3ZYQA

Crystal structure of the tandem vhs and fyve domains of hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) at 1.48 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
216
structure length
216
Chain Sequence
GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
publication title Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) at 1.48 A Resolution
rcsb
source organism Homo sapiens
molecule tags Signaling
total genus 73
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zyqA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zyqA02
3RTRB 4NN2A 2VPBA 5TDRA 5B77A 2XB1A 5G04B 3N9NA 1X5BA 3ONKA 2QICA 2XEUA 4CA1A 2YQLA 2PNXA 4CCGX 4N3WA 3PUQA 3G2VA 1HG2A 2L0BA 2VPDA 4WA6A 5FB1A 1UJJA 1FP0A 5LKZA 2KWNA 2YU4A 2F42A 4YATA 2YQMA 3EB5A 4MSXA 5TRBA 3G2TA 3QZVA 3O7AA 2DX8A 3HCUA 3O34A 3L11A 2VPEA 4NACA 1VDYA 2JMIA 2K16A 4Q96A 2LGGA 4WZ0A 3T6RA 3GV4A 2YHOA 2M85A 1K2FA 3VK6A 1LDKC 4GB0A 4GNDA 5J08A 5LCWB 3PHDA 3RPGB 2FSAA 2VP7A 4WZ2A 2ZETC 4LADB 2EODA 2H0DB 4TKPB 4YAXA 2RSDA 2ECTA 4IC3A 3KV5A 1HG5A 3D9IA 3G2UA 4A4BA 5FERA 3LQHA 2MD8C 4F52B 5B79A 2MUMA 3SHBA 5H1TA 1V87A 2PUYA 5LOZA 2HDPA 5B78A 1BORA 5CMYA 4LLBA 4YBTA 2C2VS 4W4UA 3U5OA 2UZGA 4I7BA 2YYRA 4AYCB 4PTBA 1SZAA 4BHWA 3LQJA 5H1VA 2LQ6A 3GL6A 3SOXA 1X4JA 3LRQA 1WEUA 3T7LA 1MM2A 1WESA 1EDUA 4Q94A 1MM3A 2ECGA 2QJ0A 4Q6FA 5EYAF 1H0AA 1XGWA 2MOWA 1WFKA 1UJKA 2L0IA 4LJNA 2YUCA 2LDRA 1XWHA 4GZDA 4FIPA 1VD4A 5B8DA 2KWOA 2F6NA 4FK5A 4P5OB 2L0TB 5G05B 3N9MA 4C9ZA 5FEYA 4UP5A 5C13A 1X4UA 2LGKA 2BAYA 1HYIA 2LRIC 3NG2A 4XI1A 2LGLA 4FO9A 1INZA 3V43A 2H0DA 4YABA 3ZTGA 5D1LB 3O70A 3SOUA 1G25A 5G0FA 2YHNA 3ZYLA 1WILA 3PURA 3O33A 2VJEB 3U5MA 3SOWA 3HCTA 1HX8A 4GZCA 2V8SE 2LXPC 4LKAA 1N87A 2KREA 2M1RA 5KH3A 4PPEA 5I3LA 3G2SA 2Y1NA 4WZ3B 3I2DA 2LXHC 2QY7A 2JMDA 3LQIA 1WEWA 5LP0A 2VJFB 2MT5A 4V3KC 4AYCA 3O36A 1JM7B 1X4IA 1JUQA 2BF0X 5B75A 3D9MA 3KV6A 4V3LC 3M63A 1WGMA 2HYED 1WIMA 2KWJA 1VYXA 2DIWA 4L7XA 2L43A 1WEQA 2KFTA 4A4CA 2CKLA 3CLJA 3HTKC 3ZPV1 1F62A 4JXTA 5KH7A 2M3HA 4S3OC 3DQVR 5TDWA 2L80A 4FJCA 1CHCA 5TABA 3D9OA 4AUQB 4A49A 3G2WA 2G45A 1SZ9A 2E6SA 4B7YC 2CSYA 2RI7A 1WEVA 2YSJA 2KM4A 3C5KA 1WEEA 4R2YA 4YC9A 2F6JA 1WEOA 3DPLR 1Z60A 3KQIA 3L1ZB 4UI9B 5C11A 5KH9A 2NAAA 3D9PA 3HCSA 1WEMA 4YBMA 1JPLA 2L5UA 1LF8A 4O64A 2EGPA 2C2LA 3ZYKA 3M99A 2CKLB 3N9PA 2K17A 4N4FA 4L58A 4AVXA 2MIQA 2MNZA 2YREA 1DVPA 3RRUA 4HFGA 2VJEA 5AITA 4UP0A 4AP4A 4ZUXU 2ECVA 2KE1A 1E4UA 5H1UA 3D9JA 2KGGA 4GNFA 5H9MA 2VJFA 2Y43A 5D1MB 1JM7A 2OXQC 3LDZA 3ZYQA 3D9KA 3MHHA 1VFYA 3N9OA 1LDJB 5B76A 4LK9A 2I50A 2LN0A 3ZVYA 2L75A 1EYHA 1ZBDB 2JRJA 2G6QA 2M6MA 2LGVA 4YADA 2ECWA 1Z2QA 2EA6A 4QF3A 4YBSA 2ECJA 1WENA 3U5PA 1U6GB 2KR4A 2FUIA 5LKUA 2MA5A 5AIUA 3ZYMA 3N9QA 3N9LA 2YW8A 3ASLA 1IYMA 2AN6A 2KWKA 4FLBA 4X3GA 2D8SA 4A0CD 3RPGC 1Z6UA 4ZQLA 3U5NA 2MNYA 4I7CA 2KYUA 2YSMA 5CMWA 2YURA 1PY1A 5TBNA 1WE9A 3O37A 4B86C 2LO6A 3IHPA 2E6RA 1MHQA 5LKTA 2CSZA 3M62A 4R7EA 4BBQA 4GNGA 3C6WA 2FUUA 2DCPA 1JWFA 3D9NA 2LV9A 2MA6A 4QF2A 2Y1MA 2G43A 1WEPA 2MD7B 2K4DA 4S3OB 1JWGA 1JOCA 4FU3A 2KU3A 5D1KB 2QIZA 2IDAA 3MHSA 3ZNIA 5DINA 2KIZA 3O35A 4IC2A 5JG6A 5LKXA 3ONLA 2YT5A 4R8PK 3L1XA 1HFAA 2VPGA 2ECIA 1HYJA 1T1HA 3FL2A 3EB6A 2CT2A 2K1JA 1RMDA 5DKAA 1HF8A 4ZDTA 5J3XA 5FB0A 3ZVZB 1ELKA 4I7DA 1FBVA 3KNVA 4MVTA 4GNEA 2VNFA 3ZPVE 3D9LA 2JMJA 2ECNA 2KGIA
chains in the Genus database with same CATH superfamily
3WXXA 3FUHA 2XPYA 2E2EA 3LYAA 3Q15A 3V2OA 1X5BA 4K5BA 3PEUB 5G55A 3ZU7B 2WXLA 4WA6A 1UJJA 1FP0A 2KWNA 2YU4A 4H9DA 4JHRA 2F42A 2YQMA 3FTYA 5TRBA 1OCOE 4F53A 3L11A 2XHEA 5SVYA 4G1TA 2KKYA 2VPEA 3CK7A 4GYYA 4B0ZA 2JMIA 5G2NA 3LCAA 3R9MA 2HR2A 4Q96A 4WZ0A 4ANUA 4XZ4A 2J4DA 1N4RA 3VK6A 4FHJA 3ZFWA 4JEHA 3FHEA 3FUKA 4XKBA 2P58C 3Q9UC 4WZ2A 4GU5A 2WXHA 4NQ0A 2Y69E 1Z3YA 4CT4A 2EIKE 3KEAA 2KCKA 3QJZA 3FTUA 3UTMA 1N94A 4UWGA 4PDXA 4EPZA 1U2VG 5FERA 2CFZA 3CVYA 4ANWA 4MLPA 4LNUD 4EBAG 4L9PA 2P9NG 2MUMA 3SFXA 3PUJA 1V87A 2V4HC 2HDPA 5AIJA 3LPZA 2YHEA 5CMYA 4TRQA 2ZISA 5G05J 3DDTA 2UZGA 2R17C 3SF4A 4AYCB 4CEMA 4B8CB 3LRQA 1HS6A 3T7LA 3E37A 3UIPC 5A23A 1WESA 3RKVA 2ECGA 4TXPA 2XEEA 3VTXA 3ZXPA 1O1TA 3DRAA 4JEUA 3V31A 1WFKA 2Y4UA 4BY6A 2L0IA 2WXFA 4OGCA 3CVPA 2WM9A 1EPUA 2ZU6B 1VD4A 4OVUA 4WNDA 3PNLB 3N71A 3RAUA 1SA4A 4C9ZA 4A63B 4YDWA 1N11A 3I5PA 3ULEG 1KT0A 1X4UA 2HO1A 4WWPA 5EYLA 4EZJA 2LGLA 1Z6TA 1BI7B 3ZVVA 3MEKA 5D1LB 3O70A 1G25A 4CRWA 5JJ6A 2RKKA 2VSYA 5G0FA 3FEYA 1TNOA 5E75A 4AOFA 2XOYA 5CBOA 4HXIA 1OWLA 4HNAD 4WZ3B 3IBEA 3PZ4A 5EKQD 2JMDA 1E8WA 2VJFB 4V3KC 2LSUA 3CV0A 2WXRA 2CG3A 4AM9A 3KAEA 4GMRA 4GMJA 1O5MA 4I1MA 3TXNA 3ZHEA 5T8IA 5KJMA 3FUIA 1OY3D 3U64A 3M63A 4ILIA 2MHKA 2CSVA 5JHAA 2KWJA 4Z68A 4I43A 2VGEA 4AJWA 2F8XK 2FO7A 1WEQA 2KFTA 3QB2A 3NB2A 2L80A 3HXEA 3APDA 5TABA 4AUQB 2G45A 1SZ9A 2E6SA 3PREA 3KEZA 4CDRA 3B7TA 1BPOA 1SW6A 5A7DB 2FBNA 4YC9A 5C2YA 4GMLA 1Z60A 4J8EA 3CHQA 4UI9B 5C11A 5KH9A 2PL2A 3NZSA 2QYUA 3GZSA 5FQ7A 3VLDA 1JPLA 4FC8A 2L5UA 1LF8A 5LFAA 3RRMB 3M99A 4B93B 2K17A 4UQZA 3ZN3A 4ANVA 2X38A 1DVPA 3RRUA 1MX4A 2OEWA 4DX1A 5FQ6A 4HOSA 3TWQA 4UP0A 3APCA 4ZUXU 1TN8A 5A6CA 2P9IG 3JUEA 3L6AA 4XIFA 3MV2B 1N4PA 5G04C 4U96D 4ABNA 2FULA 3FTXA 4J6IA 2XRZA 2KGGA 4GNFA 5H9MA 5BV0A 5CECB 4JD2G 3PZ1A 3MGBA 1JCQA 5FJYA 2OXQC 1ELRA 3VTYA 3ZYQA 3U66A 3AG4E 3B95A 1B89A 5AQ7A 5BW8C 2PM6A 4WWOA 2LN0A 3FU6A 2XZTG 4XE0A 3DSVA 2G6QA 3I3NA 2NYJA 3JQ1A 2LGVA 3OXFA 4QF3A 1NA0A 4YBSA 1WG0A 1FVFA 3URZA 3ZUVB 3EIQC 4L2YA 2KR4A 1PC2A 3B7SA 2I6HA 2ZGDA 5ARGA 2DWZA 3P1UA 1FPPA 3ZYMA 3SBTB 1TYQG 3DEOA 5FZSA 3CHPA 3W9GA 4FLBA 3APFA 2X6FA 2D8SA 5LCWC 2J9QA 3CHOA 3FUDA 4I6GA 1DCEA 3U5NA 5CMWA 2MRIA 2YURA 2ZGGA 4O60A 3IHPA 2E0IA 4KZCA 2CSZA 2IFUA 4BBQA 3C6WA 4JL0A 2FFWA 3ABKE 2EGMA 2K4DA 4S3OB 3HHMA 2JLBA 4ZFHA 4AEZC 2KU3A 2UWJG 2GRNB 2B6CA 3SHFA 2VSNA 5KJNA 2LXMA 4U8VD 4FLHA 1H2UA 5G04J 3FDHA 1DNPA 3CEQA 4ZHBA 3L1XA 3UT7A 2KZTA 3LVRE 2E61A 4OGEA 4ATZD 1HYJA 1LD7A 2J4BA 2QYJA 3FUEA 3Q7FA 5DKAA 5FB0A 2P9PG 2WB2A 1ELKA 5CHEE 4I7DA 2WPVA 2WVIA 3FJUB 3U9WA 2ECNA 2FEZA 2FI7A 3RTRB 4NN2A 3NOGD 5TDRA 4I6JA 4BSZB 3ZXSA 3ONKA 4DLQA 2QICA 1SQMA 2XEUA 3UM1A 3M7KA 3CHSA 1N9AA 2ZIRA 4N3WA 2QC9A 4F3VA 5LCWJ 3NBNB 2AVPA 2DZNA 3LS8A 5FINA 3U4TA 5HRYA 3ZNGA 4UWFA 1MYOA 5FWQA 1TR4A 5CEDB 1KLXA 3LY8A 3G2TA 3HVEB 4DK5A 2XS1A 2DX8A 2J8SD 4U0ZA 2CG2A 3L17A 1U3DA 5CCLA 2OVFA 5BUZA 3PVLA 4NACA 3CSTA 3CKCA 3FTVA 4QFVA 4I17A 3DWLG 5EIDA 1FCHA 2PM7A 5AYWD 2GGFA 5E76A 4GB9A 4BTAA 1N52A 2BKGA 2YHOA 3GW4A 4CGWA 3FTZA 2L7PA 2M63A 2HE0A 2NXPA 1LDKC 5B3SE 2Q7FA 4N5CA 5FIOA 2L6JA 2GRQB 3PHDA 3SD5A 3RPGB 5D0QD 2FSAA 2VP7A 1WM5A 4HOQA 2IU1A 3ASDA 1TNYA 3ZW3A 4LADB 2YQ8A 4FADA 2H0DB 3PUKA 4TKPB 3TWSA 4CGVA 4YAXA 3NF1A 1S63A 1OCRE 4TXQA 3ASFA 2AWIA 1OXJA 1D8EA 4KZ0A 2GW1A 4GYWA 1N4SA 3SHBA 3Q7AA 3UUXA 4CYMD 3MZLB 4A1SA 2C2VS 3TAXA 5JHBA 4EZLA 2YYRA 3SY2A 4PTBA 3EJNA 4EBAA 1SZAA 3EHQA 4BHWA 3LQJA 5H1VA 2NC9A 2A5UA 3RJVA 1WEUA 4O1PA 5BT1A 3B7RL 3GZ2A 1MM2A 1S0PA 4K0RA 4Q94A 4UQXA 3LVQE 3RIBA 3SUBA 5EYAF 1H0AA 1XGWA 4LJNA 5DIZA 2YUCA 3FUFA 1NL4A 1IYGA 5DBKA 4AY6A 5B8DA 1AWCB 3R9AB 1SA5A 4BETA 3FP3A 5G05B 4XI0A 3FUJA 3ABME 5FEYA 5EYPF 3FH8A 4HRMB 2IOSA 3S7BA 1AP7A 1H6KA 2BAYA 1HYIA 3MKQB 3NG2A 4I2ZA 4XI1A 1Y6IA 3V43A 1FT2A 3L16A 4HLLA 3SOUA 4DX6D 5JA4D 1D8DA 1K3ZD 2YHNA 4K03A 4N5QA 3V30A 3K9IA 4KT6B 4HB5A 2F0YA 4C48B 5KJLA 2VJEB 3TL5A 3D9HA 3U5MA 2D8UA 4DX7D 4LKAA 1N87A 4DI4A 1OWNA 2KREA 2M1RA 5KH3A 4PPEA 5I3LA 1MZCA 5ENQD 4EZKA 5AENA 3AJIA 2LXHC 4LNBA 2QY7A 4C0MA 1MX2A 3HXDA 3LQIA 3PEVB 5CCMA 1WEWA 5LP0A 2MT5A 3W9FA 2IQJA 1JM7B 2CHZA 1JUQA 3D9MA 2GROB 3DSTA 1K8KG 5EDSA 4GA2A 1IQRA 2WXKA 2IF4A 3HYMB 3RSEG 4Y6CA 2A5EA 2NSZA 5B1AE 1F62A 4PS3A 2X6HA 4UWKA 3QWVA 2V4LA 2FO1E 5TDWA 4GYOA 4GZ3A 2P57A 4A49A 3G2WA 4FP7A 4G11A 4D10C 3MKRA 3FEHA 4AY5A 2YSJA 4BESA 2KM4A 2I9CA 2P2CP 4ILGA 1WEOA 3FAOA 2KCLA 1YCSB 2C0LA 4OVVA 3D3MA 3Q5MA 3CVVA 3L1ZB 3HCSA 1BLXB 1WEMA 3GYZA 1HZ4A 4XEIG 4O64A 2EGPA 2V5FA 2C2LA 4GTVA 2GRLA 4FJZA 1HXIA 4L58A 4J8DA 1OCZE 3EHMA 2YREA 5AITA 5D0OD 1E90A 1WY6A 3PNTB 4RG9A 2C0MA 4EECA 2DJAA 3UPVA 4LG6A 3D9JA 5J90A 2FF4A 4U0SA 2Y43A 4BX8A 5SVXA 5D1MB 5EN5D 3CVLA 3LDZA 5ITZF 4CDNA 4IULA 4JHJA 3QWPA 3Q78A 3S7DA 3S2AA 3OXLA 2GRPB 5B1BE 1EF1C 2AJAA 3B13A 4E85A 4L2LA 3SGHA 4UQYA 3H7HA 3MDBC 3E33A 2ILRA 4A55A 1UOHA 5KNGA 5T3RA 1U6GB 5KNHD 2Y1LE 2JM3A 3CVQA 3N9LA 3AS4A 3JQ0A 3ASLA 2AN6A 1NI1A 2KWKA 4X8QA 5FQ8A 3E2DA 4LCTA 3TWTA 4A0CD 3CVWA 1Z6UA 4ZQLA 2QFCA 3IHYA 2KYUA 4Q69A 2YSMA 1KPSB 4E6HA 2IONA 1N54A 4C0EA 2BTDA 4BERA 4CCAA 3O37A 4J0UA 2E6RA 3MX3A 3M62A 3AG2E 3OAWA 5K3QA 4N39A 1K1AA 4DLOA 2EILE 2JEKA 3JXJA 3D9NA 2ZXWE 4G25A 2MA6A 3LJNA 4I1OB 2MD7B 4GA1A 3P2BA 3UIOC 2X6KA 3TGOA 3J5PA 5ENTD 5D1KB 4EQFA 1DC2A 1H2VC 4U95D 2YVRA 3MHSA 3ZNIA 5DINA 4AXHA 2KIZA 1IXVA 3O35A 3LJUX 2R5SA 4J8SA 5D66A 2EXUA 3NAWA 3SZ7A 1LTXA 2YT5A 4GTOA 1IQUA 4DX5D 4TV3A 4RG6A 3LJ3A 3EB6A 4GTQA 2CT2A 1RMDA 1IHGA 2K1JA 4LEUA 5SVIB 2KKXA 4ZDTA 1YA0A 5CEAA 3FUNA 4NRHB 3HVEA 2KCVA 3ZVZB 2H6IA 3IV0A 1NFIE 4BEPA 1FBVA 2LUHA 5FTPA 3L82A 1MX6A 1YMPA 4L1BA 2XQ0A 3EU5A 3UM2A 3FH7A 4NURA 5CRVA 3KDEC 2VSOE 2XB1A 5G04B 3TWRA 3QOUA 4JB8P 2WXIA 3RU0A 4U07A 2PNXA 2YQLA 4YDYA 3G2VA 4I2WA 1HG2A 2L0BA 5FB1A 2XZDG 5LKZA 3C3OA 1FT1A 2XP0A 4CZ2D 4YATA 4G26A 5AQAA 3QZVA 3O7AA 2EIME 5JMND 1IHBA 4GTRA 5BNWA 4CT0A 4RQIA 2VJ8A 3Q49B 4F1PA 3T6RA 3GV4A 5EX3A 4J7WA 4L23A 2OOEA 5D2MC 5CBNA 3FU0A 5J08A 5LCWB 1A5EA 2PQRA 4O6FA 5FT9A 4UI9J 5BXUA 2R03A 5ANRA 3T5VA 4ACKA 2WQHA 2P9UG 4IRUA 4FJYA 4IC3A 1E8YA 3KV5A 5IY5E 3NZUA 3D9IA 3G2UA 2MD8C 2DSMA 4F52B 5B79A 4ILHB 2ETBA 1UG3A 1TJCA 1E96B 2PUYA 5LOZA 1BU9A 3CGHA 5B78A 4YBTA 2PQNA 3FM8C 1OWPA 1S64A 5ENRD 4GAAA 4U8HA 1P5QA 3ZIMA 1SVXA 4C9BB 4N2QA 3SOXA 1X4JA 3MKQA 3LKUA 3UXGA 3FU3A 2AXZA 1EDUA 3IKOB 2VGYA 3FFLA 3UM0A 2QJ0A 4Q6FA 2LNIA 4GTSA 2VTBB 2OVBA 2UY1B 4LUNU 3RK6A 4FULA 4BTBA 2LDRA 2RR4A 5HKPA 4W9RA 3L54A 1QNFA 1KZPA 2F6NA 4FK5A 4P5OB 3N9MA 1TEZA 3L13A 3TWUA 2EINE 2LGKA 3DSSA 2CFUA 4HBDA 4U63A 4HRLA 4LRZA 4YVOA 2JABA 3CK9A 3ESKA 4ACLA 4DJAA 1INZA 3CKBA 2DBAA 4EHMA 5AN8A 5C1DA 4F7AA 3DEPA 4Z0RA 4HI9A 2PNNA 3SQVA 4YNDA 3UMVA 3FULA 3ZYLA 3I4GA 1WILA 3PURA 3O33A 1X81A 2JUNA 3RO2A 1HX8A 3CK8A 3G2SA 3TJPA 1BI8B 3DBSA 3KD7A 5AQBA 4I6EA 2XRYA 4YDEA 2WMOA 2VQ2A 1W3BA 4R7LA 3L08A 1OUVA 4YDOA 1QQEA 3UT4A 4AYCA 1X4IA 1ZB1A 2RD0A 4HLEA 4WNGA 2R2LA 1NZNA 1KT1A 3FH5A 3KV6A 3J5QB 2LXLA 1WGMA 1ZU2A 1FVHA 4F6RD 2X6IA 4I1AA 1VYXA 2DIWA 4KBQA 4L7XA 2H6FA 2L43A 2AXVA 3HTKC 3ZPV1 4G24A 3JXIA 3DQVR 3AU4A 2CHXA 3UINC 1CHCA 3OTNA 4GPMA 3ULQA 4PS7A 4B94A 4A1GA 4GZ5A 1WEVA 2B0OE 1HH8A 4NIKA 5EX0A 1Q2ZA 3MV3B 1WEEA 2Y4TA 3QK0A 3F6QA 2XENA 1TJFA 1U3CA 2WXOA 2FD4A 2EQXA 3D9PA 3T8MA 5AJDA 2MKEA 3ASOE 3IEGA 4PS8A 4O62A 2CKLB 4DUIA 3N9PA 2ETAA 5EIBE 4N4FA 4UWLA 2MIQA 2MNZA 3EIJA 3T5XA 3ZEFA 4AP4A 2LSVA 3UT8A 1N4QA 2ECVA 3QKYA 3MA5A 2KE1A 4JHKA 3ISMC 4BT8A 3HXBA 2XOCA 5H1UA 4YVQC 3LXUX 3VLFA 2CRWA 3BG0B 4K5CA 2IO3C 2VJFA 3ML9A 4JPSA 2YHCA 4JC8A 4RVBA 3JUIA 4F1SA 4I9CA 2X6JA 4KVOA 1VFYA 3IXEA 5ENNA 4GA0A 2KZTB 4HVBA 1LDJB 2XPIA 3V2XA 2DVWA 5KBAA 4LK9A 2L6BA 3BG1B 3ZVYA 3UM3A 1EYHA 1ZBDB 2WMNA 2JRJA 2BUGA 4KVMA 2ECWA 3DXKG 3UX4A 2ECJA 4N3CA 1TNBA 1WENA 3U5PA 3FUMA 2J09A 5LKUA 2LAIA 4LNGA 2Y0BG 3CVXA 5AIUA 3JCKC 3N9QA 2YW8A 3DSUA 3CQCB 5JJ7A 1IYMA 5KCMA 2VGXB 1H6PA 4H7YA 3FANA 3C72A 1UW4B 4B8AA 3HXFA 4GPKA 3CIAA 2MNYA 4FA6A 4U0UA 4I7CA 4AIFA 3Q75A 2Y3AA 4O1OA 3LEWA 3PS6A 3TG4A 5TBNA 1WE9A 3MYVA 1OWOA 5LKTA 5ANLA 2L9BA 1E7UA 1UN8A 2FUUA 2DCPA 5SVIA 2OCCE 2ETCA 4HS2A 4ME2A 3UI2A 2Y1MA 2WXMA 2G43A 2VYIA 5JJTA 3S7FA 1JWGA 1JOCA 4FU3A 1WDYA 2QIZA 1HO8A 2IDAA 1OWMA 2DYSE 3DXMG 2P9SG 5H7PA 3CR3A 5HS0A 5JG6A 4Z0OA 5LKXA 3ONLA 3CSFA 4R8PK 1PAQA 2VPGA 3AG1E 1UN9A 3ASGA 3T8KA 4MKTA 2ONDA 1T1HA 1HU3A 4N3BA 3PH0C 3FL2A 3WG7E 4BX9A 1HF8A 3ASNE 4JA9A 1JCRA 1V54E 2H6HA 2WXJA 3PZ3A 3CHRA 3T9KA 4WUYA 4MVTA 4GNEA 5CRUA 2VNFA 4HQDA 3D9LA 3L9TA 4U04A 1H2TC 3O4ZA 3FWVA 5BXOA 2VPBA 4BT9A 5B77A 2V0PA 2KATA 3N9NA 4UI9K 3LY7A 3PZ2A 4CA1A 4XI9A 3HDXA 4M7CA 2R59A 3ULYA 4CCGX 3C5RA 3PUQA 1OT8A 3ZGQA 2J08A 3QDNA 2VPDA 2IJGX 5ENOD 5AAOA 1QBQA 3EB5A 2J07A 4MSXA 4N2SA 2AW6A 4PUCA 3HCUA 3O34A 1KZOA 2GRRB 5FZRA 4QQIA 4WNFA 1VDYA 2AXUA 4JA7A 3DPDA 4P29A 4FHKA 4GCOA 2K16A 2LGGA 2WXGA 5BV1A 2M85A 2I1JA 4APOA 1K2FA 3DSXA 4HI8A 2I1KA 2XOZA 4OAUC 4GB0A 4GNDA 2IEJA 3AU5A 2WXNA 4XKCA 3PE3A 2CRRA 2J49A 5HQ8A 2M13A 3QAQA 2ZETC 1N95A 2EODA 3Q1DA 2IOLA 3Q79A 1NP7A 2RSDA 3I4RB 2ECTA 1BD8A 3EUVA 4WNEA 1WAO1 3PRZA 3TWVA 1HG5A 3U3WA 4A4BA 4APFA 4WWNA 3LQHA 3TWWA 4JW1A 4PH4B 2XCCA 2VTBA 2UY1A 5H1TA 3B7BA 4IN3B 3DSWA 1Z5SC 1BORA 4LLBA 4W4UA 3HIZA 3U5OA 1RW2A 3E30A 4UI9C 3GZ1A 5LX8A 4I7BA 5FZQA 2YINA 3NQPA 3SFZA 2LQ6A 3GL6A 3Q4AB 5ENPD 2RFMA 2XS8A 4U8YD 4GTTA 2WQ6A 1Y8MA 3FY4A 2P9KG 1MM3A 4AP2A 4KXKB 3EU9A 3EDTB 3EHNA 4XX5A 3DPYA 4GTPA 2MOWA 4MBGA 5AJLA 1UJKA 4MS6A 2WXPA 4A3VA 3FU5A 3PZDA 4ANXA 1XWHA 1K1BA 1OCCE 4GZDA 4FIPA 4L7TA 3E4BA 1XNFA 4AV7A 3QWWA 3VLEA 3QNKA 4K5AB 3Q47B 2KWOA 2L0TB 5ARFA 3SBSA 4UP5A 4V3IA 5KWDA 5C13A 4DRXE 3PLWA 1RZ4A 1V55E 2LRIC 3ML8A 3UQ3A 4U7EB 4LERA 4FO9A 4GZ6A 2V5QC 2H0DA 4YABA 4KYOB 1GW6A 3ZTGA 5ENSD 3BUAA 3C3QA 2XGSA 3AAAC 4G23A 3QC1A 2IY0C 1TN7A 2RG8A 3JYSA 3ENEA 3PDNA 2XGMA 4BWRA 1D9SA 3SOWA 3HCTA 4GZCA 2LXPC 2V8SE 1A17A 2VSXE 3R7RA 4HOTA 3AS5A 2Y1NA 2PZIA 2YNQA 2HYZA 3B7UX 3I2DA 3NOCD 4DPRA 1HE8A 1MBMA 3X2QE 3UKRG 3BQOA 3IHVA 2XGOA 2H6GA 4OAVB 3O36A 4GTMA 1QYMA 3C3RA 4I9EA 3QARA 1E8XA 2BF0X 4JVSA 5B75A 3UKUG 1IKND 4ATGA 4V3LC 2HYED 3FEXA 1WIMA 4A4CA 2CKLA 3CLJA 4DI3A 4JXTA 5KH7A 2M3HA 2LAHA 4S3OC 1O1RA 2XEVA 4FJCA 3D9OA 3LDYA 1MQSA 5FQ4A 4B7YC 2CSYA 2RI7A 3R7QA 2LAUA 3AS8A 3C5KA 4M3OA 4R2YA 2BEDA 5EILA 2F6JA 4IYPA 4G2VA 3ZPJA 2R02A 3DPLR 1MJ0A 4TUMA 2XPZA 3ZHEB 4HORA 2BKKB 3KQIA 3LY9A 1LD8A 3O48A 1E7VA 2NAAA 3EHRA 4YBMA 4DX2A 3AG3E 3SFYA 3V79K 4WAFA 3ZYKA 1ZBPA 5M72A 4TUUA 4JZYA 2OEVA 4AVXA 3KSLA 4HFGA 5HI7A 2VJEA 2WQ7A 3PE4A 1TNZA 2IQCA 2X3MA 4OYSA 4J8FA 4URKA 1NA3A 5AARA 2KXPC 5CERB 4HRNA 3OXGA 2R05A 1E4UA 2EIJE 3Q73A 4N3AA 5T4YA 3SNXA 3BEEA 2IO2C 3TG5A 1JM7A 1H19A 2VGXA 3D9KA 3KS2A 3SO8A 3CVUA 3MHHA 4G8KA 3N9OA 4Y6WA 5B76A 2I50A 2WXQA 2L75A 4G8LA 3HXCA 2M6MA 4YADA 1Z2QA 2EA6A 3ABLE 3DWDA 2I2OA 4LSZE 2P9LG 2XCBA 2DZOA 3L22A 2FUIA 2MA5A 4B89A 4J8YA 3KSQA 1N0QA 3S7JA 3ASHA 2F37A 4HOUA 4X3GA 5AQ9A 1G3NB 3RPGC 2OWAA 3RO3A 1Z3XA 3HG0D 2CHWA 3TWXA 3CVNA 1PY1A 3C98A 2RFAA 3Q9NC 3HRAA 2LO6A 4B86C 1MHQA 4R7EA 3FTSA 4GNGA 4BSXA 2OV8A 4MRUA 4UWHA 1TN6A 1JWFA 3CQGB 3MJWA 2LV9A 1TNUA 4QF2A 3FTWA 2HM8A 1WEPA 1L5JA 3E34A 1E8ZA 4RSYA 3SI5A 3RRNB 4A3TA 4QQ4A 3MCXA 1S70B 3ESLA 3TXMA 2GRMA 2A4ZA 1ELWA 1DCQA 4IC2A 3BU8A 1HFAA 2MYOA 2QZAA 2CONA 2ECIA 4UUCA 3CHMA 3O47A 1YYHA 4TXRA 4CDMA 2DYRE 2XEHA 4H7XA 5BPPA 5J3XA 2F8YA 2KC7A 1QZ2A 1N0RA 3ZKJA 1O1SA 5KJKA 3E32A 1JCSA 3KNVA 4GCNA 4BFRA 3ZPVE 2KBXA 4KMOA 2JMJA 1H6OA 4RLYA 3ZRHA 2KGIA 5G05C
chains in the Genus database with same CATH topology
3WXXA 3FUHA 2XPYA 2E2EA 3LYAA 3Q15A 1X5BA 3PEUB 5G55A 2WXLA 4WA6A 1UJJA 1FP0A 2KWNA 2YU4A 4JHRA 2F42A 2YQMA 3FTYA 5TRBA 4F53A 3L11A 2XHEA 4G1TA 2VPEA 3CK7A 4GYYA 4B0ZA 2JMIA 5G2NA 3LCAA 2HR2A 4Q96A 4WZ0A 4ANUA 4XZ4A 2J4DA 3VK6A 4FHJA 3ZFWA 4JEHA 3FHEA 3FUKA 4XKBA 2P58C 4WZ2A 4GU5A 2WXHA 4NQ0A 1Z3YA 4CT4A 2KCKA 3QJZA 3FTUA 4UWGA 4PDXA 4EPZA 5FERA 2CFZA 3CVYA 4ANWA 4MLPA 4EBAG 2MUMA 3PUJA 1V87A 2HDPA 5AIJA 3LPZA 2YHEA 5CMYA 4TRQA 5G05J 2UZGA 2R17C 3SF4A 4AYCB 4CEMA 4B8CB 3LRQA 1HS6A 3T7LA 5A23A 1WESA 3RKVA 2ECGA 3VTXA 4JEUA 1WFKA 2Y4UA 4BY6A 2L0IA 2WXFA 3CVPA 2WM9A 1EPUA 2ZU6B 1VD4A 4OVUA 4WNDA 3PNLB 3N71A 4C9ZA 3I5PA 1KT0A 1X4UA 2HO1A 4WWPA 4EZJA 2LGLA 1Z6TA 3ZVVA 3MEKA 5D1LB 3O70A 1G25A 4CRWA 5JJ6A 2VSYA 5G0FA 3FEYA 5E75A 4AOFA 4HXIA 1OWLA 4WZ3B 3IBEA 5EKQD 2JMDA 1E8WA 2VJFB 4V3KC 2LSUA 3CV0A 2WXRA 2CG3A 4AM9A 3KAEA 4GMJA 3TXNA 4I1MA 3ZHEA 5T8IA 5KJMA 3FUIA 3U64A 3M63A 4ILIA 2MHKA 5JHAA 2KWJA 4I43A 4AJWA 2FO7A 1WEQA 2KFTA 3QB2A 2L80A 3APDA 5TABA 4AUQB 2G45A 2E6SA 1SZ9A 3PREA 3KEZA 4CDRA 3B7TA 1BPOA 5A7DB 2FBNA 4YC9A 5C2YA 4GMLA 1Z60A 4J8EA 3CHQA 4UI9B 5C11A 5KH9A 2PL2A 3NZSA 3GZSA 5FQ7A 3VLDA 1JPLA 4FC8A 2L5UA 1LF8A 5LFAA 3RRMB 3M99A 2K17A 4UQZA 3ZN3A 4ANVA 2X38A 1DVPA 3RRUA 5FQ6A 4HOSA 4UP0A 3APCA 4ZUXU 5A6CA 3L6AA 4XIFA 3MV2B 5G04C 4ABNA 2FULA 3FTXA 4J6IA 2XRZA 2KGGA 4GNFA 5H9MA 5BV0A 3MGBA 5FJYA 2OXQC 1ELRA 3VTYA 3ZYQA 3U66A 1B89A 5BW8C 2PM6A 4WWOA 2LN0A 3FU6A 4XE0A 2G6QA 3I3NA 3JQ1A 2LGVA 3OXFA 4QF3A 1NA0A 4YBSA 1FVFA 3URZA 3EIQC 4L2YA 2KR4A 1PC2A 3B7SA 2I6HA 5ARGA 3P1UA 3ZYMA 3SBTB 5FZSA 3CHPA 4FLBA 3APFA 2X6FA 2D8SA 5LCWC 2J9QA 3CHOA 3FUDA 4I6GA 3U5NA 5CMWA 2MRIA 2YURA 3IHPA 2E0IA 4KZCA 2CSZA 2IFUA 4BBQA 3C6WA 4JL0A 2K4DA 4S3OB 3HHMA 2JLBA 4AEZC 2KU3A 2UWJG 3SHFA 2VSNA 5KJNA 4FLHA 1H2UA 5G04J 3FDHA 1DNPA 3CEQA 3L1XA 3UT7A 2KZTA 3LVRE 1HYJA 2J4BA 3FUEA 5DKAA 5FB0A 2WB2A 1ELKA 5CHEE 4I7DA 2WPVA 2WVIA 3U9WA 2ECNA 2FEZA 2FI7A 3RTRB 4NN2A 5TDRA 4I6JA 3ZXSA 3ONKA 4DLQA 2QICA 1SQMA 2XEUA 3CHSA 4N3WA 4F3VA 5LCWJ 2AVPA 3LS8A 3U4TA 4UWFA 5FWQA 1KLXA 3LY8A 3G2TA 3HVEB 4DK5A 2DX8A 4U0ZA 2CG2A 3L17A 1U3DA 5CCLA 2OVFA 5BUZA 3PVLA 4NACA 3CSTA 3CKCA 3FTVA 4QFVA 4I17A 1FCHA 2PM7A 5AYWD 2GGFA 5E76A 4GB9A 4BTAA 1N52A 2YHOA 3GW4A 4CGWA 3FTZA 2M63A 2NXPA 1LDKC 2Q7FA 4N5CA 2L6JA 3PHDA 3SD5A 3RPGB 5D0QD 2FSAA 2VP7A 1WM5A 4HOQA 2IU1A 3ASDA 3ZW3A 4LADB 2YQ8A 4FADA 2H0DB 3PUKA 4TKPB 4CGVA 4YAXA 3NF1A 3ASFA 2AWIA 4KZ0A 2GW1A 4GYWA 3SHBA 3UUXA 3MZLB 4A1SA 2C2VS 3TAXA 5JHBA 4EZLA 2YYRA 4PTBA 3EJNA 4EBAA 1SZAA 4BHWA 3LQJA 5H1VA 2NC9A 2A5UA 3RJVA 1WEUA 5BT1A 3B7RL 3GZ2A 1MM2A 1S0PA 4K0RA 4Q94A 4UQXA 3LVQE 3RIBA 5EYAF 1H0AA 1XGWA 4LJNA 5DIZA 2YUCA 3FUFA 1IYGA 5DBKA 4AY6A 5B8DA 3R9AB 5G05B 3FP3A 4XI0A 3FUJA 5FEYA 3FH8A 2IOSA 3S7BA 2BAYA 1H6KA 1HYIA 3MKQB 3NG2A 4I2ZA 4XI1A 1Y6IA 3V43A 3L16A 3SOUA 2YHNA 4K03A 3K9IA 4KT6B 5KJLA 2VJEB 3TL5A 3U5MA 4LKAA 1N87A 4DI4A 1OWNA 2KREA 2M1RA 5KH3A 4PPEA 5I3LA 4EZKA 5AENA 2LXHC 2QY7A 4C0MA 3LQIA 3PEVB 5CCMA 1WEWA 5LP0A 2MT5A 1JM7B 2CHZA 1JUQA 3D9MA 5EDSA 4GA2A 1IQRA 2WXKA 2IF4A 3HYMB 4Y6CA 2NSZA 1F62A 4PS3A 2X6HA 4UWKA 3QWVA 2V4LA 5TDWA 4GYOA 4GZ3A 4A49A 3G2WA 4FP7A 4G11A 4D10C 3MKRA 4AY5A 2YSJA 2KM4A 2I9CA 4ILGA 1WEOA 2KCLA 2C0LA 4OVVA 3D3MA 3Q5MA 3CVVA 3L1ZB 3HCSA 1WEMA 3GYZA 1HZ4A 4O64A 2EGPA 2V5FA 2C2LA 2GRLA 4FJZA 1HXIA 4L58A 4J8DA 3EHMA 2YREA 5AITA 5D0OD 1E90A 1WY6A 3PNTB 4RG9A 2C0MA 4EECA 3UPVA 3D9JA 5J90A 2FF4A 4U0SA 2Y43A 4BX8A 5D1MB 3CVLA 3LDZA 4CDNA 4IULA 4JHJA 3QWPA 3S2AA 3S7DA 3OXLA 1EF1C 3B13A 4E85A 4L2LA 3SGHA 4UQYA 2ILRA 4A55A 5T3RA 1U6GB 3CVQA 3N9LA 3AS4A 3JQ0A 3ASLA 2AN6A 2KWKA 5FQ8A 4LCTA 4A0CD 3CVWA 1Z6UA 4ZQLA 2QFCA 3IHYA 2KYUA 4Q69A 2YSMA 4E6HA 2IONA 1N54A 4C0EA 2BTDA 4CCAA 3O37A 4J0UA 2E6RA 3MX3A 3M62A 3OAWA 4N39A 4DLOA 2JEKA 3D9NA 4G25A 2MA6A 4I1OB 2MD7B 4GA1A 3P2BA 2X6KA 3TGOA 5D1KB 4EQFA 1H2VC 3MHSA 3ZNIA 5DINA 4AXHA 2KIZA 3O35A 2R5SA 4J8SA 3SZ7A 2YT5A 1IQUA 4TV3A 4RG6A 3LJ3A 3EB6A 2CT2A 2K1JA 1RMDA 1IHGA 4LEUA 4ZDTA 1YA0A 3FUNA 4NRHB 3HVEA 2KCVA 3ZVZB 3IV0A 1FBVA 5FTPA 4L1BA 2XQ0A 3FH7A 4NURA 2VSOE 2XB1A 5G04B 3QOUA 2WXIA 3RU0A 4U07A 2PNXA 2YQLA 3G2VA 4I2WA 1HG2A 2L0BA 5FB1A 5LKZA 4YATA 4G26A 3QZVA 3O7AA 5BNWA 4CT0A 2VJ8A 3Q49B 3T6RA 3GV4A 5EX3A 4L23A 2OOEA 3FU0A 5J08A 5LCWB 2PQRA 4O6FA 5FT9A 4UI9J 5ANRA 3T5VA 4ACKA 2WQHA 4IRUA 4FJYA 4IC3A 1E8YA 3KV5A 3NZUA 3D9IA 3G2UA 2MD8C 4F52B 5B79A 4ILHB 1UG3A 1TJCA 1E96B 2PUYA 5LOZA 3CGHA 5B78A 4YBTA 2PQNA 1OWPA 4GAAA 4U8HA 1P5QA 3ZIMA 4C9BB 4N2QA 3SOXA 1X4JA 3MKQA 3LKUA 3FU3A 2AXZA 1EDUA 3IKOB 2VGYA 3FFLA 2QJ0A 4Q6FA 2LNIA 2VTBB 2OVBA 2UY1B 4LUNU 3RK6A 4FULA 4BTBA 2LDRA 4W9RA 3L54A 1QNFA 2F6NA 4FK5A 4P5OB 3N9MA 1TEZA 3L13A 2LGKA 2CFUA 4U63A 4LRZA 4YVOA 3CK9A 3ESKA 4ACLA 4DJAA 1INZA 3CKBA 2DBAA 5C1DA 4F7AA 4YNDA 3UMVA 3FULA 3ZYLA 3I4GA 1WILA 3PURA 3O33A 3RO2A 1HX8A 3CK8A 3G2SA 3TJPA 3DBSA 3KD7A 4I6EA 2XRYA 2WMOA 2VQ2A 1W3BA 4R7LA 3L08A 1OUVA 3UT4A 1QQEA 4AYCA 1X4IA 2RD0A 4HLEA 4WNGA 1NZNA 1KT1A 3FH5A 3KV6A 1WGMA 1ZU2A 1FVHA 1VYXA 2X6IA 4I1AA 2DIWA 4KBQA 4L7XA 2L43A 2AXVA 3HTKC 3ZPV1 4G24A 3DQVR 3AU4A 2CHXA 1CHCA 3OTNA 3ULQA 4PS7A 4B94A 4A1GA 4GZ5A 1WEVA 1HH8A 5EX0A 3MV3B 1WEEA 2Y4TA 3QK0A 1TJFA 1U3CA 2WXOA 2EQXA 3D9PA 3T8MA 5AJDA 3IEGA 4PS8A 2CKLB 3N9PA 4N4FA 4UWLA 2MIQA 2MNZA 3EIJA 3T5XA 3ZEFA 4AP4A 2LSVA 3UT8A 2ECVA 3QKYA 3MA5A 2KE1A 4JHKA 4BT8A 5H1UA 4YVQC 3LXUX 3VLFA 3BG0B 2VJFA 3ML9A 4JPSA 2YHCA 4JC8A 4RVBA 3JUIA 4F1SA 4I9CA 2X6JA 4KVOA 1VFYA 5ENNA 4GA0A 2KZTB 4HVBA 1LDJB 2XPIA 4LK9A 3BG1B 3ZVYA 1EYHA 1ZBDB 2WMNA 2JRJA 2BUGA 4KVMA 2ECWA 3UX4A 2ECJA 4N3CA 1WENA 3U5PA 3FUMA 2J09A 5LKUA 2LAIA 3CVXA 5AIUA 3JCKC 3N9QA 2YW8A 3CQCB 5JJ7A 1IYMA 5KCMA 2VGXB 4H7YA 1UW4B 4B8AA 4GPKA 3CIAA 2MNYA 4FA6A 4U0UA 4I7CA 4AIFA 2Y3AA 3LEWA 3PS6A 3TG4A 5TBNA 1WE9A 3MYVA 1OWOA 5LKTA 5ANLA 2L9BA 1E7UA 1UN8A 2FUUA 2DCPA 4HS2A 4ME2A 2Y1MA 2WXMA 2G43A 2VYIA 5JJTA 3S7FA 1JWGA 1JOCA 4FU3A 2QIZA 1HO8A 2IDAA 1OWMA 3CR3A 5JG6A 5LKXA 3ONLA 3CSFA 4R8PK 1PAQA 2VPGA 1UN9A 3ASGA 4MKTA 2ONDA 1T1HA 1HU3A 4N3BA 3PH0C 3FL2A 4BX9A 1HF8A 4JA9A 2WXJA 3CHRA 4WUYA 4MVTA 4GNEA 2VNFA 3D9LA 4U04A 1H2TC 3O4ZA 3FWVA 2VPBA 4BT9A 5B77A 2V0PA 2KATA 3N9NA 4UI9K 3LY7A 4CA1A 4XI9A 3HDXA 2R59A 4CCGX 3PUQA 3ZGQA 2J08A 3QDNA 2VPDA 2IJGX 3EB5A 4MSXA 2J07A 4N2SA 2AW6A 4PUCA 3HCUA 3O34A 5FZRA 4WNFA 1VDYA 2AXUA 4JA7A 3DPDA 4P29A 2K16A 4FHKA 4GCOA 2LGGA 2WXGA 5BV1A 2M85A 2I1JA 4APOA 1K2FA 2I1KA 4GB0A 4GNDA 3AU5A 2WXNA 4XKCA 3PE3A 2J49A 5HQ8A 3QAQA 2ZETC 2EODA 2IOLA 1NP7A 2RSDA 3I4RB 2ECTA 4WNEA 1WAO1 3PRZA 1HG5A 3U3WA 4A4BA 4APFA 4WWNA 3LQHA 4JW1A 4PH4B 2XCCA 2VTBA 2UY1A 5H1TA 4IN3B 1BORA 4LLBA 4W4UA 3HIZA 3U5OA 4UI9C 4I7BA 3GZ1A 5LX8A 5FZQA 2YINA 3NQPA 3SFZA 2LQ6A 3GL6A 3Q4AB 2WQ6A 1Y8MA 3FY4A 1MM3A 4AP2A 4KXKB 3EDTB 3EHNA 4XX5A 2MOWA 5AJLA 1UJKA 4MS6A 2WXPA 4A3VA 3FU5A 3PZDA 4ANXA 1XWHA 4GZDA 4FIPA 4L7TA 3E4BA 1XNFA 4AV7A 3QWWA 3VLEA 3QNKA 3Q47B 2KWOA 2L0TB 5ARFA 3SBSA 4UP5A 4V3IA 5C13A 2LRIC 3ML8A 3UQ3A 4LERA 4FO9A 4GZ6A 2H0DA 4YABA 4KYOB 1GW6A 3ZTGA 2XGSA 4G23A 3QC1A 2RG8A 3JYSA 3ENEA 3PDNA 2XGMA 4BWRA 3SOWA 3HCTA 4GZCA 2LXPC 2V8SE 1A17A 2VSXE 3R7RA 4HOTA 3AS5A 2Y1NA 2PZIA 2YNQA 2HYZA 3B7UX 3I2DA 4DPRA 1HE8A 3IHVA 2XGOA 3O36A 4I9EA 3QARA 1E8XA 2BF0X 4JVSA 5B75A 4ATGA 4V3LC 2HYED 3FEXA 1WIMA 4A4CA 2CKLA 3CLJA 4DI3A 4JXTA 5KH7A 2M3HA 2LAHA 4S3OC 2XEVA 4FJCA 3D9OA 1MQSA 5FQ4A 4B7YC 2CSYA 2RI7A 3R7QA 3AS8A 3C5KA 4M3OA 4R2YA 2F6JA 4IYPA 4G2VA 3ZPJA 3DPLR 2XPZA 3ZHEB 4HORA 3KQIA 3LY9A 3O48A 1E7VA 2NAAA 4YBMA 4WAFA 3ZYKA 1ZBPA 5M72A 4TUUA 4JZYA 4AVXA 4HFGA 5HI7A 2VJEA 2WQ7A 3PE4A 2IQCA 2X3MA 4OYSA 4J8FA 4URKA 1NA3A 3OXGA 1E4UA 4N3AA 5T4YA 3SNXA 3BEEA 3TG5A 1JM7A 1H19A 2VGXA 3D9KA 3KS2A 3CVUA 3MHHA 3N9OA 4Y6WA 5B76A 2I50A 2WXQA 2L75A 2M6MA 4YADA 1Z2QA 2EA6A 2I2OA 2XCBA 3L22A 2FUIA 2MA5A 4B89A 3S7JA 3ASHA 4HOUA 4X3GA 3RPGC 3RO3A 1Z3XA 2CHWA 3CVNA 1PY1A 3C98A 4B86C 2LO6A 1MHQA 4R7EA 3FTSA 4GNGA 4BSXA 2OV8A 4MRUA 4UWHA 3MJWA 1JWFA 3CQGB 2LV9A 4QF2A 3FTWA 2HM8A 1WEPA 1L5JA 1E8ZA 4RSYA 3SI5A 3RRNB 4A3TA 3MCXA 3ESLA 3TXMA 2GRMA 2A4ZA 1ELWA 4IC2A 1HFAA 2ECIA 3CHMA 4CDMA 4H7XA 5BPPA 5J3XA 2KC7A 1QZ2A 5KJKA 3KNVA 4GCNA 4BFRA 3ZPVE 4KMOA 2JMJA 3ZRHA 2KGIA 5G05C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTR B;  4NN2 A;  2VPB A;  5TDR A;  5B77 A;  2XB1 A;  5G04 B;  3N9N A;  1X5B A;  3ONK A;  2QIC A;  2XEU A;  4CA1 A;  2YQL A;  2PNX A;  4CCG X;  4N3W A;  3PUQ A;  3G2V A;  1HG2 A;  2L0B A;  2VPD A;  4WA6 A;  5FB1 A;  1UJJ A;  1FP0 A;  5LKZ A;  2KWN A;  2YU4 A;  2F42 A;  4YAT A;  2YQM A;  3EB5 A;  4MSX A;  5TRB A;  3G2T A;  3QZV A;  3O7A A;  2DX8 A;  3HCU A;  3O34 A;  3L11 A;  2VPE A;  4NAC A;  1VDY A;  2JMI A;  2K16 A;  4Q96 A;  2LGG A;  4WZ0 A;  3T6R A;  3GV4 A;  2YHO A;  2M85 A;  1K2F A;  3VK6 A;  1LDK C;  4GB0 A;  4GND A;  5J08 A;  5LCW B;  3PHD A;  3RPG B;  2FSA A;  2VP7 A;  4WZ2 A;  2ZET C;  4LAD B;  2EOD A;  2H0D B;  4TKP B;  4YAX A;  2RSD A;  2ECT A;  4IC3 A;  3KV5 A;  1HG5 A;  3D9I A;  3G2U A;  4A4B A;  5FER A;  3LQH A;  2MD8 C;  4F52 B;  5B79 A;  2MUM A;  3SHB A;  5H1T A;  1V87 A;  2PUY A;  5LOZ A;  2HDP A;  5B78 A;  1BOR A;  5CMY A;  4LLB A;  4YBT A;  2C2V S;  4W4U A;  3U5O A;  2UZG A;  4I7B A;  2YYR A;  4AYC B;  4PTB A;  1SZA A;  4BHW A;  3LQJ A;  5H1V A;  2LQ6 A;  3GL6 A;  3SOX A;  1X4J A;  3LRQ A;  1WEU A;  3T7L A;  1MM2 A;  1WES A;  1EDU A;  4Q94 A;  1MM3 A;  2ECG A;  2QJ0 A;  4Q6F A;  5EYA F;  1H0A A;  1XGW A;  2MOW A;  1WFK A;  1UJK A;  2L0I A;  4LJN A;  2YUC A;  2LDR A;  1XWH A;  4GZD A;  4FIP A;  1VD4 A;  5B8D A;  2KWO A;  2F6N A;  4FK5 A;  4P5O B;  2L0T B;  5G05 B;  3N9M A;  4C9Z A;  5FEY A;  4UP5 A;  5C13 A;  1X4U A;  2LGK A;  2BAY A;  1HYI A;  2LRI C;  3NG2 A;  4XI1 A;  2LGL A;  4FO9 A;  1INZ A;  3V43 A;  2H0D A;  4YAB A;  3ZTG A;  5D1L B;  3O70 A;  3SOU A;  1G25 A;  5G0F A;  2YHN A;  3ZYL A;  1WIL A;  3PUR A;  3O33 A;  2VJE B;  3U5M A;  3SOW A;  3HCT A;  1HX8 A;  4GZC A;  2V8S E;  2LXP C;  4LKA A;  1N87 A;  2KRE A;  2M1R A;  5KH3 A;  4PPE A;  5I3L A;  3G2S A;  2Y1N A;  4WZ3 B;  3I2D A;  2LXH C;  2QY7 A;  2JMD A;  3LQI A;  1WEW A;  5LP0 A;  2VJF B;  2MT5 A;  4V3K C;  4AYC A;  3O36 A;  1JM7 B;  1X4I A;  1JUQ A;  2BF0 X;  5B75 A;  3D9M A;  3KV6 A;  4V3L C;  3M63 A;  1WGM A;  2HYE D;  1WIM A;  2KWJ A;  1VYX A;  2DIW A;  4L7X A;  2L43 A;  1WEQ A;  2KFT A;  4A4C A;  2CKL A;  3CLJ A;  3HTK C;  3ZPV 1;  1F62 A;  4JXT A;  5KH7 A;  2M3H A;  4S3O C;  3DQV R;  5TDW A;  2L80 A;  4FJC A;  1CHC A;  5TAB A;  3D9O A;  4AUQ B;  4A49 A;  3G2W A;  2G45 A;  1SZ9 A;  2E6S A;  4B7Y C;  2CSY A;  2RI7 A;  1WEV A;  2YSJ A;  2KM4 A;  3C5K A;  1WEE A;  4R2Y A;  4YC9 A;  2F6J A;  1WEO A;  3DPL R;  1Z60 A;  3KQI A;  3L1Z B;  4UI9 B;  5C11 A;  5KH9 A;  2NAA A;  3D9P A;  3HCS A;  1WEM A;  4YBM A;  1JPL A;  2L5U A;  1LF8 A;  4O64 A;  2EGP A;  2C2L A;  3ZYK A;  3M99 A;  2CKL B;  3N9P A;  2K17 A;  4N4F A;  4L58 A;  4AVX A;  2MIQ A;  2MNZ A;  2YRE A;  1DVP A;  3RRU A;  4HFG A;  2VJE A;  5AIT A;  4UP0 A;  4AP4 A;  4ZUX U;  2ECV A;  2KE1 A;  1E4U A;  5H1U A;  3D9J A;  2KGG A;  4GNF A;  5H9M A;  2VJF A;  2Y43 A;  5D1M B;  1JM7 A;  2OXQ C;  3LDZ A;  3ZYQ A;  3D9K A;  3MHH A;  1VFY A;  3N9O A;  1LDJ B;  5B76 A;  4LK9 A;  2I50 A;  2LN0 A;  3ZVY A;  2L75 A;  1EYH A;  1ZBD B;  2JRJ A;  2G6Q A;  2M6M A;  2LGV A;  4YAD A;  2ECW A;  1Z2Q A;  2EA6 A;  4QF3 A;  4YBS A;  2ECJ A;  1WEN A;  3U5P A;  1U6G B;  2KR4 A;  2FUI A;  5LKU A;  2MA5 A;  5AIU A;  3ZYM A;  3N9Q A;  3N9L A;  2YW8 A;  3ASL A;  1IYM A;  2AN6 A;  2KWK A;  4FLB A;  4X3G A;  2D8S A;  4A0C D;  3RPG C;  1Z6U A;  4ZQL A;  3U5N A;  2MNY A;  4I7C A;  2KYU A;  2YSM A;  5CMW A;  2YUR A;  1PY1 A;  5TBN A;  1WE9 A;  3O37 A;  4B86 C;  2LO6 A;  3IHP A;  2E6R A;  1MHQ A;  5LKT A;  2CSZ A;  3M62 A;  4R7E A;  4BBQ A;  4GNG A;  3C6W A;  2FUU A;  2DCP A;  1JWF A;  3D9N A;  2LV9 A;  2MA6 A;  4QF2 A;  2Y1M A;  2G43 A;  1WEP A;  2MD7 B;  2K4D A;  4S3O B;  1JWG A;  1JOC A;  4FU3 A;  2KU3 A;  5D1K B;  2QIZ A;  2IDA A;  3MHS A;  3ZNI A;  5DIN A;  2KIZ A;  3O35 A;  4IC2 A;  5JG6 A;  5LKX A;  3ONL A;  2YT5 A;  4R8P K;  3L1X A;  1HFA A;  2VPG A;  2ECI A;  1HYJ A;  1T1H A;  3FL2 A;  3EB6 A;  2CT2 A;  2K1J A;  1RMD A;  5DKA A;  1HF8 A;  4ZDT A;  5J3X A;  5FB0 A;  3ZVZ B;  1ELK A;  4I7D A;  1FBV A;  3KNV A;  4MVT A;  4GNE A;  2VNF A;  3ZPV E;  3D9L A;  2JMJ A;  2ECN A;  2KGI A; 
#chains in the Genus database with same CATH topology
 3WXX A;  3FUH A;  2XPY A;  2E2E A;  3LYA A;  3Q15 A;  3V2O A;  1X5B A;  4K5B A;  3PEU B;  5G55 A;  3ZU7 B;  2WXL A;  4WA6 A;  1UJJ A;  1FP0 A;  2KWN A;  2YU4 A;  4H9D A;  4JHR A;  2F42 A;  2YQM A;  3FTY A;  5TRB A;  1OCO E;  4F53 A;  3L11 A;  2XHE A;  5SVY A;  4G1T A;  2KKY A;  2VPE A;  3CK7 A;  4GYY A;  4B0Z A;  2JMI A;  5G2N A;  3LCA A;  3R9M A;  2HR2 A;  4Q96 A;  4WZ0 A;  4ANU A;  4XZ4 A;  2J4D A;  1N4R A;  3VK6 A;  4FHJ A;  3ZFW A;  4JEH A;  3FHE A;  3FUK A;  4XKB A;  2P58 C;  3Q9U C;  4WZ2 A;  4GU5 A;  2WXH A;  4NQ0 A;  2Y69 E;  1Z3Y A;  4CT4 A;  2EIK E;  3KEA A;  2KCK A;  3QJZ A;  3FTU A;  3UTM A;  1N94 A;  4UWG A;  4PDX A;  4EPZ A;  1U2V G;  5FER A;  2CFZ A;  3CVY A;  4ANW A;  4MLP A;  4LNU D;  4EBA G;  4L9P A;  2P9N G;  2MUM A;  3SFX A;  3PUJ A;  1V87 A;  2V4H C;  2HDP A;  5AIJ A;  3LPZ A;  2YHE A;  5CMY A;  4TRQ A;  2ZIS A;  5G05 J;  3DDT A;  2UZG A;  2R17 C;  3SF4 A;  4AYC B;  4CEM A;  4B8C B;  3LRQ A;  1HS6 A;  3T7L A;  3E37 A;  3UIP C;  5A23 A;  1WES A;  3RKV A;  2ECG A;  4TXP A;  2XEE A;  3VTX A;  3ZXP A;  1O1T A;  3DRA A;  4JEU A;  3V31 A;  1WFK A;  2Y4U A;  4BY6 A;  2L0I A;  2WXF A;  4OGC A;  3CVP A;  2WM9 A;  1EPU A;  2ZU6 B;  1VD4 A;  4OVU A;  4WND A;  3PNL B;  3N71 A;  3RAU A;  1SA4 A;  4C9Z A;  4A63 B;  4YDW A;  1N11 A;  3I5P A;  3ULE G;  1KT0 A;  1X4U A;  2HO1 A;  4WWP A;  5EYL A;  4EZJ A;  2LGL A;  1Z6T A;  1BI7 B;  3ZVV A;  3MEK A;  5D1L B;  3O70 A;  1G25 A;  4CRW A;  5JJ6 A;  2RKK A;  2VSY A;  5G0F A;  3FEY A;  1TNO A;  5E75 A;  4AOF A;  2XOY A;  5CBO A;  4HXI A;  1OWL A;  4HNA D;  4WZ3 B;  3IBE A;  3PZ4 A;  5EKQ D;  2JMD A;  1E8W A;  2VJF B;  4V3K C;  2LSU A;  3CV0 A;  2WXR A;  2CG3 A;  4AM9 A;  3KAE A;  4GMR A;  4GMJ A;  1O5M A;  4I1M A;  3TXN A;  3ZHE A;  5T8I A;  5KJM A;  3FUI A;  1OY3 D;  3U64 A;  3M63 A;  4ILI A;  2MHK A;  2CSV A;  5JHA A;  2KWJ A;  4Z68 A;  4I43 A;  2VGE A;  4AJW A;  2F8X K;  2FO7 A;  1WEQ A;  2KFT A;  3QB2 A;  3NB2 A;  2L80 A;  3HXE A;  3APD A;  5TAB A;  4AUQ B;  2G45 A;  1SZ9 A;  2E6S A;  3PRE A;  3KEZ A;  4CDR A;  3B7T A;  1BPO A;  1SW6 A;  5A7D B;  2FBN A;  4YC9 A;  5C2Y A;  4GML A;  1Z60 A;  4J8E A;  3CHQ A;  4UI9 B;  5C11 A;  5KH9 A;  2PL2 A;  3NZS A;  2QYU A;  3GZS A;  5FQ7 A;  3VLD A;  1JPL A;  4FC8 A;  2L5U A;  1LF8 A;  5LFA A;  3RRM B;  3M99 A;  4B93 B;  2K17 A;  4UQZ A;  3ZN3 A;  4ANV A;  2X38 A;  1DVP A;  3RRU A;  1MX4 A;  2OEW A;  4DX1 A;  5FQ6 A;  4HOS A;  3TWQ A;  4UP0 A;  3APC A;  4ZUX U;  1TN8 A;  5A6C A;  2P9I G;  3JUE A;  3L6A A;  4XIF A;  3MV2 B;  1N4P A;  5G04 C;  4U96 D;  4ABN A;  2FUL A;  3FTX A;  4J6I A;  2XRZ A;  2KGG A;  4GNF A;  5H9M A;  5BV0 A;  5CEC B;  4JD2 G;  3PZ1 A;  3MGB A;  1JCQ A;  5FJY A;  2OXQ C;  1ELR A;  3VTY A;  3ZYQ A;  3U66 A;  3AG4 E;  3B95 A;  1B89 A;  5AQ7 A;  5BW8 C;  2PM6 A;  4WWO A;  2LN0 A;  3FU6 A;  2XZT G;  4XE0 A;  3DSV A;  2G6Q A;  3I3N A;  2NYJ A;  3JQ1 A;  2LGV A;  3OXF A;  4QF3 A;  1NA0 A;  4YBS A;  1WG0 A;  1FVF A;  3URZ A;  3ZUV B;  3EIQ C;  4L2Y A;  2KR4 A;  1PC2 A;  3B7S A;  2I6H A;  2ZGD A;  5ARG A;  2DWZ A;  3P1U A;  1FPP A;  3ZYM A;  3SBT B;  1TYQ G;  3DEO A;  5FZS A;  3CHP A;  3W9G A;  4FLB A;  3APF A;  2X6F A;  2D8S A;  5LCW C;  2J9Q A;  3CHO A;  3FUD A;  4I6G A;  1DCE A;  3U5N A;  5CMW A;  2MRI A;  2YUR A;  2ZGG A;  4O60 A;  3IHP A;  2E0I A;  4KZC A;  2CSZ A;  2IFU A;  4BBQ A;  3C6W A;  4JL0 A;  2FFW A;  3ABK E;  2EGM A;  2K4D A;  4S3O B;  3HHM A;  2JLB A;  4ZFH A;  4AEZ C;  2KU3 A;  2UWJ G;  2GRN B;  2B6C A;  3SHF A;  2VSN A;  5KJN A;  2LXM A;  4U8V D;  4FLH A;  1H2U A;  5G04 J;  3FDH A;  1DNP A;  3CEQ A;  4ZHB A;  3L1X A;  3UT7 A;  2KZT A;  3LVR E;  2E61 A;  4OGE A;  4ATZ D;  1HYJ A;  1LD7 A;  2J4B A;  2QYJ A;  3FUE A;  3Q7F A;  5DKA A;  5FB0 A;  2P9P G;  2WB2 A;  1ELK A;  5CHE E;  4I7D A;  2WPV A;  2WVI A;  3FJU B;  3U9W A;  2ECN A;  2FEZ A;  2FI7 A;  3RTR B;  4NN2 A;  3NOG D;  5TDR A;  4I6J A;  4BSZ B;  3ZXS A;  3ONK A;  4DLQ A;  2QIC A;  1SQM A;  2XEU A;  3UM1 A;  3M7K A;  3CHS A;  1N9A A;  2ZIR A;  4N3W A;  2QC9 A;  4F3V A;  5LCW J;  3NBN B;  2AVP A;  2DZN A;  3LS8 A;  5FIN A;  3U4T A;  5HRY A;  3ZNG A;  4UWF A;  1MYO A;  5FWQ A;  1TR4 A;  5CED B;  1KLX A;  3LY8 A;  3G2T A;  3HVE B;  4DK5 A;  2XS1 A;  2DX8 A;  2J8S D;  4U0Z A;  2CG2 A;  3L17 A;  1U3D A;  5CCL A;  2OVF A;  5BUZ A;  3PVL A;  4NAC A;  3CST A;  3CKC A;  3FTV A;  4QFV A;  4I17 A;  3DWL G;  5EID A;  1FCH A;  2PM7 A;  5AYW D;  2GGF A;  5E76 A;  4GB9 A;  4BTA A;  1N52 A;  2BKG A;  2YHO A;  3GW4 A;  4CGW A;  3FTZ A;  2L7P A;  2M63 A;  2HE0 A;  2NXP A;  1LDK C;  5B3S E;  2Q7F A;  4N5C A;  5FIO A;  2L6J A;  2GRQ B;  3PHD A;  3SD5 A;  3RPG B;  5D0Q D;  2FSA A;  2VP7 A;  1WM5 A;  4HOQ A;  2IU1 A;  3ASD A;  1TNY A;  3ZW3 A;  4LAD B;  2YQ8 A;  4FAD A;  2H0D B;  3PUK A;  4TKP B;  3TWS A;  4CGV A;  4YAX A;  3NF1 A;  1S63 A;  1OCR E;  4TXQ A;  3ASF A;  2AWI A;  1OXJ A;  1D8E A;  4KZ0 A;  2GW1 A;  4GYW A;  1N4S A;  3SHB A;  3Q7A A;  3UUX A;  4CYM D;  3MZL B;  4A1S A;  2C2V S;  3TAX A;  5JHB A;  4EZL A;  2YYR A;  3SY2 A;  4PTB A;  3EJN A;  4EBA A;  1SZA A;  3EHQ A;  4BHW A;  3LQJ A;  5H1V A;  2NC9 A;  2A5U A;  3RJV A;  1WEU A;  4O1P A;  5BT1 A;  3B7R L;  3GZ2 A;  1MM2 A;  1S0P A;  4K0R A;  4Q94 A;  4UQX A;  3LVQ E;  3RIB A;  3SUB A;  5EYA F;  1H0A A;  1XGW A;  4LJN A;  5DIZ A;  2YUC A;  3FUF A;  1NL4 A;  1IYG A;  5DBK A;  4AY6 A;  5B8D A;  1AWC B;  3R9A B;  1SA5 A;  4BET A;  3FP3 A;  5G05 B;  4XI0 A;  3FUJ A;  3ABM E;  5FEY A;  5EYP F;  3FH8 A;  4HRM B;  2IOS A;  3S7B A;  1AP7 A;  1H6K A;  2BAY A;  1HYI A;  3MKQ B;  3NG2 A;  4I2Z A;  4XI1 A;  1Y6I A;  3V43 A;  1FT2 A;  3L16 A;  4HLL A;  3SOU A;  4DX6 D;  5JA4 D;  1D8D A;  1K3Z D;  2YHN A;  4K03 A;  4N5Q A;  3V30 A;  3K9I A;  4KT6 B;  4HB5 A;  2F0Y A;  4C48 B;  5KJL A;  2VJE B;  3TL5 A;  3D9H A;  3U5M A;  2D8U A;  4DX7 D;  4LKA A;  1N87 A;  4DI4 A;  1OWN A;  2KRE A;  2M1R A;  5KH3 A;  4PPE A;  5I3L A;  1MZC A;  5ENQ D;  4EZK A;  5AEN A;  3AJI A;  2LXH C;  4LNB A;  2QY7 A;  4C0M A;  1MX2 A;  3HXD A;  3LQI A;  3PEV B;  5CCM A;  1WEW A;  5LP0 A;  2MT5 A;  3W9F A;  2IQJ A;  1JM7 B;  2CHZ A;  1JUQ A;  3D9M A;  2GRO B;  3DST A;  1K8K G;  5EDS A;  4GA2 A;  1IQR A;  2WXK A;  2IF4 A;  3HYM B;  3RSE G;  4Y6C A;  2A5E A;  2NSZ A;  5B1A E;  1F62 A;  4PS3 A;  2X6H A;  4UWK A;  3QWV A;  2V4L A;  2FO1 E;  5TDW A;  4GYO A;  4GZ3 A;  2P57 A;  4A49 A;  3G2W A;  4FP7 A;  4G11 A;  4D10 C;  3MKR A;  3FEH A;  4AY5 A;  2YSJ A;  4BES A;  2KM4 A;  2I9C A;  2P2C P;  4ILG A;  1WEO A;  3FAO A;  2KCL A;  1YCS B;  2C0L A;  4OVV A;  3D3M A;  3Q5M A;  3CVV A;  3L1Z B;  3HCS A;  1BLX B;  1WEM A;  3GYZ A;  1HZ4 A;  4XEI G;  4O64 A;  2EGP A;  2V5F A;  2C2L A;  4GTV A;  2GRL A;  4FJZ A;  1HXI A;  4L58 A;  4J8D A;  1OCZ E;  3EHM A;  2YRE A;  5AIT A;  5D0O D;  1E90 A;  1WY6 A;  3PNT B;  4RG9 A;  2C0M A;  4EEC A;  2DJA A;  3UPV A;  4LG6 A;  3D9J A;  5J90 A;  2FF4 A;  4U0S A;  2Y43 A;  4BX8 A;  5SVX A;  5D1M B;  5EN5 D;  3CVL A;  3LDZ A;  5ITZ F;  4CDN A;  4IUL A;  4JHJ A;  3QWP A;  3Q78 A;  3S7D A;  3S2A A;  3OXL A;  2GRP B;  5B1B E;  1EF1 C;  2AJA A;  3B13 A;  4E85 A;  4L2L A;  3SGH A;  4UQY A;  3H7H A;  3MDB C;  3E33 A;  2ILR A;  4A55 A;  1UOH A;  5KNG A;  5T3R A;  1U6G B;  5KNH D;  2Y1L E;  2JM3 A;  3CVQ A;  3N9L A;  3AS4 A;  3JQ0 A;  3ASL A;  2AN6 A;  1NI1 A;  2KWK A;  4X8Q A;  5FQ8 A;  3E2D A;  4LCT A;  3TWT A;  4A0C D;  3CVW A;  1Z6U A;  4ZQL A;  2QFC A;  3IHY A;  2KYU A;  4Q69 A;  2YSM A;  1KPS B;  4E6H A;  2ION A;  1N54 A;  4C0E A;  2BTD A;  4BER A;  4CCA A;  3O37 A;  4J0U A;  2E6R A;  3MX3 A;  3M62 A;  3AG2 E;  3OAW A;  5K3Q A;  4N39 A;  1K1A A;  4DLO A;  2EIL E;  2JEK A;  3JXJ A;  3D9N A;  2ZXW E;  4G25 A;  2MA6 A;  3LJN A;  4I1O B;  2MD7 B;  4GA1 A;  3P2B A;  3UIO C;  2X6K A;  3TGO A;  3J5P A;  5ENT D;  5D1K B;  4EQF A;  1DC2 A;  1H2V C;  4U95 D;  2YVR A;  3MHS A;  3ZNI A;  5DIN A;  4AXH A;  2KIZ A;  1IXV A;  3O35 A;  3LJU X;  2R5S A;  4J8S A;  5D66 A;  2EXU A;  3NAW A;  3SZ7 A;  1LTX A;  2YT5 A;  4GTO A;  1IQU A;  4DX5 D;  4TV3 A;  4RG6 A;  3LJ3 A;  3EB6 A;  4GTQ A;  2CT2 A;  1RMD A;  1IHG A;  2K1J A;  4LEU A;  5SVI B;  2KKX A;  4ZDT A;  1YA0 A;  5CEA A;  3FUN A;  4NRH B;  3HVE A;  2KCV A;  3ZVZ B;  2H6I A;  3IV0 A;  1NFI E;  4BEP A;  1FBV A;  2LUH A;  5FTP A;  3L82 A;  1MX6 A;  1YMP A;  4L1B A;  2XQ0 A;  3EU5 A;  3UM2 A;  3FH7 A;  4NUR A;  5CRV A;  3KDE C;  2VSO E;  2XB1 A;  5G04 B;  3TWR A;  3QOU A;  4JB8 P;  2WXI A;  3RU0 A;  4U07 A;  2PNX A;  2YQL A;  4YDY A;  3G2V A;  4I2W A;  1HG2 A;  2L0B A;  5FB1 A;  2XZD G;  5LKZ A;  3C3O A;  1FT1 A;  2XP0 A;  4CZ2 D;  4YAT A;  4G26 A;  5AQA A;  3QZV A;  3O7A A;  2EIM E;  5JMN D;  1IHB A;  4GTR A;  5BNW A;  4CT0 A;  4RQI A;  2VJ8 A;  3Q49 B;  4F1P A;  3T6R A;  3GV4 A;  5EX3 A;  4J7W A;  4L23 A;  2OOE A;  5D2M C;  5CBN A;  3FU0 A;  5J08 A;  5LCW B;  1A5E A;  2PQR A;  4O6F A;  5FT9 A;  4UI9 J;  5BXU A;  2R03 A;  5ANR A;  3T5V A;  4ACK A;  2WQH A;  2P9U G;  4IRU A;  4FJY A;  4IC3 A;  1E8Y A;  3KV5 A;  5IY5 E;  3NZU A;  3D9I A;  3G2U A;  2MD8 C;  2DSM A;  4F52 B;  5B79 A;  4ILH B;  2ETB A;  1UG3 A;  1TJC A;  1E96 B;  2PUY A;  5LOZ A;  1BU9 A;  3CGH A;  5B78 A;  4YBT A;  2PQN A;  3FM8 C;  1OWP A;  1S64 A;  5ENR D;  4GAA A;  4U8H A;  1P5Q A;  3ZIM A;  1SVX A;  4C9B B;  4N2Q A;  3SOX A;  1X4J A;  3MKQ A;  3LKU A;  3UXG A;  3FU3 A;  2AXZ A;  1EDU A;  3IKO B;  2VGY A;  3FFL A;  3UM0 A;  2QJ0 A;  4Q6F A;  2LNI A;  4GTS A;  2VTB B;  2OVB A;  2UY1 B;  4LUN U;  3RK6 A;  4FUL A;  4BTB A;  2LDR A;  2RR4 A;  5HKP A;  4W9R A;  3L54 A;  1QNF A;  1KZP A;  2F6N A;  4FK5 A;  4P5O B;  3N9M A;  1TEZ A;  3L13 A;  3TWU A;  2EIN E;  2LGK A;  3DSS A;  2CFU A;  4HBD A;  4U63 A;  4HRL A;  4LRZ A;  4YVO A;  2JAB A;  3CK9 A;  3ESK A;  4ACL A;  4DJA A;  1INZ A;  3CKB A;  2DBA A;  4EHM A;  5AN8 A;  5C1D A;  4F7A A;  3DEP A;  4Z0R A;  4HI9 A;  2PNN A;  3SQV A;  4YND A;  3UMV A;  3FUL A;  3ZYL A;  3I4G A;  1WIL A;  3PUR A;  3O33 A;  1X81 A;  2JUN A;  3RO2 A;  1HX8 A;  3CK8 A;  3G2S A;  3TJP A;  1BI8 B;  3DBS A;  3KD7 A;  5AQB A;  4I6E A;  2XRY A;  4YDE A;  2WMO A;  2VQ2 A;  1W3B A;  4R7L A;  3L08 A;  1OUV A;  4YDO A;  1QQE A;  3UT4 A;  4AYC A;  1X4I A;  1ZB1 A;  2RD0 A;  4HLE A;  4WNG A;  2R2L A;  1NZN A;  1KT1 A;  3FH5 A;  3KV6 A;  3J5Q B;  2LXL A;  1WGM A;  1ZU2 A;  1FVH A;  4F6R D;  2X6I A;  4I1A A;  1VYX A;  2DIW A;  4KBQ A;  4L7X A;  2H6F A;  2L43 A;  2AXV A;  3HTK C;  3ZPV 1;  4G24 A;  3JXI A;  3DQV R;  3AU4 A;  2CHX A;  3UIN C;  1CHC A;  3OTN A;  4GPM A;  3ULQ A;  4PS7 A;  4B94 A;  4A1G A;  4GZ5 A;  1WEV A;  2B0O E;  1HH8 A;  4NIK A;  5EX0 A;  1Q2Z A;  3MV3 B;  1WEE A;  2Y4T A;  3QK0 A;  3F6Q A;  2XEN A;  1TJF A;  1U3C A;  2WXO A;  2FD4 A;  2EQX A;  3D9P A;  3T8M A;  5AJD A;  2MKE A;  3ASO E;  3IEG A;  4PS8 A;  4O62 A;  2CKL B;  4DUI A;  3N9P A;  2ETA A;  5EIB E;  4N4F A;  4UWL A;  2MIQ A;  2MNZ A;  3EIJ A;  3T5X A;  3ZEF A;  4AP4 A;  2LSV A;  3UT8 A;  1N4Q A;  2ECV A;  3QKY A;  3MA5 A;  2KE1 A;  4JHK A;  3ISM C;  4BT8 A;  3HXB A;  2XOC A;  5H1U A;  4YVQ C;  3LXU X;  3VLF A;  2CRW A;  3BG0 B;  4K5C A;  2IO3 C;  2VJF A;  3ML9 A;  4JPS A;  2YHC A;  4JC8 A;  4RVB A;  3JUI A;  4F1S A;  4I9C A;  2X6J A;  4KVO A;  1VFY A;  3IXE A;  5ENN A;  4GA0 A;  2KZT B;  4HVB A;  1LDJ B;  2XPI A;  3V2X A;  2DVW A;  5KBA A;  4LK9 A;  2L6B A;  3BG1 B;  3ZVY A;  3UM3 A;  1EYH A;  1ZBD B;  2WMN A;  2JRJ A;  2BUG A;  4KVM A;  2ECW A;  3DXK G;  3UX4 A;  2ECJ A;  4N3C A;  1TNB A;  1WEN A;  3U5P A;  3FUM A;  2J09 A;  5LKU A;  2LAI A;  4LNG A;  2Y0B G;  3CVX A;  5AIU A;  3JCK C;  3N9Q A;  2YW8 A;  3DSU A;  3CQC B;  5JJ7 A;  1IYM A;  5KCM A;  2VGX B;  1H6P A;  4H7Y A;  3FAN A;  3C72 A;  1UW4 B;  4B8A A;  3HXF A;  4GPK A;  3CIA A;  2MNY A;  4FA6 A;  4U0U A;  4I7C A;  4AIF A;  3Q75 A;  2Y3A A;  4O1O A;  3LEW A;  3PS6 A;  3TG4 A;  5TBN A;  1WE9 A;  3MYV A;  1OWO A;  5LKT A;  5ANL A;  2L9B A;  1E7U A;  1UN8 A;  2FUU A;  2DCP A;  5SVI A;  2OCC E;  2ETC A;  4HS2 A;  4ME2 A;  3UI2 A;  2Y1M A;  2WXM A;  2G43 A;  2VYI A;  5JJT A;  3S7F A;  1JWG A;  1JOC A;  4FU3 A;  1WDY A;  2QIZ A;  1HO8 A;  2IDA A;  1OWM A;  2DYS E;  3DXM G;  2P9S G;  5H7P A;  3CR3 A;  5HS0 A;  5JG6 A;  4Z0O A;  5LKX A;  3ONL A;  3CSF A;  4R8P K;  1PAQ A;  2VPG A;  3AG1 E;  1UN9 A;  3ASG A;  3T8K A;  4MKT A;  2OND A;  1T1H A;  1HU3 A;  4N3B A;  3PH0 C;  3FL2 A;  3WG7 E;  4BX9 A;  1HF8 A;  3ASN E;  4JA9 A;  1JCR A;  1V54 E;  2H6H A;  2WXJ A;  3PZ3 A;  3CHR A;  3T9K A;  4WUY A;  4MVT A;  4GNE A;  5CRU A;  2VNF A;  4HQD A;  3D9L A;  3L9T A;  4U04 A;  1H2T C;  3O4Z A;  3FWV A;  5BXO A;  2VPB A;  4BT9 A;  5B77 A;  2V0P A;  2KAT A;  3N9N A;  4UI9 K;  3LY7 A;  3PZ2 A;  4CA1 A;  4XI9 A;  3HDX A;  4M7C A;  2R59 A;  3ULY A;  4CCG X;  3C5R A;  3PUQ A;  1OT8 A;  3ZGQ A;  2J08 A;  3QDN A;  2VPD A;  2IJG X;  5ENO D;  5AAO A;  1QBQ A;  3EB5 A;  2J07 A;  4MSX A;  4N2S A;  2AW6 A;  4PUC A;  3HCU A;  3O34 A;  1KZO A;  2GRR B;  5FZR A;  4QQI A;  4WNF A;  1VDY A;  2AXU A;  4JA7 A;  3DPD A;  4P29 A;  4FHK A;  4GCO A;  2K16 A;  2LGG A;  2WXG A;  5BV1 A;  2M85 A;  2I1J A;  4APO A;  1K2F A;  3DSX A;  4HI8 A;  2I1K A;  2XOZ A;  4OAU C;  4GB0 A;  4GND A;  2IEJ A;  3AU5 A;  2WXN A;  4XKC A;  3PE3 A;  2CRR A;  2J49 A;  5HQ8 A;  2M13 A;  3QAQ A;  2ZET C;  1N95 A;  2EOD A;  3Q1D A;  2IOL A;  3Q79 A;  1NP7 A;  2RSD A;  3I4R B;  2ECT A;  1BD8 A;  3EUV A;  4WNE A;  1WAO 1;  3PRZ A;  3TWV A;  1HG5 A;  3U3W A;  4A4B A;  4APF A;  4WWN A;  3LQH A;  3TWW A;  4JW1 A;  4PH4 B;  2XCC A;  2VTB A;  2UY1 A;  5H1T A;  3B7B A;  4IN3 B;  3DSW A;  1Z5S C;  1BOR A;  4LLB A;  4W4U A;  3HIZ A;  3U5O A;  1RW2 A;  3E30 A;  4UI9 C;  3GZ1 A;  5LX8 A;  4I7B A;  5FZQ A;  2YIN A;  3NQP A;  3SFZ A;  2LQ6 A;  3GL6 A;  3Q4A B;  5ENP D;  2RFM A;  2XS8 A;  4U8Y D;  4GTT A;  2WQ6 A;  1Y8M A;  3FY4 A;  2P9K G;  1MM3 A;  4AP2 A;  4KXK B;  3EU9 A;  3EDT B;  3EHN A;  4XX5 A;  3DPY A;  4GTP A;  2MOW A;  4MBG A;  5AJL A;  1UJK A;  4MS6 A;  2WXP A;  4A3V A;  3FU5 A;  3PZD A;  4ANX A;  1XWH A;  1K1B A;  1OCC E;  4GZD A;  4FIP A;  4L7T A;  3E4B A;  1XNF A;  4AV7 A;  3QWW A;  3VLE A;  3QNK A;  4K5A B;  3Q47 B;  2KWO A;  2L0T B;  5ARF A;  3SBS A;  4UP5 A;  4V3I A;  5KWD A;  5C13 A;  4DRX E;  3PLW A;  1RZ4 A;  1V55 E;  2LRI C;  3ML8 A;  3UQ3 A;  4U7E B;  4LER A;  4FO9 A;  4GZ6 A;  2V5Q C;  2H0D A;  4YAB A;  4KYO B;  1GW6 A;  3ZTG A;  5ENS D;  3BUA A;  3C3Q A;  2XGS A;  3AAA C;  4G23 A;  3QC1 A;  2IY0 C;  1TN7 A;  2RG8 A;  3JYS A;  3ENE A;  3PDN A;  2XGM A;  4BWR A;  1D9S A;  3SOW A;  3HCT A;  4GZC A;  2LXP C;  2V8S E;  1A17 A;  2VSX E;  3R7R A;  4HOT A;  3AS5 A;  2Y1N A;  2PZI A;  2YNQ A;  2HYZ A;  3B7U X;  3I2D A;  3NOC D;  4DPR A;  1HE8 A;  1MBM A;  3X2Q E;  3UKR G;  3BQO A;  3IHV A;  2XGO A;  2H6G A;  4OAV B;  3O36 A;  4GTM A;  1QYM A;  3C3R A;  4I9E A;  3QAR A;  1E8X A;  2BF0 X;  4JVS A;  5B75 A;  3UKU G;  1IKN D;  4ATG A;  4V3L C;  2HYE D;  3FEX A;  1WIM A;  4A4C A;  2CKL A;  3CLJ A;  4DI3 A;  4JXT A;  5KH7 A;  2M3H A;  2LAH A;  4S3O C;  1O1R A;  2XEV A;  4FJC A;  3D9O A;  3LDY A;  1MQS A;  5FQ4 A;  4B7Y C;  2CSY A;  2RI7 A;  3R7Q A;  2LAU A;  3AS8 A;  3C5K A;  4M3O A;  4R2Y A;  2BED A;  5EIL A;  2F6J A;  4IYP A;  4G2V A;  3ZPJ A;  2R02 A;  3DPL R;  1MJ0 A;  4TUM A;  2XPZ A;  3ZHE B;  4HOR A;  2BKK B;  3KQI A;  3LY9 A;  1LD8 A;  3O48 A;  1E7V A;  2NAA A;  3EHR A;  4YBM A;  4DX2 A;  3AG3 E;  3SFY A;  3V79 K;  4WAF A;  3ZYK A;  1ZBP A;  5M72 A;  4TUU A;  4JZY A;  2OEV A;  4AVX A;  3KSL A;  4HFG A;  5HI7 A;  2VJE A;  2WQ7 A;  3PE4 A;  1TNZ A;  2IQC A;  2X3M A;  4OYS A;  4J8F A;  4URK A;  1NA3 A;  5AAR A;  2KXP C;  5CER B;  4HRN A;  3OXG A;  2R05 A;  1E4U A;  2EIJ E;  3Q73 A;  4N3A A;  5T4Y A;  3SNX A;  3BEE A;  2IO2 C;  3TG5 A;  1JM7 A;  1H19 A;  2VGX A;  3D9K A;  3KS2 A;  3SO8 A;  3CVU A;  3MHH A;  4G8K A;  3N9O A;  4Y6W A;  5B76 A;  2I50 A;  2WXQ A;  2L75 A;  4G8L A;  3HXC A;  2M6M A;  4YAD A;  1Z2Q A;  2EA6 A;  3ABL E;  3DWD A;  2I2O A;  4LSZ E;  2P9L G;  2XCB A;  2DZO A;  3L22 A;  2FUI A;  2MA5 A;  4B89 A;  4J8Y A;  3KSQ A;  1N0Q A;  3S7J A;  3ASH A;  2F37 A;  4HOU A;  4X3G A;  5AQ9 A;  1G3N B;  3RPG C;  2OWA A;  3RO3 A;  1Z3X A;  3HG0 D;  2CHW A;  3TWX A;  3CVN A;  1PY1 A;  3C98 A;  2RFA A;  3Q9N C;  3HRA A;  2LO6 A;  4B86 C;  1MHQ A;  4R7E A;  3FTS A;  4GNG A;  4BSX A;  2OV8 A;  4MRU A;  4UWH A;  1TN6 A;  1JWF A;  3CQG B;  3MJW A;  2LV9 A;  1TNU A;  4QF2 A;  3FTW A;  2HM8 A;  1WEP A;  1L5J A;  3E34 A;  1E8Z A;  4RSY A;  3SI5 A;  3RRN B;  4A3T A;  4QQ4 A;  3MCX A;  1S70 B;  3ESL A;  3TXM A;  2GRM A;  2A4Z A;  1ELW A;  1DCQ A;  4IC2 A;  3BU8 A;  1HFA A;  2MYO A;  2QZA A;  2CON A;  2ECI A;  4UUC A;  3CHM A;  3O47 A;  1YYH A;  4TXR A;  4CDM A;  2DYR E;  2XEH A;  4H7X A;  5BPP A;  5J3X A;  2F8Y A;  2KC7 A;  1QZ2 A;  1N0R A;  3ZKJ A;  1O1S A;  5KJK A;  3E32 A;  1JCS A;  3KNV A;  4GCN A;  4BFR A;  3ZPV E;  2KBX A;  4KMO A;  2JMJ A;  1H6O A;  4RLY A;  3ZRH A;  2KGI A;  5G05 C; 
#chains in the Genus database with same CATH homology
 3WXX A;  3FUH A;  2XPY A;  2E2E A;  3LYA A;  3Q15 A;  1X5B A;  3PEU B;  5G55 A;  2WXL A;  4WA6 A;  1UJJ A;  1FP0 A;  2KWN A;  2YU4 A;  4JHR A;  2F42 A;  2YQM A;  3FTY A;  5TRB A;  4F53 A;  3L11 A;  2XHE A;  4G1T A;  2VPE A;  3CK7 A;  4GYY A;  4B0Z A;  2JMI A;  5G2N A;  3LCA A;  2HR2 A;  4Q96 A;  4WZ0 A;  4ANU A;  4XZ4 A;  2J4D A;  3VK6 A;  4FHJ A;  3ZFW A;  4JEH A;  3FHE A;  3FUK A;  4XKB A;  2P58 C;  4WZ2 A;  4GU5 A;  2WXH A;  4NQ0 A;  1Z3Y A;  4CT4 A;  2KCK A;  3QJZ A;  3FTU A;  4UWG A;  4PDX A;  4EPZ A;  5FER A;  2CFZ A;  3CVY A;  4ANW A;  4MLP A;  4EBA G;  2MUM A;  3PUJ A;  1V87 A;  2HDP A;  5AIJ A;  3LPZ A;  2YHE A;  5CMY A;  4TRQ A;  5G05 J;  2UZG A;  2R17 C;  3SF4 A;  4AYC B;  4CEM A;  4B8C B;  3LRQ A;  1HS6 A;  3T7L A;  5A23 A;  1WES A;  3RKV A;  2ECG A;  3VTX A;  4JEU A;  1WFK A;  2Y4U A;  4BY6 A;  2L0I A;  2WXF A;  3CVP A;  2WM9 A;  1EPU A;  2ZU6 B;  1VD4 A;  4OVU A;  4WND A;  3PNL B;  3N71 A;  4C9Z A;  3I5P A;  1KT0 A;  1X4U A;  2HO1 A;  4WWP A;  4EZJ A;  2LGL A;  1Z6T A;  3ZVV A;  3MEK A;  5D1L B;  3O70 A;  1G25 A;  4CRW A;  5JJ6 A;  2VSY A;  5G0F A;  3FEY A;  5E75 A;  4AOF A;  4HXI A;  1OWL A;  4WZ3 B;  3IBE A;  5EKQ D;  2JMD A;  1E8W A;  2VJF B;  4V3K C;  2LSU A;  3CV0 A;  2WXR A;  2CG3 A;  4AM9 A;  3KAE A;  4GMJ A;  3TXN A;  4I1M A;  3ZHE A;  5T8I A;  5KJM A;  3FUI A;  3U64 A;  3M63 A;  4ILI A;  2MHK A;  5JHA A;  2KWJ A;  4I43 A;  4AJW A;  2FO7 A;  1WEQ A;  2KFT A;  3QB2 A;  2L80 A;  3APD A;  5TAB A;  4AUQ B;  2G45 A;  2E6S A;  1SZ9 A;  3PRE A;  3KEZ A;  4CDR A;  3B7T A;  1BPO A;  5A7D B;  2FBN A;  4YC9 A;  5C2Y A;  4GML A;  1Z60 A;  4J8E A;  3CHQ A;  4UI9 B;  5C11 A;  5KH9 A;  2PL2 A;  3NZS A;  3GZS A;  5FQ7 A;  3VLD A;  1JPL A;  4FC8 A;  2L5U A;  1LF8 A;  5LFA A;  3RRM B;  3M99 A;  2K17 A;  4UQZ A;  3ZN3 A;  4ANV A;  2X38 A;  1DVP A;  3RRU A;  5FQ6 A;  4HOS A;  4UP0 A;  3APC A;  4ZUX U;  5A6C A;  3L6A A;  4XIF A;  3MV2 B;  5G04 C;  4ABN A;  2FUL A;  3FTX A;  4J6I A;  2XRZ A;  2KGG A;  4GNF A;  5H9M A;  5BV0 A;  3MGB A;  5FJY A;  2OXQ C;  1ELR A;  3VTY A;  3ZYQ A;  3U66 A;  1B89 A;  5BW8 C;  2PM6 A;  4WWO A;  2LN0 A;  3FU6 A;  4XE0 A;  2G6Q A;  3I3N A;  3JQ1 A;  2LGV A;  3OXF A;  4QF3 A;  1NA0 A;  4YBS A;  1FVF A;  3URZ A;  3EIQ C;  4L2Y A;  2KR4 A;  1PC2 A;  3B7S A;  2I6H A;  5ARG A;  3P1U A;  3ZYM A;  3SBT B;  5FZS A;  3CHP A;  4FLB A;  3APF A;  2X6F A;  2D8S A;  5LCW C;  2J9Q A;  3CHO A;  3FUD A;  4I6G A;  3U5N A;  5CMW A;  2MRI A;  2YUR A;  3IHP A;  2E0I A;  4KZC A;  2CSZ A;  2IFU A;  4BBQ A;  3C6W A;  4JL0 A;  2K4D A;  4S3O B;  3HHM A;  2JLB A;  4AEZ C;  2KU3 A;  2UWJ G;  3SHF A;  2VSN A;  5KJN A;  4FLH A;  1H2U A;  5G04 J;  3FDH A;  1DNP A;  3CEQ A;  3L1X A;  3UT7 A;  2KZT A;  3LVR E;  1HYJ A;  2J4B A;  3FUE A;  5DKA A;  5FB0 A;  2WB2 A;  1ELK A;  5CHE E;  4I7D A;  2WPV A;  2WVI A;  3U9W A;  2ECN A;  2FEZ A;  2FI7 A;  3RTR B;  4NN2 A;  5TDR A;  4I6J A;  3ZXS A;  3ONK A;  4DLQ A;  2QIC A;  1SQM A;  2XEU A;  3CHS A;  4N3W A;  4F3V A;  5LCW J;  2AVP A;  3LS8 A;  3U4T A;  4UWF A;  5FWQ A;  1KLX A;  3LY8 A;  3G2T A;  3HVE B;  4DK5 A;  2DX8 A;  4U0Z A;  2CG2 A;  3L17 A;  1U3D A;  5CCL A;  2OVF A;  5BUZ A;  3PVL A;  4NAC A;  3CST A;  3CKC A;  3FTV A;  4QFV A;  4I17 A;  1FCH A;  2PM7 A;  5AYW D;  2GGF A;  5E76 A;  4GB9 A;  4BTA A;  1N52 A;  2YHO A;  3GW4 A;  4CGW A;  3FTZ A;  2M63 A;  2NXP A;  1LDK C;  2Q7F A;  4N5C A;  2L6J A;  3PHD A;  3SD5 A;  3RPG B;  5D0Q D;  2FSA A;  2VP7 A;  1WM5 A;  4HOQ A;  2IU1 A;  3ASD A;  3ZW3 A;  4LAD B;  2YQ8 A;  4FAD A;  2H0D B;  3PUK A;  4TKP B;  4CGV A;  4YAX A;  3NF1 A;  3ASF A;  2AWI A;  4KZ0 A;  2GW1 A;  4GYW A;  3SHB A;  3UUX A;  3MZL B;  4A1S A;  2C2V S;  3TAX A;  5JHB A;  4EZL A;  2YYR A;  4PTB A;  3EJN A;  4EBA A;  1SZA A;  4BHW A;  3LQJ A;  5H1V A;  2NC9 A;  2A5U A;  3RJV A;  1WEU A;  5BT1 A;  3B7R L;  3GZ2 A;  1MM2 A;  1S0P A;  4K0R A;  4Q94 A;  4UQX A;  3LVQ E;  3RIB A;  5EYA F;  1H0A A;  1XGW A;  4LJN A;  5DIZ A;  2YUC A;  3FUF A;  1IYG A;  5DBK A;  4AY6 A;  5B8D A;  3R9A B;  5G05 B;  3FP3 A;  4XI0 A;  3FUJ A;  5FEY A;  3FH8 A;  2IOS A;  3S7B A;  2BAY A;  1H6K A;  1HYI A;  3MKQ B;  3NG2 A;  4I2Z A;  4XI1 A;  1Y6I A;  3V43 A;  3L16 A;  3SOU A;  2YHN A;  4K03 A;  3K9I A;  4KT6 B;  5KJL A;  2VJE B;  3TL5 A;  3U5M A;  4LKA A;  1N87 A;  4DI4 A;  1OWN A;  2KRE A;  2M1R A;  5KH3 A;  4PPE A;  5I3L A;  4EZK A;  5AEN A;  2LXH C;  2QY7 A;  4C0M A;  3LQI A;  3PEV B;  5CCM A;  1WEW A;  5LP0 A;  2MT5 A;  1JM7 B;  2CHZ A;  1JUQ A;  3D9M A;  5EDS A;  4GA2 A;  1IQR A;  2WXK A;  2IF4 A;  3HYM B;  4Y6C A;  2NSZ A;  1F62 A;  4PS3 A;  2X6H A;  4UWK A;  3QWV A;  2V4L A;  5TDW A;  4GYO A;  4GZ3 A;  4A49 A;  3G2W A;  4FP7 A;  4G11 A;  4D10 C;  3MKR A;  4AY5 A;  2YSJ A;  2KM4 A;  2I9C A;  4ILG A;  1WEO A;  2KCL A;  2C0L A;  4OVV A;  3D3M A;  3Q5M A;  3CVV A;  3L1Z B;  3HCS A;  1WEM A;  3GYZ A;  1HZ4 A;  4O64 A;  2EGP A;  2V5F A;  2C2L A;  2GRL A;  4FJZ A;  1HXI A;  4L58 A;  4J8D A;  3EHM A;  2YRE A;  5AIT A;  5D0O D;  1E90 A;  1WY6 A;  3PNT B;  4RG9 A;  2C0M A;  4EEC A;  3UPV A;  3D9J A;  5J90 A;  2FF4 A;  4U0S A;  2Y43 A;  4BX8 A;  5D1M B;  3CVL A;  3LDZ A;  4CDN A;  4IUL A;  4JHJ A;  3QWP A;  3S2A A;  3S7D A;  3OXL A;  1EF1 C;  3B13 A;  4E85 A;  4L2L A;  3SGH A;  4UQY A;  2ILR A;  4A55 A;  5T3R A;  1U6G B;  3CVQ A;  3N9L A;  3AS4 A;  3JQ0 A;  3ASL A;  2AN6 A;  2KWK A;  5FQ8 A;  4LCT A;  4A0C D;  3CVW A;  1Z6U A;  4ZQL A;  2QFC A;  3IHY A;  2KYU A;  4Q69 A;  2YSM A;  4E6H A;  2ION A;  1N54 A;  4C0E A;  2BTD A;  4CCA A;  3O37 A;  4J0U A;  2E6R A;  3MX3 A;  3M62 A;  3OAW A;  4N39 A;  4DLO A;  2JEK A;  3D9N A;  4G25 A;  2MA6 A;  4I1O B;  2MD7 B;  4GA1 A;  3P2B A;  2X6K A;  3TGO A;  5D1K B;  4EQF A;  1H2V C;  3MHS A;  3ZNI A;  5DIN A;  4AXH A;  2KIZ A;  3O35 A;  2R5S A;  4J8S A;  3SZ7 A;  2YT5 A;  1IQU A;  4TV3 A;  4RG6 A;  3LJ3 A;  3EB6 A;  2CT2 A;  2K1J A;  1RMD A;  1IHG A;  4LEU A;  4ZDT A;  1YA0 A;  3FUN A;  4NRH B;  3HVE A;  2KCV A;  3ZVZ B;  3IV0 A;  1FBV A;  5FTP A;  4L1B A;  2XQ0 A;  3FH7 A;  4NUR A;  2VSO E;  2XB1 A;  5G04 B;  3QOU A;  2WXI A;  3RU0 A;  4U07 A;  2PNX A;  2YQL A;  3G2V A;  4I2W A;  1HG2 A;  2L0B A;  5FB1 A;  5LKZ A;  4YAT A;  4G26 A;  3QZV A;  3O7A A;  5BNW A;  4CT0 A;  2VJ8 A;  3Q49 B;  3T6R A;  3GV4 A;  5EX3 A;  4L23 A;  2OOE A;  3FU0 A;  5J08 A;  5LCW B;  2PQR A;  4O6F A;  5FT9 A;  4UI9 J;  5ANR A;  3T5V A;  4ACK A;  2WQH A;  4IRU A;  4FJY A;  4IC3 A;  1E8Y A;  3KV5 A;  3NZU A;  3D9I A;  3G2U A;  2MD8 C;  4F52 B;  5B79 A;  4ILH B;  1UG3 A;  1TJC A;  1E96 B;  2PUY A;  5LOZ A;  3CGH A;  5B78 A;  4YBT A;  2PQN A;  1OWP A;  4GAA A;  4U8H A;  1P5Q A;  3ZIM A;  4C9B B;  4N2Q A;  3SOX A;  1X4J A;  3MKQ A;  3LKU A;  3FU3 A;  2AXZ A;  1EDU A;  3IKO B;  2VGY A;  3FFL A;  2QJ0 A;  4Q6F A;  2LNI A;  2VTB B;  2OVB A;  2UY1 B;  4LUN U;  3RK6 A;  4FUL A;  4BTB A;  2LDR A;  4W9R A;  3L54 A;  1QNF A;  2F6N A;  4FK5 A;  4P5O B;  3N9M A;  1TEZ A;  3L13 A;  2LGK A;  2CFU A;  4U63 A;  4LRZ A;  4YVO A;  3CK9 A;  3ESK A;  4ACL A;  4DJA A;  1INZ A;  3CKB A;  2DBA A;  5C1D A;  4F7A A;  4YND A;  3UMV A;  3FUL A;  3ZYL A;  3I4G A;  1WIL A;  3PUR A;  3O33 A;  3RO2 A;  1HX8 A;  3CK8 A;  3G2S A;  3TJP A;  3DBS A;  3KD7 A;  4I6E A;  2XRY A;  2WMO A;  2VQ2 A;  1W3B A;  4R7L A;  3L08 A;  1OUV A;  3UT4 A;  1QQE A;  4AYC A;  1X4I A;  2RD0 A;  4HLE A;  4WNG A;  1NZN A;  1KT1 A;  3FH5 A;  3KV6 A;  1WGM A;  1ZU2 A;  1FVH A;  1VYX A;  2X6I A;  4I1A A;  2DIW A;  4KBQ A;  4L7X A;  2L43 A;  2AXV A;  3HTK C;  3ZPV 1;  4G24 A;  3DQV R;  3AU4 A;  2CHX A;  1CHC A;  3OTN A;  3ULQ A;  4PS7 A;  4B94 A;  4A1G A;  4GZ5 A;  1WEV A;  1HH8 A;  5EX0 A;  3MV3 B;  1WEE A;  2Y4T A;  3QK0 A;  1TJF A;  1U3C A;  2WXO A;  2EQX A;  3D9P A;  3T8M A;  5AJD A;  3IEG A;  4PS8 A;  2CKL B;  3N9P A;  4N4F A;  4UWL A;  2MIQ A;  2MNZ A;  3EIJ A;  3T5X A;  3ZEF A;  4AP4 A;  2LSV A;  3UT8 A;  2ECV A;  3QKY A;  3MA5 A;  2KE1 A;  4JHK A;  4BT8 A;  5H1U A;  4YVQ C;  3LXU X;  3VLF A;  3BG0 B;  2VJF A;  3ML9 A;  4JPS A;  2YHC A;  4JC8 A;  4RVB A;  3JUI A;  4F1S A;  4I9C A;  2X6J A;  4KVO A;  1VFY A;  5ENN A;  4GA0 A;  2KZT B;  4HVB A;  1LDJ B;  2XPI A;  4LK9 A;  3BG1 B;  3ZVY A;  1EYH A;  1ZBD B;  2WMN A;  2JRJ A;  2BUG A;  4KVM A;  2ECW A;  3UX4 A;  2ECJ A;  4N3C A;  1WEN A;  3U5P A;  3FUM A;  2J09 A;  5LKU A;  2LAI A;  3CVX A;  5AIU A;  3JCK C;  3N9Q A;  2YW8 A;  3CQC B;  5JJ7 A;  1IYM A;  5KCM A;  2VGX B;  4H7Y A;  1UW4 B;  4B8A A;  4GPK A;  3CIA A;  2MNY A;  4FA6 A;  4U0U A;  4I7C A;  4AIF A;  2Y3A A;  3LEW A;  3PS6 A;  3TG4 A;  5TBN A;  1WE9 A;  3MYV A;  1OWO A;  5LKT A;  5ANL A;  2L9B A;  1E7U A;  1UN8 A;  2FUU A;  2DCP A;  4HS2 A;  4ME2 A;  2Y1M A;  2WXM A;  2G43 A;  2VYI A;  5JJT A;  3S7F A;  1JWG A;  1JOC A;  4FU3 A;  2QIZ A;  1HO8 A;  2IDA A;  1OWM A;  3CR3 A;  5JG6 A;  5LKX A;  3ONL A;  3CSF A;  4R8P K;  1PAQ A;  2VPG A;  1UN9 A;  3ASG A;  4MKT A;  2OND A;  1T1H A;  1HU3 A;  4N3B A;  3PH0 C;  3FL2 A;  4BX9 A;  1HF8 A;  4JA9 A;  2WXJ A;  3CHR A;  4WUY A;  4MVT A;  4GNE A;  2VNF A;  3D9L A;  4U04 A;  1H2T C;  3O4Z A;  3FWV A;  2VPB A;  4BT9 A;  5B77 A;  2V0P A;  2KAT A;  3N9N A;  4UI9 K;  3LY7 A;  4CA1 A;  4XI9 A;  3HDX A;  2R59 A;  4CCG X;  3PUQ A;  3ZGQ A;  2J08 A;  3QDN A;  2VPD A;  2IJG X;  3EB5 A;  4MSX A;  2J07 A;  4N2S A;  2AW6 A;  4PUC A;  3HCU A;  3O34 A;  5FZR A;  4WNF A;  1VDY A;  2AXU A;  4JA7 A;  3DPD A;  4P29 A;  2K16 A;  4FHK A;  4GCO A;  2LGG A;  2WXG A;  5BV1 A;  2M85 A;  2I1J A;  4APO A;  1K2F A;  2I1K A;  4GB0 A;  4GND A;  3AU5 A;  2WXN A;  4XKC A;  3PE3 A;  2J49 A;  5HQ8 A;  3QAQ A;  2ZET C;  2EOD A;  2IOL A;  1NP7 A;  2RSD A;  3I4R B;  2ECT A;  4WNE A;  1WAO 1;  3PRZ A;  1HG5 A;  3U3W A;  4A4B A;  4APF A;  4WWN A;  3LQH A;  4JW1 A;  4PH4 B;  2XCC A;  2VTB A;  2UY1 A;  5H1T A;  4IN3 B;  1BOR A;  4LLB A;  4W4U A;  3HIZ A;  3U5O A;  4UI9 C;  4I7B A;  3GZ1 A;  5LX8 A;  5FZQ A;  2YIN A;  3NQP A;  3SFZ A;  2LQ6 A;  3GL6 A;  3Q4A B;  2WQ6 A;  1Y8M A;  3FY4 A;  1MM3 A;  4AP2 A;  4KXK B;  3EDT B;  3EHN A;  4XX5 A;  2MOW A;  5AJL A;  1UJK A;  4MS6 A;  2WXP A;  4A3V A;  3FU5 A;  3PZD A;  4ANX A;  1XWH A;  4GZD A;  4FIP A;  4L7T A;  3E4B A;  1XNF A;  4AV7 A;  3QWW A;  3VLE A;  3QNK A;  3Q47 B;  2KWO A;  2L0T B;  5ARF A;  3SBS A;  4UP5 A;  4V3I A;  5C13 A;  2LRI C;  3ML8 A;  3UQ3 A;  4LER A;  4FO9 A;  4GZ6 A;  2H0D A;  4YAB A;  4KYO B;  1GW6 A;  3ZTG A;  2XGS A;  4G23 A;  3QC1 A;  2RG8 A;  3JYS A;  3ENE A;  3PDN A;  2XGM A;  4BWR A;  3SOW A;  3HCT A;  4GZC A;  2LXP C;  2V8S E;  1A17 A;  2VSX E;  3R7R A;  4HOT A;  3AS5 A;  2Y1N A;  2PZI A;  2YNQ A;  2HYZ A;  3B7U X;  3I2D A;  4DPR A;  1HE8 A;  3IHV A;  2XGO A;  3O36 A;  4I9E A;  3QAR A;  1E8X A;  2BF0 X;  4JVS A;  5B75 A;  4ATG A;  4V3L C;  2HYE D;  3FEX A;  1WIM A;  4A4C A;  2CKL A;  3CLJ A;  4DI3 A;  4JXT A;  5KH7 A;  2M3H A;  2LAH A;  4S3O C;  2XEV A;  4FJC A;  3D9O A;  1MQS A;  5FQ4 A;  4B7Y C;  2CSY A;  2RI7 A;  3R7Q A;  3AS8 A;  3C5K A;  4M3O A;  4R2Y A;  2F6J A;  4IYP A;  4G2V A;  3ZPJ A;  3DPL R;  2XPZ A;  3ZHE B;  4HOR A;  3KQI A;  3LY9 A;  3O48 A;  1E7V A;  2NAA A;  4YBM A;  4WAF A;  3ZYK A;  1ZBP A;  5M72 A;  4TUU A;  4JZY A;  4AVX A;  4HFG A;  5HI7 A;  2VJE A;  2WQ7 A;  3PE4 A;  2IQC A;  2X3M A;  4OYS A;  4J8F A;  4URK A;  1NA3 A;  3OXG A;  1E4U A;  4N3A A;  5T4Y A;  3SNX A;  3BEE A;  3TG5 A;  1JM7 A;  1H19 A;  2VGX A;  3D9K A;  3KS2 A;  3CVU A;  3MHH A;  3N9O A;  4Y6W A;  5B76 A;  2I50 A;  2WXQ A;  2L75 A;  2M6M A;  4YAD A;  1Z2Q A;  2EA6 A;  2I2O A;  2XCB A;  3L22 A;  2FUI A;  2MA5 A;  4B89 A;  3S7J A;  3ASH A;  4HOU A;  4X3G A;  3RPG C;  3RO3 A;  1Z3X A;  2CHW A;  3CVN A;  1PY1 A;  3C98 A;  4B86 C;  2LO6 A;  1MHQ A;  4R7E A;  3FTS A;  4GNG A;  4BSX A;  2OV8 A;  4MRU A;  4UWH A;  3MJW A;  1JWF A;  3CQG B;  2LV9 A;  4QF2 A;  3FTW A;  2HM8 A;  1WEP A;  1L5J A;  1E8Z A;  4RSY A;  3SI5 A;  3RRN B;  4A3T A;  3MCX A;  3ESL A;  3TXM A;  2GRM A;  2A4Z A;  1ELW A;  4IC2 A;  1HFA A;  2ECI A;  3CHM A;  4CDM A;  4H7X A;  5BPP A;  5J3X A;  2KC7 A;  1QZ2 A;  5KJK A;  3KNV A;  4GCN A;  4BFR A;  3ZPV E;  4KMO A;  2JMJ A;  3ZRH A;  2KGI A;  5G05 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...