5 A;  5TRB A;  3D9N A;  3PDN A;  3L6A A;  4R8P K;  1X4J A;  2YW8 A;  4ZUX U;  3P2B A;  1WE9 A;  3KAE A;  2FF4 A;  3K9I A;  5JJ6 A;  1WEW A;  4TV3 A;  4GNG A;  4U0U A;  3I2D A;  3PUR A;  4GML A;  4XE0 A;  3PRZ A;  4EBA A;  4GYW A;  3ULQ A;  5B76 A;  2ZET C;  4WWN A;  2KIZ A;  2YSM A;  2HM8 A;  5I3L A;  4UI9 J;  2L80 A;  5JHA A;  4B86 C;  3N71 A;  3DQV R;  2V5F A;  1E7V A;  3QB2 A;  2WVI A;  4C0E A;  3Q15 A;  3CVU A;  4YND A;  2H0D B;  4AXH A;  3S7B A;  2X6J A;  4CCG X;  2VSN A;  2YYR A;  4UWH A;  4JPS A;  4GZC A;  3L1X A;  2YHE A;  4CGW A;  1OUV A;  4FHK A;  2OVF A;  3GW4 A;  4IC2 A;  3ZHE A;  2FO7 A;  3EHM A;  2YU4 A;  2XCC A;  5ENN A;  3FL2 A;  2JEK A;  2NAA A;  3N9P A;  4YAT A;  4YAD A;  1HG2 A;  4U8H A;  1HX8 A;  3PUJ A;  3S7J A;  3UUX A;  2KE1 A;  2LQ6 A;  1DNP A;  3IHP A;  4MSX A;  4PH4 B;  4A4C A;  3ZRH A;  1EPU A;  4HS2 A;  2KRE A;  5BT1 A;  1UJJ A;  1JOC A;  4L23 A;  3PH0 C;  4N4F A;  2X6H A;  4AOF A;  3MA5 A;  5KJK A;  1H2V C;  4L7T A;  1INZ A;  2C2V S;  1HG5 A;  2VJE A;  4YAX A;  2KGI A;  3FU3 A;  3D9M A;  2LGK A;  3O4Z A;  2G6Q A;  2UWJ G;  4YC9 A;  4QF3 A;  4YVO A;  1F62 A;  4AVX A;  5CMY A;  5JJ7 A;  5J08 A;  3RPG B;  2XRY A;  4B0Z A;  4CEM A;  2KZT B;  3D9I A;  2VTB B;  5DIN A;  4A0C D;  2OV8 A;  2MD7 B;  3FTY A;  4P5O B;  2XPY A;  4LCT A;  1W3B A;  2LO6 A;  3EHN A;  2YRE A;  3GL6 A;  3BG0 B;  3IV0 A;  5AJD A;  1OWP A;  5LX8 A;  4O64 A;  4M3O A;  5LP0 A;  2J49 A;  4IYP A;  2KWN A;  4XI1 A;  4WND A;  1MHQ A;  4F7A A;  3CST A;  1WIM A;  3TG5 A;  4F3V A;  1SZA A;  4BFR A;  4HLE A;  1WEN A;  2VPE A;  2HDP A;  2HYZ A;  2WXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...