3ZYQA

Crystal structure of the tandem vhs and fyve domains of hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) at 1.48 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
216
structure length
216
Chain Sequence
b'GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
publication title Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) at 1.48 A Resolution
rcsb
source organism Homo sapiens
molecule tags Signaling
total genus 73
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zyqA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zyqA02
2E6SA 5FEYA 4R8PK 4QF2A 3D9MA 4YABA 3D9OA 2VPBA 2JRJA 1VD4A 1HG2A 1E4UA 4JXTA 4AP4A 4CA1A 4WA6A 4C9ZA 2XB1A 3NG2A 3MHSA 1X4JA 2M6MA 2ECWA 2H0DA 4FJCA 1PY1A 4N3WA 1XGWA 3MHHA 3ZVYA 1WGMA 1WEVA 3N9MA 4IC2A 4CCGX 1JOCA 1DVPA 3G2TA 2MT5A 2C2VS 3T6RA 3RPGB 4R2YA 5KH7A 4B7YC 1MHQA 5B79A 2VJFB 2YHNA 3ZYLA 3DPLR 2LV9A 3ZYMA 2YSJA 1X5BA 5KH3A 4AVXA 2LDRA 2LRIC 2YURA 2QJ0A 1FP0A 3G2UA 4AUQB 2CKLA 2FUIA 4PTBA 2DCPA 3D9LA 3L1XA 1T1HA 2VNFA 5JG6A 2K16A 5D1MB 2KFTA 2L80A 4N4FA 2E6RA 4X3GA 4V3LC 2KWOA 1WESA 3O33A 5TBNA 4I7CA 2YQLA 5D1LB 4UI9B 4YBMA 2K4DA 4GB0A 2Y43A 4WZ2A 2L0BA 1HYJA 1FBVA 1JPLA 3PUQA 2VPDA 3C5KA 4A49A 1RMDA 5B8DA 2YYRA 3ZTGA 2LXPC 3ASLA 4I7BA 2XEUA 3O70A 2F6NA 5AITA 1LF8A 2KWNA 1U6GB 4FK5A 2EODA 3U5NA 2L0TB 5FB0A 3D9IA 4WZ0A 2EGPA 5KH9A 1WEEA 3SHBA 2MNYA 2YT5A 5EYAF 5B78A 2BAYA 2LGGA 4LKAA 1ZBDB 5TABA 1WEOA 2LQ6A 1WFKA 5TRBA 4R7EA 1G25A 4GZDA 1WENA 3FL2A 3QZVA 3M99A 1UJKA 5DKAA 3V43A 4L58A 2K1JA 2L0IA 1MM3A 2D8SA 2ECTA 2K17A 2QY7A 4PPEA 2JMIA 3G2WA 3O36A 1WE9A 3HCTA 3ZPVE 3PHDA 4BHWA 2MIQA 5LKXA 1JM7B 1Z6UA 2HDPA 2F6JA 4A4BA 3G2VA 5LP0A 2L75A 4UP0A 4I7DA 1SZ9A 4FU3A 2VJEA 1SZAA 4MSXA 4NN2A 2MA5A 2FSAA 4YC9A 3ZNIA 3KV6A 2YSMA 5H1UA 2Y1MA 3CLJA 3LQIA 1XWHA 2ZETC 1WEUA 2NAAA 2DX8A 4YADA 1IYMA 3ZVZB 3D9NA 1MM2A 2KU3A 4V3KC 1JWFA 3KV5A 2M85A 5LKTA 3U5MA 2FUUA 4FLBA 2MUMA 2KYUA 5I3LA 1HYIA 4B86C 3O37A 5J3XA 5TDWA 1ELKA 4Q94A 4S3OC 3N9PA 2F42A 2RI7A 3G2SA 2YQMA 5H9MA 2I50A 5CMYA 3O35A 2G43A 2KREA 3N9LA 3O34A 1N87A 3ZYKA 4GNGA 4ZQLA 2L5UA 2LGKA 4Q6FA 4ZUXU 1INZA 4LADB 5H1VA 4ZDTA 5B75A 2KIZA 4XI1A 1WEPA 3SOUA 2IDAA 1HG5A 2EA6A 4AYCB 3LDZA 3VK6A 3HTKC 2DIWA 1HFAA 2BF0X 2G45A 2Y1NA 2YW8A 1JWGA 4W4UA 3RPGC 4A4CA 1K2FA 2V8SE 2CSYA 5FB1A 5G05B 1V87A 4YBSA 2YU4A 2MOWA 1HX8A 5G04B 2VJFA 3O7AA 4Q96A 3GL6A 5B76A 5D1KB 4FIPA 1CHCA 2L43A 5LCWB 3HCUA 1WEWA 2CKLB 2ECIA 1EYHA 4GNEA 4YATA 2VPGA 5G0FA 3RTRB 3D9JA 2MD7B 2M3HA 1VDYA 2MD8C 2ECVA 2PUYA 1HF8A 1WIMA 4NACA 2MNZA 1WEMA 4S3OB 5LKUA 2KM4A 3SOXA 2VP7A 2LO6A 1H0AA 4YBTA 5H1TA 2MA6A 2YHOA 2ECGA 1JUQA 3IHPA 5DINA 2QICA 3N9OA 1Z60A 1F62A 3M63A 3LRQA 4IC3A 2KR4A 4AYCA 5AIUA 2LGLA 3GV4A 2LXHC 3L11A 2UZGA 3D9PA 2KE1A 3KNVA 4A0CD 4GNDA 4QF3A 3I2DA 2HYED 3N9NA 4UP5A 4TKPB 1WEQA 2YUCA 3HCSA 5LKZA 5J08A 3N9QA 4FO9A 5C13A 3LQJA 3LQHA 3L1ZB 3EB6A 4LK9A 1X4UA 1Z2QA 4LJNA 1VFYA 3T7LA 2AN6A 2JMDA 2CSZA 3M62A 3ZYQA 2H0DB 3C6WA 4YAXA 4O64A 3ONLA 3SOWA 3ONKA 4WZ3B 4GZCA 2KWKA 5C11A 2QIZA 2CT2A 3PURA 1JM7A 1LDKC 2RSDA 5LOZA 2VJEB 1UJJA 2LGVA 2C2LA 3U5OA 2ECJA 2G6QA 4P5OB 5CMWA 2LN0A 3ZPV1 2KWJA 2OXQC 1X4IA 1VYXA 3D9KA 1WILA 4BBQA 1BORA 4MVTA 1EDUA 3KQIA 2ECNA 2JMJA 4GNFA 4L7XA 2KGIA 3RRUA 4F52B 1LDJB 5B77A 3U5PA 4HFGA 4LLBA 2M1RA 5TDRA 3EB5A 3DQVR 5FERA 2KGGA 2YREA 2VPEA 2PNXA
chains in the Genus database with same CATH superfamily
4HVBA 4MRUA 4F1SA 5FEYA 4R8PK 4QF2A 4ATZD 3UM2A 2VPBA 4BERA 4OVUA 1LD8A 1RZ4A 3M7KA 2I6HA 3FTVA 3SNXA 3FTUA 2GROB 4JXTA 5JJ6A 3FUJA 1Z6TA 2XB1A 2ECWA 5BUZA 1OY3D 4DJAA 2XHEA 3Q7AA 3U3WA 3UINC 4BT8A 5CRVA 1XGWA 5SVIA 5FWQA 2XQ0A 3OXFA 1WGMA 4HRLA 4EBAG 4I1MA 4F1PA 3B7UX 4B94A 5KJKA 3CVQA 4B0ZA 4CCGX 1DCEA 3IHVA 3UM3A 3RPGB 4Y6WA 2VJFB 5JHAA 2XPZA 2RKKA 2E0IA 1NA0A 4JEHA 5CECB 3ASDA 4KVOA 1H2TC 5CEAA 2Q7FA 3Q9UC 3UM0A 2YURA 4L23A 2QJ0A 2WXPA 2OVBA 3T5VA 3CHRA 3ASFA 3L1XA 2LXLA 2Y1LE 3PEUB 5JG6A 2KFTA 2YVRA 1MX4A 1OWOA 4V3LC 3O33A 2CHZA 3CKCA 2VSOE 3QK0A 5D1LB 2F0YA 4I9EA 4UI9B 1BI8B 2H6HA 2M13A 4GB0A 2X6IA 2F37A 3L6AA 1DC2A 3RJVA 4A49A 3KAEA 3LVQE 2LXPC 3SGHA 1S70B 3EDTB 2F8XK 1E90A 3DSSA 3MJWA 2XEUA 3O70A 3WXXA 3DWDA 4FK5A 3FANA 3D9IA 3PS6A 4LG6A 3B13A 5KH9A 1WEEA 4HNAD 3RO2A 5EYAF 1O1RA 3FU3A 4UQYA 1WEOA 3QB2A 3O4ZA 4D10C 4UQZA 5TRBA 4DI4A 2XEEA 4R7EA 1G25A 2WXMA 2J49A 3Q73A 5FINA 1IKND 2E2EA 2V4LA 3ZNGA 4PH4B 2VTBB 2FFWA 4ILGA 2K1JA 2KCLA 4EHMA 4I6GA 1WAO1 5EX0A 3B7RL 1S63A 2X6JA 2K17A 2V4HC 1EF1C 3CVPA 2WXFA 3HCTA 3SUBA 3Q15A 4N39A 3PHDA 1N4SA 4K5CA 4FHJA 1E8ZA 2WVIA 2L6JA 1OCRE 2HDPA 2F6JA 3JQ0A 4PUCA 2NXPA 2P2CP 3MA5A 3ML9A 4UP0A 4TXQA 4FU3A 1SZAA 1TNUA 5FT9A 2FSAA 3KSLA 2X38A 2YSMA 2DBAA 2J08A 5ITZF 5LCWJ 4LCTA 2NSZA 4APOA 4ANXA 5JMND 4G8LA 4BEPA 4YADA 5EIDA 5LCWC 1IYMA 3ZVZB 1OWPA 4IRUA 3ZRHA 1TEZA 1P5QA 2OEVA 4AEZC 4A3VA 2R02A 3EUVA 3DXMG 4FLBA 2CHXA 4XKCA 4FA6A 1NZNA 2MYOA 4AY5A 1HYIA 3ZGQA 3KDEC 2DJAA 4YVQC 1K1BA 1LD7A 2X6KA 4YDOA 5HS0A 2PNNA 4Q94A 3HHMA 4XKBA 2P9PG 5AENA 2JUNA 2I50A 4G25A 3PZ2A 1QBQA 3APDA 3QWWA 5CMYA 3FUMA 5ENQD 2L5UA 4OGEA 3ZEFA 5ENTD 4ZUXU 1INZA 3ZKJA 5FZSA 4NIKA 5KJLA 5H1VA 4WUYA 3HXCA 1ELWA 3AG4E 5B75A 4RG6A 2KIZA 4AXHA 3VLFA 4OYSA 4F53A 1WEPA 2IDAA 3MYVA 1HG5A 4JL0A 3LDZA 5IY5E 4ACLA 1HFAA 3S7DA 2YW8A 1JWGA 4W4UA 1K2FA 2V8SE 1E8XA 2CSYA 4RSYA 5T8IA 3AJIA 4MKTA 3PLWA 3W9GA 2WMNA 3MKQA 4Q96A 5D1KB 3CKBA 4FIPA 2J8SD 3HCUA 5LCWB 3FTZA 3GYZA 3FU5A 3NBNB 1WDYA 2VPGA 1UOHA 3MEKA 2XENA 3DWLG 3V2XA 1BD8A 3RTRB 5J90A 3Q9NC 4KZCA 3AU5A 3ENEA 2MD8C 3QJZA 4GA0A 3R7RA 1RW2A 3T8MA 3X2QE 4I9CA 2V0PA 5FIOA 1WEMA 3TG4A 3C72A 3AS4A 5FZRA 2KZTA 4X8QA 2LO6A 2IEJA 2AXZA 5DIZA 3U4TA 2ECGA 1JUQA 1BPOA 4M7CA 4DX7D 4J8FA 2WXHA 3SY2A 1A5EA 4RLYA 1QNFA 4WWNA 2KR4A 4AYCA 4C0MA 4HOQA 2YHEA 3KNVA 2R2LA 2HYED 3CVYA 1IQUA 3DSWA 2XPYA 5J08A 2IO2C 4FO9A 2R05A 3ZN3A 1N54A 3LQJA 3LQHA 3EB6A 2ZGGA 2DZNA 3RK6A 3L82A 2ILRA 2R59A 4LRZA 3FH8A 5T4YA 1IXVA 2CSZA 3M62A 3W9FA 4YAXA 4GMRA 3S7JA 3PE4A 5KNGA 4TXRA 1MZCA 4J8DA 1JM7A 1LDKC 3EHQA 4NQ0A 3B95A 1N52A 4UI9K 1KT1A 2VJEB 3V79K 4GTMA 4QFVA 4DX1A 3AAAC 5KJMA 3UT7A 3NQPA 4ZHBA 1TYQG 2NYJA 2LN0A 3PZ4A 1KPSB 2WQ7A 3DRAA 3E30A 2WXKA 3SZ7A 3S7BA 1EDUA 3KQIA 3CVXA 4GNFA 5KCMA 4L7XA 1Y6IA 3RRUA 3L54A 2I9CA 3HVEA 1KT0A 4I6JA 3U66A 5A6CA 4JA7A 4LLBA 2FO7A 5TDRA 3EB5A 4A63B 4MLPA 3ASHA 2VPEA 2PNXA 4FJYA 1G3NB 5JHBA 2E6SA 4DLOA 2DWZA 3WG7E 3SBSA 3Q79A 3MZLB 3FUHA 3UKRG 3V30A 3LY7A 1N4RA 3I4RB 4K03A 1HG2A 3JUIA 1N4QA 1VD4A 3Q47B 1E4UA 4B8CB 2PQNA 4MS6A 2IY0C 4C9ZA 3FTYA 4I2WA 3MHSA 2M6MA 3O47A 4AOFA 3LYAA 3MX3A 4I1AA 1PY1A 3CVWA 4FLHA 4JA9A 1PC2A 4I43A 1WEVA 3VLEA 3FH7A 2VJ8A 4HS2A 2LAIA 2B0OE 2ONDA 4IC2A 2WXQA 3I5PA 2HM8A 2XOCA 1DVPA 4JC8A 5G55A 3G2TA 4DI3A 2P58C 4JVSA 2C2VS 4R2YA 4B7YC 3IEGA 3DPLR 3ZYMA 3R9MA 3QAQA 5KH3A 2ZISA 2BEDA 4A1GA 1FP0A 4AUQB 2CKLA 2JABA 1MBMA 5EILA 4O60A 1T1HA 4N4FA 2L7PA 2AW6A 2E6RA 2CHWA 2KWOA 3RRNB 4I7CA 1UN8A 3NZUA 4R7LA 5A23A 2Y43A 5SVYA 5C1DA 3PUKA 1RMDA 2A4ZA 3C3RA 3QKYA 2YYRA 3ZTGA 3IKOB 5FJYA 3J5PA 3C98A 4I7BA 4FADA 3GZ2A 4TXPA 3CSTA 4XZ4A 2F6NA 3KS2A 2H6IA 3U5NA 2L0TB 5FB0A 3T5XA 3TAXA 4URKA 2EGPA 2ETAA 1TJCA 5ENPD 4UWLA 5B78A 1HS6A 5ARFA 2BAYA 4U04A 4ANVA 2R5SA 3LCAA 3BG0B 3VTYA 3LXUX 1UJKA 4GTOA 3SD5A 1E96B 3V43A 2NC9A 1MM3A 2D8SA 3FEHA 1OWNA 4PPEA 3O36A 1WE9A 2CRWA 2QYJA 4I1OB 5CCLA 3ZPVE 3SQVA 3TL5A 4BHWA 3OTNA 3ISMC 3CV0A 3HG0D 3P2BA 2HYZA 4DRXE 2L75A 3AS5A 3LY8A 4I7DA 1SZ9A 3CGHA 3HXEA 5HKPA 1JCQA 4MSXA 5ANRA 3CK7A 3BQOA 3LQIA 2WXRA 3FFLA 1O1TA 1U2VG 1WEUA 3SHFA 1TNYA 4NURA 4CRWA 4G11A 3FH5A 3ZHEB 4PS8A 2IO3C 3D9NA 1MM2A 4V3KC 3EHNA 5C2YA 3HDXA 1IHBA 2VGXA 5A7DB 1NA3A 2QZAA 3H7HA 2UY1A 5I3LA 5BV1A 4B86C 3HIZA 1U3DA 1OWLA 2WXLA 2F42A 2MRIA 2YQMA 5H9MA 2QC9A 2VTBA 4Y6CA 2KREA 4ZQLA 4U63A 3TWVA 2LGKA 3DPYA 5B1AE 2PL2A 4BX8A 5JJ7A 4Z0OA 5EX3A 3PUJA 4U95D 4CDMA 1KLXA 3L16A 5SVIB 2CG2A 3FWVA 1W3BA 4B8AA 5ARGA 3ULEG 1AWCB 2G45A 2Y1NA 2B6CA 2YQ8A 1FVHA 1NP7A 4A4CA 4GCNA 1B89A 3MDBC 5CBOA 2WM9A 1V87A 2MOWA 2GRNB 2BKKB 1MQSA 4KMOA 2EIJE 4HRMB 5HRYA 3TJPA 1CHCA 3BG1B 3B7BA 3BU8A 3RKVA 2J09A 2L43A 1WEWA 2ETBA 1EYHA 3IHYA 3CVNA 5AQ7A 4CCAA 2H6FA 4APFA 3CK9A 3EJNA 4G2VA 2ETCA 3C3OA 1MX6A 2ZIRA 5G0FA 3DXKG 3D9JA 4RG9A 3HYMB 2MD7B 4HI9A 5FTPA 3I3NA 4CGVA 3SOXA 3V2OA 4ABNA 3CIAA 5H1TA 4DPRA 4LERA 2YINA 3ZPJA 3RSEG 3MV2B 1YMPA 3GZ1A 3SI5A 3KEAA 3HRAA 4N2QA 2QICA 4XIFA 4K0RA 3M63A 3UX4A 5D0QD 4HOUA 4CGWA 3F6QA 4IC3A 2L6BA 3JUEA 2UZGA 1HZ4A 3D9PA 2AVPA 4I2ZA 3R9AB 2LAHA 5E76A 1X81A 2VSYA 3N9NA 3ESLA 4AP2A 2E61A 2WXGA 2YUCA 3HCSA 2P9UG 5C13A 3ASGA 1WG0A 4JB8P 3L1ZB 4RVBA 4F3VA 1X4UA 3UM1A 4J6IA 3ZIMA 2CSVA 4U8HA 5AQ9A 1SW6A 2P9KG 3FTXA 4PS3A 2AN6A 5BPPA 2QFCA 1KZPA 1E7VA 4WNFA 2H0DB 4L9PA 2IU1A 5ENOD 3ONLA 2XZTG 4YDYA 1TNBA 3ONKA 4GYOA 5FQ6A 4CT0A 1PAQA 4U0UA 3IBEA 1ZB1A 3JYSA 3FEYA 3QARA 2XP0A 5LOZA 5BNWA 2EILE 1UJJA 3ZVVA 5AN8A 1TN8A 1BLXB 4RQIA 3U9WA 2OVFA 5M72A 1Z5SC 5EYLA 5D66A 1OT8A 3CR3A 1X4IA 1VYXA 3D9KA 3E32A 2LAUA 2OEWA 3CVVA 3CHMA 4IYPA 5BXOA 2KGIA 4ACKA 1OWMA 3EIJA 2MKEA 2GGFA 2C0LA 4HFGA 5CCMA 1V54E 4GMJA 4A1SA 2EQXA 3FM8C 2M1RA 2CFZA 1A17A 3MGBA 3MCXA 1TNZA 3RAUA 4YABA 3UPVA 2JRJA 5LFAA 1ZBPA 3O48A 2HE0A 4GU5A 3DSUA 4CEMA 2XPIA 4AP4A 3E2DA 4WNEA 4TV3A 4F6RD 4WA6A 3VLDA 3I4GA 3DPDA 3NG2A 1QQEA 5G2NA 4FJCA 1E8WA 2RFAA 3MHHA 2GRLA 3JQ1A 3N9MA 4KBQA 5G05J 2J4DA 3OXLA 2OWAA 5FQ8A 4LEUA 5G04J 3E37A 5G05C 5AYWD 3B7SA 1K1AA 3CHPA 3QWPA 2MT5A 3FEXA 1MHQA 4BWRA 2YHNA 3ZYLA 2YSJA 1X5BA 3MKQB 2VQ2A 4O1OA 1Z3YA 3LS8A 2EGMA 2LDRA 5JA4D 3FDHA 3KSQA 3HXBA 5KWDA 4ANWA 2PQRA 3KD7A 2FUIA 2DCPA 3D9LA 2VGYA 2VNFA 3UMVA 1TR4A 2L80A 4G1TA 4WAFA 3CHQA 4X3GA 4O62A 3TGOA 1WESA 5TBNA 4ILIA 2YQLA 3N71A 2IJGX 3SBTB 2KKYA 3DEPA 2I1JA 3UIOC 4WZ2A 3FHEA 1JPLA 3PUQA 2VPDA 2RD0A 1WM5A 1K8KG 4QQ4A 4UWGA 5CRUA 2I1KA 3ASLA 1N9AA 4JHRA 3FAOA 1BU9A 2WQ6A 5FZQA 2GRQB 5AITA 2RG8A 4J8SA 4C0EA 3ULYA 1D8EA 1H6OA 2EODA 2DZOA 3PZ3A 2PM6A 2XGMA 4BT9A 4WZ0A 3NB2A 4NRHB 2MNYA 2P9IG 2VSXE 2YT5A 4Q69A 5BT1A 4LKAA 5TABA 2LQ6A 3DSXA 1FCHA 1WFKA 4GTQA 5FQ4A 2HO1A 3FL2A 1IHGA 4KT6B 5KBAA 4GA1A 5DKAA 4G26A 3TWSA 5KNHD 2JEKA 4L58A 2L0IA 4UUCA 3BUAA 2QY7A 4G23A 5CBNA 2FBNA 4HOSA 4YDWA 3S7FA 3LKUA 2L9BA 2KKXA 2EIME 1OCOE 3QC1A 4CDRA 1JM7B 1Z6UA 2XOYA 3CEQA 4A4BA 3NAWA 2UWJG 3LVRE 3CK8A 3CVUA 1IYGA 2X6FA 4HQDA 3ULQA 3FULA 4JEUA 4F7AA 2IFUA 2MA5A 4DX5D 4AJWA 3KV6A 3UT4A 2WPVA 3CLJA 2D8UA 1XWHA 2Y69E 2NAAA 5H7PA 4EPZA 3FU0A 1UW4B 4J8EA 4M3OA 3HVEB 3PRZA 1QYMA 2IONA 3KV5A 2M85A 5LKTA 2FUUA 4GTTA 3OAWA 3UT8A 2LSUA 1H19A 3QOUA 2MUMA 2KYUA 5ENRD 3U64A 1H2VC 1EPUA 3O37A 3E34A 1LTXA 2AXUA 4GTPA 2OOEA 4S3OC 3N9PA 4WNDA 2RI7A 3FUKA 1SA5A 5EDSA 3G2SA 4ILHB 3AU4A 5CEDB 3AS8A 4U07A 3N9LA 4GNGA 1N87A 3ZYKA 1FPPA 4CT4A 4LADB 3PZDA 3SFZA 3DSVA 5B1BE 3RO3A 4G8KA 3LY9A 3CVLA 3MKRA 1N4PA 4GTSA 4ATGA 3TWUA 4TUUA 3HTKC 2DIWA 1MJ0A 2XS1A 2FULA 2EIKE 4GB9A 4KZ0A 3RPGC 4FHKA 4JPSA 4XI0A 4WWOA 1AP7A 3CHSA 4YBSA 1HX8A 2GRPB 2VJFA 3L9TA 4CYMD 3O7AA 2BUGA 3TWQA 3D9HA 4GMLA 1ELRA 5B76A 1HXIA 4HBDA 3APFA 3IXEA 4ANUA 1N0QA 2XCCA 2KATA 3ZHEA 2CKLB 2Y4UA 3GW4A 1OCZE 5BW8C 4B89A 3GZSA 1YA0A 3ESKA 4U0ZA 4ZFHA 4UI9J 4U0SA 5AIJA 2J07A 4BESA 4UI9C 4OVVA 2M3HA 1VDYA 2ECVA 1SQMA 2PUYA 1HF8A 1WIMA 3CQCB 4LNGA 5SVXA 4BETA 5KJNA 4S3OB 4GYWA 4AY6A 2VP7A 4GYYA 1QZ2A 2MA6A 3NOGD 2XCBA 4BFRA 4E6HA 1H2UA 3PH0C 3QWVA 2JLBA 4QQIA 2JM3A 3CSFA 3LRQA 4N3CA 4BTBA 3RU0A 5AIUA 2LGLA 3GV4A 2LXHC 4EZLA 4AV7A 1Q2ZA 4A0CD 4GNDA 1D8DA 1NL4A 3I2DA 5AQAA 2BTDA 4TKPB 2MHKA 1WEQA 3QNKA 1IQRA 3T9KA 3P1UA 2DYRE 3Q1DA 4UWKA 3K9IA 1H6KA 1Z2QA 2P57A 1VFYA 4XE0A 5LX8A 4EZKA 3T7LA 1WY6A 4TUMA 3V31A 4BX9A 4UWFA 2YNQA 1HU3A 5T3RA 3S2AA 4H7XA 4DX2A 4O64A 4XX5A 4L2YA 3SOWA 4WZ3B 4G24A 4GZCA 2KWKA 3EU5A 1NI1A 3IV0A 2CT2A 5BV0A 3AG1E 3TG5A 2RSDA 5CERB 4WWPA 5DBKA 2LGVA 1HO8A 3U5OA 3LDYA 3UQ3A 3AG3E 2ECJA 1GW6A 2RFMA 2RR4A 3Q7FA 4CDNA 3PNLB 1ZU2A 2KWJA 2OXQC 2J4BA 4N2SA 4PDXA 4BBQA 4DK5A 2V5FA 2WXNA 2ECNA 4N5QA 3B7TA 4GZ5A 4F52B 4GTRA 5B77A 2KCVA 2VGXB 3TWRA 3U5PA 2XOZA 4V3IA 4HB5A 4J7WA 3FY4A 3FJUB 4LSZE 3UKUG 2UY1B 2FF4A 2KBXA 3DQVR 5FERA 2KGGA 3FUNA 2Y4TA 3FUIA 3UXGA 4H7YA 2ZU6B 3EHRA 3D9MA 5E75A 2CG3A 3D9OA 5ENSD 2VYIA 4ME2A 2FO1E 3KEZA 1HE8A 4CA1A 4HRNA 2WXOA 2V5QC 4C9BB 1X4JA 4J0UA 3ZU7B 2KXPC 2WB2A 2H0DA 4N3WA 3ABME 3ZVYA 4FP7A 3HXFA 5BXUA 2KC7A 2XRYA 3ZUVB 2QYUA 1JOCA 2A5EA 5B3SE 3MV3B 3T6RA 2WXIA 4OAVB 5KH7A 3LPZA 3PREA 5AQBA 5B79A 4Z0RA 5HQ8A 2LV9A 2AWIA 2VGEA 2FI7A 3EHMA 4AVXA 2WMOA 2LRIC 4GPMA 3NOCD 3TWWA 1YYHA 3G2UA 4FC8A 3Q75A 4PTBA 2K16A 5D1MB 3Q49B 2I2OA 1TJFA 4U8VD 5AJLA 4LUNU 3PDNA 1E7UA 4MBGA 4C48B 4YBMA 2R17C 2KCKA 2X6HA 4LNUD 2K4DA 3C3QA 1Y8MA 3ABKE 2L0BA 1HYJA 1FBVA 4JHJA 3C5KA 4BSXA 2ZGDA 4K5BA 5B8DA 4GAAA 3DBSA 3E33A 1OXJA 2R03A 1DNPA 2EXUA 1U3CA 2IF4A 4HLLA 1JCSA 4N3BA 5JJTA 4CZ2D 1LF8A 2KWNA 2XEHA 1U6GB 4FULA 4BSZB 1XNFA 4BY6A 1S0PA 3FP3A 3PZ1A 3SHBA 1Z3XA 3UUXA 4EBAA 3C5RA 3ZXPA 2DSMA 3ASOE 4JHKA 1FT1A 2LGGA 1ZBDB 2XZDG 2Y0BG 4GZDA 1WENA 3QZVA 2BKGA 3M99A 2LUHA 4GPKA 4DX6D 4BTAA 4YDEA 1OUVA 4HORA 1FT2A 2ECTA 2JMIA 3G2WA 5AJDA 4TRQA 5EKQD 3J5QB 2IQJA 4JW1A 3URZA 2MIQA 5LKXA 1KZOA 4HOTA 3Q5MA 3G2VA 5LP0A 5AARA 4N5CA 2IOSA 4IN3B 2XRZA 3AG2E 2VJEA 2P9LG 5ENNA 4HLEA 5G04C 4NN2A 1S64A 3TWTA 4YC9A 3ZNIA 2XEVA 3QDNA 4U8YD 4PS7A 5H1UA 1TNOA 2Y1MA 2A5UA 1FVFA 2ZETC 3LJNA 2OCCE 2FD4A 2YHCA 4YVOA 5ANLA 2DX8A 2WQHA 3DEOA 4HXIA 4B93B 3D3MA 4OGCA 1UN9A 4E85A 1H6PA 2KU3A 2C0MA 2XGOA 1JWFA 4FJZA 1TN6A 3U5MA 2LXMA 2P9NG 1D9SA 1MYOA 3FU6A 5EN5D 2Y3AA 5J3XA 5TDWA 1ELKA 3EIQC 2GW1A 1TN7A 3Q78A 3ZW3A 2KZTB 3O35A 4L2LA 2G43A 4AIFA 3O34A 3L13A 2WXJA 3RRMB 4Q6FA 5D2MC 1N11A 4ZDTA 3LEWA 4XI1A 4XI9A 1UG3A 3NZSA 3SOUA 3UI2A 3E4BA 1E8YA 4YNDA 2EA6A 4AYCB 3VK6A 3JCKC 4GZ6A 4J8YA 4EQFA 2BF0X 2LNIA 1O5MA 4JZYA 3OXGA 2GRRB 3BEEA 2OV8A 3UTMA 3TXMA 5FB1A 4GZ3A 5G05B 4P29A 2YU4A 5G04B 3JXJA 3PVLA 2LSVA 3GL6A 4GA2A 3FTSA 3DSTA 1O1SA 4XEIG 3FUDA 3T8KA 3TXNA 2ECIA 4GNEA 4KYOB 2CONA 4YATA 4L1BA 4U96D 2EINE 3NF1A 3VTXA 4H9DA 4GTVA 2FEZA 1HH8A 1L5JA 3DDTA 5AAOA 5FQ7A 4O6FA 4NACA 2MNZA 4DUIA 5LKUA 2KM4A 1SVXA 3ABLE 5CHEE 1H0AA 4YBTA 2IQCA 3ZFWA 2YHOA 3IHPA 2IOLA 3CHOA 5EYPF 5DINA 1DCQA 3N9OA 3L08A 1Z60A 1F62A 4LNBA 2HR2A 4KVMA 2VSNA 5K3QA 4WNGA 3L11A 4KXKB 1N95A 2XS8A 2CFUA 2X3MA 4Z68A 3SO8A 3FTWA 4L7TA 1K3ZD 2KE1A 4GCOA 4QF3A 3SF4A 2CRRA 2DVWA 2M63A 4UP5A 3TWXA 5LKZA 1JCRA 4DLQA 3N9QA 3R7QA 4EECA 3ASNE 1NFIE 4LK9A 2PM7A 4EZJA 4LJNA 1N94A 3LJ3A 4UQXA 4A55A 3FUEA 3ZXSA 2F8YA 3EU9A 1N0RA 3CQGB 4U7EB 1OCCE 2JMDA 2AXVA 3PEVB 4IULA 3ZYQA 3SFXA 3C6WA 4W9RA 4K5AB 5EIBE 2P9SG 5C11A 4UWHA 2QIZA 4JD2G 3PURA 4A3TA 1SA4A 2C2LA 2PZIA 3HXDA 2DYSE 2XGSA 5HI7A 2ZXWE 3PNTB 2G6QA 4AM9A 4I17A 4P5OB 2GRMA 5CMWA 3ZPV1 3FUFA 4I6EA 1WILA 4HI8A 1BORA 1MX2A 4MVTA 3L17A 3SFYA 2JMJA 3ML8A 1YCSB 2H6GA 3APCA 3L22A 1LDJB 1V55E 4N3AA 4O1PA 3UIPC 3RIBA 4OAUC 5D0OD 2AJAA 2J9QA 3JXIA 3Q4AB 3LJUX 2YREA 1BI7B 3PE3A
chains in the Genus database with same CATH topology
4HVBA 4MRUA 4F1SA 5FEYA 4R8PK 4QF2A 2VPBA 4OVUA 2I6HA 3FTVA 3SNXA 3FTUA 4JXTA 5JJ6A 3FUJA 1Z6TA 2XB1A 2ECWA 5BUZA 4DJAA 2XHEA 3U3WA 4BT8A 1XGWA 5FWQA 2XQ0A 3OXFA 1WGMA 4EBAG 4I1MA 3B7UX 4B94A 5KJKA 3CVQA 4B0ZA 4CCGX 3IHVA 3RPGB 4Y6WA 2VJFB 5JHAA 2XPZA 2E0IA 1NA0A 4JEHA 3ASDA 4KVOA 1H2TC 2Q7FA 2YURA 4L23A 2QJ0A 2WXPA 2OVBA 3T5VA 3CHRA 3ASFA 3L1XA 3PEUB 5JG6A 2KFTA 1OWOA 4V3LC 3O33A 2CHZA 3CKCA 2VSOE 3QK0A 5D1LB 4I9EA 4UI9B 4GB0A 2X6IA 3L6AA 3RJVA 4A49A 3KAEA 3LVQE 2LXPC 3SGHA 3EDTB 1E90A 3MJWA 2XEUA 3O70A 3WXXA 4FK5A 3D9IA 3PS6A 5KH9A 3B13A 1WEEA 3RO2A 5EYAF 3FU3A 4UQYA 1WEOA 3QB2A 3O4ZA 4D10C 4UQZA 5TRBA 4DI4A 4R7EA 1G25A 2WXMA 2J49A 2E2EA 2V4LA 4PH4B 2VTBB 4ILGA 2K1JA 2KCLA 4I6GA 1WAO1 5EX0A 3B7RL 2X6JA 2K17A 1EF1C 3CVPA 2WXFA 3HCTA 3Q15A 4N39A 3PHDA 4FHJA 1E8ZA 2WVIA 2L6JA 2HDPA 2F6JA 3JQ0A 4PUCA 2NXPA 3MA5A 3ML9A 4UP0A 4FU3A 1SZAA 5FT9A 2FSAA 2X38A 2YSMA 2DBAA 2J08A 5LCWJ 4LCTA 2NSZA 4APOA 4ANXA 4YADA 5LCWC 1IYMA 3ZVZB 1OWPA 4IRUA 3ZRHA 1TEZA 1P5QA 4AEZC 4A3VA 4FLBA 2CHXA 4XKCA 4FA6A 1NZNA 4AY5A 1HYIA 3ZGQA 4YVQC 2X6KA 4Q94A 3HHMA 4XKBA 5AENA 2I50A 4G25A 3APDA 3QWWA 5CMYA 3FUMA 2L5UA 3ZEFA 4ZUXU 1INZA 5FZSA 5KJLA 5H1VA 4WUYA 1ELWA 5B75A 4RG6A 2KIZA 4AXHA 3VLFA 4OYSA 4F53A 1WEPA 2IDAA 3MYVA 1HG5A 4JL0A 3LDZA 4ACLA 1HFAA 3S7DA 2YW8A 1JWGA 4W4UA 1K2FA 2V8SE 1E8XA 2CSYA 4RSYA 5T8IA 4MKTA 2WMNA 3MKQA 4Q96A 5D1KB 3CKBA 4FIPA 5LCWB 3HCUA 3FTZA 3GYZA 3FU5A 2VPGA 3MEKA 3RTRB 5J90A 4KZCA 3AU5A 3ENEA 2MD8C 3QJZA 4GA0A 3R7RA 3T8MA 4I9CA 2V0PA 1WEMA 3TG4A 3AS4A 5FZRA 2KZTA 2LO6A 2AXZA 5DIZA 3U4TA 2ECGA 1JUQA 1BPOA 4J8FA 2WXHA 1QNFA 4WWNA 2KR4A 4AYCA 4C0MA 4HOQA 2YHEA 3KNVA 2HYED 3CVYA 1IQUA 2XPYA 5J08A 4FO9A 3ZN3A 1N54A 3LQJA 3LQHA 3EB6A 3RK6A 2ILRA 2R59A 4LRZA 3FH8A 5T4YA 2CSZA 3M62A 4YAXA 3S7JA 3PE4A 4J8DA 1JM7A 1LDKC 4NQ0A 1N52A 4UI9K 1KT1A 2VJEB 4QFVA 5KJMA 3UT7A 3NQPA 2LN0A 2WQ7A 2WXKA 3SZ7A 3S7BA 1EDUA 3KQIA 3CVXA 4L7XA 4GNFA 5KCMA 1Y6IA 3RRUA 3L54A 2I9CA 3HVEA 1KT0A 4I6JA 3U66A 5A6CA 4JA7A 4LLBA 2FO7A 5TDRA 3EB5A 4MLPA 3ASHA 2VPEA 2PNXA 4FJYA 5JHBA 2E6SA 4DLOA 3SBSA 3MZLB 3FUHA 3LY7A 3I4RB 4K03A 1HG2A 3JUIA 1VD4A 1E4UA 3Q47B 4B8CB 2PQNA 4MS6A 4C9ZA 3FTYA 4I2WA 3MHSA 2M6MA 4AOFA 3LYAA 3MX3A 4I1AA 1PY1A 3CVWA 4FLHA 4JA9A 1PC2A 4I43A 1WEVA 3VLEA 3FH7A 2VJ8A 4HS2A 2LAIA 2ONDA 4IC2A 2WXQA 3I5PA 2HM8A 1DVPA 4JC8A 5G55A 3G2TA 4DI3A 2P58C 4JVSA 2C2VS 4R2YA 4B7YC 3IEGA 3DPLR 3ZYMA 3QAQA 5KH3A 4A1GA 1FP0A 4AUQB 2CKLA 1T1HA 4N4FA 2AW6A 2E6RA 2CHWA 2KWOA 3RRNB 4I7CA 1UN8A 3NZUA 4R7LA 5A23A 2Y43A 5C1DA 3PUKA 1RMDA 2A4ZA 3QKYA 2YYRA 3ZTGA 3IKOB 5FJYA 3C98A 4I7BA 4FADA 3GZ2A 3CSTA 4XZ4A 2F6NA 3KS2A 3U5NA 2L0TB 5FB0A 3T5XA 3TAXA 4URKA 2EGPA 1TJCA 4UWLA 5B78A 1HS6A 5ARFA 2BAYA 4U04A 4ANVA 2R5SA 3LCAA 3BG0B 3VTYA 3LXUX 1UJKA 3SD5A 1E96B 3V43A 2NC9A 1MM3A 2D8SA 1OWNA 4PPEA 3O36A 1WE9A 4I1OB 5CCLA 3ZPVE 3TL5A 4BHWA 3OTNA 3CV0A 3P2BA 2HYZA 2L75A 3AS5A 3LY8A 4I7DA 1SZ9A 3CGHA 4MSXA 5ANRA 3CK7A 3LQIA 2WXRA 3FFLA 1WEUA 3SHFA 4NURA 4CRWA 4G11A 3FH5A 3ZHEB 4PS8A 3D9NA 1MM2A 4V3KC 3EHNA 5C2YA 3HDXA 2VGXA 5A7DB 1NA3A 2UY1A 5I3LA 5BV1A 4B86C 3HIZA 1U3DA 1OWLA 2WXLA 2F42A 2MRIA 2YQMA 5H9MA 2VTBA 4Y6CA 2KREA 4ZQLA 4U63A 2LGKA 2PL2A 4BX8A 5JJ7A 5EX3A 3PUJA 4CDMA 1KLXA 3L16A 2CG2A 3FWVA 1W3BA 4B8AA 5ARGA 2G45A 2Y1NA 2YQ8A 1FVHA 1NP7A 4A4CA 4GCNA 1B89A 2WM9A 1V87A 2MOWA 1MQSA 4KMOA 3TJPA 1CHCA 3BG1B 3RKVA 2L43A 2J09A 1WEWA 1EYHA 3IHYA 3CVNA 4CCAA 4APFA 3CK9A 3EJNA 4G2VA 5G0FA 3D9JA 4RG9A 3HYMB 2MD7B 5FTPA 3I3NA 4CGVA 3SOXA 4ABNA 3CIAA 5H1TA 4DPRA 4LERA 2YINA 3ZPJA 3MV2B 3GZ1A 3SI5A 4N2QA 2QICA 4XIFA 4K0RA 3M63A 3UX4A 5D0QD 4HOUA 4CGWA 4IC3A 2UZGA 1HZ4A 3D9PA 2AVPA 4I2ZA 3R9AB 2LAHA 5E76A 2VSYA 3N9NA 3ESLA 4AP2A 2WXGA 2YUCA 3HCSA 5C13A 3ASGA 3L1ZB 4RVBA 4F3VA 1X4UA 4J6IA 3ZIMA 4U8HA 3FTXA 4PS3A 2AN6A 5BPPA 2QFCA 1E7VA 4WNFA 2H0DB 2IU1A 3ONLA 4GYOA 3ONKA 5FQ6A 4CT0A 1PAQA 4U0UA 3IBEA 3JYSA 3FEYA 3QARA 5LOZA 5BNWA 1UJJA 3ZVVA 3U9WA 2OVFA 5M72A 3CR3A 1X4IA 1VYXA 3D9KA 3CVVA 3CHMA 4IYPA 2KGIA 4ACKA 1OWMA 3EIJA 2GGFA 2C0LA 4HFGA 5CCMA 4GMJA 4A1SA 2EQXA 2M1RA 2CFZA 1A17A 3MGBA 3MCXA 4YABA 3UPVA 2JRJA 5LFAA 1ZBPA 3O48A 4GU5A 4CEMA 2XPIA 4AP4A 4WNEA 4TV3A 4WA6A 3VLDA 3I4GA 3DPDA 3NG2A 1QQEA 5G2NA 4FJCA 1E8WA 3MHHA 2GRLA 3JQ1A 3N9MA 4KBQA 5G05J 2J4DA 3OXLA 5FQ8A 4LEUA 5G04J 5G05C 5AYWD 3B7SA 3QWPA 3CHPA 2MT5A 3FEXA 1MHQA 4BWRA 2YHNA 3ZYLA 2YSJA 1X5BA 3MKQB 2VQ2A 1Z3YA 3LS8A 2LDRA 3FDHA 4ANWA 2PQRA 3KD7A 2FUIA 2DCPA 3D9LA 2VGYA 2VNFA 3UMVA 2L80A 4G1TA 4WAFA 3CHQA 4X3GA 3TGOA 1WESA 5TBNA 4ILIA 2YQLA 3N71A 2IJGX 3SBTB 2I1JA 4WZ2A 3FHEA 1JPLA 3PUQA 2VPDA 2RD0A 1WM5A 4UWGA 2I1KA 3ASLA 4JHRA 2WQ6A 5FZQA 5AITA 2RG8A 4J8SA 4C0EA 2EODA 2PM6A 2XGMA 4BT9A 4WZ0A 4NRHB 2MNYA 2VSXE 2YT5A 4Q69A 5BT1A 4LKAA 5TABA 2LQ6A 1FCHA 1WFKA 5FQ4A 2HO1A 3FL2A 1IHGA 4KT6B 4GA1A 5DKAA 4G26A 2JEKA 4L58A 2L0IA 2QY7A 4G23A 2FBNA 4HOSA 3S7FA 3LKUA 2L9BA 3QC1A 4CDRA 1JM7B 1Z6UA 3CEQA 4A4BA 2UWJG 3LVRE 3CK8A 3CVUA 1IYGA 2X6FA 3ULQA 3FULA 4JEUA 4F7AA 2IFUA 2MA5A 4AJWA 3KV6A 3UT4A 2WPVA 3CLJA 1XWHA 2NAAA 4EPZA 3FU0A 1UW4B 4J8EA 4M3OA 3HVEB 3PRZA 2IONA 3KV5A 2M85A 5LKTA 2FUUA 3UT8A 3OAWA 2LSUA 1H19A 3QOUA 2MUMA 2KYUA 3U64A 1H2VC 1EPUA 3O37A 2AXUA 2OOEA 4S3OC 3N9PA 4WNDA 2RI7A 3FUKA 5EDSA 3G2SA 4ILHB 3AU4A 3AS8A 4U07A 3N9LA 4GNGA 1N87A 3ZYKA 4CT4A 4LADB 3PZDA 3SFZA 3RO3A 3LY9A 3CVLA 3MKRA 4ATGA 4TUUA 3HTKC 2DIWA 2FULA 4GB9A 4KZ0A 3RPGC 4FHKA 4JPSA 4XI0A 4WWOA 3CHSA 4YBSA 1HX8A 2VJFA 3O7AA 2BUGA 4GMLA 1ELRA 5B76A 1HXIA 3APFA 4ANUA 2XCCA 2KATA 3ZHEA 2CKLB 2Y4UA 3GW4A 5BW8C 4B89A 3GZSA 1YA0A 3ESKA 4U0ZA 4UI9J 4U0SA 5AIJA 2J07A 4UI9C 4OVVA 2M3HA 1VDYA 2ECVA 1SQMA 2PUYA 1HF8A 1WIMA 3CQCB 5KJNA 4S3OB 4GYWA 4AY6A 2VP7A 4GYYA 1QZ2A 2MA6A 2XCBA 4BFRA 4E6HA 1H2UA 3PH0C 3QWVA 2JLBA 3CSFA 3LRQA 4N3CA 4BTBA 3RU0A 5AIUA 2LGLA 3GV4A 2LXHC 4EZLA 4AV7A 4A0CD 4GNDA 3I2DA 2BTDA 4TKPB 2MHKA 1WEQA 3QNKA 1IQRA 3P1UA 4UWKA 3K9IA 1H6KA 1Z2QA 1VFYA 4XE0A 5LX8A 4EZKA 3T7LA 1WY6A 4BX9A 4UWFA 2YNQA 1HU3A 5T3RA 3S2AA 4H7XA 4O64A 4XX5A 4L2YA 3SOWA 4WZ3B 4G24A 4GZCA 2KWKA 3IV0A 2CT2A 5BV0A 3TG5A 2RSDA 4WWPA 5DBKA 2LGVA 1HO8A 3U5OA 3UQ3A 2ECJA 1GW6A 4CDNA 3PNLB 1ZU2A 2KWJA 2OXQC 2J4BA 4N2SA 4PDXA 4BBQA 4DK5A 2V5FA 2WXNA 2ECNA 3B7TA 4GZ5A 4F52B 5B77A 2KCVA 2VGXB 3U5PA 4V3IA 3FY4A 2UY1B 2FF4A 3DQVR 5FERA 2KGGA 3FUNA 2Y4TA 3FUIA 4H7YA 2ZU6B 3D9MA 5E75A 2CG3A 3D9OA 2VYIA 4ME2A 3KEZA 1HE8A 4CA1A 2WXOA 4C9BB 1X4JA 4J0UA 2WB2A 2H0DA 4N3WA 3ZVYA 4FP7A 2KC7A 2XRYA 1JOCA 3MV3B 3T6RA 2WXIA 5KH7A 3LPZA 3PREA 5B79A 5HQ8A 2LV9A 2AWIA 2FI7A 3EHMA 4AVXA 2WMOA 2LRIC 3G2UA 4FC8A 4PTBA 2K16A 5D1MB 3Q49B 2I2OA 1TJFA 5AJLA 4LUNU 3PDNA 1E7UA 4YBMA 2R17C 2KCKA 2X6HA 2K4DA 1Y8MA 2L0BA 1HYJA 1FBVA 4JHJA 3C5KA 4BSXA 5B8DA 4GAAA 3DBSA 1DNPA 1U3CA 2IF4A 4N3BA 5JJTA 1LF8A 2KWNA 1U6GB 4FULA 1XNFA 4BY6A 1S0PA 3FP3A 3SHBA 1Z3XA 3UUXA 4EBAA 4JHKA 2LGGA 1ZBDB 4GZDA 1WENA 3QZVA 3M99A 4GPKA 4BTAA 1OUVA 4HORA 2ECTA 2JMIA 3G2WA 5AJDA 4TRQA 5EKQD 4JW1A 3URZA 2MIQA 5LKXA 4HOTA 3Q5MA 3G2VA 5LP0A 4N5CA 2IOSA 4IN3B 2XRZA 2VJEA 5ENNA 4HLEA 5G04C 4NN2A 4YC9A 3ZNIA 2XEVA 3QDNA 4PS7A 5H1UA 2Y1MA 2A5UA 1FVFA 2ZETC 2YHCA 4YVOA 5ANLA 2DX8A 2WQHA 4HXIA 3D3MA 1UN9A 4E85A 2KU3A 2C0MA 2XGOA 1JWFA 4FJZA 3U5MA 3FU6A 2Y3AA 5J3XA 5TDWA 1ELKA 3EIQC 2GW1A 3ZW3A 2KZTB 3O35A 4L2LA 2G43A 4AIFA 3O34A 3L13A 2WXJA 3RRMB 4Q6FA 4ZDTA 3LEWA 4XI1A 4XI9A 1UG3A 3NZSA 3SOUA 3E4BA 1E8YA 4YNDA 2EA6A 4AYCB 3VK6A 3JCKC 4GZ6A 4EQFA 2BF0X 2LNIA 4JZYA 3OXGA 3BEEA 2OV8A 3TXMA 5FB1A 4GZ3A 5G05B 4P29A 2YU4A 5G04B 3PVLA 2LSVA 3GL6A 4GA2A 3FTSA 3FUDA 3TXNA 2ECIA 4GNEA 4KYOB 4YATA 4L1BA 3VTXA 3NF1A 2FEZA 1HH8A 1L5JA 5FQ7A 4O6FA 4NACA 2MNZA 5LKUA 2KM4A 5CHEE 1H0AA 4YBTA 2IQCA 3ZFWA 2YHOA 3IHPA 2IOLA 3CHOA 5DINA 3N9OA 3L08A 1Z60A 1F62A 2HR2A 4KVMA 2VSNA 4WNGA 3L11A 4KXKB 2CFUA 2X3MA 3FTWA 4L7TA 2KE1A 4GCOA 4QF3A 3SF4A 2M63A 4UP5A 5LKZA 4DLQA 3N9QA 3R7QA 4EECA 4LK9A 2PM7A 4EZJA 4LJNA 3LJ3A 4UQXA 4A55A 3FUEA 3ZXSA 3CQGB 2JMDA 2AXVA 3PEVB 4IULA 3ZYQA 3C6WA 4W9RA 5C11A 4UWHA 2QIZA 3PURA 4A3TA 2C2LA 2PZIA 5HI7A 2XGSA 3PNTB 2G6QA 4AM9A 4I17A 4P5OB 2GRMA 5CMWA 3ZPV1 3FUFA 4I6EA 1WILA 1BORA 4MVTA 3L17A 2JMJA 3ML8A 3APCA 3L22A 1LDJB 4N3AA 3RIBA 5D0OD 2J9QA 3Q4AB 2YREA 3PE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6S A;  5FEY A;  4R8P K;  4QF2 A;  3D9M A;  4YAB A;  3D9O A;  2VPB A;  2JRJ A;  1VD4 A;  1HG2 A;  1E4U A;  4JXT A;  4AP4 A;  4CA1 A;  4WA6 A;  4C9Z A;  2XB1 A;  3NG2 A;  3MHS A;  1X4J A;  2M6M A;  2ECW A;  2H0D A;  4FJC A;  1PY1 A;  4N3W A;  1XGW A;  3MHH A;  3ZVY A;  1WGM A;  1WEV A;  3N9M A;  4IC2 A;  4CCG X;  1JOC A;  1DVP A;  3G2T A;  2MT5 A;  2C2V S;  3T6R A;  3RPG B;  4R2Y A;  5KH7 A;  4B7Y C;  1MHQ A;  5B79 A;  2VJF B;  2YHN A;  3ZYL A;  3DPL R;  2LV9 A;  3ZYM A;  2YSJ A;  1X5B A;  5KH3 A;  4AVX A;  2LDR A;  2LRI C;  2YUR A;  2QJ0 A;  1FP0 A;  3G2U A;  4AUQ B;  2CKL A;  2FUI A;  4PTB A;  2DCP A;  3D9L A;  3L1X A;  1T1H A;  2VNF A;  5JG6 A;  2K16 A;  5D1M B;  2KFT A;  2L80 A;  4N4F A;  2E6R A;  4X3G A;  4V3L C;  2KWO A;  1WES A;  3O33 A;  5TBN A;  4I7C A;  2YQL A;  5D1L B;  4UI9 B;  4YBM A;  2K4D A;  4GB0 A;  2Y43 A;  4WZ2 A;  2L0B A;  1HYJ A;  1FBV A;  1JPL A;  3PUQ A;  2VPD A;  3C5K A;  4A49 A;  1RMD A;  5B8D A;  2YYR A;  3ZTG A;  2LXP C;  3ASL A;  4I7B A;  2XEU A;  3O70 A;  2F6N A;  5AIT A;  1LF8 A;  2KWN A;  1U6G B;  4FK5 A;  2EOD A;  3U5N A;  2L0T B;  5FB0 A;  3D9I A;  4WZ0 A;  2EGP A;  5KH9 A;  1WEE A;  3SHB A;  2MNY A;  2YT5 A;  5EYA F;  5B78 A;  2BAY A;  2LGG A;  4LKA A;  1ZBD B;  5TAB A;  1WEO A;  2LQ6 A;  1WFK A;  5TRB A;  4R7E A;  1G25 A;  4GZD A;  1WEN A;  3FL2 A;  3QZV A;  3M99 A;  1UJK A;  5DKA A;  3V43 A;  4L58 A;  2K1J A;  2L0I A;  1MM3 A;  2D8S A;  2ECT A;  2K17 A;  2QY7 A;  4PPE A;  2JMI A;  3G2W A;  3O36 A;  1WE9 A;  3HCT A;  3ZPV E;  3PHD A;  4BHW A;  2MIQ A;  5LKX A;  1JM7 B;  1Z6U A;  2HDP A;  2F6J A;  4A4B A;  3G2V A;  5LP0 A;  2L75 A;  4UP0 A;  4I7D A;  1SZ9 A;  4FU3 A;  2VJE A;  1SZA A;  4MSX A;  4NN2 A;  2MA5 A;  2FSA A;  4YC9 A;  3ZNI A;  3KV6 A;  2YSM A;  5H1U A;  2Y1M A;  3CLJ A;  3LQI A;  1XWH A;  2ZET C;  1WEU A;  2NAA A;  2DX8 A;  4YAD A;  1IYM A;  3ZVZ B;  3D9N A;  1MM2 A;  2KU3 A;  4V3K C;  1JWF A;  3KV5 A;  2M85 A;  5LKT A;  3U5M A;  2FUU A;  4FLB A;  2MUM A;  2KYU A;  5I3L A;  1HYI A;  4B86 C;  3O37 A;  5J3X A;  5TDW A;  1ELK A;  4Q94 A;  4S3O C;  3N9P A;  2F42 A;  2RI7 A;  3G2S A;  2YQM A;  5H9M A;  2I50 A;  5CMY A;  3O35 A;  2G43 A;  2KRE A;  3N9L A;  3O34 A;  1N87 A;  3ZYK A;  4GNG A;  4ZQL A;  2L5U A;  2LGK A;  4Q6F A;  4ZUX U;  1INZ A;  4LAD B;  5H1V A;  4ZDT A;  5B75 A;  2KIZ A;  4XI1 A;  1WEP A;  3SOU A;  2IDA A;  1HG5 A;  2EA6 A;  4AYC B;  3LDZ A;  3VK6 A;  3HTK C;  2DIW A;  1HFA A;  2BF0 X;  2G45 A;  2Y1N A;  2YW8 A;  1JWG A;  4W4U A;  3RPG C;  4A4C A;  1K2F A;  2V8S E;  2CSY A;  5FB1 A;  5G05 B;  1V87 A;  4YBS A;  2YU4 A;  2MOW A;  1HX8 A;  5G04 B;  2VJF A;  3O7A A;  4Q96 A;  3GL6 A;  5B76 A;  5D1K B;  4FIP A;  1CHC A;  2L43 A;  5LCW B;  3HCU A;  1WEW A;  2CKL B;  2ECI A;  1EYH A;  4GNE A;  4YAT A;  2VPG A;  5G0F A;  3RTR B;  3D9J A;  2MD7 B;  2M3H A;  1VDY A;  2MD8 C;  2ECV A;  2PUY A;  1HF8 A;  1WIM A;  4NAC A;  2MNZ A;  1WEM A;  4S3O B;  5LKU A;  2KM4 A;  3SOX A;  2VP7 A;  2LO6 A;  1H0A A;  4YBT A;  5H1T A;  2MA6 A;  2YHO A;  2ECG A;  1JUQ A;  3IHP A;  5DIN A;  2QIC A;  3N9O A;  1Z60 A;  1F62 A;  3M63 A;  3LRQ A;  4IC3 A;  2KR4 A;  4AYC A;  5AIU A;  2LGL A;  3GV4 A;  2LXH C;  3L11 A;  2UZG A;  3D9P A;  2KE1 A;  3KNV A;  4A0C D;  4GND A;  4QF3 A;  3I2D A;  2HYE D;  3N9N A;  4UP5 A;  4TKP B;  1WEQ A;  2YUC A;  3HCS A;  5LKZ A;  5J08 A;  3N9Q A;  4FO9 A;  5C13 A;  3LQJ A;  3LQH A;  3L1Z B;  3EB6 A;  4LK9 A;  1X4U A;  1Z2Q A;  4LJN A;  1VFY A;  3T7L A;  2AN6 A;  2JMD A;  2CSZ A;  3M62 A;  3ZYQ A;  2H0D B;  3C6W A;  4YAX A;  4O64 A;  3ONL A;  3SOW A;  3ONK A;  4WZ3 B;  4GZC A;  2KWK A;  5C11 A;  2QIZ A;  2CT2 A;  3PUR A;  1JM7 A;  1LDK C;  2RSD A;  5LOZ A;  2VJE B;  1UJJ A;  2LGV A;  2C2L A;  3U5O A;  2ECJ A;  2G6Q A;  4P5O B;  5CMW A;  2LN0 A;  3ZPV 1;  2KWJ A;  2OXQ C;  1X4I A;  1VYX A;  3D9K A;  1WIL A;  4BBQ A;  1BOR A;  4MVT A;  1EDU A;  3KQI A;  2ECN A;  2JMJ A;  4GNF A;  4L7X A;  2KGI A;  3RRU A;  4F52 B;  1LDJ B;  5B77 A;  3U5P A;  4HFG A;  4LLB A;  2M1R A;  5TDR A;  3EB5 A;  3DQV R;  5FER A;  2KGG A;  2YRE A;  2VPE A;  2PNX A; 
#chains in the Genus database with same CATH topology
 4HVB A;  4MRU A;  4F1S A;  5FEY A;  4R8P K;  4QF2 A;  4ATZ D;  3UM2 A;  2VPB A;  4BER A;  4OVU A;  1LD8 A;  1RZ4 A;  3M7K A;  2I6H A;  3FTV A;  3SNX A;  3FTU A;  2GRO B;  4JXT A;  5JJ6 A;  3FUJ A;  1Z6T A;  2XB1 A;  2ECW A;  5BUZ A;  1OY3 D;  4DJA A;  2XHE A;  3Q7A A;  3U3W A;  3UIN C;  4BT8 A;  5CRV A;  1XGW A;  5SVI A;  5FWQ A;  2XQ0 A;  3OXF A;  1WGM A;  4HRL A;  4EBA G;  4I1M A;  4F1P A;  3B7U X;  4B94 A;  5KJK A;  3CVQ A;  4B0Z A;  4CCG X;  1DCE A;  3IHV A;  3UM3 A;  3RPG B;  4Y6W A;  2VJF B;  5JHA A;  2XPZ A;  2RKK A;  2E0I A;  1NA0 A;  4JEH A;  5CEC B;  3ASD A;  4KVO A;  1H2T C;  5CEA A;  2Q7F A;  3Q9U C;  3UM0 A;  2YUR A;  4L23 A;  2QJ0 A;  2WXP A;  2OVB A;  3T5V A;  3CHR A;  3ASF A;  3L1X A;  2LXL A;  2Y1L E;  3PEU B;  5JG6 A;  2KFT A;  2YVR A;  1MX4 A;  1OWO A;  4V3L C;  3O33 A;  2CHZ A;  3CKC A;  2VSO E;  3QK0 A;  5D1L B;  2F0Y A;  4I9E A;  4UI9 B;  1BI8 B;  2H6H A;  2M13 A;  4GB0 A;  2X6I A;  2F37 A;  3L6A A;  1DC2 A;  3RJV A;  4A49 A;  3KAE A;  3LVQ E;  2LXP C;  3SGH A;  1S70 B;  3EDT B;  2F8X K;  1E90 A;  3DSS A;  3MJW A;  2XEU A;  3O70 A;  3WXX A;  3DWD A;  4FK5 A;  3FAN A;  3D9I A;  3PS6 A;  4LG6 A;  3B13 A;  5KH9 A;  1WEE A;  4HNA D;  3RO2 A;  5EYA F;  1O1R A;  3FU3 A;  4UQY A;  1WEO A;  3QB2 A;  3O4Z A;  4D10 C;  4UQZ A;  5TRB A;  4DI4 A;  2XEE A;  4R7E A;  1G25 A;  2WXM A;  2J49 A;  3Q73 A;  5FIN A;  1IKN D;  2E2E A;  2V4L A;  3ZNG A;  4PH4 B;  2VTB B;  2FFW A;  4ILG A;  2K1J A;  2KCL A;  4EHM A;  4I6G A;  1WAO 1;  5EX0 A;  3B7R L;  1S63 A;  2X6J A;  2K17 A;  2V4H C;  1EF1 C;  3CVP A;  2WXF A;  3HCT A;  3SUB A;  3Q15 A;  4N39 A;  3PHD A;  1N4S A;  4K5C A;  4FHJ A;  1E8Z A;  2WVI A;  2L6J A;  1OCR E;  2HDP A;  2F6J A;  3JQ0 A;  4PUC A;  2NXP A;  2P2C P;  3MA5 A;  3ML9 A;  4UP0 A;  4TXQ A;  4FU3 A;  1SZA A;  1TNU A;  5FT9 A;  2FSA A;  3KSL A;  2X38 A;  2YSM A;  2DBA A;  2J08 A;  5ITZ F;  5LCW J;  4LCT A;  2NSZ A;  4APO A;  4ANX A;  5JMN D;  4G8L A;  4BEP A;  4YAD A;  5EID A;  5LCW C;  1IYM A;  3ZVZ B;  1OWP A;  4IRU A;  3ZRH A;  1TEZ A;  1P5Q A;  2OEV A;  4AEZ C;  4A3V A;  2R02 A;  3EUV A;  3DXM G;  4FLB A;  2CHX A;  4XKC A;  4FA6 A;  1NZN A;  2MYO A;  4AY5 A;  1HYI A;  3ZGQ A;  3KDE C;  2DJA A;  4YVQ C;  1K1B A;  1LD7 A;  2X6K A;  4YDO A;  5HS0 A;  2PNN A;  4Q94 A;  3HHM A;  4XKB A;  2P9P G;  5AEN A;  2JUN A;  2I50 A;  4G25 A;  3PZ2 A;  1QBQ A;  3APD A;  3QWW A;  5CMY A;  3FUM A;  5ENQ D;  2L5U A;  4OGE A;  3ZEF A;  5ENT D;  4ZUX U;  1INZ A;  3ZKJ A;  5FZS A;  4NIK A;  5KJL A;  5H1V A;  4WUY A;  3HXC A;  1ELW A;  3AG4 E;  5B75 A;  4RG6 A;  2KIZ A;  4AXH A;  3VLF A;  4OYS A;  4F53 A;  1WEP A;  2IDA A;  3MYV A;  1HG5 A;  4JL0 A;  3LDZ A;  5IY5 E;  4ACL A;  1HFA A;  3S7D A;  2YW8 A;  1JWG A;  4W4U A;  1K2F A;  2V8S E;  1E8X A;  2CSY A;  4RSY A;  5T8I A;  3AJI A;  4MKT A;  3PLW A;  3W9G A;  2WMN A;  3MKQ A;  4Q96 A;  5D1K B;  3CKB A;  4FIP A;  2J8S D;  3HCU A;  5LCW B;  3FTZ A;  3GYZ A;  3FU5 A;  3NBN B;  1WDY A;  2VPG A;  1UOH A;  3MEK A;  2XEN A;  3DWL G;  3V2X A;  1BD8 A;  3RTR B;  5J90 A;  3Q9N C;  4KZC A;  3AU5 A;  3ENE A;  2MD8 C;  3QJZ A;  4GA0 A;  3R7R A;  1RW2 A;  3T8M A;  3X2Q E;  4I9C A;  2V0P A;  5FIO A;  1WEM A;  3TG4 A;  3C72 A;  3AS4 A;  5FZR A;  2KZT A;  4X8Q A;  2LO6 A;  2IEJ A;  2AXZ A;  5DIZ A;  3U4T A;  2ECG A;  1JUQ A;  1BPO A;  4M7C A;  4DX7 D;  4J8F A;  2WXH A;  3SY2 A;  1A5E A;  4RLY A;  1QNF A;  4WWN A;  2KR4 A;  4AYC A;  4C0M A;  4HOQ A;  2YHE A;  3KNV A;  2R2L A;  2HYE D;  3CVY A;  1IQU A;  3DSW A;  2XPY A;  5J08 A;  2IO2 C;  4FO9 A;  2R05 A;  3ZN3 A;  1N54 A;  3LQJ A;  3LQH A;  3EB6 A;  2ZGG A;  2DZN A;  3RK6 A;  3L82 A;  2ILR A;  2R59 A;  4LRZ A;  3FH8 A;  5T4Y A;  1IXV A;  2CSZ A;  3M62 A;  3W9F A;  4YAX A;  4GMR A;  3S7J A;  3PE4 A;  5KNG A;  4TXR A;  1MZC A;  4J8D A;  1JM7 A;  1LDK C;  3EHQ A;  4NQ0 A;  3B95 A;  1N52 A;  4UI9 K;  1KT1 A;  2VJE B;  3V79 K;  4GTM A;  4QFV A;  4DX1 A;  3AAA C;  5KJM A;  3UT7 A;  3NQP A;  4ZHB A;  1TYQ G;  2NYJ A;  2LN0 A;  3PZ4 A;  1KPS B;  2WQ7 A;  3DRA A;  3E30 A;  2WXK A;  3SZ7 A;  3S7B A;  1EDU A;  3KQI A;  3CVX A;  4GNF A;  5KCM A;  4L7X A;  1Y6I A;  3RRU A;  3L54 A;  2I9C A;  3HVE A;  1KT0 A;  4I6J A;  3U66 A;  5A6C A;  4JA7 A;  4LLB A;  2FO7 A;  5TDR A;  3EB5 A;  4A63 B;  4MLP A;  3ASH A;  2VPE A;  2PNX A;  4FJY A;  1G3N B;  5JHB A;  2E6S A;  4DLO A;  2DWZ A;  3WG7 E;  3SBS A;  3Q79 A;  3MZL B;  3FUH A;  3UKR G;  3V30 A;  3LY7 A;  1N4R A;  3I4R B;  4K03 A;  1HG2 A;  3JUI A;  1N4Q A;  1VD4 A;  3Q47 B;  1E4U A;  4B8C B;  2PQN A;  4MS6 A;  2IY0 C;  4C9Z A;  3FTY A;  4I2W A;  3MHS A;  2M6M A;  3O47 A;  4AOF A;  3LYA A;  3MX3 A;  4I1A A;  1PY1 A;  3CVW A;  4FLH A;  4JA9 A;  1PC2 A;  4I43 A;  1WEV A;  3VLE A;  3FH7 A;  2VJ8 A;  4HS2 A;  2LAI A;  2B0O E;  2OND A;  4IC2 A;  2WXQ A;  3I5P A;  2HM8 A;  2XOC A;  1DVP A;  4JC8 A;  5G55 A;  3G2T A;  4DI3 A;  2P58 C;  4JVS A;  2C2V S;  4R2Y A;  4B7Y C;  3IEG A;  3DPL R;  3ZYM A;  3R9M A;  3QAQ A;  5KH3 A;  2ZIS A;  2BED A;  4A1G A;  1FP0 A;  4AUQ B;  2CKL A;  2JAB A;  1MBM A;  5EIL A;  4O60 A;  1T1H A;  4N4F A;  2L7P A;  2AW6 A;  2E6R A;  2CHW A;  2KWO A;  3RRN B;  4I7C A;  1UN8 A;  3NZU A;  4R7L A;  5A23 A;  2Y43 A;  5SVY A;  5C1D A;  3PUK A;  1RMD A;  2A4Z A;  3C3R A;  3QKY A;  2YYR A;  3ZTG A;  3IKO B;  5FJY A;  3J5P A;  3C98 A;  4I7B A;  4FAD A;  3GZ2 A;  4TXP A;  3CST A;  4XZ4 A;  2F6N A;  3KS2 A;  2H6I A;  3U5N A;  2L0T B;  5FB0 A;  3T5X A;  3TAX A;  4URK A;  2EGP A;  2ETA A;  1TJC A;  5ENP D;  4UWL A;  5B78 A;  1HS6 A;  5ARF A;  2BAY A;  4U04 A;  4ANV A;  2R5S A;  3LCA A;  3BG0 B;  3VTY A;  3LXU X;  1UJK A;  4GTO A;  3SD5 A;  1E96 B;  3V43 A;  2NC9 A;  1MM3 A;  2D8S A;  3FEH A;  1OWN A;  4PPE A;  3O36 A;  1WE9 A;  2CRW A;  2QYJ A;  4I1O B;  5CCL A;  3ZPV E;  3SQV A;  3TL5 A;  4BHW A;  3OTN A;  3ISM C;  3CV0 A;  3HG0 D;  3P2B A;  2HYZ A;  4DRX E;  2L75 A;  3AS5 A;  3LY8 A;  4I7D A;  1SZ9 A;  3CGH A;  3HXE A;  5HKP A;  1JCQ A;  4MSX A;  5ANR A;  3CK7 A;  3BQO A;  3LQI A;  2WXR A;  3FFL A;  1O1T A;  1U2V G;  1WEU A;  3SHF A;  1TNY A;  4NUR A;  4CRW A;  4G11 A;  3FH5 A;  3ZHE B;  4PS8 A;  2IO3 C;  3D9N A;  1MM2 A;  4V3K C;  3EHN A;  5C2Y A;  3HDX A;  1IHB A;  2VGX A;  5A7D B;  1NA3 A;  2QZA A;  3H7H A;  2UY1 A;  5I3L A;  5BV1 A;  4B86 C;  3HIZ A;  1U3D A;  1OWL A;  2WXL A;  2F42 A;  2MRI A;  2YQM A;  5H9M A;  2QC9 A;  2VTB A;  4Y6C A;  2KRE A;  4ZQL A;  4U63 A;  3TWV A;  2LGK A;  3DPY A;  5B1A E;  2PL2 A;  4BX8 A;  5JJ7 A;  4Z0O A;  5EX3 A;  3PUJ A;  4U95 D;  4CDM A;  1KLX A;  3L16 A;  5SVI B;  2CG2 A;  3FWV A;  1W3B A;  4B8A A;  5ARG A;  3ULE G;  1AWC B;  2G45 A;  2Y1N A;  2B6C A;  2YQ8 A;  1FVH A;  1NP7 A;  4A4C A;  4GCN A;  1B89 A;  3MDB C;  5CBO A;  2WM9 A;  1V87 A;  2MOW A;  2GRN B;  2BKK B;  1MQS A;  4KMO A;  2EIJ E;  4HRM B;  5HRY A;  3TJP A;  1CHC A;  3BG1 B;  3B7B A;  3BU8 A;  3RKV A;  2J09 A;  2L43 A;  1WEW A;  2ETB A;  1EYH A;  3IHY A;  3CVN A;  5AQ7 A;  4CCA A;  2H6F A;  4APF A;  3CK9 A;  3EJN A;  4G2V A;  2ETC A;  3C3O A;  1MX6 A;  2ZIR A;  5G0F A;  3DXK G;  3D9J A;  4RG9 A;  3HYM B;  2MD7 B;  4HI9 A;  5FTP A;  3I3N A;  4CGV A;  3SOX A;  3V2O A;  4ABN A;  3CIA A;  5H1T A;  4DPR A;  4LER A;  2YIN A;  3ZPJ A;  3RSE G;  3MV2 B;  1YMP A;  3GZ1 A;  3SI5 A;  3KEA A;  3HRA A;  4N2Q A;  2QIC A;  4XIF A;  4K0R A;  3M63 A;  3UX4 A;  5D0Q D;  4HOU A;  4CGW A;  3F6Q A;  4IC3 A;  2L6B A;  3JUE A;  2UZG A;  1HZ4 A;  3D9P A;  2AVP A;  4I2Z A;  3R9A B;  2LAH A;  5E76 A;  1X81 A;  2VSY A;  3N9N A;  3ESL A;  4AP2 A;  2E61 A;  2WXG A;  2YUC A;  3HCS A;  2P9U G;  5C13 A;  3ASG A;  1WG0 A;  4JB8 P;  3L1Z B;  4RVB A;  4F3V A;  1X4U A;  3UM1 A;  4J6I A;  3ZIM A;  2CSV A;  4U8H A;  5AQ9 A;  1SW6 A;  2P9K G;  3FTX A;  4PS3 A;  2AN6 A;  5BPP A;  2QFC A;  1KZP A;  1E7V A;  4WNF A;  2H0D B;  4L9P A;  2IU1 A;  5ENO D;  3ONL A;  2XZT G;  4YDY A;  1TNB A;  3ONK A;  4GYO A;  5FQ6 A;  4CT0 A;  1PAQ A;  4U0U A;  3IBE A;  1ZB1 A;  3JYS A;  3FEY A;  3QAR A;  2XP0 A;  5LOZ A;  5BNW A;  2EIL E;  1UJJ A;  3ZVV A;  5AN8 A;  1TN8 A;  1BLX B;  4RQI A;  3U9W A;  2OVF A;  5M72 A;  1Z5S C;  5EYL A;  5D66 A;  1OT8 A;  3CR3 A;  1X4I A;  1VYX A;  3D9K A;  3E32 A;  2LAU A;  2OEW A;  3CVV A;  3CHM A;  4IYP A;  5BXO A;  2KGI A;  4ACK A;  1OWM A;  3EIJ A;  2MKE A;  2GGF A;  2C0L A;  4HFG A;  5CCM A;  1V54 E;  4GMJ A;  4A1S A;  2EQX A;  3FM8 C;  2M1R A;  2CFZ A;  1A17 A;  3MGB A;  3MCX A;  1TNZ A;  3RAU A;  4YAB A;  3UPV A;  2JRJ A;  5LFA A;  1ZBP A;  3O48 A;  2HE0 A;  4GU5 A;  3DSU A;  4CEM A;  2XPI A;  4AP4 A;  3E2D A;  4WNE A;  4TV3 A;  4F6R D;  4WA6 A;  3VLD A;  3I4G A;  3DPD A;  3NG2 A;  1QQE A;  5G2N A;  4FJC A;  1E8W A;  2RFA A;  3MHH A;  2GRL A;  3JQ1 A;  3N9M A;  4KBQ A;  5G05 J;  2J4D A;  3OXL A;  2OWA A;  5FQ8 A;  4LEU A;  5G04 J;  3E37 A;  5G05 C;  5AYW D;  3B7S A;  1K1A A;  3CHP A;  3QWP A;  2MT5 A;  3FEX A;  1MHQ A;  4BWR A;  2YHN A;  3ZYL A;  2YSJ A;  1X5B A;  3MKQ B;  2VQ2 A;  4O1O A;  1Z3Y A;  3LS8 A;  2EGM A;  2LDR A;  5JA4 D;  3FDH A;  3KSQ A;  3HXB A;  5KWD A;  4ANW A;  2PQR A;  3KD7 A;  2FUI A;  2DCP A;  3D9L A;  2VGY A;  2VNF A;  3UMV A;  1TR4 A;  2L80 A;  4G1T A;  4WAF A;  3CHQ A;  4X3G A;  4O62 A;  3TGO A;  1WES A;  5TBN A;  4ILI A;  2YQL A;  3N71 A;  2IJG X;  3SBT B;  2KKY A;  3DEP A;  2I1J A;  3UIO C;  4WZ2 A;  3FHE A;  1JPL A;  3PUQ A;  2VPD A;  2RD0 A;  1WM5 A;  1K8K G;  4QQ4 A;  4UWG A;  5CRU A;  2I1K A;  3ASL A;  1N9A A;  4JHR A;  3FAO A;  1BU9 A;  2WQ6 A;  5FZQ A;  2GRQ B;  5AIT A;  2RG8 A;  4J8S A;  4C0E A;  3ULY A;  1D8E A;  1H6O A;  2EOD A;  2DZO A;  3PZ3 A;  2PM6 A;  2XGM A;  4BT9 A;  4WZ0 A;  3NB2 A;  4NRH B;  2MNY A;  2P9I G;  2VSX E;  2YT5 A;  4Q69 A;  5BT1 A;  4LKA A;  5TAB A;  2LQ6 A;  3DSX A;  1FCH A;  1WFK A;  4GTQ A;  5FQ4 A;  2HO1 A;  3FL2 A;  1IHG A;  4KT6 B;  5KBA A;  4GA1 A;  5DKA A;  4G26 A;  3TWS A;  5KNH D;  2JEK A;  4L58 A;  2L0I A;  4UUC A;  3BUA A;  2QY7 A;  4G23 A;  5CBN A;  2FBN A;  4HOS A;  4YDW A;  3S7F A;  3LKU A;  2L9B A;  2KKX A;  2EIM E;  1OCO E;  3QC1 A;  4CDR A;  1JM7 B;  1Z6U A;  2XOY A;  3CEQ A;  4A4B A;  3NAW A;  2UWJ G;  3LVR E;  3CK8 A;  3CVU A;  1IYG A;  2X6F A;  4HQD A;  3ULQ A;  3FUL A;  4JEU A;  4F7A A;  2IFU A;  2MA5 A;  4DX5 D;  4AJW A;  3KV6 A;  3UT4 A;  2WPV A;  3CLJ A;  2D8U A;  1XWH A;  2Y69 E;  2NAA A;  5H7P A;  4EPZ A;  3FU0 A;  1UW4 B;  4J8E A;  4M3O A;  3HVE B;  3PRZ A;  1QYM A;  2ION A;  3KV5 A;  2M85 A;  5LKT A;  2FUU A;  4GTT A;  3OAW A;  3UT8 A;  2LSU A;  1H19 A;  3QOU A;  2MUM A;  2KYU A;  5ENR D;  3U64 A;  1H2V C;  1EPU A;  3O37 A;  3E34 A;  1LTX A;  2AXU A;  4GTP A;  2OOE A;  4S3O C;  3N9P A;  4WND A;  2RI7 A;  3FUK A;  1SA5 A;  5EDS A;  3G2S A;  4ILH B;  3AU4 A;  5CED B;  3AS8 A;  4U07 A;  3N9L A;  4GNG A;  1N87 A;  3ZYK A;  1FPP A;  4CT4 A;  4LAD B;  3PZD A;  3SFZ A;  3DSV A;  5B1B E;  3RO3 A;  4G8K A;  3LY9 A;  3CVL A;  3MKR A;  1N4P A;  4GTS A;  4ATG A;  3TWU A;  4TUU A;  3HTK C;  2DIW A;  1MJ0 A;  2XS1 A;  2FUL A;  2EIK E;  4GB9 A;  4KZ0 A;  3RPG C;  4FHK A;  4JPS A;  4XI0 A;  4WWO A;  1AP7 A;  3CHS A;  4YBS A;  1HX8 A;  2GRP B;  2VJF A;  3L9T A;  4CYM D;  3O7A A;  2BUG A;  3TWQ A;  3D9H A;  4GML A;  1ELR A;  5B76 A;  1HXI A;  4HBD A;  3APF A;  3IXE A;  4ANU A;  1N0Q A;  2XCC A;  2KAT A;  3ZHE A;  2CKL B;  2Y4U A;  3GW4 A;  1OCZ E;  5BW8 C;  4B89 A;  3GZS A;  1YA0 A;  3ESK A;  4U0Z A;  4ZFH A;  4UI9 J;  4U0S A;  5AIJ A;  2J07 A;  4BES A;  4UI9 C;  4OVV A;  2M3H A;  1VDY A;  2ECV A;  1SQM A;  2PUY A;  1HF8 A;  1WIM A;  3CQC B;  4LNG A;  5SVX A;  4BET A;  5KJN A;  4S3O B;  4GYW A;  4AY6 A;  2VP7 A;  4GYY A;  1QZ2 A;  2MA6 A;  3NOG D;  2XCB A;  4BFR A;  4E6H A;  1H2U A;  3PH0 C;  3QWV A;  2JLB A;  4QQI A;  2JM3 A;  3CSF A;  3LRQ A;  4N3C A;  4BTB A;  3RU0 A;  5AIU A;  2LGL A;  3GV4 A;  2LXH C;  4EZL A;  4AV7 A;  1Q2Z A;  4A0C D;  4GND A;  1D8D A;  1NL4 A;  3I2D A;  5AQA A;  2BTD A;  4TKP B;  2MHK A;  1WEQ A;  3QNK A;  1IQR A;  3T9K A;  3P1U A;  2DYR E;  3Q1D A;  4UWK A;  3K9I A;  1H6K A;  1Z2Q A;  2P57 A;  1VFY A;  4XE0 A;  5LX8 A;  4EZK A;  3T7L A;  1WY6 A;  4TUM A;  3V31 A;  4BX9 A;  4UWF A;  2YNQ A;  1HU3 A;  5T3R A;  3S2A A;  4H7X A;  4DX2 A;  4O64 A;  4XX5 A;  4L2Y A;  3SOW A;  4WZ3 B;  4G24 A;  4GZC A;  2KWK A;  3EU5 A;  1NI1 A;  3IV0 A;  2CT2 A;  5BV0 A;  3AG1 E;  3TG5 A;  2RSD A;  5CER B;  4WWP A;  5DBK A;  2LGV A;  1HO8 A;  3U5O A;  3LDY A;  3UQ3 A;  3AG3 E;  2ECJ A;  1GW6 A;  2RFM A;  2RR4 A;  3Q7F A;  4CDN A;  3PNL B;  1ZU2 A;  2KWJ A;  2OXQ C;  2J4B A;  4N2S A;  4PDX A;  4BBQ A;  4DK5 A;  2V5F A;  2WXN A;  2ECN A;  4N5Q A;  3B7T A;  4GZ5 A;  4F52 B;  4GTR A;  5B77 A;  2KCV A;  2VGX B;  3TWR A;  3U5P A;  2XOZ A;  4V3I A;  4HB5 A;  4J7W A;  3FY4 A;  3FJU B;  4LSZ E;  3UKU G;  2UY1 B;  2FF4 A;  2KBX A;  3DQV R;  5FER A;  2KGG A;  3FUN A;  2Y4T A;  3FUI A;  3UXG A;  4H7Y A;  2ZU6 B;  3EHR A;  3D9M A;  5E75 A;  2CG3 A;  3D9O A;  5ENS D;  2VYI A;  4ME2 A;  2FO1 E;  3KEZ A;  1HE8 A;  4CA1 A;  4HRN A;  2WXO A;  2V5Q C;  4C9B B;  1X4J A;  4J0U A;  3ZU7 B;  2KXP C;  2WB2 A;  2H0D A;  4N3W A;  3ABM E;  3ZVY A;  4FP7 A;  3HXF A;  5BXU A;  2KC7 A;  2XRY A;  3ZUV B;  2QYU A;  1JOC A;  2A5E A;  5B3S E;  3MV3 B;  3T6R A;  2WXI A;  4OAV B;  5KH7 A;  3LPZ A;  3PRE A;  5AQB A;  5B79 A;  4Z0R A;  5HQ8 A;  2LV9 A;  2AWI A;  2VGE A;  2FI7 A;  3EHM A;  4AVX A;  2WMO A;  2LRI C;  4GPM A;  3NOC D;  3TWW A;  1YYH A;  3G2U A;  4FC8 A;  3Q75 A;  4PTB A;  2K16 A;  5D1M B;  3Q49 B;  2I2O A;  1TJF A;  4U8V D;  5AJL A;  4LUN U;  3PDN A;  1E7U A;  4MBG A;  4C48 B;  4YBM A;  2R17 C;  2KCK A;  2X6H A;  4LNU D;  2K4D A;  3C3Q A;  1Y8M A;  3ABK E;  2L0B A;  1HYJ A;  1FBV A;  4JHJ A;  3C5K A;  4BSX A;  2ZGD A;  4K5B A;  5B8D A;  4GAA A;  3DBS A;  3E33 A;  1OXJ A;  2R03 A;  1DNP A;  2EXU A;  1U3C A;  2IF4 A;  4HLL A;  1JCS A;  4N3B A;  5JJT A;  4CZ2 D;  1LF8 A;  2KWN A;  2XEH A;  1U6G B;  4FUL A;  4BSZ B;  1XNF A;  4BY6 A;  1S0P A;  3FP3 A;  3PZ1 A;  3SHB A;  1Z3X A;  3UUX A;  4EBA A;  3C5R A;  3ZXP A;  2DSM A;  3ASO E;  4JHK A;  1FT1 A;  2LGG A;  1ZBD B;  2XZD G;  2Y0B G;  4GZD A;  1WEN A;  3QZV A;  2BKG A;  3M99 A;  2LUH A;  4GPK A;  4DX6 D;  4BTA A;  4YDE A;  1OUV A;  4HOR A;  1FT2 A;  2ECT A;  2JMI A;  3G2W A;  5AJD A;  4TRQ A;  5EKQ D;  3J5Q B;  2IQJ A;  4JW1 A;  3URZ A;  2MIQ A;  5LKX A;  1KZO A;  4HOT A;  3Q5M A;  3G2V A;  5LP0 A;  5AAR A;  4N5C A;  2IOS A;  4IN3 B;  2XRZ A;  3AG2 E;  2VJE A;  2P9L G;  5ENN A;  4HLE A;  5G04 C;  4NN2 A;  1S64 A;  3TWT A;  4YC9 A;  3ZNI A;  2XEV A;  3QDN A;  4U8Y D;  4PS7 A;  5H1U A;  1TNO A;  2Y1M A;  2A5U A;  1FVF A;  2ZET C;  3LJN A;  2OCC E;  2FD4 A;  2YHC A;  4YVO A;  5ANL A;  2DX8 A;  2WQH A;  3DEO A;  4HXI A;  4B93 B;  3D3M A;  4OGC A;  1UN9 A;  4E85 A;  1H6P A;  2KU3 A;  2C0M A;  2XGO A;  1JWF A;  4FJZ A;  1TN6 A;  3U5M A;  2LXM A;  2P9N G;  1D9S A;  1MYO A;  3FU6 A;  5EN5 D;  2Y3A A;  5J3X A;  5TDW A;  1ELK A;  3EIQ C;  2GW1 A;  1TN7 A;  3Q78 A;  3ZW3 A;  2KZT B;  3O35 A;  4L2L A;  2G43 A;  4AIF A;  3O34 A;  3L13 A;  2WXJ A;  3RRM B;  4Q6F A;  5D2M C;  1N11 A;  4ZDT A;  3LEW A;  4XI1 A;  4XI9 A;  1UG3 A;  3NZS A;  3SOU A;  3UI2 A;  3E4B A;  1E8Y A;  4YND A;  2EA6 A;  4AYC B;  3VK6 A;  3JCK C;  4GZ6 A;  4J8Y A;  4EQF A;  2BF0 X;  2LNI A;  1O5M A;  4JZY A;  3OXG A;  2GRR B;  3BEE A;  2OV8 A;  3UTM A;  3TXM A;  5FB1 A;  4GZ3 A;  5G05 B;  4P29 A;  2YU4 A;  5G04 B;  3JXJ A;  3PVL A;  2LSV A;  3GL6 A;  4GA2 A;  3FTS A;  3DST A;  1O1S A;  4XEI G;  3FUD A;  3T8K A;  3TXN A;  2ECI A;  4GNE A;  4KYO B;  2CON A;  4YAT A;  4L1B A;  4U96 D;  2EIN E;  3NF1 A;  3VTX A;  4H9D A;  4GTV A;  2FEZ A;  1HH8 A;  1L5J A;  3DDT A;  5AAO A;  5FQ7 A;  4O6F A;  4NAC A;  2MNZ A;  4DUI A;  5LKU A;  2KM4 A;  1SVX A;  3ABL E;  5CHE E;  1H0A A;  4YBT A;  2IQC A;  3ZFW A;  2YHO A;  3IHP A;  2IOL A;  3CHO A;  5EYP F;  5DIN A;  1DCQ A;  3N9O A;  3L08 A;  1Z60 A;  1F62 A;  4LNB A;  2HR2 A;  4KVM A;  2VSN A;  5K3Q A;  4WNG A;  3L11 A;  4KXK B;  1N95 A;  2XS8 A;  2CFU A;  2X3M A;  4Z68 A;  3SO8 A;  3FTW A;  4L7T A;  1K3Z D;  2KE1 A;  4GCO A;  4QF3 A;  3SF4 A;  2CRR A;  2DVW A;  2M63 A;  4UP5 A;  3TWX A;  5LKZ A;  1JCR A;  4DLQ A;  3N9Q A;  3R7Q A;  4EEC A;  3ASN E;  1NFI E;  4LK9 A;  2PM7 A;  4EZJ A;  4LJN A;  1N94 A;  3LJ3 A;  4UQX A;  4A55 A;  3FUE A;  3ZXS A;  2F8Y A;  3EU9 A;  1N0R A;  3CQG B;  4U7E B;  1OCC E;  2JMD A;  2AXV A;  3PEV B;  4IUL A;  3ZYQ A;  3SFX A;  3C6W A;  4W9R A;  4K5A B;  5EIB E;  2P9S G;  5C11 A;  4UWH A;  2QIZ A;  4JD2 G;  3PUR A;  4A3T A;  1SA4 A;  2C2L A;  2PZI A;  3HXD A;  2DYS E;  2XGS A;  5HI7 A;  2ZXW E;  3PNT B;  2G6Q A;  4AM9 A;  4I17 A;  4P5O B;  2GRM A;  5CMW A;  3ZPV 1;  3FUF A;  4I6E A;  1WIL A;  4HI8 A;  1BOR A;  1MX2 A;  4MVT A;  3L17 A;  3SFY A;  2JMJ A;  3ML8 A;  1YCS B;  2H6G A;  3APC A;  3L22 A;  1LDJ B;  1V55 E;  4N3A A;  4O1P A;  3UIP C;  3RIB A;  4OAU C;  5D0O D;  2AJA A;  2J9Q A;  3JXI A;  3Q4A B;  3LJU X;  2YRE A;  1BI7 B;  3PE3 A; 
#chains in the Genus database with same CATH homology
 4HVB A;  4MRU A;  4F1S A;  5FEY A;  4R8P K;  4QF2 A;  2VPB A;  4OVU A;  2I6H A;  3FTV A;  3SNX A;  3FTU A;  4JXT A;  5JJ6 A;  3FUJ A;  1Z6T A;  2XB1 A;  2ECW A;  5BUZ A;  4DJA A;  2XHE A;  3U3W A;  4BT8 A;  1XGW A;  5FWQ A;  2XQ0 A;  3OXF A;  1WGM A;  4EBA G;  4I1M A;  3B7U X;  4B94 A;  5KJK A;  3CVQ A;  4B0Z A;  4CCG X;  3IHV A;  3RPG B;  4Y6W A;  2VJF B;  5JHA A;  2XPZ A;  2E0I A;  1NA0 A;  4JEH A;  3ASD A;  4KVO A;  1H2T C;  2Q7F A;  2YUR A;  4L23 A;  2QJ0 A;  2WXP A;  2OVB A;  3T5V A;  3CHR A;  3ASF A;  3L1X A;  3PEU B;  5JG6 A;  2KFT A;  1OWO A;  4V3L C;  3O33 A;  2CHZ A;  3CKC A;  2VSO E;  3QK0 A;  5D1L B;  4I9E A;  4UI9 B;  4GB0 A;  2X6I A;  3L6A A;  3RJV A;  4A49 A;  3KAE A;  3LVQ E;  2LXP C;  3SGH A;  3EDT B;  1E90 A;  3MJW A;  2XEU A;  3O70 A;  3WXX A;  4FK5 A;  3D9I A;  3PS6 A;  5KH9 A;  3B13 A;  1WEE A;  3RO2 A;  5EYA F;  3FU3 A;  4UQY A;  1WEO A;  3QB2 A;  3O4Z A;  4D10 C;  4UQZ A;  5TRB A;  4DI4 A;  4R7E A;  1G25 A;  2WXM A;  2J49 A;  2E2E A;  2V4L A;  4PH4 B;  2VTB B;  4ILG A;  2K1J A;  2KCL A;  4I6G A;  1WAO 1;  5EX0 A;  3B7R L;  2X6J A;  2K17 A;  1EF1 C;  3CVP A;  2WXF A;  3HCT A;  3Q15 A;  4N39 A;  3PHD A;  4FHJ A;  1E8Z A;  2WVI A;  2L6J A;  2HDP A;  2F6J A;  3JQ0 A;  4PUC A;  2NXP A;  3MA5 A;  3ML9 A;  4UP0 A;  4FU3 A;  1SZA A;  5FT9 A;  2FSA A;  2X38 A;  2YSM A;  2DBA A;  2J08 A;  5LCW J;  4LCT A;  2NSZ A;  4APO A;  4ANX A;  4YAD A;  5LCW C;  1IYM A;  3ZVZ B;  1OWP A;  4IRU A;  3ZRH A;  1TEZ A;  1P5Q A;  4AEZ C;  4A3V A;  4FLB A;  2CHX A;  4XKC A;  4FA6 A;  1NZN A;  4AY5 A;  1HYI A;  3ZGQ A;  4YVQ C;  2X6K A;  4Q94 A;  3HHM A;  4XKB A;  5AEN A;  2I50 A;  4G25 A;  3APD A;  3QWW A;  5CMY A;  3FUM A;  2L5U A;  3ZEF A;  4ZUX U;  1INZ A;  5FZS A;  5KJL A;  5H1V A;  4WUY A;  1ELW A;  5B75 A;  4RG6 A;  2KIZ A;  4AXH A;  3VLF A;  4OYS A;  4F53 A;  1WEP A;  2IDA A;  3MYV A;  1HG5 A;  4JL0 A;  3LDZ A;  4ACL A;  1HFA A;  3S7D A;  2YW8 A;  1JWG A;  4W4U A;  1K2F A;  2V8S E;  1E8X A;  2CSY A;  4RSY A;  5T8I A;  4MKT A;  2WMN A;  3MKQ A;  4Q96 A;  5D1K B;  3CKB A;  4FIP A;  5LCW B;  3HCU A;  3FTZ A;  3GYZ A;  3FU5 A;  2VPG A;  3MEK A;  3RTR B;  5J90 A;  4KZC A;  3AU5 A;  3ENE A;  2MD8 C;  3QJZ A;  4GA0 A;  3R7R A;  3T8M A;  4I9C A;  2V0P A;  1WEM A;  3TG4 A;  3AS4 A;  5FZR A;  2KZT A;  2LO6 A;  2AXZ A;  5DIZ A;  3U4T A;  2ECG A;  1JUQ A;  1BPO A;  4J8F A;  2WXH A;  1QNF A;  4WWN A;  2KR4 A;  4AYC A;  4C0M A;  4HOQ A;  2YHE A;  3KNV A;  2HYE D;  3CVY A;  1IQU A;  2XPY A;  5J08 A;  4FO9 A;  3ZN3 A;  1N54 A;  3LQJ A;  3LQH A;  3EB6 A;  3RK6 A;  2ILR A;  2R59 A;  4LRZ A;  3FH8 A;  5T4Y A;  2CSZ A;  3M62 A;  4YAX A;  3S7J A;  3PE4 A;  4J8D A;  1JM7 A;  1LDK C;  4NQ0 A;  1N52 A;  4UI9 K;  1KT1 A;  2VJE B;  4QFV A;  5KJM A;  3UT7 A;  3NQP A;  2LN0 A;  2WQ7 A;  2WXK A;  3SZ7 A;  3S7B A;  1EDU A;  3KQI A;  3CVX A;  4L7X A;  4GNF A;  5KCM A;  1Y6I A;  3RRU A;  3L54 A;  2I9C A;  3HVE A;  1KT0 A;  4I6J A;  3U66 A;  5A6C A;  4JA7 A;  4LLB A;  2FO7 A;  5TDR A;  3EB5 A;  4MLP A;  3ASH A;  2VPE A;  2PNX A;  4FJY A;  5JHB A;  2E6S A;  4DLO A;  3SBS A;  3MZL B;  3FUH A;  3LY7 A;  3I4R B;  4K03 A;  1HG2 A;  3JUI A;  1VD4 A;  1E4U A;  3Q47 B;  4B8C B;  2PQN A;  4MS6 A;  4C9Z A;  3FTY A;  4I2W A;  3MHS A;  2M6M A;  4AOF A;  3LYA A;  3MX3 A;  4I1A A;  1PY1 A;  3CVW A;  4FLH A;  4JA9 A;  1PC2 A;  4I43 A;  1WEV A;  3VLE A;  3FH7 A;  2VJ8 A;  4HS2 A;  2LAI A;  2OND A;  4IC2 A;  2WXQ A;  3I5P A;  2HM8 A;  1DVP A;  4JC8 A;  5G55 A;  3G2T A;  4DI3 A;  2P58 C;  4JVS A;  2C2V S;  4R2Y A;  4B7Y C;  3IEG A;  3DPL R;  3ZYM A;  3QAQ A;  5KH3 A;  4A1G A;  1FP0 A;  4AUQ B;  2CKL A;  1T1H A;  4N4F A;  2AW6 A;  2E6R A;  2CHW A;  2KWO A;  3RRN B;  4I7C A;  1UN8 A;  3NZU A;  4R7L A;  5A23 A;  2Y43 A;  5C1D A;  3PUK A;  1RMD A;  2A4Z A;  3QKY A;  2YYR A;  3ZTG A;  3IKO B;  5FJY A;  3C98 A;  4I7B A;  4FAD A;  3GZ2 A;  3CST A;  4XZ4 A;  2F6N A;  3KS2 A;  3U5N A;  2L0T B;  5FB0 A;  3T5X A;  3TAX A;  4URK A;  2EGP A;  1TJC A;  4UWL A;  5B78 A;  1HS6 A;  5ARF A;  2BAY A;  4U04 A;  4ANV A;  2R5S A;  3LCA A;  3BG0 B;  3VTY A;  3LXU X;  1UJK A;  3SD5 A;  1E96 B;  3V43 A;  2NC9 A;  1MM3 A;  2D8S A;  1OWN A;  4PPE A;  3O36 A;  1WE9 A;  4I1O B;  5CCL A;  3ZPV E;  3TL5 A;  4BHW A;  3OTN A;  3CV0 A;  3P2B A;  2HYZ A;  2L75 A;  3AS5 A;  3LY8 A;  4I7D A;  1SZ9 A;  3CGH A;  4MSX A;  5ANR A;  3CK7 A;  3LQI A;  2WXR A;  3FFL A;  1WEU A;  3SHF A;  4NUR A;  4CRW A;  4G11 A;  3FH5 A;  3ZHE B;  4PS8 A;  3D9N A;  1MM2 A;  4V3K C;  3EHN A;  5C2Y A;  3HDX A;  2VGX A;  5A7D B;  1NA3 A;  2UY1 A;  5I3L A;  5BV1 A;  4B86 C;  3HIZ A;  1U3D A;  1OWL A;  2WXL A;  2F42 A;  2MRI A;  2YQM A;  5H9M A;  2VTB A;  4Y6C A;  2KRE A;  4ZQL A;  4U63 A;  2LGK A;  2PL2 A;  4BX8 A;  5JJ7 A;  5EX3 A;  3PUJ A;  4CDM A;  1KLX A;  3L16 A;  2CG2 A;  3FWV A;  1W3B A;  4B8A A;  5ARG A;  2G45 A;  2Y1N A;  2YQ8 A;  1FVH A;  1NP7 A;  4A4C A;  4GCN A;  1B89 A;  2WM9 A;  1V87 A;  2MOW A;  1MQS A;  4KMO A;  3TJP A;  1CHC A;  3BG1 B;  3RKV A;  2L43 A;  2J09 A;  1WEW A;  1EYH A;  3IHY A;  3CVN A;  4CCA A;  4APF A;  3CK9 A;  3EJN A;  4G2V A;  5G0F A;  3D9J A;  4RG9 A;  3HYM B;  2MD7 B;  5FTP A;  3I3N A;  4CGV A;  3SOX A;  4ABN A;  3CIA A;  5H1T A;  4DPR A;  4LER A;  2YIN A;  3ZPJ A;  3MV2 B;  3GZ1 A;  3SI5 A;  4N2Q A;  2QIC A;  4XIF A;  4K0R A;  3M63 A;  3UX4 A;  5D0Q D;  4HOU A;  4CGW A;  4IC3 A;  2UZG A;  1HZ4 A;  3D9P A;  2AVP A;  4I2Z A;  3R9A B;  2LAH A;  5E76 A;  2VSY A;  3N9N A;  3ESL A;  4AP2 A;  2WXG A;  2YUC A;  3HCS A;  5C13 A;  3ASG A;  3L1Z B;  4RVB A;  4F3V A;  1X4U A;  4J6I A;  3ZIM A;  4U8H A;  3FTX A;  4PS3 A;  2AN6 A;  5BPP A;  2QFC A;  1E7V A;  4WNF A;  2H0D B;  2IU1 A;  3ONL A;  4GYO A;  3ONK A;  5FQ6 A;  4CT0 A;  1PAQ A;  4U0U A;  3IBE A;  3JYS A;  3FEY A;  3QAR A;  5LOZ A;  5BNW A;  1UJJ A;  3ZVV A;  3U9W A;  2OVF A;  5M72 A;  3CR3 A;  1X4I A;  1VYX A;  3D9K A;  3CVV A;  3CHM A;  4IYP A;  2KGI A;  4ACK A;  1OWM A;  3EIJ A;  2GGF A;  2C0L A;  4HFG A;  5CCM A;  4GMJ A;  4A1S A;  2EQX A;  2M1R A;  2CFZ A;  1A17 A;  3MGB A;  3MCX A;  4YAB A;  3UPV A;  2JRJ A;  5LFA A;  1ZBP A;  3O48 A;  4GU5 A;  4CEM A;  2XPI A;  4AP4 A;  4WNE A;  4TV3 A;  4WA6 A;  3VLD A;  3I4G A;  3DPD A;  3NG2 A;  1QQE A;  5G2N A;  4FJC A;  1E8W A;  3MHH A;  2GRL A;  3JQ1 A;  3N9M A;  4KBQ A;  5G05 J;  2J4D A;  3OXL A;  5FQ8 A;  4LEU A;  5G04 J;  5G05 C;  5AYW D;  3B7S A;  3QWP A;  3CHP A;  2MT5 A;  3FEX A;  1MHQ A;  4BWR A;  2YHN A;  3ZYL A;  2YSJ A;  1X5B A;  3MKQ B;  2VQ2 A;  1Z3Y A;  3LS8 A;  2LDR A;  3FDH A;  4ANW A;  2PQR A;  3KD7 A;  2FUI A;  2DCP A;  3D9L A;  2VGY A;  2VNF A;  3UMV A;  2L80 A;  4G1T A;  4WAF A;  3CHQ A;  4X3G A;  3TGO A;  1WES A;  5TBN A;  4ILI A;  2YQL A;  3N71 A;  2IJG X;  3SBT B;  2I1J A;  4WZ2 A;  3FHE A;  1JPL A;  3PUQ A;  2VPD A;  2RD0 A;  1WM5 A;  4UWG A;  2I1K A;  3ASL A;  4JHR A;  2WQ6 A;  5FZQ A;  5AIT A;  2RG8 A;  4J8S A;  4C0E A;  2EOD A;  2PM6 A;  2XGM A;  4BT9 A;  4WZ0 A;  4NRH B;  2MNY A;  2VSX E;  2YT5 A;  4Q69 A;  5BT1 A;  4LKA A;  5TAB A;  2LQ6 A;  1FCH A;  1WFK A;  5FQ4 A;  2HO1 A;  3FL2 A;  1IHG A;  4KT6 B;  4GA1 A;  5DKA A;  4G26 A;  2JEK A;  4L58 A;  2L0I A;  2QY7 A;  4G23 A;  2FBN A;  4HOS A;  3S7F A;  3LKU A;  2L9B A;  3QC1 A;  4CDR A;  1JM7 B;  1Z6U A;  3CEQ A;  4A4B A;  2UWJ G;  3LVR E;  3CK8 A;  3CVU A;  1IYG A;  2X6F A;  3ULQ A;  3FUL A;  4JEU A;  4F7A A;  2IFU A;  2MA5 A;  4AJW A;  3KV6 A;  3UT4 A;  2WPV A;  3CLJ A;  1XWH A;  2NAA A;  4EPZ A;  3FU0 A;  1UW4 B;  4J8E A;  4M3O A;  3HVE B;  3PRZ A;  2ION A;  3KV5 A;  2M85 A;  5LKT A;  2FUU A;  3UT8 A;  3OAW A;  2LSU A;  1H19 A;  3QOU A;  2MUM A;  2KYU A;  3U64 A;  1H2V C;  1EPU A;  3O37 A;  2AXU A;  2OOE A;  4S3O C;  3N9P A;  4WND A;  2RI7 A;  3FUK A;  5EDS A;  3G2S A;  4ILH B;  3AU4 A;  3AS8 A;  4U07 A;  3N9L A;  4GNG A;  1N87 A;  3ZYK A;  4CT4 A;  4LAD B;  3PZD A;  3SFZ A;  3RO3 A;  3LY9 A;  3CVL A;  3MKR A;  4ATG A;  4TUU A;  3HTK C;  2DIW A;  2FUL A;  4GB9 A;  4KZ0 A;  3RPG C;  4FHK A;  4JPS A;  4XI0 A;  4WWO A;  3CHS A;  4YBS A;  1HX8 A;  2VJF A;  3O7A A;  2BUG A;  4GML A;  1ELR A;  5B76 A;  1HXI A;  3APF A;  4ANU A;  2XCC A;  2KAT A;  3ZHE A;  2CKL B;  2Y4U A;  3GW4 A;  5BW8 C;  4B89 A;  3GZS A;  1YA0 A;  3ESK A;  4U0Z A;  4UI9 J;  4U0S A;  5AIJ A;  2J07 A;  4UI9 C;  4OVV A;  2M3H A;  1VDY A;  2ECV A;  1SQM A;  2PUY A;  1HF8 A;  1WIM A;  3CQC B;  5KJN A;  4S3O B;  4GYW A;  4AY6 A;  2VP7 A;  4GYY A;  1QZ2 A;  2MA6 A;  2XCB A;  4BFR A;  4E6H A;  1H2U A;  3PH0 C;  3QWV A;  2JLB A;  3CSF A;  3LRQ A;  4N3C A;  4BTB A;  3RU0 A;  5AIU A;  2LGL A;  3GV4 A;  2LXH C;  4EZL A;  4AV7 A;  4A0C D;  4GND A;  3I2D A;  2BTD A;  4TKP B;  2MHK A;  1WEQ A;  3QNK A;  1IQR A;  3P1U A;  4UWK A;  3K9I A;  1H6K A;  1Z2Q A;  1VFY A;  4XE0 A;  5LX8 A;  4EZK A;  3T7L A;  1WY6 A;  4BX9 A;  4UWF A;  2YNQ A;  1HU3 A;  5T3R A;  3S2A A;  4H7X A;  4O64 A;  4XX5 A;  4L2Y A;  3SOW A;  4WZ3 B;  4G24 A;  4GZC A;  2KWK A;  3IV0 A;  2CT2 A;  5BV0 A;  3TG5 A;  2RSD A;  4WWP A;  5DBK A;  2LGV A;  1HO8 A;  3U5O A;  3UQ3 A;  2ECJ A;  1GW6 A;  4CDN A;  3PNL B;  1ZU2 A;  2KWJ A;  2OXQ C;  2J4B A;  4N2S A;  4PDX A;  4BBQ A;  4DK5 A;  2V5F A;  2WXN A;  2ECN A;  3B7T A;  4GZ5 A;  4F52 B;  5B77 A;  2KCV A;  2VGX B;  3U5P A;  4V3I A;  3FY4 A;  2UY1 B;  2FF4 A;  3DQV R;  5FER A;  2KGG A;  3FUN A;  2Y4T A;  3FUI A;  4H7Y A;  2ZU6 B;  3D9M A;  5E75 A;  2CG3 A;  3D9O A;  2VYI A;  4ME2 A;  3KEZ A;  1HE8 A;  4CA1 A;  2WXO A;  4C9B B;  1X4J A;  4J0U A;  2WB2 A;  2H0D A;  4N3W A;  3ZVY A;  4FP7 A;  2KC7 A;  2XRY A;  1JOC A;  3MV3 B;  3T6R A;  2WXI A;  5KH7 A;  3LPZ A;  3PRE A;  5B79 A;  5HQ8 A;  2LV9 A;  2AWI A;  2FI7 A;  3EHM A;  4AVX A;  2WMO A;  2LRI C;  3G2U A;  4FC8 A;  4PTB A;  2K16 A;  5D1M B;  3Q49 B;  2I2O A;  1TJF A;  5AJL A;  4LUN U;  3PDN A;  1E7U A;  4YBM A;  2R17 C;  2KCK A;  2X6H A;  2K4D A;  1Y8M A;  2L0B A;  1HYJ A;  1FBV A;  4JHJ A;  3C5K A;  4BSX A;  5B8D A;  4GAA A;  3DBS A;  1DNP A;  1U3C A;  2IF4 A;  4N3B A;  5JJT A;  1LF8 A;  2KWN A;  1U6G B;  4FUL A;  1XNF A;  4BY6 A;  1S0P A;  3FP3 A;  3SHB A;  1Z3X A;  3UUX A;  4EBA A;  4JHK A;  2LGG A;  1ZBD B;  4GZD A;  1WEN A;  3QZV A;  3M99 A;  4GPK A;  4BTA A;  1OUV A;  4HOR A;  2ECT A;  2JMI A;  3G2W A;  5AJD A;  4TRQ A;  5EKQ D;  4JW1 A;  3URZ A;  2MIQ A;  5LKX A;  4HOT A;  3Q5M A;  3G2V A;  5LP0 A;  4N5C A;  2IOS A;  4IN3 B;  2XRZ A;  2VJE A;  5ENN A;  4HLE A;  5G04 C;  4NN2 A;  4YC9 A;  3ZNI A;  2XEV A;  3QDN A;  4PS7 A;  5H1U A;  2Y1M A;  2A5U A;  1FVF A;  2ZET C;  2YHC A;  4YVO A;  5ANL A;  2DX8 A;  2WQH A;  4HXI A;  3D3M A;  1UN9 A;  4E85 A;  2KU3 A;  2C0M A;  2XGO A;  1JWF A;  4FJZ A;  3U5M A;  3FU6 A;  2Y3A A;  5J3X A;  5TDW A;  1ELK A;  3EIQ C;  2GW1 A;  3ZW3 A;  2KZT B;  3O35 A;  4L2L A;  2G43 A;  4AIF A;  3O34 A;  3L13 A;  2WXJ A;  3RRM B;  4Q6F A;  4ZDT A;  3LEW A;  4XI1 A;  4XI9 A;  1UG3 A;  3NZS A;  3SOU A;  3E4B A;  1E8Y A;  4YND A;  2EA6 A;  4AYC B;  3VK6 A;  3JCK C;  4GZ6 A;  4EQF A;  2BF0 X;  2LNI A;  4JZY A;  3OXG A;  3BEE A;  2OV8 A;  3TXM A;  5FB1 A;  4GZ3 A;  5G05 B;  4P29 A;  2YU4 A;  5G04 B;  3PVL A;  2LSV A;  3GL6 A;  4GA2 A;  3FTS A;  3FUD A;  3TXN A;  2ECI A;  4GNE A;  4KYO B;  4YAT A;  4L1B A;  3VTX A;  3NF1 A;  2FEZ A;  1HH8 A;  1L5J A;  5FQ7 A;  4O6F A;  4NAC A;  2MNZ A;  5LKU A;  2KM4 A;  5CHE E;  1H0A A;  4YBT A;  2IQC A;  3ZFW A;  2YHO A;  3IHP A;  2IOL A;  3CHO A;  5DIN A;  3N9O A;  3L08 A;  1Z60 A;  1F62 A;  2HR2 A;  4KVM A;  2VSN A;  4WNG A;  3L11 A;  4KXK B;  2CFU A;  2X3M A;  3FTW A;  4L7T A;  2KE1 A;  4GCO A;  4QF3 A;  3SF4 A;  2M63 A;  4UP5 A;  5LKZ A;  4DLQ A;  3N9Q A;  3R7Q A;  4EEC A;  4LK9 A;  2PM7 A;  4EZJ A;  4LJN A;  3LJ3 A;  4UQX A;  4A55 A;  3FUE A;  3ZXS A;  3CQG B;  2JMD A;  2AXV A;  3PEV B;  4IUL A;  3ZYQ A;  3C6W A;  4W9R A;  5C11 A;  4UWH A;  2QIZ A;  3PUR A;  4A3T A;  2C2L A;  2PZI A;  5HI7 A;  2XGS A;  3PNT B;  2G6Q A;  4AM9 A;  4I17 A;  4P5O B;  2GRM A;  5CMW A;  3ZPV 1;  3FUF A;  4I6E A;  1WIL A;  1BOR A;  4MVT A;  3L17 A;  2JMJ A;  3ML8 A;  3APC A;  3L22 A;  1LDJ B;  4N3A A;  3RIB A;  5D0O D;  2J9Q A;  3Q4A B;  2YRE A;  3PE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...