3ZYQA

Crystal structure of the tandem vhs and fyve domains of hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) at 1.48 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
216
structure length
216
Chain Sequence
GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) at 1.48 A Resolution
rcsb
source organism Homo sapiens
molecule tags Signaling
molecule keywords HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
total genus 73
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zyqA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zyqA02
2QY7A 2MT5A 4AYCA 1H0AA 4GB0A 4BHWA 2ECJA 2KWNA 5LKXA 2LGVA 1WEOA 1FBVA 2ECNA 3N9OA 4P5OB 3CLJA 2YQLA 4YATA 2CKLA 3N9PA 1JWFA 3M63A 3LRQA 3ZYMA 2LV9A 1HFAA 2QIZA 3MHSA 5B75A 3QZVA 3ZNIA 3G2SA 3N9NA 3G2VA 2PUYA 3KQIA 4N3WA 3O34A 3MHHA 2M1RA 1WEQA 2BF0X 4YBMA 5B76A 3NG2A 1VD4A 1Z2QA 2DX8A 4YBSA 5DINA 5I3LA 5LOZA 5AIUA 2IDAA 1X4JA 1LDJB 4I7CA 4A4CA 2F6NA 2M3HA 2YUCA 5DKAA 2YSMA 1LDKC 2LO6A 2L80A 4LJNA 2VJFB 5LP0A 5H1TA 2L75A 5TDWA 4W4UA 2L0TB 2LGLA 2ECTA 2VJEA 4WZ3B 1XGWA 4GNEA 2JMDA 2LXPC 2Y1MA 3M62A 2K1JA 5FERA 3LQHA 2KWKA 2L0BA 2E6RA 1F62A 2CKLB 1JM7B 3T7LA 3ZPVE 4PTBA 4FJCA 3V43A 2F6JA 2KYUA 1MHQA 1UJJA 3DPLR 2F42A 2YW8A 4BBQA 5KH7A 4YBTA 3L1XA 4F52B 3SOXA 1MM2A 4IC3A 4YAXA 3ONLA 4XI1A 2Y43A 3SHBA 1INZA 3RPGB 3D9MA 4AP4A 2RSDA 1HYIA 2VNFA 4Q94A 2OXQC 4LADB 5KH9A 3G2WA 1DVPA 2M85A 4UP0A 3EB6A 5FB1A 2H0DA 3ZYLA 1V87A 2YSJA 1RMDA 3N9QA 4A4BA 5CMWA 1WEWA 2ZETC 2VPBA 4MVTA 2Y1NA 2ECVA 1WEEA 3ONKA 3PHDA 4GZDA 1SZAA 3M99A 1MM3A 2YREA 2JMJA 4L58A 1HF8A 4MSXA 3D9LA 2EA6A 5EYAF 4I7BA 4R8PK 5D1LB 2YU4A 5B8DA 5H1UA 2KREA 4NN2A 2XEUA 4CCGX 1WENA 3D9NA 4S3OB 5KH3A 3C6WA 5TRBA 3U5PA 2FSAA 4WZ0A 2K17A 4V3LC 1T1HA 1WGMA 5H9MA 1ELKA 3RTRB 3U5NA 4A49A 4S3OC 1PY1A 3L1ZB 5FEYA 1HX8A 3D9OA 3SOUA 4A0CD 2CSZA 1Z6UA 3HCSA 1VDYA 1SZ9A 4TKPB 4AYCB 1G25A 2AN6A 2C2LA 5JG6A 4UP5A 1JM7A 2KR4A 4YC9A 2VPEA 4LLBA 2ECWA 1JOCA 3O70A 5C11A 3SOWA 2RI7A 1EDUA 5D1KB 1IYMA 4NACA 2XB1A 1WESA 2YHNA 1VYXA 1UJKA 2V8SE 2VPGA 2KE1A 3ZVZB 2L5UA 3T6RA 3LQIA 2KFTA 2ECIA 2CSYA 2VP7A 4Q96A 2VJEB 4GNDA 4FU3A 1Z60A 4ZUXU 5AITA 4FIPA 2FUUA 4YABA 5J08A 5TBNA 5CMYA 2MIQA 4PPEA 4WZ2A 4GNGA 2YURA 3KNVA 3ZYQA 3O7AA 4FLBA 2LGGA 1HYJA 1EYHA 1WEVA 2G45A 4IC2A 1VFYA 2KGIA 1E4UA 5LCWB 1X4UA 3PUQA 2HYED 1HG5A 1CHCA 2UZGA 4FO9A 2CT2A 1JWGA 5G0FA 1WIMA 2DIWA 2L0IA 2MA5A 2KIZA 3LQJA 5FB0A 2VPDA 5B79A 2K4DA 3ZYKA 4WA6A 2YHOA 5C13A 2HDPA 3RPGC 3IHPA 4UI9B 4O64A 5B78A 1JPLA 2L43A 3LDZA 2DCPA 1ZBDB 4R2YA 4R7EA 3ZPV1 4LKAA 3U5MA 4X3GA 3C5KA 5LKUA 4GNFA 3O37A 3FL2A 5B77A 1BORA 2G6QA 3G2UA 3O36A 2YT5A 3DQVR 2MD8C 4HFGA 3VK6A 1WEUA 4ZQLA 4AVXA 4FK5A 3I2DA 4ZDTA 2LN0A 2M6MA 2MA6A 3PURA 2MD7B 2MNZA 2I50A 2H0DB 1WE9A 1WILA 3D9PA 2K16A 2NAAA 3D9IA 3RRUA 2FUIA 3KV6A 2MUMA 1X5BA 1WEMA 2KM4A 3N9LA 5D1MB 2KU3A 3D9JA 4Q6FA 1JUQA 2VJFA 4CA1A 2D8SA 1K2FA 3ZVYA 2PNXA 4I7DA 4N4FA 2EGPA 2ECGA 3GL6A 4QF2A 3N9MA 2YYRA 1HG2A 2YQMA 3G2TA 1N87A 4V3KC 5H1VA 5LKTA 2E6SA 5LKZA 4JXTA 4YADA 4C9ZA 3ZTGA 3O35A 2EODA 2LGKA 1WEPA 5J3XA 1LF8A 1WFKA 2MOWA 2KWJA 2LQ6A 3HTKC 3L11A 3EB5A 2C2VS 2KWOA 2QJ0A 5TABA 4LK9A 1X4IA 2QICA 2BAYA 2JMIA 1U6GB 5G05B 4QF3A 5TDRA 1FP0A 4B86C 4L7XA 2MNYA 2KGGA 3O33A 3U5OA 3D9KA 2JRJA 2G43A 2LDRA 2LXHC 3ASLA 4GZCA 3HCUA 5G04B 3KV5A 2LRIC 4B7YC 1XWHA 3GV4A 3HCTA 4AUQB
chains in the Genus database with same CATH superfamily
2WXIA 2QY7A 5EIBE 3ZEFA 3AS4A 4DI4A 4M7CA 2ECJA 3BG1B 4G8LA 4HQDA 3ASHA 2XHEA 3N9OA 5FIOA 2B6CA 4CDNA 2XEEA 5DBKA 3FU5A 4D10C 3U66A 2OCCE 4G23A 3MV2B 3ZYMA 5KJLA 2QIZA 3KSQA 4G1TA 2FFWA 3QZVA 4TXRA 3G2SA 3G2VA 2BEDA 4NIKA 3LKUA 3SI5A 3O34A 2AJAA 2XGMA 3HVEB 3CVLA 2OOEA 5B76A 5G55A 3TWXA 3FEYA 1VD4A 3FEHA 1JCRA 2X6FA 3NB2A 4BT9A 4YBSA 1E7UA 1MX6A 5LOZA 3Q47B 2XZTG 3MKQA 1LDJB 3U64A 4I7CA 3S7BA 4A4CA 5DKAA 2LXLA 2YSMA 2ONDA 3IHYA 4N39A 5ANRA 2VJFB 4YNDA 1O1RA 2CHWA 2V5QC 5AQBA 2VSYA 5CERB 4WWNA 1OWMA 1NI1A 2GRMA 4Y6CA 4BEPA 4UQZA 3I5PA 1TNZA 2AWIA 4YDWA 4XX5A 3CVXA 2CKLB 4G8KA 4J8SA 4I17A 2XCCA 4L2LA 5KJKA 5EYLA 1O1TA 4KVOA 5D0QD 3SNXA 3P1UA 2NSZA 2WXLA 5KH7A 4F52B 3SOXA 1MM2A 3KEZA 3V79K 1RZ4A 1OWLA 4JW1A 1YCSB 4RLYA 2AXZA 2WM9A 3TG4A 3RPGB 4UUCA 3MGBA 2OXQC 3PRZA 2IONA 2C0MA 1DVPA 3PDNA 3D9HA 1V55E 1TN8A 5AJDA 3AG2E 2NXPA 4AV7A 1V87A 4BFRA 2IO2C 1RMDA 3B7UX 2EIKE 2YSJA 2J49A 5CMWA 4A3VA 4MVTA 3ONKA 4GMLA 4U0SA 3M99A 5LFAA 1AP7A 1W3BA 3J5QB 4TUMA 3UPVA 2YREA 3TWRA 2WMOA 2WXQA 5EYPF 1WG0A 3CHSA 2R03A 3D9LA 4FULA 4Q69A 1H2VC 1E96B 2OVFA 5DIZA 3PNTB 4I7BA 5HI7A 5D1LB 1O1SA 2XEUA 1TNOA 1IHGA 2ZU6B 3R7RA 3U9WA 3W9GA 3R7QA 5TRBA 5G05C 3LYAA 3NZUA 2JABA 3NQPA 3S7DA 3V31A 1WGMA 5H9MA 5CCLA 4Y6WA 4A49A 3QJZA 3PREA 1PY1A 1HX8A 3D9OA 4WNFA 5BNWA 3SOUA 4A0CD 4O1PA 3FH7A 1H6KA 1RW2A 5ENPD 4QFVA 4TKPB 1G25A 4QQIA 5JG6A 2KATA 4OVUA 2ECWA 2RI7A 5CEDB 5ENTD 1WESA 5CEAA 3QWPA 2L5UA 3T6RA 3LY8A 1HU3A 2WXHA 2ECIA 2DYRE 3FTXA 3DPYA 3JQ1A 2VJEB 1E8XA 5D66A 1QQEA 4FU3A 3FEXA 2XPIA 1Z60A 2ZISA 1QBQA 2IJGX 4N3AA 5CMYA 3ML9A 1FVFA 4OGEA 4BX9A 4PPEA 4WZ2A 4ANVA 4GNGA 3JUIA 2RKKA 2LGGA 1HYJA 1EYHA 5ARFA 4IC2A 3EHNA 3I3NA 2XGSA 1X4UA 3R9AB 4UQXA 5FTPA 4BESA 1HG5A 4C48B 3LXUX 2XOYA 3UM2A 2ETAA 2DWZA 2WQ7A 2IFUA 1A5EA 2X6KA 3ABKE 3P2BA 3LJ3A 2DIWA 2ILRA 3Q7AA 4J8DA 2JEKA 5FB0A 5T3RA 3J5PA 4DX7D 2L6JA 5AYWD 4XE0A 2YHOA 5C13A 4IYPA 4GAAA 2LXMA 4U07A 4ACKA 2P9KG 3TWWA 4HNAD 3TGOA 4OYSA 3GZ2A 1AWCB 5A23A 4F3VA 4HOTA 5LKUA 3FTZA 3UT4A 2CG3A 4GNFA 4G26A 5G2NA 3HXCA 4I1OB 3UI2A 3G2UA 3IXEA 2WXPA 2YT5A 2IOSA 5EILA 3GZSA 3MDBC 3VK6A 3CK9A 1D9SA 4ATGA 4FK5A 4H9DA 3IV0A 2LN0A 3PUKA 4HB5A 2NC9A 2J9QA 3PURA 3FH5A 2I50A 2H0DB 1FVHA 3TWTA 1DCQA 3L16A 2IQJA 2NAAA 4JHJA 2WXGA 4U0UA 3D9IA 2MUMA 1N4SA 5LCWJ 2KU3A 2VJFA 4WWOA 4CA1A 3S7JA 2D8SA 4JHKA 3ZVYA 3MJWA 4I7DA 4N4FA 2EGPA 2P9LG 1N9AA 1KLXA 2ECGA 3C98A 4F7AA 3SUBA 4BX8A 2EINE 1HG2A 3G2TA 4RQIA 5G04C 4XKBA 1E8YA 4YADA 2R05A 2DVWA 4HOUA 4J0UA 4AIFA 4RG6A 1IQRA 2WXFA 2V4LA 1NA3A 1WEPA 5J3XA 4HRNA 5JMND 3CVPA 2XZDG 3WXXA 3FU0A 4EZLA 5C2YA 1U6GB 3EDTB 5G05B 4QF3A 5AARA 2JM3A 1SA4A 4HRMB 4P29A 3HCUA 2KBXA 4R7LA 3SBSA 4A1SA 4B0ZA 1IYGA 4QQ4A 3GV4A 1A17A 3UIPC 2P57A 5FQ8A 2ZGDA 2MT5A 3EHRA 2IEJA 1H0AA 4GMRA 4GTMA 1Y6IA 4U7EB 3APCA 2LGVA 3ZUVB 1WEOA 3JYSA 4CDRA 3HRAA 1TN6A 5EKQD 2E0IA 4GTRA 2CKLA 3ZFWA 1S0PA 3LRQA 2KKXA 5B75A 3BG0B 4J8YA 4HRLA 1UN8A 2L6BA 3LY9A 3TWSA 4B93B 3MKQB 2M1RA 3QOUA 3SZ7A 3B7RL 2WXJA 5EX0A 3TL5A 4J6IA 2P9UG 1Z2QA 5JHAA 3PZ4A 2WXNA 5DINA 5BPPA 5D2MC 4K5CA 3FDHA 4JZYA 1SVXA 2F6NA 1YYHA 4APOA 1DCEA 3CIAA 2YHCA 4LJNA 2XEHA 4YDEA 2L75A 5TDWA 4W4UA 2L0TB 2LGLA 2QFCA 3Q15A 1EF1C 3OTNA 4UQYA 2GRPB 3CHQA 2J4BA 5JHBA 4WZ3B 3V30A 2JMDA 2LXPC 2Y1MA 1N4RA 4GTOA 2KWKA 3L22A 5FWQA 3V2XA 3RSEG 1JM7B 3SFXA 1N11A 5ANLA 4L7TA 3V43A 2GGFA 4CT0A 2KYUA 1ELRA 2P9SG 3SY2A 4CYMD 1LD7A 2LAHA 4YBTA 5BV0A 2EIME 2ZIRA 5FZSA 1HH8A 1H2TC 4IC3A 3TAXA 4XI1A 2F8YA 3SHBA 4GMJA 3UQ3A 1N4QA 2F0YA 3CVUA 1WDYA 4I6EA 4DX1A 3D9MA 3LY7A 1Q2ZA 1H6PA 1HYIA 2VNFA 4L9PA 3G2WA 3PS6A 1FCHA 3PZ2A 3C5RA 5FB1A 3EUVA 3CK8A 1HZ4A 4ZFHA 3F6QA 3N9QA 2B0OE 2GRQB 1WEWA 2OEVA 2Y0BG 4K5AB 4C9BB 2IU1A 3PHDA 4GZDA 3KS2A 1SZAA 3RU0A 1MM3A 3PZDA 3O4ZA 5B1BE 4BY6A 1DNPA 1N95A 1HF8A 2X6HA 3U4TA 2FF4A 5AAOA 2I6HA 3CR3A 3ASOE 3MEKA 1S64A 1U3CA 5CCMA 1N0QA 4LRZA 4HORA 1FPPA 3UM3A 3T5XA 2I1JA 4G25A 4NN2A 4WAFA 4DJAA 3UUXA 3SF4A 4S3OB 2ZGGA 3HDXA 3NOGD 3QDNA 3C6WA 3DSVA 2FSAA 4O60A 1UOHA 3QKYA 2D8UA 4I6GA 1T1HA 3UIOC 3RTRB 2CG2A 2HR2A 1HO8A 1K1BA 3L1ZB 4XKCA 4G11A 4BT8A 5C1DA 3KD7A 4MS6A 4AYCB 2AN6A 1IKND 2PL2A 2WXMA 2V4HC 3EHQA 3AS8A 2GRLA 1P5QA 2VPEA 4WNDA 3C72A 1JOCA 3O70A 1IYMA 4NACA 3PEVB 4WNGA 1X81A 3QAQA 1OCOE 3JCKC 3LQIA 2X6IA 2VP7A 4Q96A 3CK7A 4YABA 3ESLA 2XQ0A 4OAUC 3B13A 3ZYQA 3O7AA 3SO8A 2VGEA 2AVPA 2PM7A 1WAO1 4FLBA 5CHEE 4UWHA 5B1AE 2H6HA 2BKKB 1WEVA 1VFYA 2KGIA 3CV0A 3UXGA 2OV8A 2Y1LE 4PS7A 4EQFA 5M72A 2DJAA 3PZ1A 2UZGA 3QWWA 2CT2A 4UWGA 5FQ6A 4JB8P 3Q4AB 3AS5A 4HI8A 2M63A 3JXIA 4CRWA 2LSVA 5G0FA 2QZAA 5KCMA 3LQJA 1Z3XA 1TJCA 2VPDA 4LNGA 3ZYKA 2VSNA 3SBTB 4WA6A 4UI9C 3PZ3A 3CEQA 3AU5A 4UI9B 3AG1E 5JJ6A 3AAAC 3DEPA 3FTUA 2DCPA 4GYWA 1ZBDB 4U0ZA 1YA0A 4R7EA 5HKPA 1OWNA 4CDMA 4LKAA 3ZPV1 3U5MA 5K3QA 4X3GA 3CKCA 3BQOA 3O37A 4DPRA 3KDEC 2OVBA 4UI9K 2FEZA 2YHEA 2G6QA 2MRIA 1N52A 3C3RA 3DQVR 2MD8C 4HFGA 1WEUA 1OY3D 2Q7FA 4APFA 3C3QA 3TWVA 3C3OA 3I2DA 4X8QA 5KNHD 5FINA 2GRRB 2MD7B 3SQVA 2UY1A 3SGHA 3D9PA 4A1GA 2FD4A 4KXKB 4YDYA 4MLPA 2OWAA 3R9MA 4KYOB 1QYMA 2MKEA 1NP7A 4MKTA 5BUZA 3KV6A 1ZB1A 1WEMA 2KM4A 2CFZA 1MX4A 1UN9A 4RG9A 4OVVA 3HXEA 3D9JA 1K8KG 4JHRA 2VSXE 2PNXA 2X3MA 3CHMA 4A63B 3SD5A 3FM8C 3FAOA 2KZTB 4A3TA 2YQMA 1IHBA 4K0RA 4V3KC 3EHMA 4Z68A 5LKTA 5D0OD 4JXTA 3FFLA 2FO7A 2EODA 1EPUA 5ENNA 5ENRD 3DXMG 3FUEA 1LF8A 3KSLA 1WFKA 2KWJA 2LQ6A 2P2CP 4I2WA 3Q79A 2XCBA 2QICA 4ATZD 2BAYA 2JMIA 1KT0A 3FTWA 4L7XA 3O33A 4CGWA 3FUHA 4NQ0A 2LDRA 2G43A 3ASLA 3OXGA 5AIJA 1U2VG 1UG3A 3KV5A 1S63A 5KJNA 2M13A 1WY6A 4GA0A 4AYCA 2KXPC 3FTVA 2J8SD 4GB0A 2WPVA 5BXUA 1LD8A 2BTDA 1TNBA 1FBVA 2ECNA 2XOZA 4KMOA 1L5JA 3FUNA 3ABME 4Z0OA 3CLJA 1QNFA 4YATA 1TNUA 3N9PA 3B7BA 3LVQE 4I43A 2ZXWE 3FU6A 3N71A 1HFAA 4TRQA 3TJPA 2RG8A 3ZNIA 4PS3A 3N9NA 3ESKA 3CHRA 2WQ6A 4FA6A 1TJFA 2QC9A 3MHHA 3S2AA 5BW8C 4YBMA 3V2OA 4TUUA 1Z5SC 3B7SA 5ENQD 5I3LA 4DLQA 5AIUA 1OUVA 1Y8MA 2YVRA 2IDAA 3QARA 4E85A 2YNQA 3PH0C 2MYOA 2FULA 2RD0A 2A5UA 3ZXPA 1LDKC 2L80A 4K5BA 3VLEA 5CBOA 5AQ7A 4I9EA 3HXDA 5LP0A 3D3MA 4GYOA 3S7FA 2V5FA 2J4DA 3CVNA 1KZPA 2ECTA 3QWVA 2VJEA 3CSFA 2BUGA 1UW4B 3DEOA 3X2QE 4ZHBA 2CRRA 5FERA 2J08A 3FUMA 2X38A 2FO1E 4FC8A 2E6RA 1HXIA 2YQ8A 1F62A 3VLFA 3ZPVE 4PTBA 3OXLA 1JCQA 3ML8A 4FJCA 5CBNA 3RK6A 1MHQA 1UJJA 3FUFA 3DPLR 2YW8A 5EX3A 2IY0C 2WQHA 3Q5MA 3CGHA 4LNUD 4NURA 4GYYA 4YAXA 4CGVA 3ONLA 2Y43A 3ASGA 4ACLA 4PDXA 4FHJA 1INZA 4BERA 4V3IA 4GU5A 3ZXSA 3FU3A 4AP4A 3RO2A 3RO3A 3IHVA 4F1PA 4Q94A 4KVMA 4M3OA 3GZ1A 4LADB 3E4BA 4ILHB 5ARGA 4UP0A 1H2UA 3IKOB 3UKRG 2VTBA 3QK0A 2A4ZA 4LSZE 2UY1B 3L9TA 2PM6A 2IF4A 3DSTA 3ZYLA 3NBNB 3DWDA 4U8HA 3LDYA 2ZETC 2YINA 3FUJA 2Y1NA 2CRWA 2CSVA 3FWVA 4UWFA 3L54A 5G05J 1K1AA 4FP7A 4L58A 3UMVA 3E32A 3LS8A 3LJNA 2VGYA 4AM9A 3E30A 3Q78A 2EIJE 5AJLA 3T5VA 2EA6A 5EYAF 4U96D 4EHMA 5EIDA 3ABLE 4ILGA 4HLLA 4R8PK 2AW6A 3L08A 2YU4A 4O62A 4EPZA 2KREA 4O1OA 2H6FA 2ETCA 4CCGX 4EECA 5KH3A 2J07A 2DYSE 4HOQA 4JEUA 5FZQA 2WXOA 1N4PA 4V3LC 5LX8A 1WM5A 4L2YA 4GTPA 4UWKA 1PAQA 3U5NA 3NOCD 4IRUA 3IEGA 4GCOA 3CQGB 3CKBA 4JVSA 3DSSA 5FEYA 3L6AA 4N3CA 3HVEA 2Y69E 3T8MA 2PNNA 4N5QA 3H7HA 2KCLA 5EDSA 1VDYA 2A5EA 1SZ9A 2WVIA 2C2LA 4FJZA 3CVWA 2I1KA 1FT1A 2AXVA 4HBDA 1JM7A 4YC9A 4XIFA 3FUIA 4H7XA 5C11A 1BU9A 3ZW3A 4AY5A 2P58C 2CHXA 5D1KB 4JD2G 2XB1A 5FT9A 3TWUA 4GA1A 1VYXA 2V8SE 2KFTA 3ZHEA 2CSYA 3B95A 4J8EA 4G2VA 3PNLB 5J08A 3FP3A 1S70B 3DRAA 3PLWA 3BEEA 4HVBA 1MJ0A 5A6CA 2YURA 1E7VA 3KNVA 3Q49B 3LPZA 4RSYA 2XPYA 3RJVA 2CHZA 1V54E 4XI0A 1NL4A 4YVOA 2XRYA 4BWRA 2EXUA 2G45A 1E4UA 3CHPA 5LCWB 3ZVVA 4I2ZA 2HYED 4HLEA 4JC8A 3HG0D 4FO9A 3FUKA 4B8CB 4MBGA 5FZRA 4LG6A 3MX3A 1YMPA 3PEUB 4JA7A 4DLOA 2MA5A 2WXRA 2KIZA 2P9NG 2PQNA 1BI7B 2E2EA 4NRHB 5SVYA 2K4DA 2HDPA 3L17A 1JPLA 3LDZA 5FJYA 5SVIA 3EIQC 4R2YA 2LAIA 1KPSB 3L82A 2XENA 2P9IG 4MRUA 5AQ9A 3ZHEB 3FL2A 1OWOA 1H6OA 2HYZA 3GW4A 4FJYA 3ISMC 1BORA 1TYQG 1IQUA 4YVQC 4ZQLA 4AVXA 2R17C 4FLHA 5KNGA 3EU9A 3CVYA 4ZDTA 3PUJA 4GZ5A 3CQCB 4ANUA 2M6MA 2LAUA 4EZJA 2VQ2A 2MNZA 3VTYA 1WILA 2K16A 1D8DA 2LNIA 2X6JA 1OCCE 2R2LA 3IBEA 3UKUG 3RRUA 1GW6A 2DZOA 4GB9A 2FUIA 4FADA 5B3SE 1G3NB 5D1MB 3ZKJA 1HE8A 4Q6FA 4HXIA 1JUQA 2KZTA 3QNKA 4CT4A 3SFZA 1ZBPA 4GTQA 3ENEA 3GL6A 3HHMA 4EBAG 3FTSA 4OAVB 4QF2A 2GRNB 4B89A 1XNFA 4WUYA 5H1VA 2VGXA 2E6SA 5KWDA 5LKZA 1OXJA 5BV1A 2CFUA 3O35A 2R02A 4JL0A 2XGOA 4XEIG 3B7TA 2XRZA 2H6GA 2RFAA 4WNEA 2XS8A 3DWLG 3HTKC 3UINC 3L11A 1OCZE 1N0RA 2C2VS 3EB5A 2KWOA 1OWPA 5E76A 1TN7A 2QYUA 5TABA 5SVIB 1FP0A 3MV3B 4K03A 2LSUA 2MNYA 3KAEA 4L23A 2KGGA 3E37A 4LUNU 2LXHC 3ZPJA 2JRJA 4Z0RA 3U5OA 2IO3C 3QC1A 4B8AA 4F53A 2LRIC 4B7YC 2RFMA 3EJNA 4AUQB 4KZCA 4HS2A 3HXFA 5SVXA 4JEHA 4BHWA 2KWNA 3AJIA 5LKXA 5JJTA 5H7PA 4N2QA 3ZGQA 4P5OB 3I4GA 3VLDA 4ILIA 3E2DA 2EQXA 5FQ4A 2YQLA 1JWFA 3JXJA 3M63A 3LVRE 3WG7E 2LV9A 3MHSA 1SQMA 2PUYA 4A55A 4AY6A 3KQIA 4N3WA 1SW6A 3ASNE 1WEQA 2BF0X 3AG3E 2EILE 2VGXB 3NG2A 5JJ7A 2VYIA 2F8XK 3T8KA 2DX8A 2VSOE 3SHFA 2ETBA 1X4JA 4GTVA 2M3HA 2YUCA 3UM0A 1B89A 1TEZA 2LO6A 2FI7A 4LCTA 2XP0A 5H1TA 4U8VD 4GPMA 3ULYA 1IXVA 2EGMA 1H19A 4U63A 5JA4D 1XGWA 2R59A 4GNEA 3FUDA 3M62A 3UM1A 2K1JA 3AU4A 4TXPA 4AOFA 1MBMA 3LQHA 3TXMA 2DZNA 2L0BA 2JLBA 3NZSA 3Q9UC 3T7LA 2F6JA 5E75A 3APDA 2F42A 4BBQA 3L1XA 4ABNA 4W9RA 5FQ7A 4UWLA 3DXKG 4DX6D 2H6IA 3LEWA 4FHKA 2HE0A 3AG4E 1SA5A 3FY4A 4GZ6A 2RSDA 3FH8A 3O47A 1LTXA 3EU5A 4TXQA 5KH9A 1KZOA 2KCKA 2M85A 4IULA 4DUIA 5T8IA 3U3WA 3EB6A 2H0DA 4GTSA 3RRMB 2Y4TA 3BU8A 3APFA 4ANWA 2I9CA 3Q73A 1N54A 4J7WA 4BTAA 4A4BA 5CECB 4DX2A 2VPBA 4B94A 2ECVA 1WEEA 3MA5A 3MZLB 5LCWC 2F37A 3ZN3A 2JMJA 3VTXA 3ULQA 4U95D 3TXNA 3T9KA 3PVLA 5KBAA 1D8EA 4MSXA 5BT1A 1PC2A 3UX4A 2HM8A 4BSZB 3Q1DA 5T4YA 5BXOA 5HS0A 1MYOA 3UT7A 4PH4B 5B8DA 4BETA 5H1UA 2LUHA 1WENA 1KT1A 3D9NA 4LEUA 3ULEG 3O48A 4AP2A 5EN5D 3FANA 3TWQA 2CONA 2JUNA 1Z3YA 3U5PA 1HS6A 4ME2A 1U3DA 2XPZA 1MX2A 2K17A 4WZ0A 3CHOA 3RIBA 1ELKA 3CVQA 2C0LA 3DDTA 3HYMB 4XZ4A 3UTMA 3MCXA 4S3OC 2VJ8A 1BD8A 2XEVA 2P9PG 3SFYA 4IN3B 3ASFA 2CSZA 2XOCA 1Z6UA 3HCSA 5IY5E 1JCSA 3PE4A 5HRYA 4UP5A 4KT6B 3ZIMA 1Z6TA 4DK5A 2DSMA 4DRXE 2KR4A 4LLBA 1BLXB 4JPSA 3SOWA 4N3BA 1EDUA 1OCRE 3ZU7B 2GW1A 3CVVA 2YHNA 1UJKA 3MYVA 2VPGA 2KE1A 3ZVZB 1QZ2A 3DSWA 5KJMA 2I2OA 5CRVA 3E33A 2IQCA 1O5MA 3ZRHA 4GNDA 3HIZA 4ZUXU 3JUEA 5AITA 4FIPA 1NZNA 2FUUA 5TBNA 4RVBA 2IOLA 3FTYA 1E90A 3W9FA 2MIQA 2RR4A 4KZ0A 3ZNGA 2WXKA 4ANXA 3CSTA 2PQRA 3HXBA 3L13A 3DBSA 2E61A 4GTTA 5AQAA 2J09A 2KCVA 2HO1A 3NF1A 1NA0A 3PUQA 2L7PA 4DI3A 1CHCA 4C0MA 3KEAA 4OGCA 3MKRA 1JWGA 3JQ0A 1WIMA 1NFIE 4G24A 1E8WA 2L0IA 4KBQA 3UT8A 5B79A 2Y4UA 3EIJA 4H7YA 3RPGC 3IHPA 4O64A 1DC2A 3Q9NC 5B78A 4GCNA 2L43A 2AXUA 3BUAA 1BI8B 4O6FA 4TV3A 3FJUB 4HI9A 1OT8A 2PZIA 3FULA 3Q7FA 4AEZC 1ELWA 4CEMA 4EBAA 1BPOA 3DSUA 3C5KA 2NYJA 4U04A 2KC7A 2L9BA 3RAUA 1N94A 2WB2A 5B77A 4LERA 4I9CA 3O36A 1ZU2A 1FT2A 4N5CA 4YDOA 2KKYA 2DBAA 4WWPA 2MHKA 4GPKA 2MA6A 2WMNA 5CRUA 4HOSA 1WE9A 4URKA 4N2SA 4GZ3A 4XI9A 5ENOD 3GYZA 5AENA 3TG5A 3DSXA 1K3ZD 1E8ZA 3ASDA 4LNBA 3URZA 4C0EA 3LCAA 1X5BA 2OEWA 2XS1A 3N9LA 3OXFA 3LJUX 5ENSD 3Q75A 3OAWA 5HQ8A 1TNYA 3NAWA 3FHEA 1K2FA 4I6JA 4L1BA 4CCAA 3N9MA 2YYRA 3QB2A 5ITZF 4EZKA 2R5SA 4UI9J 4I1MA 1TR4A 1N87A 2FBNA 3RRNB 4AXHA 1MZCA 5G04J 1MQSA 2BKGA 5A7DB 4DX5D 4BTBA 4C9ZA 3ZTGA 3K9IA 2Y3AA 2LGKA 4AJWA 2V0PA 2GROB 2MOWA 4I1AA 2VTBB 5J90A 4F6RD 4CZ2D 4JA9A 2QJ0A 4LK9A 1X4IA 2UWJG 3I4RB 3RKVA 3E34A 4PUCA 3DPDA 4U8YD 5TDRA 3M7KA 4B86C 4E6HA 3D9KA 4PS8A 4GZCA 4J8FA 4F1SA 5G04B 3PE3A 2QYJA 4GA2A 5AN8A 1XWHA 4BSXA 3HCTA
chains in the Genus database with same CATH topology
4KZCA 2WXIA 4GA0A 2QY7A 4HS2A 2MT5A 4AYCA 1H0AA 3AS4A 3ZEFA 3FTVA 4GB0A 1Y6IA 4JEHA 4DI4A 4BHWA 3APCA 2ECJA 2WPVA 2KWNA 3BG1B 5LKXA 5JJTA 2LGVA 4N2QA 1WEOA 3JYSA 4CDRA 2BTDA 3ASHA 3ZGQA 2XHEA 1FBVA 4KMOA 5EKQD 1L5JA 2E0IA 3FUNA 2ECNA 3N9OA 4P5OB 3I4GA 4CDNA 3VLDA 4ILIA 3CLJA 2EQXA 1QNFA 5FQ4A 2YQLA 4YATA 5DBKA 2CKLA 3FU5A 3ZFWA 4D10C 3N9PA 1JWFA 1S0PA 3U66A 3M63A 3LVQE 3LVRE 4I43A 4G23A 3MV2B 3FU6A 3ZYMA 3N71A 5KJLA 2LV9A 1HFAA 4TRQA 3TJPA 2QIZA 3LRQA 4G1TA 3MHSA 5B75A 3BG0B 2RG8A 3QZVA 3ZNIA 4PS3A 3G2SA 1UN8A 1SQMA 3G2VA 3N9NA 2PUYA 3ESKA 3CHRA 2WQ6A 4A55A 4AY6A 3LKUA 3SI5A 4FA6A 3KQIA 1TJFA 3O34A 4N3WA 2XGMA 3HVEB 3LY9A 3MHHA 3S2AA 3CVLA 3MKQB 2M1RA 1WEQA 2BF0X 2OOEA 3QOUA 5BW8C 3B7RL 2VGXB 5G55A 2WXJA 3SZ7A 5JJ7A 3FEYA 4TUUA 3NG2A 5EX0A 1VD4A 2VYIA 4J6IA 3TL5A 3B7SA 1Z2QA 5JHAA 2DX8A 2X6FA 4BT9A 2WXNA 4YBSA 5DINA 2VSOE 1E7UA 3SHFA 5BPPA 5LOZA 4DLQA 5AIUA 5I3LA 1OUVA 1Y8MA 3Q47B 2IDAA 3QARA 1X4JA 3FDHA 3MKQA 4JZYA 1LDJB 4E85A 2YNQA 3PH0C 3U64A 4I7CA 2FULA 3S7BA 4A4CA 2F6NA 2M3HA 2RD0A 4APOA 2YUCA 5DKAA 2A5UA 1B89A 2ONDA 3IHYA 4N39A 3CIAA 1TEZA 2LO6A 2FI7A 2YHCA 4LCTA 5ANRA 1LDKC 3VLEA 2L80A 4LJNA 4I9EA 2VJFB 4YNDA 5LP0A 2CHWA 3D3MA 2L75A 5TDWA 4GYOA 5H1TA 4W4UA 2L0TB 3S7FA 2V5FA 2QFCA 3Q15A 2LGLA 1EF1C 3OTNA 2VSYA 2J4DA 3CVNA 4UQYA 1H19A 4WWNA 4U63A 1OWMA 2ECTA 3QWVA 3CHQA 2GRMA 2J4BA 4Y6CA 5JHBA 2VJEA 3CSFA 2BUGA 4UQZA 4WZ3B 1XGWA 2R59A 3I5PA 4GNEA 1UW4B 2AWIA 3FUDA 2JMDA 2LXPC 2Y1MA 3M62A 2K1JA 5FERA 2J08A 4XX5A 3AU4A 3FUMA 4AOFA 3CVXA 2LXHC 2X38A 3LQHA 3TXMA 2KWKA 3L22A 2L0BA 4FC8A 2E6RA 1HXIA 2YQ8A 2JLBA 2CKLB 5FWQA 1F62A 4J8SA 3NZSA 3VLFA 1JM7B 5ANLA 3T7LA 4PTBA 4I17A 3ZPVE 2XCCA 3OXLA 4L2LA 3ML8A 5KJKA 4FJCA 4L7TA 3V43A 4KVOA 2GGFA 5D0QD 3P1UA 3SNXA 4CT0A 2F6JA 1ELRA 2KYUA 2NSZA 3RK6A 1MHQA 1UJJA 5E75A 3FUFA 3APDA 3DPLR 2F42A 2WXLA 2YW8A 4BBQA 5KH7A 2LAHA 5EX3A 5BV0A 3L1XA 4YBTA 4F52B 3SOXA 1MM2A 3KEZA 5FZSA 1HH8A 4W9RA 4ABNA 5FQ7A 1H2TC 2WQHA 1OWLA 3CGHA 3Q5MA 4JW1A 4GYYA 4NURA 2AXZA 4UWLA 4CGVA 3ONLA 3TAXA 4IC3A 4XI1A 4YAXA 2Y43A 3SHBA 3ASGA 2WM9A 4PDXA 4GMJA 3LEWA 4FHJA 3TG4A 4FHKA 3UQ3A 4ACLA 3M99A 3CVUA 1INZA 4I6EA 4V3IA 4GU5A 3ZXSA 3FY4A 4GZ6A 3FU3A 3D9MA 3RPGB 4AP4A 2RSDA 3LY7A 3MGBA 1HYIA 3FH8A 3RO2A 2VNFA 3RO3A 3IHVA 4Q94A 4KVMA 4M3OA 3GZ1A 2OXQC 3PRZA 4LADB 5KH9A 2IONA 3E4BA 3G2WA 3PS6A 2C0MA 1DVPA 2KCKA 4ILHB 4IULA 5ARGA 2M85A 4UP0A 1H2UA 1FCHA 3IKOB 3PDNA 5T8IA 3U3WA 2VTBA 3EB6A 3QK0A 2A4ZA 5AJDA 5FB1A 2NXPA 4AV7A 2UY1B 3CK8A 1HZ4A 2PM6A 3RRMB 2IF4A 2Y4TA 2H0DA 3APFA 4ANWA 2I9CA 3ZYLA 1N54A 4BTAA 4BFRA 1V87A 2YSJA 1RMDA 3B7UX 2J49A 3N9QA 4A4BA 5CMWA 4U8HA 1WEWA 2ZETC 2YINA 2VPBA 4B94A 4A3VA 3FUJA 2ECVA 1WEEA 2Y1NA 3MA5A 4MVTA 3ONKA 4C9BB 2IU1A 4GMLA 4GZDA 3MZLB 3PHDA 3KS2A 4U0SA 1SZAA 3FWVA 4UWFA 5LCWC 3RU0A 5LFAA 3PZDA 1MM3A 1W3BA 3ZN3A 3O4ZA 3L54A 5G05J 3UPVA 2JMJA 2YREA 4IRUA 2YSMA 4BY6A 4FP7A 3VTXA 3ULQA 2WMOA 2WXQA 4L58A 1DNPA 3TXNA 3UMVA 3PVLA 3LS8A 2VGYA 1HF8A 4AM9A 2X6HA 3CHSA 2KGIA 3U4TA 2FF4A 5AJLA 2I6HA 4MSXA 3CR3A 3MEKA 3T5VA 3D9LA 4FULA 4Q69A 2EA6A 5BT1A 5EYAF 1H2VC 1E96B 2OVFA 5DIZA 3PNTB 1PC2A 1U3CA 2HM8A 4ILGA 3UX4A 4I7BA 5T4YA 5HI7A 4LRZA 2AW6A 5CCMA 5D1LB 4R8PK 3L08A 4HORA 2YU4A 3UT7A 4PH4B 5B8DA 3T5XA 5H1UA 2I1JA 4G25A 4EPZA 2KREA 4WAFA 2XEUA 4DJAA 4NN2A 1IHGA 1WENA 4CCGX 2ZU6B 3D9NA 1KT1A 4LEUA 3O48A 3R7RA 3SF4A 3U9WA 3UUXA 4AP2A 4EECA 5KJNA 4S3OB 3R7QA 3HDXA 5KH3A 3QDNA 3C6WA 5TRBA 2J07A 3LYAA 4HOQA 4JEUA 5FZQA 3NZUA 1Z3YA 5G05C 2WXOA 3NQPA 1HS6A 3U5PA 4ME2A 2FSAA 3S7DA 1U3DA 2XPZA 4WZ0A 2K17A 3CHOA 4V3LC 3QKYA 5LX8A 1WM5A 4L2YA 3RIBA 4I6GA 1T1HA 1WGMA 5H9MA 1ELKA 3CVQA 2C0LA 4UWKA 1PAQA 3RTRB 3HYMB 5CCLA 2CG2A 4Y6WA 4XZ4A 3U5NA 4A49A 3MCXA 3IEGA 3PREA 2HR2A 1HO8A 3CQGB 3CKBA 3QJZA 1PY1A 2VJ8A 4GCOA 4JVSA 3L1ZB 2XEVA 5FEYA 3L6AA 4XKCA 4N3CA 3HVEA 1HX8A 4G11A 4BT8A 3D9OA 5C1DA 3KD7A 4WNFA 5BNWA 3SOUA 4A0CD 4YBMA 4IN3B 3ASFA 3T8MA 2CSZA 3FH7A 4MS6A 1Z6UA 2KCLA 5EDSA 1H6KA 3HCSA 1VDYA 3PE4A 1SZ9A 2WVIA 4TKPB 4QFVA 4AYCB 1G25A 2AN6A 3HCTA 2C2LA 2PL2A 4FJZA 5JG6A 4UP5A 3CVWA 2I1KA 4KT6B 2KATA 2WXMA 2AXVA 1Z6TA 3ZIMA 4DK5A 3AS8A 2GRLA 1JM7A 2KR4A 1P5QA 4XIFA 3FUIA 4YC9A 2VPEA 4OVUA 4WNDA 4LLBA 2ECWA 1JOCA 4H7XA 3O70A 5C11A 4S3OC 4JPSA 3SOWA 3ZW3A 2RI7A 4N3BA 4AY5A 1EDUA 2P58C 2CHXA 2GW1A 5D1KB 1IYMA 4NACA 2XB1A 5FT9A 1WESA 3CVVA 4GA1A 2YHNA 3PEVB 4WNGA 1VYXA 1UJKA 3MYVA 3QWPA 2V8SE 2VPGA 2KE1A 3QAQA 3ZVZB 1QZ2A 2L5UA 3T6RA 3JCKC 3LY8A 2KFTA 3LQIA 1HU3A 3ZHEA 5KJMA 2I2OA 2X6IA 2WXHA 2ECIA 2CSYA 2VP7A 3U5OA 3FTXA 2IQCA 3JQ1A 4Q96A 2VJEB 3ZRHA 4GNDA 1E8XA 1QQEA 3HIZA 4FU3A 3FEXA 2XPIA 4G2VA 4J8EA 1Z60A 4ZUXU 5AITA 4FIPA 3CK7A 1NZNA 3PNLB 2FUUA 4YABA 5J08A 4RVBA 5TBNA 3FP3A 2IOLA 2IJGX 3FTYA 4N3AA 5CMYA 1E90A 3ML9A 1FVFA 3BEEA 3ESLA 4HVBA 4KZ0A 2XQ0A 2MIQA 4BX9A 4PPEA 4WZ2A 4ANVA 4GNGA 2WXKA 3JUIA 5A6CA 2YURA 1E7VA 3KNVA 3B13A 3ZYQA 3O7AA 3Q49B 3LPZA 4RSYA 2XPYA 4ANXA 2AVPA 2PM7A 3CSTA 2PQRA 1WAO1 3RJVA 2CHZA 4FLBA 4UWHA 5CHEE 4BSXA 3L13A 3DBSA 2LGGA 1HYJA 1EYHA 1WEVA 4XI0A 4YVOA 5ARFA 2J09A 2XRYA 4BWRA 2G45A 4IC2A 2KCVA 1VFYA 2HO1A 3CHPA 3EHNA 3CV0A 3I3NA 3NF1A 3ZVVA 2XGSA 1X4UA 5LCWB 1NA0A 3PUQA 2OV8A 4I2ZA 3R9AB 2HYED 4UQXA 4PS7A 4DI3A 5FTPA 4EQFA 4HLEA 4JC8A 5M72A 1HG5A 1CHCA 2UZGA 3QWWA 4C0MA 3LXUX 2CT2A 4FO9A 3FUKA 4UWGA 4B8CB 5FQ6A 3MKRA 3Q4AB 3AS5A 5FZRA 1JWGA 2WQ7A 2M63A 3JQ0A 3MX3A 2IFUA 4CRWA 2LSVA 5G0FA 1WIMA 1E4UA 2X6KA 4G24A 3PEUB 3LJ3A 3P2BA 1E8WA 2DIWA 2L0IA 4JA7A 4DLOA 2ILRA 5KCMA 2MA5A 4J8DA 2WXRA 2KIZA 2JEKA 3LQJA 2PQNA 4KBQA 1Z3XA 3UT8A 5FB0A 1TJCA 2E2EA 2VPDA 4NRHB 5T3RA 5B79A 2K4DA 3ZYKA 2VSNA 3SBTB 4WA6A 4UI9C 2Y4UA 3EIJA 2L6JA 5AYWD 4XE0A 3CEQA 4H7YA 2YHOA 5C13A 3AU5A 4IYPA 2HDPA 4GAAA 3L17A 3IHPA 4O64A 4UI9B 1JPLA 4U07A 3RPGC 4GCNA 5B78A 4ACKA 5JJ6A 3LDZA 2AXUA 3FTUA 4TV3A 4O6FA 2DCPA 5FJYA 2L43A 4GYWA 1ZBDB 3EIQC 3TGOA 4OYSA 2PZIA 3GZ2A 4R2YA 3FULA 4U0ZA 1YA0A 4R7EA 4AEZC 1ELWA 1OWNA 4CEMA 4CDMA 5A23A 4LKAA 3U5MA 3ZPV1 4F3VA 4EBAA 4X3GA 1BPOA 4HOTA 2LAIA 3C5KA 3CKCA 4U04A 2KC7A 2L9BA 4MRUA 5LKUA 3FTZA 3UT4A 2CG3A 3O37A 3ZHEB 4GNFA 4DPRA 3FL2A 4G26A 5G2NA 1OWOA 2OVBA 4UI9K 2WB2A 2HYZA 3GW4A 4FJYA 4LERA 5B77A 4I1OB 1BORA 2FEZA 4I9CA 2YHEA 2G6QA 3G2UA 1IQUA 4YVQC 2MRIA 2WXPA 3O36A 2YT5A 1N52A 1ZU2A 2IOSA 3GZSA 3DQVR 2MD8C 4HFGA 3VK6A 1WEUA 4ZQLA 3CK9A 4AVXA 2R17C 4FLHA 4N5CA 2Q7FA 4APFA 4ATGA 4FK5A 3I2DA 3CVYA 4ZDTA 3PUJA 4GZ5A 3IV0A 2LN0A 3CQCB 2DBAA 3PUKA 2MHKA 4WWPA 4ANUA 2WMNA 4EZJA 4GPKA 2M6MA 2MA6A 2NC9A 5B76A 2J9QA 2VQ2A 3PURA 2MD7B 3FH5A 2MNZA 2I50A 2UY1A 3SGHA 4HOSA 1WE9A 3VTYA 3D9PA 1FVHA 4A1GA 1WILA 2H0DB 2K16A 4URKA 3L16A 2LNIA 2X6JA 4N2SA 4KXKB 4GZ3A 4XI9A 2NAAA 3GYZA 4JHJA 4MLPA 5AENA 2WXGA 4U0UA 3D9IA 4KYOB 3TG5A 3IBEA 1NP7A 1E8ZA 4MKTA 3RRUA 1GW6A 3ASDA 5BUZA 4GB9A 2FUIA 3URZA 4C0EA 3KV6A 3LCAA 4FADA 2MUMA 1X5BA 1WEMA 2KM4A 2CFZA 3N9LA 3OXFA 1UN9A 4RG9A 4OVVA 5D1MB 5LCWJ 2KU3A 3D9JA 1HE8A 4Q6FA 4HXIA 1JUQA 2KZTA 3QNKA 4WWOA 2VJFA 4JHRA 4CA1A 3OAWA 3S7JA 5HQ8A 2D8SA 3FHEA 4CT4A 4I6JA 4JHKA 1K2FA 2VSXE 4L1BA 1ZBPA 3MJWA 3SFZA 2PNXA 3ZVYA 4I7DA 4CCAA 2X3MA 4N4FA 2EGPA 2ECGA 1KLXA 3CHMA 3ENEA 3C98A 3HHMA 4EBAG 3GL6A 3FTSA 4F7AA 4QF2A 3SD5A 4BX8A 4B89A 3N9MA 1XNFA 2YYRA 1HG2A 3QB2A 2KZTB 4EZKA 4A3TA 2R5SA 3G2TA 2YQMA 4UI9J 4I1MA 4K0RA 4WUYA 1N87A 4V3KC 2FBNA 3RRNB 4AXHA 5H1VA 3EHMA 5G04C 5LKTA 2VGXA 2E6SA 4XKBA 5G04J 1MQSA 5A7DB 5LKZA 5D0OD 5BV1A 1E8YA 4JXTA 2CFUA 4YADA 4BTBA 4C9ZA 3ZTGA 3O35A 3K9IA 4HOUA 3FFLA 2FO7A 4J0UA 4JL0A 4AIFA 4RG6A 1EPUA 2Y3AA 2XGOA 1IQRA 5ENNA 2EODA 2WXFA 3B7TA 4AJWA 2LGKA 2V0PA 3FUEA 2XRZA 2V4LA 1NA3A 1WEPA 4WNEA 1LF8A 5J3XA 1WFKA 2MOWA 4I1AA 2KWJA 2LQ6A 4I2WA 2VTBB 5J90A 3HTKC 3L11A 3EB5A 2C2VS 3CVPA 2KWOA 1OWPA 5E76A 3FU0A 3WXXA 4JA9A 2QJ0A 4LK9A 2XCBA 4EZLA 1X4IA 2BAYA 2QICA 2UWJG 5TABA 3I4RB 2JMIA 5C2YA 1U6GB 3RKVA 3EDTB 5G05B 4PUCA 1KT0A 3DPDA 4QF3A 5TDRA 1FP0A 3MV3B 4K03A 2LSUA 3FTWA 4B86C 4L7XA 4E6HA 2MNYA 3KAEA 4L23A 2KGGA 4CGWA 3O33A 3FUHA 4LUNU 3D9KA 4NQ0A 4P29A 4PS8A 3ZPJA 2G43A 2JRJA 3OXGA 2LDRA 3QC1A 3ASLA 4GZCA 3HCUA 4J8FA 5AIJA 4B8AA 3SBSA 4R7LA 4F1SA 4A1SA 5G04B 1UG3A 4B0ZA 4F53A 1IYGA 3PE3A 3KV5A 2LRIC 4GA2A 4B7YC 1XWHA 3GV4A 1A17A 1WY6A 3EJNA 4AUQB 5FQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QY7 A;  2MT5 A;  4AYC A;  1H0A A;  4GB0 A;  4BHW A;  2ECJ A;  2KWN A;  5LKX A;  2LGV A;  1WEO A;  1FBV A;  2ECN A;  3N9O A;  4P5O B;  3CLJ A;  2YQL A;  4YAT A;  2CKL A;  3N9P A;  1JWF A;  3M63 A;  3LRQ A;  3ZYM A;  2LV9 A;  1HFA A;  2QIZ A;  3MHS A;  5B75 A;  3QZV A;  3ZNI A;  3G2S A;  3N9N A;  3G2V A;  2PUY A;  3KQI A;  4N3W A;  3O34 A;  3MHH A;  2M1R A;  1WEQ A;  2BF0 X;  4YBM A;  5B76 A;  3NG2 A;  1VD4 A;  1Z2Q A;  2DX8 A;  4YBS A;  5DIN A;  5I3L A;  5LOZ A;  5AIU A;  2IDA A;  1X4J A;  1LDJ B;  4I7C A;  4A4C A;  2F6N A;  2M3H A;  2YUC A;  5DKA A;  2YSM A;  1LDK C;  2LO6 A;  2L80 A;  4LJN A;  2VJF B;  5LP0 A;  5H1T A;  2L75 A;  5TDW A;  4W4U A;  2L0T B;  2LGL A;  2ECT A;  2VJE A;  4WZ3 B;  1XGW A;  4GNE A;  2JMD A;  2LXP C;  2Y1M A;  3M62 A;  2K1J A;  5FER A;  3LQH A;  2KWK A;  2L0B A;  2E6R A;  1F62 A;  2CKL B;  1JM7 B;  3T7L A;  3ZPV E;  4PTB A;  4FJC A;  3V43 A;  2F6J A;  2KYU A;  1MHQ A;  1UJJ A;  3DPL R;  2F42 A;  2YW8 A;  4BBQ A;  5KH7 A;  4YBT A;  3L1X A;  4F52 B;  3SOX A;  1MM2 A;  4IC3 A;  4YAX A;  3ONL A;  4XI1 A;  2Y43 A;  3SHB A;  1INZ A;  3RPG B;  3D9M A;  4AP4 A;  2RSD A;  1HYI A;  2VNF A;  4Q94 A;  2OXQ C;  4LAD B;  5KH9 A;  3G2W A;  1DVP A;  2M85 A;  4UP0 A;  3EB6 A;  5FB1 A;  2H0D A;  3ZYL A;  1V87 A;  2YSJ A;  1RMD A;  3N9Q A;  4A4B A;  5CMW A;  1WEW A;  2ZET C;  2VPB A;  4MVT A;  2Y1N A;  2ECV A;  1WEE A;  3ONK A;  3PHD A;  4GZD A;  1SZA A;  3M99 A;  1MM3 A;  2YRE A;  2JMJ A;  4L58 A;  1HF8 A;  4MSX A;  3D9L A;  2EA6 A;  5EYA F;  4I7B A;  4R8P K;  5D1L B;  2YU4 A;  5B8D A;  5H1U A;  2KRE A;  4NN2 A;  2XEU A;  4CCG X;  1WEN A;  3D9N A;  4S3O B;  5KH3 A;  3C6W A;  5TRB A;  3U5P A;  2FSA A;  4WZ0 A;  2K17 A;  4V3L C;  1T1H A;  1WGM A;  5H9M A;  1ELK A;  3RTR B;  3U5N A;  4A49 A;  4S3O C;  1PY1 A;  3L1Z B;  5FEY A;  1HX8 A;  3D9O A;  3SOU A;  4A0C D;  2CSZ A;  1Z6U A;  3HCS A;  1VDY A;  1SZ9 A;  4TKP B;  4AYC B;  1G25 A;  2AN6 A;  2C2L A;  5JG6 A;  4UP5 A;  1JM7 A;  2KR4 A;  4YC9 A;  2VPE A;  4LLB A;  2ECW A;  1JOC A;  3O70 A;  5C11 A;  3SOW A;  2RI7 A;  1EDU A;  5D1K B;  1IYM A;  4NAC A;  2XB1 A;  1WES A;  2YHN A;  1VYX A;  1UJK A;  2V8S E;  2VPG A;  2KE1 A;  3ZVZ B;  2L5U A;  3T6R A;  3LQI A;  2KFT A;  2ECI A;  2CSY A;  2VP7 A;  4Q96 A;  2VJE B;  4GND A;  4FU3 A;  1Z60 A;  4ZUX U;  5AIT A;  4FIP A;  2FUU A;  4YAB A;  5J08 A;  5TBN A;  5CMY A;  2MIQ A;  4PPE A;  4WZ2 A;  4GNG A;  2YUR A;  3KNV A;  3ZYQ A;  3O7A A;  4FLB A;  2LGG A;  1HYJ A;  1EYH A;  1WEV A;  2G45 A;  4IC2 A;  1VFY A;  2KGI A;  1E4U A;  5LCW B;  1X4U A;  3PUQ A;  2HYE D;  1HG5 A;  1CHC A;  2UZG A;  4FO9 A;  2CT2 A;  1JWG A;  5G0F A;  1WIM A;  2DIW A;  2L0I A;  2MA5 A;  2KIZ A;  3LQJ A;  5FB0 A;  2VPD A;  5B79 A;  2K4D A;  3ZYK A;  4WA6 A;  2YHO A;  5C13 A;  2HDP A;  3RPG C;  3IHP A;  4UI9 B;  4O64 A;  5B78 A;  1JPL A;  2L43 A;  3LDZ A;  2DCP A;  1ZBD B;  4R2Y A;  4R7E A;  3ZPV 1;  4LKA A;  3U5M A;  4X3G A;  3C5K A;  5LKU A;  4GNF A;  3O37 A;  3FL2 A;  5B77 A;  1BOR A;  2G6Q A;  3G2U A;  3O36 A;  2YT5 A;  3DQV R;  2MD8 C;  4HFG A;  3VK6 A;  1WEU A;  4ZQL A;  4AVX A;  4FK5 A;  3I2D A;  4ZDT A;  2LN0 A;  2M6M A;  2MA6 A;  3PUR A;  2MD7 B;  2MNZ A;  2I50 A;  2H0D B;  1WE9 A;  1WIL A;  3D9P A;  2K16 A;  2NAA A;  3D9I A;  3RRU A;  2FUI A;  3KV6 A;  2MUM A;  1X5B A;  1WEM A;  2KM4 A;  3N9L A;  5D1M B;  2KU3 A;  3D9J A;  4Q6F A;  1JUQ A;  2VJF A;  4CA1 A;  2D8S A;  1K2F A;  3ZVY A;  2PNX A;  4I7D A;  4N4F A;  2EGP A;  2ECG A;  3GL6 A;  4QF2 A;  3N9M A;  2YYR A;  1HG2 A;  2YQM A;  3G2T A;  1N87 A;  4V3K C;  5H1V A;  5LKT A;  2E6S A;  5LKZ A;  4JXT A;  4YAD A;  4C9Z A;  3ZTG A;  3O35 A;  2EOD A;  2LGK A;  1WEP A;  5J3X A;  1LF8 A;  1WFK A;  2MOW A;  2KWJ A;  2LQ6 A;  3HTK C;  3L11 A;  3EB5 A;  2C2V S;  2KWO A;  2QJ0 A;  5TAB A;  4LK9 A;  1X4I A;  2QIC A;  2BAY A;  2JMI A;  1U6G B;  5G05 B;  4QF3 A;  5TDR A;  1FP0 A;  4B86 C;  4L7X A;  2MNY A;  2KGG A;  3O33 A;  3U5O A;  3D9K A;  2JRJ A;  2G43 A;  2LDR A;  2LXH C;  3ASL A;  4GZC A;  3HCU A;  5G04 B;  3KV5 A;  2LRI C;  4B7Y C;  1XWH A;  3GV4 A;  3HCT A;  4AUQ B; 
#chains in the Genus database with same CATH topology
 2WXI A;  2QY7 A;  5EIB E;  3ZEF A;  3AS4 A;  4DI4 A;  4M7C A;  2ECJ A;  3BG1 B;  4G8L A;  4HQD A;  3ASH A;  2XHE A;  3N9O A;  5FIO A;  2B6C A;  4CDN A;  2XEE A;  5DBK A;  3FU5 A;  4D10 C;  3U66 A;  2OCC E;  4G23 A;  3MV2 B;  3ZYM A;  5KJL A;  2QIZ A;  3KSQ A;  4G1T A;  2FFW A;  3QZV A;  4TXR A;  3G2S A;  3G2V A;  2BED A;  4NIK A;  3LKU A;  3SI5 A;  3O34 A;  2AJA A;  2XGM A;  3HVE B;  3CVL A;  2OOE A;  5B76 A;  5G55 A;  3TWX A;  3FEY A;  1VD4 A;  3FEH A;  1JCR A;  2X6F A;  3NB2 A;  4BT9 A;  4YBS A;  1E7U A;  1MX6 A;  5LOZ A;  3Q47 B;  2XZT G;  3MKQ A;  1LDJ B;  3U64 A;  4I7C A;  3S7B A;  4A4C A;  5DKA A;  2LXL A;  2YSM A;  2OND A;  3IHY A;  4N39 A;  5ANR A;  2VJF B;  4YND A;  1O1R A;  2CHW A;  2V5Q C;  5AQB A;  2VSY A;  5CER B;  4WWN A;  1OWM A;  1NI1 A;  2GRM A;  4Y6C A;  4BEP A;  4UQZ A;  3I5P A;  1TNZ A;  2AWI A;  4YDW A;  4XX5 A;  3CVX A;  2CKL B;  4G8K A;  4J8S A;  4I17 A;  2XCC A;  4L2L A;  5KJK A;  5EYL A;  1O1T A;  4KVO A;  5D0Q D;  3SNX A;  3P1U A;  2NSZ A;  2WXL A;  5KH7 A;  4F52 B;  3SOX A;  1MM2 A;  3KEZ A;  3V79 K;  1RZ4 A;  1OWL A;  4JW1 A;  1YCS B;  4RLY A;  2AXZ A;  2WM9 A;  3TG4 A;  3RPG B;  4UUC A;  3MGB A;  2OXQ C;  3PRZ A;  2ION A;  2C0M A;  1DVP A;  3PDN A;  3D9H A;  1V55 E;  1TN8 A;  5AJD A;  3AG2 E;  2NXP A;  4AV7 A;  1V87 A;  4BFR A;  2IO2 C;  1RMD A;  3B7U X;  2EIK E;  2YSJ A;  2J49 A;  5CMW A;  4A3V A;  4MVT A;  3ONK A;  4GML A;  4U0S A;  3M99 A;  5LFA A;  1AP7 A;  1W3B A;  3J5Q B;  4TUM A;  3UPV A;  2YRE A;  3TWR A;  2WMO A;  2WXQ A;  5EYP F;  1WG0 A;  3CHS A;  2R03 A;  3D9L A;  4FUL A;  4Q69 A;  1H2V C;  1E96 B;  2OVF A;  5DIZ A;  3PNT B;  4I7B A;  5HI7 A;  5D1L B;  1O1S A;  2XEU A;  1TNO A;  1IHG A;  2ZU6 B;  3R7R A;  3U9W A;  3W9G A;  3R7Q A;  5TRB A;  5G05 C;  3LYA A;  3NZU A;  2JAB A;  3NQP A;  3S7D A;  3V31 A;  1WGM A;  5H9M A;  5CCL A;  4Y6W A;  4A49 A;  3QJZ A;  3PRE A;  1PY1 A;  1HX8 A;  3D9O A;  4WNF A;  5BNW A;  3SOU A;  4A0C D;  4O1P A;  3FH7 A;  1H6K A;  1RW2 A;  5ENP D;  4QFV A;  4TKP B;  1G25 A;  4QQI A;  5JG6 A;  2KAT A;  4OVU A;  2ECW A;  2RI7 A;  5CED B;  5ENT D;  1WES A;  5CEA A;  3QWP A;  2L5U A;  3T6R A;  3LY8 A;  1HU3 A;  2WXH A;  2ECI A;  2DYR E;  3FTX A;  3DPY A;  3JQ1 A;  2VJE B;  1E8X A;  5D66 A;  1QQE A;  4FU3 A;  3FEX A;  2XPI A;  1Z60 A;  2ZIS A;  1QBQ A;  2IJG X;  4N3A A;  5CMY A;  3ML9 A;  1FVF A;  4OGE A;  4BX9 A;  4PPE A;  4WZ2 A;  4ANV A;  4GNG A;  3JUI A;  2RKK A;  2LGG A;  1HYJ A;  1EYH A;  5ARF A;  4IC2 A;  3EHN A;  3I3N A;  2XGS A;  1X4U A;  3R9A B;  4UQX A;  5FTP A;  4BES A;  1HG5 A;  4C48 B;  3LXU X;  2XOY A;  3UM2 A;  2ETA A;  2DWZ A;  2WQ7 A;  2IFU A;  1A5E A;  2X6K A;  3ABK E;  3P2B A;  3LJ3 A;  2DIW A;  2ILR A;  3Q7A A;  4J8D A;  2JEK A;  5FB0 A;  5T3R A;  3J5P A;  4DX7 D;  2L6J A;  5AYW D;  4XE0 A;  2YHO A;  5C13 A;  4IYP A;  4GAA A;  2LXM A;  4U07 A;  4ACK A;  2P9K G;  3TWW A;  4HNA D;  3TGO A;  4OYS A;  3GZ2 A;  1AWC B;  5A23 A;  4F3V A;  4HOT A;  5LKU A;  3FTZ A;  3UT4 A;  2CG3 A;  4GNF A;  4G26 A;  5G2N A;  3HXC A;  4I1O B;  3UI2 A;  3G2U A;  3IXE A;  2WXP A;  2YT5 A;  2IOS A;  5EIL A;  3GZS A;  3MDB C;  3VK6 A;  3CK9 A;  1D9S A;  4ATG A;  4FK5 A;  4H9D A;  3IV0 A;  2LN0 A;  3PUK A;  4HB5 A;  2NC9 A;  2J9Q A;  3PUR A;  3FH5 A;  2I50 A;  2H0D B;  1FVH A;  3TWT A;  1DCQ A;  3L16 A;  2IQJ A;  2NAA A;  4JHJ A;  2WXG A;  4U0U A;  3D9I A;  2MUM A;  1N4S A;  5LCW J;  2KU3 A;  2VJF A;  4WWO A;  4CA1 A;  3S7J A;  2D8S A;  4JHK A;  3ZVY A;  3MJW A;  4I7D A;  4N4F A;  2EGP A;  2P9L G;  1N9A A;  1KLX A;  2ECG A;  3C98 A;  4F7A A;  3SUB A;  4BX8 A;  2EIN E;  1HG2 A;  3G2T A;  4RQI A;  5G04 C;  4XKB A;  1E8Y A;  4YAD A;  2R05 A;  2DVW A;  4HOU A;  4J0U A;  4AIF A;  4RG6 A;  1IQR A;  2WXF A;  2V4L A;  1NA3 A;  1WEP A;  5J3X A;  4HRN A;  5JMN D;  3CVP A;  2XZD G;  3WXX A;  3FU0 A;  4EZL A;  5C2Y A;  1U6G B;  3EDT B;  5G05 B;  4QF3 A;  5AAR A;  2JM3 A;  1SA4 A;  4HRM B;  4P29 A;  3HCU A;  2KBX A;  4R7L A;  3SBS A;  4A1S A;  4B0Z A;  1IYG A;  4QQ4 A;  3GV4 A;  1A17 A;  3UIP C;  2P57 A;  5FQ8 A;  2ZGD A;  2MT5 A;  3EHR A;  2IEJ A;  1H0A A;  4GMR A;  4GTM A;  1Y6I A;  4U7E B;  3APC A;  2LGV A;  3ZUV B;  1WEO A;  3JYS A;  4CDR A;  3HRA A;  1TN6 A;  5EKQ D;  2E0I A;  4GTR A;  2CKL A;  3ZFW A;  1S0P A;  3LRQ A;  2KKX A;  5B75 A;  3BG0 B;  4J8Y A;  4HRL A;  1UN8 A;  2L6B A;  3LY9 A;  3TWS A;  4B93 B;  3MKQ B;  2M1R A;  3QOU A;  3SZ7 A;  3B7R L;  2WXJ A;  5EX0 A;  3TL5 A;  4J6I A;  2P9U G;  1Z2Q A;  5JHA A;  3PZ4 A;  2WXN A;  5DIN A;  5BPP A;  5D2M C;  4K5C A;  3FDH A;  4JZY A;  1SVX A;  2F6N A;  1YYH A;  4APO A;  1DCE A;  3CIA A;  2YHC A;  4LJN A;  2XEH A;  4YDE A;  2L75 A;  5TDW A;  4W4U A;  2L0T B;  2LGL A;  2QFC A;  3Q15 A;  1EF1 C;  3OTN A;  4UQY A;  2GRP B;  3CHQ A;  2J4B A;  5JHB A;  4WZ3 B;  3V30 A;  2JMD A;  2LXP C;  2Y1M A;  1N4R A;  4GTO A;  2KWK A;  3L22 A;  5FWQ A;  3V2X A;  3RSE G;  1JM7 B;  3SFX A;  1N11 A;  5ANL A;  4L7T A;  3V43 A;  2GGF A;  4CT0 A;  2KYU A;  1ELR A;  2P9S G;  3SY2 A;  4CYM D;  1LD7 A;  2LAH A;  4YBT A;  5BV0 A;  2EIM E;  2ZIR A;  5FZS A;  1HH8 A;  1H2T C;  4IC3 A;  3TAX A;  4XI1 A;  2F8Y A;  3SHB A;  4GMJ A;  3UQ3 A;  1N4Q A;  2F0Y A;  3CVU A;  1WDY A;  4I6E A;  4DX1 A;  3D9M A;  3LY7 A;  1Q2Z A;  1H6P A;  1HYI A;  2VNF A;  4L9P A;  3G2W A;  3PS6 A;  1FCH A;  3PZ2 A;  3C5R A;  5FB1 A;  3EUV A;  3CK8 A;  1HZ4 A;  4ZFH A;  3F6Q A;  3N9Q A;  2B0O E;  2GRQ B;  1WEW A;  2OEV A;  2Y0B G;  4K5A B;  4C9B B;  2IU1 A;  3PHD A;  4GZD A;  3KS2 A;  1SZA A;  3RU0 A;  1MM3 A;  3PZD A;  3O4Z A;  5B1B E;  4BY6 A;  1DNP A;  1N95 A;  1HF8 A;  2X6H A;  3U4T A;  2FF4 A;  5AAO A;  2I6H A;  3CR3 A;  3ASO E;  3MEK A;  1S64 A;  1U3C A;  5CCM A;  1N0Q A;  4LRZ A;  4HOR A;  1FPP A;  3UM3 A;  3T5X A;  2I1J A;  4G25 A;  4NN2 A;  4WAF A;  4DJA A;  3UUX A;  3SF4 A;  4S3O B;  2ZGG A;  3HDX A;  3NOG D;  3QDN A;  3C6W A;  3DSV A;  2FSA A;  4O60 A;  1UOH A;  3QKY A;  2D8U A;  4I6G A;  1T1H A;  3UIO C;  3RTR B;  2CG2 A;  2HR2 A;  1HO8 A;  1K1B A;  3L1Z B;  4XKC A;  4G11 A;  4BT8 A;  5C1D A;  3KD7 A;  4MS6 A;  4AYC B;  2AN6 A;  1IKN D;  2PL2 A;  2WXM A;  2V4H C;  3EHQ A;  3AS8 A;  2GRL A;  1P5Q A;  2VPE A;  4WND A;  3C72 A;  1JOC A;  3O70 A;  1IYM A;  4NAC A;  3PEV B;  4WNG A;  1X81 A;  3QAQ A;  1OCO E;  3JCK C;  3LQI A;  2X6I A;  2VP7 A;  4Q96 A;  3CK7 A;  4YAB A;  3ESL A;  2XQ0 A;  4OAU C;  3B13 A;  3ZYQ A;  3O7A A;  3SO8 A;  2VGE A;  2AVP A;  2PM7 A;  1WAO 1;  4FLB A;  5CHE E;  4UWH A;  5B1A E;  2H6H A;  2BKK B;  1WEV A;  1VFY A;  2KGI A;  3CV0 A;  3UXG A;  2OV8 A;  2Y1L E;  4PS7 A;  4EQF A;  5M72 A;  2DJA A;  3PZ1 A;  2UZG A;  3QWW A;  2CT2 A;  4UWG A;  5FQ6 A;  4JB8 P;  3Q4A B;  3AS5 A;  4HI8 A;  2M63 A;  3JXI A;  4CRW A;  2LSV A;  5G0F A;  2QZA A;  5KCM A;  3LQJ A;  1Z3X A;  1TJC A;  2VPD A;  4LNG A;  3ZYK A;  2VSN A;  3SBT B;  4WA6 A;  4UI9 C;  3PZ3 A;  3CEQ A;  3AU5 A;  4UI9 B;  3AG1 E;  5JJ6 A;  3AAA C;  3DEP A;  3FTU A;  2DCP A;  4GYW A;  1ZBD B;  4U0Z A;  1YA0 A;  4R7E A;  5HKP A;  1OWN A;  4CDM A;  4LKA A;  3ZPV 1;  3U5M A;  5K3Q A;  4X3G A;  3CKC A;  3BQO A;  3O37 A;  4DPR A;  3KDE C;  2OVB A;  4UI9 K;  2FEZ A;  2YHE A;  2G6Q A;  2MRI A;  1N52 A;  3C3R A;  3DQV R;  2MD8 C;  4HFG A;  1WEU A;  1OY3 D;  2Q7F A;  4APF A;  3C3Q A;  3TWV A;  3C3O A;  3I2D A;  4X8Q A;  5KNH D;  5FIN A;  2GRR B;  2MD7 B;  3SQV A;  2UY1 A;  3SGH A;  3D9P A;  4A1G A;  2FD4 A;  4KXK B;  4YDY A;  4MLP A;  2OWA A;  3R9M A;  4KYO B;  1QYM A;  2MKE A;  1NP7 A;  4MKT A;  5BUZ A;  3KV6 A;  1ZB1 A;  1WEM A;  2KM4 A;  2CFZ A;  1MX4 A;  1UN9 A;  4RG9 A;  4OVV A;  3HXE A;  3D9J A;  1K8K G;  4JHR A;  2VSX E;  2PNX A;  2X3M A;  3CHM A;  4A63 B;  3SD5 A;  3FM8 C;  3FAO A;  2KZT B;  4A3T A;  2YQM A;  1IHB A;  4K0R A;  4V3K C;  3EHM A;  4Z68 A;  5LKT A;  5D0O D;  4JXT A;  3FFL A;  2FO7 A;  2EOD A;  1EPU A;  5ENN A;  5ENR D;  3DXM G;  3FUE A;  1LF8 A;  3KSL A;  1WFK A;  2KWJ A;  2LQ6 A;  2P2C P;  4I2W A;  3Q79 A;  2XCB A;  2QIC A;  4ATZ D;  2BAY A;  2JMI A;  1KT0 A;  3FTW A;  4L7X A;  3O33 A;  4CGW A;  3FUH A;  4NQ0 A;  2LDR A;  2G43 A;  3ASL A;  3OXG A;  5AIJ A;  1U2V G;  1UG3 A;  3KV5 A;  1S63 A;  5KJN A;  2M13 A;  1WY6 A;  4GA0 A;  4AYC A;  2KXP C;  3FTV A;  2J8S D;  4GB0 A;  2WPV A;  5BXU A;  1LD8 A;  2BTD A;  1TNB A;  1FBV A;  2ECN A;  2XOZ A;  4KMO A;  1L5J A;  3FUN A;  3ABM E;  4Z0O A;  3CLJ A;  1QNF A;  4YAT A;  1TNU A;  3N9P A;  3B7B A;  3LVQ E;  4I43 A;  2ZXW E;  3FU6 A;  3N71 A;  1HFA A;  4TRQ A;  3TJP A;  2RG8 A;  3ZNI A;  4PS3 A;  3N9N A;  3ESK A;  3CHR A;  2WQ6 A;  4FA6 A;  1TJF A;  2QC9 A;  3MHH A;  3S2A A;  5BW8 C;  4YBM A;  3V2O A;  4TUU A;  1Z5S C;  3B7S A;  5ENQ D;  5I3L A;  4DLQ A;  5AIU A;  1OUV A;  1Y8M A;  2YVR A;  2IDA A;  3QAR A;  4E85 A;  2YNQ A;  3PH0 C;  2MYO A;  2FUL A;  2RD0 A;  2A5U A;  3ZXP A;  1LDK C;  2L80 A;  4K5B A;  3VLE A;  5CBO A;  5AQ7 A;  4I9E A;  3HXD A;  5LP0 A;  3D3M A;  4GYO A;  3S7F A;  2V5F A;  2J4D A;  3CVN A;  1KZP A;  2ECT A;  3QWV A;  2VJE A;  3CSF A;  2BUG A;  1UW4 B;  3DEO A;  3X2Q E;  4ZHB A;  2CRR A;  5FER A;  2J08 A;  3FUM A;  2X38 A;  2FO1 E;  4FC8 A;  2E6R A;  1HXI A;  2YQ8 A;  1F62 A;  3VLF A;  3ZPV E;  4PTB A;  3OXL A;  1JCQ A;  3ML8 A;  4FJC A;  5CBN A;  3RK6 A;  1MHQ A;  1UJJ A;  3FUF A;  3DPL R;  2YW8 A;  5EX3 A;  2IY0 C;  2WQH A;  3Q5M A;  3CGH A;  4LNU D;  4NUR A;  4GYY A;  4YAX A;  4CGV A;  3ONL A;  2Y43 A;  3ASG A;  4ACL A;  4PDX A;  4FHJ A;  1INZ A;  4BER A;  4V3I A;  4GU5 A;  3ZXS A;  3FU3 A;  4AP4 A;  3RO2 A;  3RO3 A;  3IHV A;  4F1P A;  4Q94 A;  4KVM A;  4M3O A;  3GZ1 A;  4LAD B;  3E4B A;  4ILH B;  5ARG A;  4UP0 A;  1H2U A;  3IKO B;  3UKR G;  2VTB A;  3QK0 A;  2A4Z A;  4LSZ E;  2UY1 B;  3L9T A;  2PM6 A;  2IF4 A;  3DST A;  3ZYL A;  3NBN B;  3DWD A;  4U8H A;  3LDY A;  2ZET C;  2YIN A;  3FUJ A;  2Y1N A;  2CRW A;  2CSV A;  3FWV A;  4UWF A;  3L54 A;  5G05 J;  1K1A A;  4FP7 A;  4L58 A;  3UMV A;  3E32 A;  3LS8 A;  3LJN A;  2VGY A;  4AM9 A;  3E30 A;  3Q78 A;  2EIJ E;  5AJL A;  3T5V A;  2EA6 A;  5EYA F;  4U96 D;  4EHM A;  5EID A;  3ABL E;  4ILG A;  4HLL A;  4R8P K;  2AW6 A;  3L08 A;  2YU4 A;  4O62 A;  4EPZ A;  2KRE A;  4O1O A;  2H6F A;  2ETC A;  4CCG X;  4EEC A;  5KH3 A;  2J07 A;  2DYS E;  4HOQ A;  4JEU A;  5FZQ A;  2WXO A;  1N4P A;  4V3L C;  5LX8 A;  1WM5 A;  4L2Y A;  4GTP A;  4UWK A;  1PAQ A;  3U5N A;  3NOC D;  4IRU A;  3IEG A;  4GCO A;  3CQG B;  3CKB A;  4JVS A;  3DSS A;  5FEY A;  3L6A A;  4N3C A;  3HVE A;  2Y69 E;  3T8M A;  2PNN A;  4N5Q A;  3H7H A;  2KCL A;  5EDS A;  1VDY A;  2A5E A;  1SZ9 A;  2WVI A;  2C2L A;  4FJZ A;  3CVW A;  2I1K A;  1FT1 A;  2AXV A;  4HBD A;  1JM7 A;  4YC9 A;  4XIF A;  3FUI A;  4H7X A;  5C11 A;  1BU9 A;  3ZW3 A;  4AY5 A;  2P58 C;  2CHX A;  5D1K B;  4JD2 G;  2XB1 A;  5FT9 A;  3TWU A;  4GA1 A;  1VYX A;  2V8S E;  2KFT A;  3ZHE A;  2CSY A;  3B95 A;  4J8E A;  4G2V A;  3PNL B;  5J08 A;  3FP3 A;  1S70 B;  3DRA A;  3PLW A;  3BEE A;  4HVB A;  1MJ0 A;  5A6C A;  2YUR A;  1E7V A;  3KNV A;  3Q49 B;  3LPZ A;  4RSY A;  2XPY A;  3RJV A;  2CHZ A;  1V54 E;  4XI0 A;  1NL4 A;  4YVO A;  2XRY A;  4BWR A;  2EXU A;  2G45 A;  1E4U A;  3CHP A;  5LCW B;  3ZVV A;  4I2Z A;  2HYE D;  4HLE A;  4JC8 A;  3HG0 D;  4FO9 A;  3FUK A;  4B8C B;  4MBG A;  5FZR A;  4LG6 A;  3MX3 A;  1YMP A;  3PEU B;  4JA7 A;  4DLO A;  2MA5 A;  2WXR A;  2KIZ A;  2P9N G;  2PQN A;  1BI7 B;  2E2E A;  4NRH B;  5SVY A;  2K4D A;  2HDP A;  3L17 A;  1JPL A;  3LDZ A;  5FJY A;  5SVI A;  3EIQ C;  4R2Y A;  2LAI A;  1KPS B;  3L82 A;  2XEN A;  2P9I G;  4MRU A;  5AQ9 A;  3ZHE B;  3FL2 A;  1OWO A;  1H6O A;  2HYZ A;  3GW4 A;  4FJY A;  3ISM C;  1BOR A;  1TYQ G;  1IQU A;  4YVQ C;  4ZQL A;  4AVX A;  2R17 C;  4FLH A;  5KNG A;  3EU9 A;  3CVY A;  4ZDT A;  3PUJ A;  4GZ5 A;  3CQC B;  4ANU A;  2M6M A;  2LAU A;  4EZJ A;  2VQ2 A;  2MNZ A;  3VTY A;  1WIL A;  2K16 A;  1D8D A;  2LNI A;  2X6J A;  1OCC E;  2R2L A;  3IBE A;  3UKU G;  3RRU A;  1GW6 A;  2DZO A;  4GB9 A;  2FUI A;  4FAD A;  5B3S E;  1G3N B;  5D1M B;  3ZKJ A;  1HE8 A;  4Q6F A;  4HXI A;  1JUQ A;  2KZT A;  3QNK A;  4CT4 A;  3SFZ A;  1ZBP A;  4GTQ A;  3ENE A;  3GL6 A;  3HHM A;  4EBA G;  3FTS A;  4OAV B;  4QF2 A;  2GRN B;  4B89 A;  1XNF A;  4WUY A;  5H1V A;  2VGX A;  2E6S A;  5KWD A;  5LKZ A;  1OXJ A;  5BV1 A;  2CFU A;  3O35 A;  2R02 A;  4JL0 A;  2XGO A;  4XEI G;  3B7T A;  2XRZ A;  2H6G A;  2RFA A;  4WNE A;  2XS8 A;  3DWL G;  3HTK C;  3UIN C;  3L11 A;  1OCZ E;  1N0R A;  2C2V S;  3EB5 A;  2KWO A;  1OWP A;  5E76 A;  1TN7 A;  2QYU A;  5TAB A;  5SVI B;  1FP0 A;  3MV3 B;  4K03 A;  2LSU A;  2MNY A;  3KAE A;  4L23 A;  2KGG A;  3E37 A;  4LUN U;  2LXH C;  3ZPJ A;  2JRJ A;  4Z0R A;  3U5O A;  2IO3 C;  3QC1 A;  4B8A A;  4F53 A;  2LRI C;  4B7Y C;  2RFM A;  3EJN A;  4AUQ B;  4KZC A;  4HS2 A;  3HXF A;  5SVX A;  4JEH A;  4BHW A;  2KWN A;  3AJI A;  5LKX A;  5JJT A;  5H7P A;  4N2Q A;  3ZGQ A;  4P5O B;  3I4G A;  3VLD A;  4ILI A;  3E2D A;  2EQX A;  5FQ4 A;  2YQL A;  1JWF A;  3JXJ A;  3M63 A;  3LVR E;  3WG7 E;  2LV9 A;  3MHS A;  1SQM A;  2PUY A;  4A55 A;  4AY6 A;  3KQI A;  4N3W A;  1SW6 A;  3ASN E;  1WEQ A;  2BF0 X;  3AG3 E;  2EIL E;  2VGX B;  3NG2 A;  5JJ7 A;  2VYI A;  2F8X K;  3T8K A;  2DX8 A;  2VSO E;  3SHF A;  2ETB A;  1X4J A;  4GTV A;  2M3H A;  2YUC A;  3UM0 A;  1B89 A;  1TEZ A;  2LO6 A;  2FI7 A;  4LCT A;  2XP0 A;  5H1T A;  4U8V D;  4GPM A;  3ULY A;  1IXV A;  2EGM A;  1H19 A;  4U63 A;  5JA4 D;  1XGW A;  2R59 A;  4GNE A;  3FUD A;  3M62 A;  3UM1 A;  2K1J A;  3AU4 A;  4TXP A;  4AOF A;  1MBM A;  3LQH A;  3TXM A;  2DZN A;  2L0B A;  2JLB A;  3NZS A;  3Q9U C;  3T7L A;  2F6J A;  5E75 A;  3APD A;  2F42 A;  4BBQ A;  3L1X A;  4ABN A;  4W9R A;  5FQ7 A;  4UWL A;  3DXK G;  4DX6 D;  2H6I A;  3LEW A;  4FHK A;  2HE0 A;  3AG4 E;  1SA5 A;  3FY4 A;  4GZ6 A;  2RSD A;  3FH8 A;  3O47 A;  1LTX A;  3EU5 A;  4TXQ A;  5KH9 A;  1KZO A;  2KCK A;  2M85 A;  4IUL A;  4DUI A;  5T8I A;  3U3W A;  3EB6 A;  2H0D A;  4GTS A;  3RRM B;  2Y4T A;  3BU8 A;  3APF A;  4ANW A;  2I9C A;  3Q73 A;  1N54 A;  4J7W A;  4BTA A;  4A4B A;  5CEC B;  4DX2 A;  2VPB A;  4B94 A;  2ECV A;  1WEE A;  3MA5 A;  3MZL B;  5LCW C;  2F37 A;  3ZN3 A;  2JMJ A;  3VTX A;  3ULQ A;  4U95 D;  3TXN A;  3T9K A;  3PVL A;  5KBA A;  1D8E A;  4MSX A;  5BT1 A;  1PC2 A;  3UX4 A;  2HM8 A;  4BSZ B;  3Q1D A;  5T4Y A;  5BXO A;  5HS0 A;  1MYO A;  3UT7 A;  4PH4 B;  5B8D A;  4BET A;  5H1U A;  2LUH A;  1WEN A;  1KT1 A;  3D9N A;  4LEU A;  3ULE G;  3O48 A;  4AP2 A;  5EN5 D;  3FAN A;  3TWQ A;  2CON A;  2JUN A;  1Z3Y A;  3U5P A;  1HS6 A;  4ME2 A;  1U3D A;  2XPZ A;  1MX2 A;  2K17 A;  4WZ0 A;  3CHO A;  3RIB A;  1ELK A;  3CVQ A;  2C0L A;  3DDT A;  3HYM B;  4XZ4 A;  3UTM A;  3MCX A;  4S3O C;  2VJ8 A;  1BD8 A;  2XEV A;  2P9P G;  3SFY A;  4IN3 B;  3ASF A;  2CSZ A;  2XOC A;  1Z6U A;  3HCS A;  5IY5 E;  1JCS A;  3PE4 A;  5HRY A;  4UP5 A;  4KT6 B;  3ZIM A;  1Z6T A;  4DK5 A;  2DSM A;  4DRX E;  2KR4 A;  4LLB A;  1BLX B;  4JPS A;  3SOW A;  4N3B A;  1EDU A;  1OCR E;  3ZU7 B;  2GW1 A;  3CVV A;  2YHN A;  1UJK A;  3MYV A;  2VPG A;  2KE1 A;  3ZVZ B;  1QZ2 A;  3DSW A;  5KJM A;  2I2O A;  5CRV A;  3E33 A;  2IQC A;  1O5M A;  3ZRH A;  4GND A;  3HIZ A;  4ZUX U;  3JUE A;  5AIT A;  4FIP A;  1NZN A;  2FUU A;  5TBN A;  4RVB A;  2IOL A;  3FTY A;  1E90 A;  3W9F A;  2MIQ A;  2RR4 A;  4KZ0 A;  3ZNG A;  2WXK A;  4ANX A;  3CST A;  2PQR A;  3HXB A;  3L13 A;  3DBS A;  2E61 A;  4GTT A;  5AQA A;  2J09 A;  2KCV A;  2HO1 A;  3NF1 A;  1NA0 A;  3PUQ A;  2L7P A;  4DI3 A;  1CHC A;  4C0M A;  3KEA A;  4OGC A;  3MKR A;  1JWG A;  3JQ0 A;  1WIM A;  1NFI E;  4G24 A;  1E8W A;  2L0I A;  4KBQ A;  3UT8 A;  5B79 A;  2Y4U A;  3EIJ A;  4H7Y A;  3RPG C;  3IHP A;  4O64 A;  1DC2 A;  3Q9N C;  5B78 A;  4GCN A;  2L43 A;  2AXU A;  3BUA A;  1BI8 B;  4O6F A;  4TV3 A;  3FJU B;  4HI9 A;  1OT8 A;  2PZI A;  3FUL A;  3Q7F A;  4AEZ C;  1ELW A;  4CEM A;  4EBA A;  1BPO A;  3DSU A;  3C5K A;  2NYJ A;  4U04 A;  2KC7 A;  2L9B A;  3RAU A;  1N94 A;  2WB2 A;  5B77 A;  4LER A;  4I9C A;  3O36 A;  1ZU2 A;  1FT2 A;  4N5C A;  4YDO A;  2KKY A;  2DBA A;  4WWP A;  2MHK A;  4GPK A;  2MA6 A;  2WMN A;  5CRU A;  4HOS A;  1WE9 A;  4URK A;  4N2S A;  4GZ3 A;  4XI9 A;  5ENO D;  3GYZ A;  5AEN A;  3TG5 A;  3DSX A;  1K3Z D;  1E8Z A;  3ASD A;  4LNB A;  3URZ A;  4C0E A;  3LCA A;  1X5B A;  2OEW A;  2XS1 A;  3N9L A;  3OXF A;  3LJU X;  5ENS D;  3Q75 A;  3OAW A;  5HQ8 A;  1TNY A;  3NAW A;  3FHE A;  1K2F A;  4I6J A;  4L1B A;  4CCA A;  3N9M A;  2YYR A;  3QB2 A;  5ITZ F;  4EZK A;  2R5S A;  4UI9 J;  4I1M A;  1TR4 A;  1N87 A;  2FBN A;  3RRN B;  4AXH A;  1MZC A;  5G04 J;  1MQS A;  2BKG A;  5A7D B;  4DX5 D;  4BTB A;  4C9Z A;  3ZTG A;  3K9I A;  2Y3A A;  2LGK A;  4AJW A;  2V0P A;  2GRO B;  2MOW A;  4I1A A;  2VTB B;  5J90 A;  4F6R D;  4CZ2 D;  4JA9 A;  2QJ0 A;  4LK9 A;  1X4I A;  2UWJ G;  3I4R B;  3RKV A;  3E34 A;  4PUC A;  3DPD A;  4U8Y D;  5TDR A;  3M7K A;  4B86 C;  4E6H A;  3D9K A;  4PS8 A;  4GZC A;  4J8F A;  4F1S A;  5G04 B;  3PE3 A;  2QYJ A;  4GA2 A;  5AN8 A;  1XWH A;  4BSX A;  3HCT A; 
#chains in the Genus database with same CATH homology
 4KZC A;  2WXI A;  4GA0 A;  2QY7 A;  4HS2 A;  2MT5 A;  4AYC A;  1H0A A;  3AS4 A;  3ZEF A;  3FTV A;  4GB0 A;  1Y6I A;  4JEH A;  4DI4 A;  4BHW A;  3APC A;  2ECJ A;  2WPV A;  2KWN A;  3BG1 B;  5LKX A;  5JJT A;  2LGV A;  4N2Q A;  1WEO A;  3JYS A;  4CDR A;  2BTD A;  3ASH A;  3ZGQ A;  2XHE A;  1FBV A;  4KMO A;  5EKQ D;  1L5J A;  2E0I A;  3FUN A;  2ECN A;  3N9O A;  4P5O B;  3I4G A;  4CDN A;  3VLD A;  4ILI A;  3CLJ A;  2EQX A;  1QNF A;  5FQ4 A;  2YQL A;  4YAT A;  5DBK A;  2CKL A;  3FU5 A;  3ZFW A;  4D10 C;  3N9P A;  1JWF A;  1S0P A;  3U66 A;  3M63 A;  3LVQ E;  3LVR E;  4I43 A;  4G23 A;  3MV2 B;  3FU6 A;  3ZYM A;  3N71 A;  5KJL A;  2LV9 A;  1HFA A;  4TRQ A;  3TJP A;  2QIZ A;  3LRQ A;  4G1T A;  3MHS A;  5B75 A;  3BG0 B;  2RG8 A;  3QZV A;  3ZNI A;  4PS3 A;  3G2S A;  1UN8 A;  1SQM A;  3G2V A;  3N9N A;  2PUY A;  3ESK A;  3CHR A;  2WQ6 A;  4A55 A;  4AY6 A;  3LKU A;  3SI5 A;  4FA6 A;  3KQI A;  1TJF A;  3O34 A;  4N3W A;  2XGM A;  3HVE B;  3LY9 A;  3MHH A;  3S2A A;  3CVL A;  3MKQ B;  2M1R A;  1WEQ A;  2BF0 X;  2OOE A;  3QOU A;  5BW8 C;  3B7R L;  2VGX B;  5G55 A;  2WXJ A;  3SZ7 A;  5JJ7 A;  3FEY A;  4TUU A;  3NG2 A;  5EX0 A;  1VD4 A;  2VYI A;  4J6I A;  3TL5 A;  3B7S A;  1Z2Q A;  5JHA A;  2DX8 A;  2X6F A;  4BT9 A;  2WXN A;  4YBS A;  5DIN A;  2VSO E;  1E7U A;  3SHF A;  5BPP A;  5LOZ A;  4DLQ A;  5AIU A;  5I3L A;  1OUV A;  1Y8M A;  3Q47 B;  2IDA A;  3QAR A;  1X4J A;  3FDH A;  3MKQ A;  4JZY A;  1LDJ B;  4E85 A;  2YNQ A;  3PH0 C;  3U64 A;  4I7C A;  2FUL A;  3S7B A;  4A4C A;  2F6N A;  2M3H A;  2RD0 A;  4APO A;  2YUC A;  5DKA A;  2A5U A;  1B89 A;  2OND A;  3IHY A;  4N39 A;  3CIA A;  1TEZ A;  2LO6 A;  2FI7 A;  2YHC A;  4LCT A;  5ANR A;  1LDK C;  3VLE A;  2L80 A;  4LJN A;  4I9E A;  2VJF B;  4YND A;  5LP0 A;  2CHW A;  3D3M A;  2L75 A;  5TDW A;  4GYO A;  5H1T A;  4W4U A;  2L0T B;  3S7F A;  2V5F A;  2QFC A;  3Q15 A;  2LGL A;  1EF1 C;  3OTN A;  2VSY A;  2J4D A;  3CVN A;  4UQY A;  1H19 A;  4WWN A;  4U63 A;  1OWM A;  2ECT A;  3QWV A;  3CHQ A;  2GRM A;  2J4B A;  4Y6C A;  5JHB A;  2VJE A;  3CSF A;  2BUG A;  4UQZ A;  4WZ3 B;  1XGW A;  2R59 A;  3I5P A;  4GNE A;  1UW4 B;  2AWI A;  3FUD A;  2JMD A;  2LXP C;  2Y1M A;  3M62 A;  2K1J A;  5FER A;  2J08 A;  4XX5 A;  3AU4 A;  3FUM A;  4AOF A;  3CVX A;  2LXH C;  2X38 A;  3LQH A;  3TXM A;  2KWK A;  3L22 A;  2L0B A;  4FC8 A;  2E6R A;  1HXI A;  2YQ8 A;  2JLB A;  2CKL B;  5FWQ A;  1F62 A;  4J8S A;  3NZS A;  3VLF A;  1JM7 B;  5ANL A;  3T7L A;  4PTB A;  4I17 A;  3ZPV E;  2XCC A;  3OXL A;  4L2L A;  3ML8 A;  5KJK A;  4FJC A;  4L7T A;  3V43 A;  4KVO A;  2GGF A;  5D0Q D;  3P1U A;  3SNX A;  4CT0 A;  2F6J A;  1ELR A;  2KYU A;  2NSZ A;  3RK6 A;  1MHQ A;  1UJJ A;  5E75 A;  3FUF A;  3APD A;  3DPL R;  2F42 A;  2WXL A;  2YW8 A;  4BBQ A;  5KH7 A;  2LAH A;  5EX3 A;  5BV0 A;  3L1X A;  4YBT A;  4F52 B;  3SOX A;  1MM2 A;  3KEZ A;  5FZS A;  1HH8 A;  4W9R A;  4ABN A;  5FQ7 A;  1H2T C;  2WQH A;  1OWL A;  3CGH A;  3Q5M A;  4JW1 A;  4GYY A;  4NUR A;  2AXZ A;  4UWL A;  4CGV A;  3ONL A;  3TAX A;  4IC3 A;  4XI1 A;  4YAX A;  2Y43 A;  3SHB A;  3ASG A;  2WM9 A;  4PDX A;  4GMJ A;  3LEW A;  4FHJ A;  3TG4 A;  4FHK A;  3UQ3 A;  4ACL A;  3M99 A;  3CVU A;  1INZ A;  4I6E A;  4V3I A;  4GU5 A;  3ZXS A;  3FY4 A;  4GZ6 A;  3FU3 A;  3D9M A;  3RPG B;  4AP4 A;  2RSD A;  3LY7 A;  3MGB A;  1HYI A;  3FH8 A;  3RO2 A;  2VNF A;  3RO3 A;  3IHV A;  4Q94 A;  4KVM A;  4M3O A;  3GZ1 A;  2OXQ C;  3PRZ A;  4LAD B;  5KH9 A;  2ION A;  3E4B A;  3G2W A;  3PS6 A;  2C0M A;  1DVP A;  2KCK A;  4ILH B;  4IUL A;  5ARG A;  2M85 A;  4UP0 A;  1H2U A;  1FCH A;  3IKO B;  3PDN A;  5T8I A;  3U3W A;  2VTB A;  3EB6 A;  3QK0 A;  2A4Z A;  5AJD A;  5FB1 A;  2NXP A;  4AV7 A;  2UY1 B;  3CK8 A;  1HZ4 A;  2PM6 A;  3RRM B;  2IF4 A;  2Y4T A;  2H0D A;  3APF A;  4ANW A;  2I9C A;  3ZYL A;  1N54 A;  4BTA A;  4BFR A;  1V87 A;  2YSJ A;  1RMD A;  3B7U X;  2J49 A;  3N9Q A;  4A4B A;  5CMW A;  4U8H A;  1WEW A;  2ZET C;  2YIN A;  2VPB A;  4B94 A;  4A3V A;  3FUJ A;  2ECV A;  1WEE A;  2Y1N A;  3MA5 A;  4MVT A;  3ONK A;  4C9B B;  2IU1 A;  4GML A;  4GZD A;  3MZL B;  3PHD A;  3KS2 A;  4U0S A;  1SZA A;  3FWV A;  4UWF A;  5LCW C;  3RU0 A;  5LFA A;  3PZD A;  1MM3 A;  1W3B A;  3ZN3 A;  3O4Z A;  3L54 A;  5G05 J;  3UPV A;  2JMJ A;  2YRE A;  4IRU A;  2YSM A;  4BY6 A;  4FP7 A;  3VTX A;  3ULQ A;  2WMO A;  2WXQ A;  4L58 A;  1DNP A;  3TXN A;  3UMV A;  3PVL A;  3LS8 A;  2VGY A;  1HF8 A;  4AM9 A;  2X6H A;  3CHS A;  2KGI A;  3U4T A;  2FF4 A;  5AJL A;  2I6H A;  4MSX A;  3CR3 A;  3MEK A;  3T5V A;  3D9L A;  4FUL A;  4Q69 A;  2EA6 A;  5BT1 A;  5EYA F;  1H2V C;  1E96 B;  2OVF A;  5DIZ A;  3PNT B;  1PC2 A;  1U3C A;  2HM8 A;  4ILG A;  3UX4 A;  4I7B A;  5T4Y A;  5HI7 A;  4LRZ A;  2AW6 A;  5CCM A;  5D1L B;  4R8P K;  3L08 A;  4HOR A;  2YU4 A;  3UT7 A;  4PH4 B;  5B8D A;  3T5X A;  5H1U A;  2I1J A;  4G25 A;  4EPZ A;  2KRE A;  4WAF A;  2XEU A;  4DJA A;  4NN2 A;  1IHG A;  1WEN A;  4CCG X;  2ZU6 B;  3D9N A;  1KT1 A;  4LEU A;  3O48 A;  3R7R A;  3SF4 A;  3U9W A;  3UUX A;  4AP2 A;  4EEC A;  5KJN A;  4S3O B;  3R7Q A;  3HDX A;  5KH3 A;  3QDN A;  3C6W A;  5TRB A;  2J07 A;  3LYA A;  4HOQ A;  4JEU A;  5FZQ A;  3NZU A;  1Z3Y A;  5G05 C;  2WXO A;  3NQP A;  1HS6 A;  3U5P A;  4ME2 A;  2FSA A;  3S7D A;  1U3D A;  2XPZ A;  4WZ0 A;  2K17 A;  3CHO A;  4V3L C;  3QKY A;  5LX8 A;  1WM5 A;  4L2Y A;  3RIB A;  4I6G A;  1T1H A;  1WGM A;  5H9M A;  1ELK A;  3CVQ A;  2C0L A;  4UWK A;  1PAQ A;  3RTR B;  3HYM B;  5CCL A;  2CG2 A;  4Y6W A;  4XZ4 A;  3U5N A;  4A49 A;  3MCX A;  3IEG A;  3PRE A;  2HR2 A;  1HO8 A;  3CQG B;  3CKB A;  3QJZ A;  1PY1 A;  2VJ8 A;  4GCO A;  4JVS A;  3L1Z B;  2XEV A;  5FEY A;  3L6A A;  4XKC A;  4N3C A;  3HVE A;  1HX8 A;  4G11 A;  4BT8 A;  3D9O A;  5C1D A;  3KD7 A;  4WNF A;  5BNW A;  3SOU A;  4A0C D;  4YBM A;  4IN3 B;  3ASF A;  3T8M A;  2CSZ A;  3FH7 A;  4MS6 A;  1Z6U A;  2KCL A;  5EDS A;  1H6K A;  3HCS A;  1VDY A;  3PE4 A;  1SZ9 A;  2WVI A;  4TKP B;  4QFV A;  4AYC B;  1G25 A;  2AN6 A;  3HCT A;  2C2L A;  2PL2 A;  4FJZ A;  5JG6 A;  4UP5 A;  3CVW A;  2I1K A;  4KT6 B;  2KAT A;  2WXM A;  2AXV A;  1Z6T A;  3ZIM A;  4DK5 A;  3AS8 A;  2GRL A;  1JM7 A;  2KR4 A;  1P5Q A;  4XIF A;  3FUI A;  4YC9 A;  2VPE A;  4OVU A;  4WND A;  4LLB A;  2ECW A;  1JOC A;  4H7X A;  3O70 A;  5C11 A;  4S3O C;  4JPS A;  3SOW A;  3ZW3 A;  2RI7 A;  4N3B A;  4AY5 A;  1EDU A;  2P58 C;  2CHX A;  2GW1 A;  5D1K B;  1IYM A;  4NAC A;  2XB1 A;  5FT9 A;  1WES A;  3CVV A;  4GA1 A;  2YHN A;  3PEV B;  4WNG A;  1VYX A;  1UJK A;  3MYV A;  3QWP A;  2V8S E;  2VPG A;  2KE1 A;  3QAQ A;  3ZVZ B;  1QZ2 A;  2L5U A;  3T6R A;  3JCK C;  3LY8 A;  2KFT A;  3LQI A;  1HU3 A;  3ZHE A;  5KJM A;  2I2O A;  2X6I A;  2WXH A;  2ECI A;  2CSY A;  2VP7 A;  3U5O A;  3FTX A;  2IQC A;  3JQ1 A;  4Q96 A;  2VJE B;  3ZRH A;  4GND A;  1E8X A;  1QQE A;  3HIZ A;  4FU3 A;  3FEX A;  2XPI A;  4G2V A;  4J8E A;  1Z60 A;  4ZUX U;  5AIT A;  4FIP A;  3CK7 A;  1NZN A;  3PNL B;  2FUU A;  4YAB A;  5J08 A;  4RVB A;  5TBN A;  3FP3 A;  2IOL A;  2IJG X;  3FTY A;  4N3A A;  5CMY A;  1E90 A;  3ML9 A;  1FVF A;  3BEE A;  3ESL A;  4HVB A;  4KZ0 A;  2XQ0 A;  2MIQ A;  4BX9 A;  4PPE A;  4WZ2 A;  4ANV A;  4GNG A;  2WXK A;  3JUI A;  5A6C A;  2YUR A;  1E7V A;  3KNV A;  3B13 A;  3ZYQ A;  3O7A A;  3Q49 B;  3LPZ A;  4RSY A;  2XPY A;  4ANX A;  2AVP A;  2PM7 A;  3CST A;  2PQR A;  1WAO 1;  3RJV A;  2CHZ A;  4FLB A;  4UWH A;  5CHE E;  4BSX A;  3L13 A;  3DBS A;  2LGG A;  1HYJ A;  1EYH A;  1WEV A;  4XI0 A;  4YVO A;  5ARF A;  2J09 A;  2XRY A;  4BWR A;  2G45 A;  4IC2 A;  2KCV A;  1VFY A;  2HO1 A;  3CHP A;  3EHN A;  3CV0 A;  3I3N A;  3NF1 A;  3ZVV A;  2XGS A;  1X4U A;  5LCW B;  1NA0 A;  3PUQ A;  2OV8 A;  4I2Z A;  3R9A B;  2HYE D;  4UQX A;  4PS7 A;  4DI3 A;  5FTP A;  4EQF A;  4HLE A;  4JC8 A;  5M72 A;  1HG5 A;  1CHC A;  2UZG A;  3QWW A;  4C0M A;  3LXU X;  2CT2 A;  4FO9 A;  3FUK A;  4UWG A;  4B8C B;  5FQ6 A;  3MKR A;  3Q4A B;  3AS5 A;  5FZR A;  1JWG A;  2WQ7 A;  2M63 A;  3JQ0 A;  3MX3 A;  2IFU A;  4CRW A;  2LSV A;  5G0F A;  1WIM A;  1E4U A;  2X6K A;  4G24 A;  3PEU B;  3LJ3 A;  3P2B A;  1E8W A;  2DIW A;  2L0I A;  4JA7 A;  4DLO A;  2ILR A;  5KCM A;  2MA5 A;  4J8D A;  2WXR A;  2KIZ A;  2JEK A;  3LQJ A;  2PQN A;  4KBQ A;  1Z3X A;  3UT8 A;  5FB0 A;  1TJC A;  2E2E A;  2VPD A;  4NRH B;  5T3R A;  5B79 A;  2K4D A;  3ZYK A;  2VSN A;  3SBT B;  4WA6 A;  4UI9 C;  2Y4U A;  3EIJ A;  2L6J A;  5AYW D;  4XE0 A;  3CEQ A;  4H7Y A;  2YHO A;  5C13 A;  3AU5 A;  4IYP A;  2HDP A;  4GAA A;  3L17 A;  3IHP A;  4O64 A;  4UI9 B;  1JPL A;  4U07 A;  3RPG C;  4GCN A;  5B78 A;  4ACK A;  5JJ6 A;  3LDZ A;  2AXU A;  3FTU A;  4TV3 A;  4O6F A;  2DCP A;  5FJY A;  2L43 A;  4GYW A;  1ZBD B;  3EIQ C;  3TGO A;  4OYS A;  2PZI A;  3GZ2 A;  4R2Y A;  3FUL A;  4U0Z A;  1YA0 A;  4R7E A;  4AEZ C;  1ELW A;  1OWN A;  4CEM A;  4CDM A;  5A23 A;  4LKA A;  3U5M A;  3ZPV 1;  4F3V A;  4EBA A;  4X3G A;  1BPO A;  4HOT A;  2LAI A;  3C5K A;  3CKC A;  4U04 A;  2KC7 A;  2L9B A;  4MRU A;  5LKU A;  3FTZ A;  3UT4 A;  2CG3 A;  3O37 A;  3ZHE B;  4GNF A;  4DPR A;  3FL2 A;  4G26 A;  5G2N A;  1OWO A;  2OVB A;  4UI9 K;  2WB2 A;  2HYZ A;  3GW4 A;  4FJY A;  4LER A;  5B77 A;  4I1O B;  1BOR A;  2FEZ A;  4I9C A;  2YHE A;  2G6Q A;  3G2U A;  1IQU A;  4YVQ C;  2MRI A;  2WXP A;  3O36 A;  2YT5 A;  1N52 A;  1ZU2 A;  2IOS A;  3GZS A;  3DQV R;  2MD8 C;  4HFG A;  3VK6 A;  1WEU A;  4ZQL A;  3CK9 A;  4AVX A;  2R17 C;  4FLH A;  4N5C A;  2Q7F A;  4APF A;  4ATG A;  4FK5 A;  3I2D A;  3CVY A;  4ZDT A;  3PUJ A;  4GZ5 A;  3IV0 A;  2LN0 A;  3CQC B;  2DBA A;  3PUK A;  2MHK A;  4WWP A;  4ANU A;  2WMN A;  4EZJ A;  4GPK A;  2M6M A;  2MA6 A;  2NC9 A;  5B76 A;  2J9Q A;  2VQ2 A;  3PUR A;  2MD7 B;  3FH5 A;  2MNZ A;  2I50 A;  2UY1 A;  3SGH A;  4HOS A;  1WE9 A;  3VTY A;  3D9P A;  1FVH A;  4A1G A;  1WIL A;  2H0D B;  2K16 A;  4URK A;  3L16 A;  2LNI A;  2X6J A;  4N2S A;  4KXK B;  4GZ3 A;  4XI9 A;  2NAA A;  3GYZ A;  4JHJ A;  4MLP A;  5AEN A;  2WXG A;  4U0U A;  3D9I A;  4KYO B;  3TG5 A;  3IBE A;  1NP7 A;  1E8Z A;  4MKT A;  3RRU A;  1GW6 A;  3ASD A;  5BUZ A;  4GB9 A;  2FUI A;  3URZ A;  4C0E A;  3KV6 A;  3LCA A;  4FAD A;  2MUM A;  1X5B A;  1WEM A;  2KM4 A;  2CFZ A;  3N9L A;  3OXF A;  1UN9 A;  4RG9 A;  4OVV A;  5D1M B;  5LCW J;  2KU3 A;  3D9J A;  1HE8 A;  4Q6F A;  4HXI A;  1JUQ A;  2KZT A;  3QNK A;  4WWO A;  2VJF A;  4JHR A;  4CA1 A;  3OAW A;  3S7J A;  5HQ8 A;  2D8S A;  3FHE A;  4CT4 A;  4I6J A;  4JHK A;  1K2F A;  2VSX E;  4L1B A;  1ZBP A;  3MJW A;  3SFZ A;  2PNX A;  3ZVY A;  4I7D A;  4CCA A;  2X3M A;  4N4F A;  2EGP A;  2ECG A;  1KLX A;  3CHM A;  3ENE A;  3C98 A;  3HHM A;  4EBA G;  3GL6 A;  3FTS A;  4F7A A;  4QF2 A;  3SD5 A;  4BX8 A;  4B89 A;  3N9M A;  1XNF A;  2YYR A;  1HG2 A;  3QB2 A;  2KZT B;  4EZK A;  4A3T A;  2R5S A;  3G2T A;  2YQM A;  4UI9 J;  4I1M A;  4K0R A;  4WUY A;  1N87 A;  4V3K C;  2FBN A;  3RRN B;  4AXH A;  5H1V A;  3EHM A;  5G04 C;  5LKT A;  2VGX A;  2E6S A;  4XKB A;  5G04 J;  1MQS A;  5A7D B;  5LKZ A;  5D0O D;  5BV1 A;  1E8Y A;  4JXT A;  2CFU A;  4YAD A;  4BTB A;  4C9Z A;  3ZTG A;  3O35 A;  3K9I A;  4HOU A;  3FFL A;  2FO7 A;  4J0U A;  4JL0 A;  4AIF A;  4RG6 A;  1EPU A;  2Y3A A;  2XGO A;  1IQR A;  5ENN A;  2EOD A;  2WXF A;  3B7T A;  4AJW A;  2LGK A;  2V0P A;  3FUE A;  2XRZ A;  2V4L A;  1NA3 A;  1WEP A;  4WNE A;  1LF8 A;  5J3X A;  1WFK A;  2MOW A;  4I1A A;  2KWJ A;  2LQ6 A;  4I2W A;  2VTB B;  5J90 A;  3HTK C;  3L11 A;  3EB5 A;  2C2V S;  3CVP A;  2KWO A;  1OWP A;  5E76 A;  3FU0 A;  3WXX A;  4JA9 A;  2QJ0 A;  4LK9 A;  2XCB A;  4EZL A;  1X4I A;  2BAY A;  2QIC A;  2UWJ G;  5TAB A;  3I4R B;  2JMI A;  5C2Y A;  1U6G B;  3RKV A;  3EDT B;  5G05 B;  4PUC A;  1KT0 A;  3DPD A;  4QF3 A;  5TDR A;  1FP0 A;  3MV3 B;  4K03 A;  2LSU A;  3FTW A;  4B86 C;  4L7X A;  4E6H A;  2MNY A;  3KAE A;  4L23 A;  2KGG A;  4CGW A;  3O33 A;  3FUH A;  4LUN U;  3D9K A;  4NQ0 A;  4P29 A;  4PS8 A;  3ZPJ A;  2G43 A;  2JRJ A;  3OXG A;  2LDR A;  3QC1 A;  3ASL A;  4GZC A;  3HCU A;  4J8F A;  5AIJ A;  4B8A A;  3SBS A;  4R7L A;  4F1S A;  4A1S A;  5G04 B;  1UG3 A;  4B0Z A;  4F53 A;  1IYG A;  3PE3 A;  3KV5 A;  2LRI C;  4GA2 A;  4B7Y C;  1XWH A;  3GV4 A;  1A17 A;  1WY6 A;  3EJN A;  4AUQ B;  5FQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...