3ZYQA

Crystal structure of the tandem vhs and fyve domains of hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) at 1.48 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
216
structure length
216
Chain Sequence
GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) at 1.48 A Resolution
rcsb
source organism Homo sapiens
molecule tags Signaling
molecule keywords HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
total genus 73
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zyqA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zyqA02
2L80A 2G43A 3N9NA 4F52B 2H0DA 4YABA 2VP7A 5LKUA 2KREA 4I7BA 2G6QA 5TDRA 4FIPA 4R8PK 3G2WA 3O35A 2F42A 3I2DA 5H9MA 1LF8A 1WGMA 5G04B 4Q6FA 2NAAA 3C5KA 4R2YA 3GV4A 4GZDA 5TABA 3QZVA 3KQIA 1HFAA 2DCPA 1JM7A 1DVPA 2YREA 2KE1A 3SOWA 1X4UA 4AYCB 3U5MA 2LQ6A 3N9OA 5I3LA 2CKLB 2LXHC 2CKLA 4I7DA 1WFKA 3U5OA 3SOUA 3D9PA 3NG2A 1VFYA 2L5UA 2KGIA 3KV5A 2MNYA 1LDJB 2QY7A 2LGKA 3O70A 2YT5A 4HFGA 1WIMA 2L0IA 2KWNA 3MHHA 2ECVA 3PUQA 4XI1A 5FB0A 1VYXA 3D9MA 5LKTA 1MM3A 2E6RA 3ZNIA 4BBQA 2MNZA 2QIZA 4PPEA 4GNGA 2MT5A 4LJNA 3C6WA 1U6GB 2KGGA 4X3GA 2MD7B 1XGWA 5G05B 3D9OA 3SHBA 4UP5A 2BF0X 3ZVZB 2ECJA 1JPLA 1ZBDB 3G2VA 5D1MB 2L75A 2MIQA 2VNFA 3G2TA 3D9JA 4S3OB 4LADB 3N9PA 2VPBA 2PNXA 2YU4A 1HYJA 5B79A 1FP0A 1VD4A 5H1TA 2Y1MA 4CA1A 4UP0A 2CT2A 3ZTGA 2EGPA 1PY1A 1HX8A 2UZGA 3O33A 5J3XA 1HYIA 4YAXA 3RPGC 1HF8A 2LV9A 4MVTA 4PTBA 2ZETC 1V87A 2C2LA 1H0AA 4FO9A 3ZVYA 2LGGA 3D9LA 3GL6A 2V8SE 3KV6A 1Z2QA 1Z60A 4JXTA 3T7LA 2YQMA 2KYUA 4YATA 4YBTA 5J08A 2BAYA 3L1XA 1LDKC 4GB0A 2C2VS 2M6MA 3EB6A 4A49A 5H1UA 3ZPVE 2KWKA 2E6SA 1JWFA 3V43A 5KH3A 4B7YC 4L7XA 2VPDA 5FEYA 3RTRB 4ZQLA 2ECNA 2EODA 2L0BA 2XB1A 5B77A 1CHCA 3HCSA 4C9ZA 4IC3A 3HTKC 2JMJA 2YYRA 2LXPC 4WA6A 4WZ2A 2MA6A 2YSMA 3G2UA 4YBMA 1UJJA 2LRIC 3SOXA 2LN0A 2CSYA 2KWOA 1IYMA 5TBNA 1WEWA 2KR4A 4A4BA 2M85A 1WENA 2G45A 2KWJA 3IHPA 1SZ9A 1WEVA 2KM4A 2MUMA 2VJEA 4YC9A 5FERA 2F6NA 3RPGB 5C13A 2YUCA 2MOWA 5G0FA 2FUIA 2QJ0A 3O34A 2JMIA 3M62A 5LP0A 5LCWB 4R7EA 4I7CA 2D8SA 2H0DB 4GNEA 2AN6A 3VK6A 3D9IA 3U5NA 3LQIA 1EDUA 5H1VA 1JWGA 4FU3A 2YSJA 2KU3A 4TKPB 1INZA 5DINA 3O36A 2K4DA 3U5PA 3ZPV1 3KNVA 2HYED 5B76A 3ZYMA 4NACA 4A4CA 2IDAA 3MHSA 4BHWA 1K2FA 2F6JA 2MD8C 1T1HA 4GZCA 4Q96A 2JMDA 2MA5A 4MSXA 3D9NA 4LK9A 2LDRA 4CCGX 5CMWA 5B75A 3ZYKA 1RMDA 5JG6A 1X4JA 5LOZA 1EYHA 1F62A 2K17A 2M1RA 5AITA 1WE9A 4GNDA 2VPGA 2LGLA 2L0TB 1WEOA 1XWHA 3ZYLA 2YW8A 5TRBA 4W4UA 2LGVA 3LQHA 2YURA 5EYAF 3DPLR 2VPEA 2OXQC 4IC2A 3HCUA 4WZ0A 2Y1NA 3ONLA 3D9KA 4QF2A 2ECWA 1VDYA 4N4FA 1FBVA 3L1ZB 5DKAA 1JOCA 5FB1A 3ZYQA 2KFTA 3HCTA 2L43A 3FL2A 5D1KB 1UJKA 4ZUXU 1WEUA 2CSZA 2RSDA 3RRUA 1JUQA 4P5OB 4AP4A 4YBSA 4NN2A 2DIWA 2FUUA 2VJEB 2M3HA 1MM2A 2LO6A 1G25A 3O37A 3EB5A 3ONKA 1WILA 1SZAA 2YHNA 3G2SA 1MHQA 3N9QA 2JRJA 5KH9A 2I50A 3N9LA 3CLJA 1WEQA 5B8DA 3LDZA 2YHOA 1X4IA 3L11A 1HG2A 3DQVR 2K1JA 5LKZA 3PURA 4L58A 4UI9B 5AIUA 4FJCA 4GNFA 3M63A 2ECTA 5TDWA 4V3LC 4QF3A 4WZ3B 1WEPA 5B78A 1WESA 4AVXA 2XEUA 4O64A 5C11A 4Q94A 1Z6UA 4S3OC 1JM7B 2EA6A 5LKXA 2QICA 4AYCA 5KH7A 1X5BA 1E4UA 3ASLA 1ELKA 3O7AA 4A0CD 4V3KC 4B86C 4AUQB 1HG5A 5D1LB 4ZDTA 4YADA 2KIZA 2PUYA 2ECIA 2Y43A 3T6RA 1BORA 2YQLA 1WEEA 2DX8A 3M99A 4N3WA 2VJFA 3LRQA 2VJFB 4FLBA 2ECGA 2K16A 5CMYA 4LKAA 3PHDA 1N87A 2FSAA 3LQJA 3N9MA 2HDPA 1WEMA 4FK5A 2RI7A 4LLBA
chains in the Genus database with same CATH superfamily
4F52B 3TXNA 1RZ4A 4Y6WA 3CHPA 2NSZA 5LKUA 3E2DA 1WG0A 4GTPA 2PQNA 3I2DA 3Q79A 3CV0A 4L9PA 4XE0A 4CT0A 3S7BA 3AU4A 3UKUG 5SVIB 4AIFA 3FJUB 3QZVA 4YNDA 4YDOA 2HM8A 1JM7A 4TRQA 3ZUVB 2GRLA 2XGSA 5KBAA 4WWPA 3Q4AB 2VGXA 2VJ8A 2LQ6A 3N9OA 2R59A 3UMVA 3OXFA 4ANXA 1U3DA 3U5OA 2L5UA 1TJCA 5J90A 2P9KG 4EPZA 2X3MA 3KV5A 2QY7A 3H7HA 3O70A 2KWNA 2ECVA 3I5PA 4BEPA 5FB0A 2AWIA 1VYXA 3Q1DA 4O62A 2Y1LE 1MQSA 2ILRA 3FTSA 3Q9UC 4BETA 5AQAA 1WDYA 4O1PA 2MNZA 1TN6A 3NAWA 5KNHD 2PNNA 4LJNA 1U6GB 1RW2A 2JEKA 2H6IA 4DI3A 5G05B 1FPPA 3D9OA 3PRZA 4UP5A 3ZVZB 2XPZA 2VSYA 5D1MB 4DX1A 3CVNA 2VNFA 2KBXA 2EQXA 2J4BA 3TGOA 2VPBA 5JMND 3BU8A 3HRAA 1VD4A 5FQ7A 3RJVA 3CVYA 2Y1MA 4CA1A 3SNXA 1TN7A 3ZTGA 4HOTA 3P1UA 2HYZA 4GTSA 1WM5A 4YAXA 5CRVA 2PL2A 2LV9A 4XIFA 2ZETC 1O1SA 5EKQD 2J49A 1N95A 3S2AA 2LXMA 5CCMA 3PNTB 2LAUA 3DEOA 4WUYA 2CRRA 3BQOA 2WXPA 3GL6A 4F6RD 3MKRA 3UT8A 5B3SE 3IV0A 2XENA 3T7LA 4D10C 4YATA 4WWOA 5BT1A 3RO2A 5A23A 2P9IG 1LTXA 3EB6A 4A49A 3ZPVE 4P29A 1D8DA 4A55A 5HKPA 1JCQA 5KH3A 4HRNA 4JHJA 4U0UA 3PZ3A 2L9BA 2VPDA 4AY6A 5FEYA 3X2QE 2GGFA 2ECNA 2EODA 1UOHA 2H6GA 4C9ZA 3HTKC 5ENNA 2LXPC 4WA6A 4FHJA 1HE8A 2UWJG 4GB9A 2XS1A 4G24A 2YSMA 3U3WA 4YBMA 4AP2A 2KWOA 5FQ6A 5TBNA 3CVXA 3L16A 1ELRA 2FO1E 3ZEFA 3IHPA 1LD8A 1SZ9A 1WEVA 5ENOD 5KWDA 4TV3A 3OTNA 2KM4A 2WB2A 2MUMA 4YC9A 1HU3A 5FERA 4GU5A 1OWNA 1LD7A 4HBDA 1XNFA 5LX8A 3PREA 2L6JA 2QJ0A 3T9KA 5LP0A 5LCWB 3UT4A 4I7CA 1N94A 2EIKE 1MJ0A 4AY5A 2BUGA 1S0PA 3D9IA 5EX0A 3ZKJA 1OXJA 1K1BA 2Y4UA 2WXKA 2XOYA 4GA0A 1JWGA 3ASGA 2V4LA 4TUUA 1H19A 4B0ZA 4HLEA 3URZA 4KT6B 3O36A 3MKQB 1IQUA 2VYIA 3PE3A 1H6KA 3ZYMA 4HRMB 3TWQA 2KATA 3SO8A 1K2FA 2RKKA 2J07A 3Q49B 4F53A 4GZCA 4Q96A 2MA5A 4EZLA 4LRZA 5JJTA 4G2VA 2LDRA 4CCGX 5CERB 5CMWA 3C3RA 1E96B 4U8VD 3ZYKA 4F7AA 3PH0C 3J5PA 1N11A 4QQIA 3CVLA 2K17A 4GYYA 1SQMA 3GZ2A 2XGMA 3HXBA 3VLFA 2OWAA 5AITA 2GRMA 4GYOA 4GNDA 4L2LA 2LGLA 2IQCA 4E6HA 4GYWA 1E8ZA 1IYGA 3DPLR 4HNAD 1FT2A 2Y1NA 5G2NA 3ULYA 4QF2A 2WXFA 3LJNA 3I4GA 1VDYA 1FBVA 5G05J 3CEQA 1NI1A 5G04C 3U4TA 2LSUA 3DSTA 5FB1A 4CDRA 1W3BA 3E37A 5FZRA 4OYSA 1H2TC 3V2OA 5D1KB 3C5RA 4ZUXU 4GPMA 3FM8C 3FEYA 1TJFA 4P5OB 4BESA 2FUUA 1H6PA 2M3HA 1JCSA 2P9LG 3Q7FA 2WXOA 3Q9NC 5HI7A 4FC8A 2EIJE 4LNUD 3SFZA 3PDNA 4EECA 5SVYA 3HXEA 4J8SA 4MRUA 5ENPD 1WILA 3SI5A 1S64A 3R7QA 4KZ0A 2XRYA 3N9LA 1N52A 5B8DA 5CEAA 1H2UA 4KXKB 2DZOA 2ETBA 3FUMA 2KKYA 2WM9A 5AIUA 4GTVA 5AN8A 2ECTA 1BI7B 5AQ9A 4QF3A 4WZ3B 1O5MA 3Q47B 4HOQA 2LUHA 5AJDA 3UTMA 4AVXA 2XEUA 1H2VC 5C11A 4Q94A 3UPVA 4S3OC 1JM7B 5LKXA 3LS8A 3EHMA 3FTYA 2J9QA 4EBAA 5KH7A 3ASOE 3TXMA 1X5BA 3MCXA 4ATGA 3DRAA 4F3VA 3ABLE 3TWXA 3Q7AA 4I17A 2IOLA 1ELKA 3PZ4A 3AS8A 4V3KC 3HXDA 3RKVA 4JVSA 5EILA 2PUYA 2YINA 2DSMA 1BORA 4CCAA 4N3WA 2VJFA 3R7RA 3ESLA 3MDBC 2K16A 2V5QC 4U96D 4WNEA 3FUIA 2GRNB 3RRMB 3BG0B 3N9MA 4I1AA 2FBNA 4I1MA 2G43A 3PVLA 2L80A 3LY7A 4ABNA 3N9NA 1TNOA 2A5UA 2IONA 4RG6A 3T8MA 3ZGQA 2WXQA 4R8PK 3G2WA 5AARA 3O35A 3UM2A 4HS2A 5ENSD 4O6FA 2Y4TA 1LF8A 2J4DA 3FEHA 4AJWA 3GV4A 5HRYA 4JL0A 4BX9A 5BXUA 4GCOA 4A1GA 1QZ2A 1SW6A 3K9IA 1NA3A 4AYCB 4CGWA 4IYPA 4MBGA 4WNDA 3DSVA 2LXHC 2XGOA 2CKLA 1ZBPA 3SOUA 3D9PA 2AVPA 2F37A 2OCCE 2KGIA 3ULQA 3NBNB 3ASFA 3IBEA 3KEAA 4J8EA 2PZIA 3AG1E 1LDJB 3LJ3A 4HFGA 2FULA 5ARFA 3CGHA 4FULA 2FD4A 3FU5A 2R05A 2IOSA 3QWWA 1QQEA 3EJNA 4U04A 2XP0A 4YDWA 4U95D 1SA4A 3KD7A 2E6RA 3ULEG 3PZ2A 4PS7A 5ENQD 3VTYA 3UUXA 2WMNA 3NB2A 4ACLA 1XGWA 3SHBA 1D9SA 3L22A 3L13A 2BF0X 3FANA 2ECJA 1EF1C 3ASDA 4F1PA 2L75A 4K0RA 3D9JA 4LADB 4GMJA 3N9PA 3UM1A 2PNXA 3KDEC 2YU4A 1HYJA 1FP0A 3ZHEA 4BSZB 2CT2A 1OCRE 4G25A 1NZNA 1PY1A 2UZGA 2ZU6B 3O33A 3EHQA 4G23A 2ZGGA 1HF8A 3ZNGA 3TWRA 3HXFA 1V87A 2C2LA 1DCQA 4FHKA 2LGGA 3D9LA 3B7UX 1Z2QA 3UIOC 3L6AA 3CSTA 5CECB 2YQMA 3QARA 1OWPA 2RFAA 4YBTA 4I6EA 2BAYA 3L1XA 1ZU2A 4A3VA 2C2VS 3FU3A 3PS6A 2M6MA 4GTMA 5KCMA 1MYOA 1JWFA 2XPYA 3CKBA 3V43A 1HXIA 4B7YC 1V55E 5FQ4A 5EYLA 1WY6A 5B1AE 3QWPA 5B77A 2FO7A 5G05C 1AP7A 3HCSA 3L54A 4EZKA 2JMJA 1Z3XA 2YYRA 3EIJA 4H7YA 4WZ2A 3MV3B 1E7UA 4I6JA 2XQ0A 3RU0A 1UJJA 1TYQG 1E8YA 4GTTA 1WEWA 2EXUA 4A4BA 5FWQA 4UWLA 2CRWA 3SD5A 4N2SA 3DSSA 3FUJA 1N9AA 4G11A 2VJEA 4JC8A 3QAQA 4JHRA 2E0IA 3DWLG 5C13A 2YUCA 3L08A 4U0SA 3AS4A 4HB5A 5AQ7A 5G0FA 2FUIA 2BTDA 2BEDA 3CK8A 5CBOA 2WPVA 1SVXA 4R7EA 3CHRA 3UI2A 5EDSA 4N5QA 3DXMG 4GNEA 1QYMA 2P58C 3U5NA 2ZXWE 3FU0A 2RD0A 4IN3B 1OCCE 5H1VA 3TAXA 2YSJA 2KU3A 4JPSA 4JD2G 4NRHB 5C1DA 1INZA 3DSWA 2ETAA 3LDYA 2IU1A 4C0MA 4YDEA 2NYJA 3JQ0A 1K3ZD 2JLBA 4U07A 5E75A 2IDAA 3MHSA 2GROB 4JEHA 4ANVA 4Y6CA 4MS6A 2F6JA 2MRIA 3FDHA 2JM3A 5T3RA 4F1SA 3ML8A 3D9NA 4LK9A 5JJ6A 2LNIA 3QWVA 5CRUA 5BUZA 5LCWJ 4OVVA 4ZFHA 2HR2A 2A5EA 2XS8A 2XOZA 4ANUA 2M1RA 4WAFA 1NL4A 4XI0A 4C9BB 1WE9A 3NOCD 3FEXA 4OGEA 1WEOA 2ETCA 2VGYA 2YURA 4UQYA 3IEGA 2VPEA 2XEVA 2OXQC 3VLDA 3C72A 4IC2A 1Z5SC 4LUNU 4H7XA 1MBMA 3ONLA 4DJAA 5LCWC 3OXGA 2XZTG 4N4FA 1OWOA 1JOCA 3ZYQA 2LAIA 3FUHA 4KBQA 4OGCA 1FCHA 2AW6A 3FL2A 2KKXA 2PQRA 1L5JA 1WEUA 2FI7A 4L1BA 1TEZA 4WWNA 2DIWA 4DUIA 2B0OE 3SBSA 4K5BA 3ZVVA 3DSUA 5CCLA 5FQ8A 5D0QD 1A5EA 3CHSA 4OVUA 3CHOA 2XCCA 4I2WA 2EINE 3G2SA 4L7TA 1MHQA 1YA0A 3N9QA 5KH9A 4BFRA 3LDZA 3HIZA 4R7LA 1HG2A 4GZ6A 2RFMA 5FTPA 4TXPA 4BERA 3LCAA 4L58A 4UI9B 3C98A 4GNFA 3M63A 4C48B 2KCVA 1OWLA 4V3LC 1HZ4A 4DPRA 4IRUA 3BG1B 2HE0A 3FU6A 3TG5A 2VGEA 1WESA 4I43A 1IHGA 1Y8MA 1O1RA 2XEEA 4O64A 4ACKA 2VSNA 4PH4B 4AYCA 3SF4A 3CK7A 4BTBA 2LAHA 2I1KA 3SFXA 3O7AA 3HG0D 3M7KA 3QK0A 3JCKC 5DBKA 5D1LB 3UM3A 4UI9K 3T5VA 4YADA 4A1SA 4E85A 1IXVA 3E34A 2WXLA 2P9NG 2YHCA 1KZPA 4J6IA 4B94A 3M99A 2IFUA 2JUNA 3PUJA 3NZSA 2VJFB 4GAAA 2V4HC 5M72A 4N3CA 4FLBA 1H6OA 4CDMA 5CMYA 3FH5A 3RIBA 2WMOA 3DXKG 2DYSE 3CVPA 1N87A 3QC1A 3T8KA 1P5QA 2GRRB 2KC7A 1WEMA 2R2LA 4V3IA 3Q78A 2KWJA 3IHYA 5EX3A 2H0DA 3PEUB 4XX5A 2X6KA 4BTAA 2Y0BG 2KREA 2C0MA 3TG4A 4B89A 4I7BA 1JCRA 3EU9A 4FIPA 5TDRA 4XI9A 2P57A 5H9MA 2F8XK 5BPPA 4B8AA 3TWWA 4AV7A 4A63B 4UQZA 1WGMA 4LERA 2WXIA 4R2YA 2J08A 4GZDA 3PEVB 3DDTA 4AM9A 4NQ0A 1FT1A 3ZRHA 4HOSA 1HFAA 2DCPA 2YREA 5C2YA 4MKTA 2X6IA 1MX4A 2KE1A 2UY1B 5DIZA 4BX8A 4O1OA 4KYOB 1OCOE 4GCNA 3U5MA 1TNUA 1KPSB 5I3LA 4NURA 2AXUA 2QC9A 2CFZA 3KEZA 2I2OA 3D3MA 3FH7A 3MX3A 4ATZD 4HQDA 2VQ2A 2MNYA 2CFUA 4XZ4A 4YDYA 1WIMA 2WQ6A 1IKND 1N4SA 3PUQA 4XI1A 3D9MA 3PZ1A 5LKTA 2OVFA 3UT7A 3JXIA 3SFYA 1A17A 2RG8A 2D8UA 1N54A 5T8IA 2QIZA 4PPEA 2CONA 1OT8A 2MT5A 4H9DA 2DYRE 3C6WA 2XHEA 1WAO1 2MD7B 5BV0A 3FY4A 3ENEA 2YNQA 5IY5E 4JB8P 3FUNA 1JPLA 1ZBDB 3G2VA 1YMPA 2JABA 2MIQA 3E4BA 2CSVA 3G2TA 3ZPJA 1TNZA 3Q5MA 4UP0A 1ELWA 3HHMA 1HX8A 4B8CB 3SUBA 5FZSA 3MGBA 4FJYA 5A7DB 1HYIA 3ML9A 4MVTA 3FUFA 3T5XA 3PLWA 2MYOA 2YQ8A 1OCZE 4U8HA 3R9MA 3AG3E 1DCEA 3P2BA 1Z60A 1MX2A 4JXTA 1TR4A 2KYUA 4J8FA 2KCLA 3SGHA 4U7EB 5J08A 5KJLA 4GB0A 1E8XA 3QDNA 3SZ7A 2YVRA 2QYUA 3FTWA 2KWKA 4DX6D 2I9CA 4L7XA 4TXQA 5SVIA 4AOFA 4ME2A 3RTRB 4G1TA 4CDNA 2LXLA 4ZQLA 2XB1A 1NP7A 1CHCA 4IC3A 2PM6A 4PS3A 1FVFA 2I6HA 4KZCA 3TWSA 3U64A 1IYMA 3WG7E 2KR4A 2X6HA 2ZISA 4BT8A 3TWTA 3L9TA 3JXJA 3DEPA 4CYMD 4XEIG 4HVBA 4RG9A 3S7JA 5E76A 5H7PA 5SVXA 3O48A 3RPGB 3GZ1A 4UWKA 2MOWA 5EYPF 2BKGA 4PDXA 2VSOE 4CRWA 3GW4A 3O34A 1BPOA 2JMIA 3CR3A 1E90A 3EU5A 4J7WA 3QNKA 2ONDA 4HOUA 2AN6A 3VK6A 3FHEA 3HVEA 3LQIA 1IQRA 2FFWA 1EDUA 4FLHA 4CT4A 4FU3A 4TKPB 4TUMA 3FP3A 2L7PA 4I2ZA 4O60A 3L17A 2K4DA 3UQ3A 3D9HA 5G04J 2Y3AA 3U5PA 3HYMB 3KNVA 2HYED 4GMLA 5B76A 4LEUA 2R17C 2DBAA 3LY9A 1HO8A 4GZ3A 1PC2A 3U66A 2XRZA 2IEJA 3I3NA 2KCKA 1TNYA 1BI8B 1UN8A 1UW4B 4LG6A 4LCTA 2MD8C 4L23A 2JMDA 3EIQC 4MSXA 3U9WA 3E30A 1RMDA 1K8KG 1N4RA 1EYHA 4HORA 3FUKA 3HXCA 1AWCB 2VPGA 3FUDA 2IF4A 1XWHA 3AG4E 2YW8A 1BD8A 4M3OA 5TRBA 3V79K 4I9CA 5EYAF 3MKQA 4LSZE 2AXVA 2ECWA 3V30A 5D0OD 3HDXA 3FULA 3CVWA 3RSEG 1BLXB 2X6JA 2P2CP 3DBSA 4DX7D 3L1ZB 5ANRA 4ILIA 4RVBA 3UKRG 5EN5D 2L43A 3B7TA 3CKCA 1JUQA 4W9RA 3V31A 2CHXA 4APFA 4QQ4A 4AP4A 4NN2A 4ZHBA 3CQCB 1MM2A 4CGVA 2Q7FA 2MKEA 3N71A 5AJLA 1G25A 1KZOA 3O37A 4K5CA 3EB5A 3ONKA 1D8EA 4Z0OA 4UWFA 1S63A 3NOGD 1SZAA 3MEKA 5FJYA 3UIPC 4EHMA 4RSYA 3JUEA 2F8YA 2JRJA 5BNWA 3B13A 3CLJA 1N4PA 4KVOA 4A3TA 2YHOA 1O1TA 1X4IA 3L11A 1QNFA 3DQVR 5BXOA 4HLLA 4JA7A 3ZXPA 1E8WA 3AAAC 4FJCA 4ILGA 4LNGA 1MZCA 4JZYA 1DNPA 3OAWA 4ILHB 3Q75A 2CHZA 5B78A 5D66A 5A6CA 1Z6UA 3BUAA 2H6HA 3KS2A 3EUVA 3ABME 5CHEE 5EIBE 2QICA 4GTRA 2F0YA 4YVOA 1Z6TA 3LVQE 1E4UA 3ASLA 2OEVA 1UN9A 2VTBA 4B86C 2IJGX 4TXRA 1B89A 2KIZA 3J5QB 4PUCA 5ANLA 3WXXA 4J8DA 4U8YD 5HQ8A 2YQLA 1WEEA 3FTZA 3Q15A 3R9AB 5B1BE 5FZQA 3LKUA 5D2MC 4M7CA 4WNFA 2ZGDA 2R03A 3LRQA 3RK6A 3DWDA 2XEHA 1V54E 3PNLB 4LKAA 5AAOA 2FSAA 3LQJA 3DSXA 1S70B 5JA4D 3PZDA 2HDPA 3KSLA 2RI7A 4LLBA 5K3QA 2L6BA 4YABA 4AXHA 2WQ7A 2VP7A 2G6QA 5ITZF 3B7RL 2AJAA 2I1JA 1DC2A 2F42A 2OOEA 5T4YA 3DPYA 4DX5D 2WXGA 4GA2A 5CEDB 5G04B 2CG2A 4Q6FA 2NAAA 3C5KA 5TABA 3KQIA 3B7BA 2XOCA 1DVPA 1N4QA 3IXEA 3APFA 4HXIA 5FIOA 3SOWA 1X4UA 3CHQA 4XKCA 3FTUA 3CIAA 1N0QA 2CKLB 3B95A 4I7DA 1WFKA 4GPKA 3NG2A 1VFYA 3GZSA 3W9FA 2LGKA 2YT5A 1NA0A 2L0IA 3MHHA 3IHVA 3UX4A 4G8LA 4DX2A 2QYJA 1MM3A 4Z68A 5AIJA 3ZNIA 3LPZA 4BBQA 3JQ1A 3FH8A 1BU9A 4CZ2D 4GNGA 2KGGA 4X3GA 2GW1A 4GMRA 4OAUC 3CHMA 3KSQA 5LFAA 2VGXB 2KXPC 2GRQB 2WVIA 2B6CA 4S3OB 3S7FA 3Q73A 4C0EA 5B79A 4U63A 5H1TA 2M63A 4K5AB 2A4ZA 5AYWD 2OV8A 2EGPA 2PM7A 2WXMA 4HI8A 2VSXE 4KVMA 5J3XA 2EILE 3RRNB 2BKKB 4N3AA 2R02A 3CSFA 3RPGC 2UY1A 2P9PG 4PTBA 4UWHA 4I9EA 4NIKA 1HS6A 1H0AA 4FO9A 4I6GA 3ZFWA 3ZVYA 4URKA 1K1AA 3CVQA 3L82A 2V8SE 2P9UG 3LXUX 5KNGA 4RLYA 3KV6A 3C3OA 2C0LA 3ABKE 1LDKC 3MA5A 4HRLA 5H1UA 4BWRA 1TNBA 3ZXSA 2E6SA 2WXRA 3FUEA 3DPDA 4JHKA 4MLPA 4FA6A 2QZAA 2OEWA 3LY8A 3SQVA 1G3NB 3FFLA 3JYSA 4K03A 4IULA 4GA1A 4KMOA 5HS0A 3AU5A 3NQPA 3QJZA 2L0BA 2CHWA 2V0PA 2R5SA 2DVWA 4UQXA 1Z3YA 4CEMA 3CVUA 2MA6A 1UG3A 4UI9C 4JW1A 3G2UA 2LRIC 3UM0A 3SOXA 2LN0A 2CSYA 3VTXA 1Q2ZA 2M85A 1WENA 2G45A 2NC9A 2HO1A 3EDTB 2YHEA 3PUKA 3OXLA 1TN8A 1NFIE 2Y69E 2GRPB 3FAOA 2X6FA 4J0UA 1EPUA 4WNGA 2F6NA 3SHFA 3NZUA 2H6FA 2FEZA 4APOA 1U3CA 2V5FA 3ASHA 5G55A 1GW6A 5BV1A 3LEWA 3E32A 3M62A 4QFVA 3ZN3A 5ENTD 4FP7A 5JHBA 2D8SA 4OAVB 2H0DB 5CBNA 4BT9A 5KJNA 2FF4A 1X81A 1ZB1A 2E61A 3ZU7B 4DLOA 5DINA 5EIDA 3ZPV1 3APDA 3ESKA 3LJUX 4GTOA 2CG3A 2LSVA 4NACA 5ARGA 4A4CA 4RQIA 4BHWA 3B7SA 3C3QA 4I1OB 5AQBA 1T1HA 3MZLB 2DWZA 2WXNA 4DK5A 3LYAA 2VTBB 2M13A 5B75A 4N39A 2IQJA 3ISMC 2QFCA 5JG6A 2ZIRA 3CVVA 1X4JA 1FVHA 5LOZA 5KJKA 3NF1A 1F62A 3UXGA 2L0TB 3F6QA 3MJWA 4J8YA 4GZ5A 3ZYLA 3W9GA 3AG2E 4W4UA 5FINA 1SA5A 2LGVA 1QBQA 3LQHA 3GYZA 2WQHA 3HCUA 4WZ0A 3D9KA 3RO3A 3TL5A 4FJZA 2IY0C 3CK9A 1YYHA 4HI9A 5DKAA 1HH8A 3KAEA 4B93B 2KFTA 3HCTA 5AENA 1E7VA 3VLEA 1UJKA 3AS5A 3MYVA 5FT9A 2DJAA 4JEUA 2CSZA 2RSDA 2J09A 3FTXA 3AJIA 3RRUA 1N0RA 3ZHEB 4BY6A 1KLXA 3TJPA 4EQFA 4YBSA 2WXJA 3I4RB 2XPIA 2VJEB 4G26A 1OUVA 2LO6A 1YCSB 4EZJA 3QB2A 4AEZC 2DZNA 2YHNA 3ASNE 2RR4A 3S7DA 1U2VG 2IO2C 2I50A 2OVBA 4N2QA 1WEQA 2EGMA 5KJMA 4JA9A 4UUCA 4U0ZA 4BSXA 3TWUA 2K1JA 4DRXE 5LKZA 3PURA 3E33A 4PS8A 5TDWA 2IO3C 1WEPA 1Y6IA 4Z0RA 1IHBA 3TWVA 3BEEA 4ANWA 3ZW3A 3FWVA 5BW8C 2J8SD 4DI4A 3O4ZA 2EA6A 1KT1A 3CQGB 3EHRA 4UWGA 4DLQA 3HVEB 4UI9J 3UINC 4XKBA 2KZTB 2P9SG 2KZTA 3PE4A 4A0CD 3ZIMA 3V2XA 4AUQB 1PAQA 4Q69A 1HG5A 1KT0A 5JHAA 4ZDTA 1OWMA 3QOUA 3SBTB 4G8KA 2ECIA 4L2YA 3JUIA 2Y43A 2AXZA 3T6RA 3EHNA 4X8QA 3SY2A 2DX8A 4N5CA 4GTQA 4EBAG 1OY3D 3APCA 2WXHA 2NXPA 3FTVA 2XZDG 4YVQC 3MV2B 2ECGA 3IKOB 3LVRE 2X38A 4N3BA 5ENRD 3PHDA 4FADA 3O47A 5JJ7A 2E2EA 2XCBA 3RAUA 3QKYA 2EIME 1MX6A 4FK5A 4LNBA 2MHKA
chains in the Genus database with same CATH topology
3IHYA 4I1MA 2G43A 3PVLA 2L80A 3LY7A 5EX3A 4ABNA 3N9NA 4F52B 3TXNA 2H0DA 4Y6WA 4YABA 3PEUB 2A5UA 2IONA 2X6KA 3CHPA 2NSZA 4XX5A 4AXHA 2WQ7A 2VP7A 4BTAA 2KREA 5LKUA 2C0MA 4RG6A 3TG4A 3T8MA 3ZGQA 4B89A 4I7BA 2WXQA 2PQNA 2G6QA 5TDRA 3B7RL 4FIPA 4R8PK 3G2WA 2I1JA 4XI9A 3O35A 2F42A 3I2DA 5H9MA 4HS2A 2OOEA 3CV0A 5BPPA 5T4YA 4O6FA 4B8AA 2WXGA 4AV7A 4GA2A 2Y4TA 4UQZA 1LF8A 4XE0A 1WGMA 4LERA 5G04B 2J4DA 4CT0A 2CG2A 2WXIA 4Q6FA 3S7BA 2NAAA 3C5KA 3AU4A 4AJWA 4R2YA 2J08A 3GV4A 4GZDA 4JL0A 3PEVB 4BX9A 4AIFA 4NQ0A 4AM9A 4YNDA 3KQIA 3ZRHA 4HOSA 3QZVA 5TABA 4GCOA 1HFAA 2DCPA 2HM8A 1JM7A 1DVPA 4TRQA 2YREA 5C2YA 4A1GA 1QZ2A 3APFA 2X6IA 4HXIA 4MKTA 2KE1A 2UY1B 3K9IA 2GRLA 2XGSA 5DIZA 3SOWA 1NA3A 1X4UA 4WWPA 4BX8A 4AYCB 3Q4AB 4KYOB 2VGXA 2VJ8A 3CHQA 4GCNA 4IYPA 4XKCA 4CGWA 3U5MA 3FTUA 2LQ6A 3N9OA 2R59A 3CIAA 4WNDA 5I3LA 3UMVA 2CKLB 3OXFA 2LXHC 2XGOA 2AXUA 4NURA 4ANXA 1U3DA 2CKLA 4I7DA 1ZBPA 1WFKA 3U5OA 3SOUA 3D9PA 2AVPA 4GPKA 3NG2A 2CFZA 1TJCA 3KEZA 3GZSA 2I2OA 5J90A 1VFYA 3D3MA 2KGIA 3FH7A 3MX3A 3ASFA 3IBEA 3ULQA 4EPZA 2X3MA 2VQ2A 2PZIA 4J8EA 2MNYA 3KV5A 1LDJB 2QY7A 2LGKA 2CFUA 4XZ4A 3O70A 4ZDTA 2YT5A 3LJ3A 4HFGA 1WIMA 2WQ6A 2FULA 5ARFA 1NA0A 2L0IA 2KWNA 3MHHA 3CGHA 2ECVA 3I5PA 3IHVA 4FULA 3UX4A 3PUQA 4XI1A 5FB0A 3FU5A 2AWIA 1VYXA 2IOSA 3D9MA 3QWWA 1QQEA 5LKTA 3EJNA 4U04A 2OVFA 1MM3A 3UT7A 1MQSA 2ILRA 3FTSA 2E6RA 1A17A 2RG8A 3KD7A 1N54A 5AIJA 3ZNIA 3LPZA 4PS7A 4BBQA 2L5UA 2MNZA 5T8IA 2QIZA 3JQ1A 3FH8A 4PPEA 4GNGA 2MT5A 3VTYA 4LJNA 3C6WA 1U6GB 2XHEA 3UUXA 2KGGA 2WMNA 2JEKA 4X3GA 2GW1A 1WAO1 2MD7B 4DI3A 5BV0A 3FY4A 1XGWA 4ACLA 3ENEA 3D9OA 3PRZA 5G05B 2YNQA 3SHBA 3L22A 4UP5A 3L13A 2BF0X 3FUNA 3ZVZB 2ECJA 1JPLA 3CHMA 5LFAA 1ZBDB 3G2VA 2XPZA 1EF1C 2VGXB 3ASDA 2VSYA 5D1MB 2L75A 3CVNA 2MIQA 4K0RA 3E4BA 2VNFA 3G2TA 2EQXA 3D9JA 2WVIA 2J4BA 4LADB 4GMJA 4S3OB 3N9PA 3TGOA 3S7FA 2VPBA 3ZPJA 2PNXA 2YU4A 1HYJA 4C0EA 5B79A 1FP0A 1VD4A 4U63A 5FQ7A 3RJVA 3ZHEA 5H1TA 3CVYA 2M63A 2Y1MA 4CA1A 3Q5MA 4UP0A 2CT2A 3SNXA 2A4ZA 1ELWA 3HHMA 3ZTGA 4HOTA 3P1UA 2OV8A 5AYWD 2PM7A 4G25A 1NZNA 1PY1A 1HX8A 4B8CB 2WXMA 2EGPA 2VSXE 5FZSA 2HYZA 3MGBA 2ZU6B 4FJYA 4KVMA 5A7DB 2UZGA 3O33A 5J3XA 1HYIA 3RRNB 4G23A 1WM5A 4YAXA 4N3AA 3CSFA 3RPGC 2UY1A 3ML9A 2PL2A 1HF8A 4XIFA 2LV9A 4MVTA 4PTBA 2ZETC 4UWHA 3FUFA 5EKQD 2J49A 3T5XA 3S2AA 4I9EA 2C2LA 1HS6A 1V87A 1H0AA 2YQ8A 5CCMA 4U8HA 4I6GA 3ZFWA 3PNTB 4FHKA 4FO9A 3ZVYA 2LGGA 4URKA 4WUYA 3D9LA 3CVQA 3B7UX 3LXUX 2V8SE 2WXPA 3P2BA 3GL6A 1Z2QA 3MKRA 3UT8A 3L6AA 3CSTA 3IV0A 1Z60A 3KV6A 4JXTA 3T7LA 2YQMA 2KYUA 4D10C 4YATA 4J8FA 2KCLA 4WWOA 2C0LA 3QARA 5BT1A 1OWPA 3SGHA 4YBTA 3RO2A 5A23A 5J08A 4I6EA 5KJLA 2BAYA 3L1XA 1ZU2A 3MA5A 1E8XA 1LDKC 4GB0A 4A3VA 2C2VS 3FU3A 3QDNA 3PS6A 2M6MA 3EB6A 5KCMA 4BWRA 4A49A 3ZXSA 5H1UA 3SZ7A 3ZPVE 3FTWA 2KWKA 4P29A 2E6SA 2WXRA 4A55A 3FUEA 3DPDA 1JWFA 2XPYA 4JHKA 4MLPA 4FA6A 2I9CA 3CKBA 1HXIA 3V43A 3LY8A 4JHJA 4B7YC 5KH3A 4L7XA 3JYSA 3FFLA 4U0UA 5FQ4A 2L9BA 2VPDA 4K03A 4IULA 1WY6A 4AY6A 4GA1A 4KMOA 4AOFA 4ME2A 5FEYA 3RTRB 3QWPA 4G1TA 3AU5A 2GGFA 4CDNA 3NQPA 3QJZA 4ZQLA 2ECNA 2EODA 2L0BA 2XB1A 5B77A 2CHWA 2FO7A 1NP7A 5G05C 1CHCA 3HCSA 3L54A 4C9ZA 4IC3A 3HTKC 4EZKA 2PM6A 2JMJA 1Z3XA 2V0PA 3EIJA 5ENNA 2R5SA 2LXPC 2YYRA 4H7YA 4PS3A 1Z3YA 4UQXA 4FHJA 4WA6A 4WZ2A 1FVFA 1HE8A 2I6HA 3MV3B 1E7UA 4I6JA 2XQ0A 4CEMA 2UWJG 3CVUA 4GB9A 4KZCA 2MA6A 4G24A 3RU0A 1UG3A 4UI9C 4JW1A 2YSMA 3U3WA 3G2UA 4YBMA 1UJJA 4AP2A 1E8YA 2LRIC 3SOXA 2LN0A 3U64A 2CSYA 5FQ6A 2KWOA 1IYMA 3VTXA 5TBNA 1WEWA 2KR4A 3CVXA 2X6HA 4BT8A 3L16A 1ELRA 4A4BA 5FWQA 2M85A 4UWLA 1WENA 2G45A 2NC9A 2HO1A 3ZEFA 3EDTB 3IHPA 1SZ9A 3SD5A 1WEVA 4N2SA 4TV3A 3OTNA 3FUJA 2KM4A 2WB2A 2YHEA 4HVBA 4G11A 1HU3A 4JC8A 4RG9A 3PUKA 3OXLA 2MUMA 2VJEA 4YC9A 3S7JA 5FERA 5E76A 3QAQA 4JHRA 2X6FA 4J0UA 1EPUA 2E0IA 4GU5A 4WNGA 1OWNA 3O48A 2F6NA 3RPGB 3SHFA 3NZUA 5C13A 3GZ1A 3L08A 4UWKA 2YUCA 2MOWA 3AS4A 4U0SA 2FEZA 1XNFA 5LX8A 4APOA 3PREA 1U3CA 2V5FA 3ASHA 4PDXA 5G0FA 2FUIA 5G55A 1GW6A 2BTDA 2VSOE 4CRWA 2L6JA 3GW4A 5BV1A 3CK8A 2QJ0A 3O34A 1BPOA 2JMIA 3LEWA 3M62A 2WPVA 3CR3A 5LP0A 5LCWB 4QFVA 1E90A 3UT4A 3CHRA 4I7CA 4R7EA 3ZN3A 5JHBA 4FP7A 5EDSA 2D8SA 4AY5A 2H0DB 2BUGA 1S0PA 4GNEA 3QNKA 2ONDA 4HOUA 2P58C 2AN6A 3D9IA 3FHEA 3VK6A 5EX0A 3U5NA 3HVEA 4BT9A 3LQIA 1IQRA 3FU0A 1EDUA 2RD0A 2Y4UA 2WXKA 4FLHA 2FF4A 4IN3B 4GA0A 4CT4A 1JWGA 5KJNA 3TAXA 5H1VA 4FU3A 2YSJA 3ASGA 2V4LA 2KU3A 4TKPB 3FP3A 4JPSA 4NRHB 5C1DA 4TUUA 4I2ZA 1H19A 4B0ZA 4DLOA 4HLEA 3URZA 1INZA 5DINA 3L17A 4KT6B 3O36A 3MKQB 2K4DA 1IQUA 3UQ3A 5G04J 2Y3AA 2VYIA 3HYMB 3ZPV1 3KNVA 3U5PA 2HYED 4GMLA 5B76A 2IU1A 3PE3A 3APDA 4LEUA 1H6KA 3ESKA 3ZYMA 4C0MA 2R17C 2CG3A 2DBAA 2JLBA 2KATA 2LSVA 3JQ0A 1HO8A 3LY9A 4NACA 4GZ3A 1PC2A 4U07A 5E75A 5ARGA 3U66A 2IDAA 3MHSA 4A4CA 4BHWA 1K2FA 2XRZA 3B7SA 4JEHA 4ANVA 4Y6CA 3I3NA 4MS6A 2F6JA 2RI7A 2KCKA 4I1OB 2MRIA 1UN8A 1UW4B 2J07A 3FDHA 3Q49B 4LCTA 3MZLB 4F53A 1T1HA 2MD8C 4GZCA 4L23A 4Q96A 2JMDA 3EIQC 5T3RA 2MA5A 4EZLA 4LRZA 2WXNA 4F1SA 3ML8A 4DK5A 5JJTA 4MSXA 3U9WA 3D9NA 3LYAA 2VTBB 4LK9A 4G2VA 2LDRA 4CCGX 5JJ6A 5CMWA 5B75A 4N39A 2LNIA 1E96B 3QWVA 3ZYKA 4F7AA 5BUZA 1RMDA 3PH0C 2QFCA 5LCWJ 1X4JA 3CVVA 5JG6A 4OVVA 1FVHA 5LOZA 1EYHA 3CVLA 2HR2A 5KJKA 3NF1A 1F62A 2K17A 4GYYA 4HORA 4ANUA 3FUKA 2M1RA 1SQMA 3GZ2A 4WAFA 2XGMA 4XI0A 3VLFA 4C9BB 5AITA 2GRMA 4GYOA 1WE9A 4GNDA 4L2LA 2VPGA 2LGLA 2L0TB 3FEXA 2IQCA 1WEOA 3FUDA 2IF4A 1XWHA 3MJWA 3ZYLA 4GZ5A 4E6HA 2YW8A 4M3OA 4GYWA 5TRBA 4W4UA 2LGVA 1E8ZA 4I9CA 3LQHA 2VGYA 3GYZA 4UQYA 1IYGA 2YURA 3DPLR 3IEGA 5EYAF 3MKQA 2VPEA 2XEVA 2OXQC 2AXVA 3VLDA 4IC2A 2WQHA 4LUNU 3HCUA 4H7XA 4WZ0A 2Y1NA 5G2NA 3ONLA 3D9KA 3RO3A 3TL5A 4FJZA 4DJAA 2ECWA 2WXFA 4QF2A 3I4GA 5D0OD 3HDXA 5LCWC 3FULA 3OXGA 3CVWA 1VDYA 3CK9A 2X6JA 4N4FA 1FBVA 3DBSA 5G05J 3CEQA 1OWOA 3L1ZB 5G04C 5DKAA 1HH8A 5ANRA 1JOCA 3U4TA 2LSUA 3KAEA 5FB1A 3ZYQA 2LAIA 4CDRA 3FUHA 1W3BA 4ILIA 4KBQA 2KFTA 5FZRA 4RVBA 3HCTA 4OYSA 5AENA 1H2TC 1FCHA 2L43A 1E7VA 3VLEA 2AW6A 3FL2A 1UJKA 5D1KB 3AS5A 3MYVA 4ZUXU 2PQRA 5FT9A 1L5JA 4JEUA 3B7TA 1WEUA 2FI7A 2CSZA 2J09A 3CKCA 3FTXA 3RRUA 2RSDA 1JUQA 4W9RA 3ZHEB 4BY6A 4L1BA 1TEZA 3FEYA 1TJFA 2CHXA 1KLXA 4APFA 4P5OB 4WWNA 4AP4A 3TJPA 4EQFA 4YBSA 2WXJA 2DIWA 4NN2A 3I4RB 2FUUA 2XPIA 2VJEB 4G26A 2M3HA 3CQCB 1OUVA 1MM2A 2WXOA 4CGVA 2Q7FA 2LO6A 3N71A 5HI7A 3SBSA 3ZVVA 4FC8A 5AJLA 1G25A 3O37A 3SFZA 4EZJA 5CCLA 3PDNA 5FQ8A 5D0QD 4EECA 3EB5A 3ONKA 4J8SA 4MRUA 3CHSA 3QB2A 4UWFA 4AEZC 4OVUA 1WILA 1SZAA 3MEKA 5FJYA 3SI5A 3CHOA 2YHNA 4RSYA 2XCCA 4I2WA 3S7DA 3G2SA 4L7TA 3R7QA 1MHQA 4KZ0A 1YA0A 3N9QA 2JRJA 2XRYA 5BNWA 2I50A 3B13A 3N9LA 1N52A 2OVBA 5KH9A 3CLJA 4N2QA 1WEQA 5B8DA 1H2UA 4KXKB 4KVOA 4A3TA 4BFRA 3LDZA 5KJMA 2YHOA 3HIZA 4R7LA 4JA9A 1X4IA 3L11A 4U0ZA 1HG2A 4GZ6A 4BSXA 1QNFA 5FTPA 3FUMA 3DQVR 2K1JA 3LCAA 5LKZA 2WM9A 4JA7A 3PURA 1E8WA 4L58A 4UI9B 3C98A 4FJCA 4PS8A 4ILGA 3M63A 4GNFA 5AIUA 2KCVA 2ECTA 1OWLA 5TDWA 4V3LC 4QF3A 1HZ4A 4DPRA 4WZ3B 4JZYA 3Q47B 4HOQA 1DNPA 1WEPA 4IRUA 3BG1B 1Y6IA 3FU6A 3OAWA 4ILHB 5AJDA 2CHZA 3TG5A 5B78A 1WESA 4I43A 1IHGA 4AVXA 2XEUA 1H2VC 1Y8MA 4O64A 3BEEA 4ANWA 5C11A 4Q94A 5A6CA 4ACKA 3ZW3A 3KS2A 1Z6UA 3FWVA 3UPVA 5BW8C 4S3OC 2VSNA 5CHEE 3O4ZA 4PH4B 4DI4A 1JM7B 2EA6A 3LS8A 5LKXA 3EHMA 3FTYA 2QICA 2J9QA 4EBAA 4AYCA 3SF4A 4YVOA 1KT1A 3CQGB 3TXMA 5KH7A 1X5BA 3CK7A 3MCXA 4ATGA 4UWGA 1Z6TA 4BTBA 4DLQA 3LVQE 4F3VA 1E4UA 2LAHA 3HVEB 4I17A 4UI9J 3ASLA 2IOLA 2I1KA 1ELKA 3O7AA 4XKBA 3AS8A 2KZTB 3PE4A 2KZTA 4A0CD 4V3KC 1UN9A 2VTBA 4B86C 3ZIMA 4AUQB 1PAQA 3QK0A 4Q69A 3RKVA 1HG5A 1KT0A 5JHAA 3JCKC 4JVSA 2IJGX 1OWMA 5DBKA 4UI9K 5D1LB 3QOUA 1B89A 3T5VA 3SBTB 4YADA 2KIZA 4PUCA 5ANLA 4A1SA 4E85A 3WXXA 2PUYA 4J8DA 2ECIA 4L2YA 3JUIA 2Y43A 2AXZA 2WXLA 2YINA 3T6RA 5HQ8A 1BORA 2YQLA 2YHCA 1WEEA 3EHNA 3FTZA 2DX8A 4J6IA 3Q15A 4N5CA 2IFUA 3R9AB 4B94A 5FZQA 3LKUA 4CCAA 4EBAG 3M99A 3PUJA 4N3WA 2VJFA 4WNFA 3NZSA 3LRQA 2VJFB 3APCA 3R7RA 4GAAA 5M72A 3ESLA 2WXHA 4FLBA 2NXPA 4N3CA 3FTVA 4YVQC 3MV2B 3RK6A 2ECGA 2K16A 4CDMA 3IKOB 5CMYA 3FH5A 3RIBA 3LVRE 3PNLB 2X38A 4N3BA 4LKAA 2WMOA 3PHDA 4WNEA 3FUIA 4FADA 3CVPA 3RRMB 1N87A 3BG0B 2FSAA 3LQJA 3N9MA 3QC1A 1P5QA 2E2EA 2XCBA 5JJ7A 3PZDA 4I1AA 2FBNA 3QKYA 2HDPA 2KC7A 1WEMA 4V3IA 4FK5A 2KWJA 2MHKA 4LLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L80 A;  2G43 A;  3N9N A;  4F52 B;  2H0D A;  4YAB A;  2VP7 A;  5LKU A;  2KRE A;  4I7B A;  2G6Q A;  5TDR A;  4FIP A;  4R8P K;  3G2W A;  3O35 A;  2F42 A;  3I2D A;  5H9M A;  1LF8 A;  1WGM A;  5G04 B;  4Q6F A;  2NAA A;  3C5K A;  4R2Y A;  3GV4 A;  4GZD A;  5TAB A;  3QZV A;  3KQI A;  1HFA A;  2DCP A;  1JM7 A;  1DVP A;  2YRE A;  2KE1 A;  3SOW A;  1X4U A;  4AYC B;  3U5M A;  2LQ6 A;  3N9O A;  5I3L A;  2CKL B;  2LXH C;  2CKL A;  4I7D A;  1WFK A;  3U5O A;  3SOU A;  3D9P A;  3NG2 A;  1VFY A;  2L5U A;  2KGI A;  3KV5 A;  2MNY A;  1LDJ B;  2QY7 A;  2LGK A;  3O70 A;  2YT5 A;  4HFG A;  1WIM A;  2L0I A;  2KWN A;  3MHH A;  2ECV A;  3PUQ A;  4XI1 A;  5FB0 A;  1VYX A;  3D9M A;  5LKT A;  1MM3 A;  2E6R A;  3ZNI A;  4BBQ A;  2MNZ A;  2QIZ A;  4PPE A;  4GNG A;  2MT5 A;  4LJN A;  3C6W A;  1U6G B;  2KGG A;  4X3G A;  2MD7 B;  1XGW A;  5G05 B;  3D9O A;  3SHB A;  4UP5 A;  2BF0 X;  3ZVZ B;  2ECJ A;  1JPL A;  1ZBD B;  3G2V A;  5D1M B;  2L75 A;  2MIQ A;  2VNF A;  3G2T A;  3D9J A;  4S3O B;  4LAD B;  3N9P A;  2VPB A;  2PNX A;  2YU4 A;  1HYJ A;  5B79 A;  1FP0 A;  1VD4 A;  5H1T A;  2Y1M A;  4CA1 A;  4UP0 A;  2CT2 A;  3ZTG A;  2EGP A;  1PY1 A;  1HX8 A;  2UZG A;  3O33 A;  5J3X A;  1HYI A;  4YAX A;  3RPG C;  1HF8 A;  2LV9 A;  4MVT A;  4PTB A;  2ZET C;  1V87 A;  2C2L A;  1H0A A;  4FO9 A;  3ZVY A;  2LGG A;  3D9L A;  3GL6 A;  2V8S E;  3KV6 A;  1Z2Q A;  1Z60 A;  4JXT A;  3T7L A;  2YQM A;  2KYU A;  4YAT A;  4YBT A;  5J08 A;  2BAY A;  3L1X A;  1LDK C;  4GB0 A;  2C2V S;  2M6M A;  3EB6 A;  4A49 A;  5H1U A;  3ZPV E;  2KWK A;  2E6S A;  1JWF A;  3V43 A;  5KH3 A;  4B7Y C;  4L7X A;  2VPD A;  5FEY A;  3RTR B;  4ZQL A;  2ECN A;  2EOD A;  2L0B A;  2XB1 A;  5B77 A;  1CHC A;  3HCS A;  4C9Z A;  4IC3 A;  3HTK C;  2JMJ A;  2YYR A;  2LXP C;  4WA6 A;  4WZ2 A;  2MA6 A;  2YSM A;  3G2U A;  4YBM A;  1UJJ A;  2LRI C;  3SOX A;  2LN0 A;  2CSY A;  2KWO A;  1IYM A;  5TBN A;  1WEW A;  2KR4 A;  4A4B A;  2M85 A;  1WEN A;  2G45 A;  2KWJ A;  3IHP A;  1SZ9 A;  1WEV A;  2KM4 A;  2MUM A;  2VJE A;  4YC9 A;  5FER A;  2F6N A;  3RPG B;  5C13 A;  2YUC A;  2MOW A;  5G0F A;  2FUI A;  2QJ0 A;  3O34 A;  2JMI A;  3M62 A;  5LP0 A;  5LCW B;  4R7E A;  4I7C A;  2D8S A;  2H0D B;  4GNE A;  2AN6 A;  3VK6 A;  3D9I A;  3U5N A;  3LQI A;  1EDU A;  5H1V A;  1JWG A;  4FU3 A;  2YSJ A;  2KU3 A;  4TKP B;  1INZ A;  5DIN A;  3O36 A;  2K4D A;  3U5P A;  3ZPV 1;  3KNV A;  2HYE D;  5B76 A;  3ZYM A;  4NAC A;  4A4C A;  2IDA A;  3MHS A;  4BHW A;  1K2F A;  2F6J A;  2MD8 C;  1T1H A;  4GZC A;  4Q96 A;  2JMD A;  2MA5 A;  4MSX A;  3D9N A;  4LK9 A;  2LDR A;  4CCG X;  5CMW A;  5B75 A;  3ZYK A;  1RMD A;  5JG6 A;  1X4J A;  5LOZ A;  1EYH A;  1F62 A;  2K17 A;  2M1R A;  5AIT A;  1WE9 A;  4GND A;  2VPG A;  2LGL A;  2L0T B;  1WEO A;  1XWH A;  3ZYL A;  2YW8 A;  5TRB A;  4W4U A;  2LGV A;  3LQH A;  2YUR A;  5EYA F;  3DPL R;  2VPE A;  2OXQ C;  4IC2 A;  3HCU A;  4WZ0 A;  2Y1N A;  3ONL A;  3D9K A;  4QF2 A;  2ECW A;  1VDY A;  4N4F A;  1FBV A;  3L1Z B;  5DKA A;  1JOC A;  5FB1 A;  3ZYQ A;  2KFT A;  3HCT A;  2L43 A;  3FL2 A;  5D1K B;  1UJK A;  4ZUX U;  1WEU A;  2CSZ A;  2RSD A;  3RRU A;  1JUQ A;  4P5O B;  4AP4 A;  4YBS A;  4NN2 A;  2DIW A;  2FUU A;  2VJE B;  2M3H A;  1MM2 A;  2LO6 A;  1G25 A;  3O37 A;  3EB5 A;  3ONK A;  1WIL A;  1SZA A;  2YHN A;  3G2S A;  1MHQ A;  3N9Q A;  2JRJ A;  5KH9 A;  2I50 A;  3N9L A;  3CLJ A;  1WEQ A;  5B8D A;  3LDZ A;  2YHO A;  1X4I A;  3L11 A;  1HG2 A;  3DQV R;  2K1J A;  5LKZ A;  3PUR A;  4L58 A;  4UI9 B;  5AIU A;  4FJC A;  4GNF A;  3M63 A;  2ECT A;  5TDW A;  4V3L C;  4QF3 A;  4WZ3 B;  1WEP A;  5B78 A;  1WES A;  4AVX A;  2XEU A;  4O64 A;  5C11 A;  4Q94 A;  1Z6U A;  4S3O C;  1JM7 B;  2EA6 A;  5LKX A;  2QIC A;  4AYC A;  5KH7 A;  1X5B A;  1E4U A;  3ASL A;  1ELK A;  3O7A A;  4A0C D;  4V3K C;  4B86 C;  4AUQ B;  1HG5 A;  5D1L B;  4ZDT A;  4YAD A;  2KIZ A;  2PUY A;  2ECI A;  2Y43 A;  3T6R A;  1BOR A;  2YQL A;  1WEE A;  2DX8 A;  3M99 A;  4N3W A;  2VJF A;  3LRQ A;  2VJF B;  4FLB A;  2ECG A;  2K16 A;  5CMY A;  4LKA A;  3PHD A;  1N87 A;  2FSA A;  3LQJ A;  3N9M A;  2HDP A;  1WEM A;  4FK5 A;  2RI7 A;  4LLB A; 
#chains in the Genus database with same CATH topology
 4F52 B;  3TXN A;  1RZ4 A;  4Y6W A;  3CHP A;  2NSZ A;  5LKU A;  3E2D A;  1WG0 A;  4GTP A;  2PQN A;  3I2D A;  3Q79 A;  3CV0 A;  4L9P A;  4XE0 A;  4CT0 A;  3S7B A;  3AU4 A;  3UKU G;  5SVI B;  4AIF A;  3FJU B;  3QZV A;  4YND A;  4YDO A;  2HM8 A;  1JM7 A;  4TRQ A;  3ZUV B;  2GRL A;  2XGS A;  5KBA A;  4WWP A;  3Q4A B;  2VGX A;  2VJ8 A;  2LQ6 A;  3N9O A;  2R59 A;  3UMV A;  3OXF A;  4ANX A;  1U3D A;  3U5O A;  2L5U A;  1TJC A;  5J90 A;  2P9K G;  4EPZ A;  2X3M A;  3KV5 A;  2QY7 A;  3H7H A;  3O70 A;  2KWN A;  2ECV A;  3I5P A;  4BEP A;  5FB0 A;  2AWI A;  1VYX A;  3Q1D A;  4O62 A;  2Y1L E;  1MQS A;  2ILR A;  3FTS A;  3Q9U C;  4BET A;  5AQA A;  1WDY A;  4O1P A;  2MNZ A;  1TN6 A;  3NAW A;  5KNH D;  2PNN A;  4LJN A;  1U6G B;  1RW2 A;  2JEK A;  2H6I A;  4DI3 A;  5G05 B;  1FPP A;  3D9O A;  3PRZ A;  4UP5 A;  3ZVZ B;  2XPZ A;  2VSY A;  5D1M B;  4DX1 A;  3CVN A;  2VNF A;  2KBX A;  2EQX A;  2J4B A;  3TGO A;  2VPB A;  5JMN D;  3BU8 A;  3HRA A;  1VD4 A;  5FQ7 A;  3RJV A;  3CVY A;  2Y1M A;  4CA1 A;  3SNX A;  1TN7 A;  3ZTG A;  4HOT A;  3P1U A;  2HYZ A;  4GTS A;  1WM5 A;  4YAX A;  5CRV A;  2PL2 A;  2LV9 A;  4XIF A;  2ZET C;  1O1S A;  5EKQ D;  2J49 A;  1N95 A;  3S2A A;  2LXM A;  5CCM A;  3PNT B;  2LAU A;  3DEO A;  4WUY A;  2CRR A;  3BQO A;  2WXP A;  3GL6 A;  4F6R D;  3MKR A;  3UT8 A;  5B3S E;  3IV0 A;  2XEN A;  3T7L A;  4D10 C;  4YAT A;  4WWO A;  5BT1 A;  3RO2 A;  5A23 A;  2P9I G;  1LTX A;  3EB6 A;  4A49 A;  3ZPV E;  4P29 A;  1D8D A;  4A55 A;  5HKP A;  1JCQ A;  5KH3 A;  4HRN A;  4JHJ A;  4U0U A;  3PZ3 A;  2L9B A;  2VPD A;  4AY6 A;  5FEY A;  3X2Q E;  2GGF A;  2ECN A;  2EOD A;  1UOH A;  2H6G A;  4C9Z A;  3HTK C;  5ENN A;  2LXP C;  4WA6 A;  4FHJ A;  1HE8 A;  2UWJ G;  4GB9 A;  2XS1 A;  4G24 A;  2YSM A;  3U3W A;  4YBM A;  4AP2 A;  2KWO A;  5FQ6 A;  5TBN A;  3CVX A;  3L16 A;  1ELR A;  2FO1 E;  3ZEF A;  3IHP A;  1LD8 A;  1SZ9 A;  1WEV A;  5ENO D;  5KWD A;  4TV3 A;  3OTN A;  2KM4 A;  2WB2 A;  2MUM A;  4YC9 A;  1HU3 A;  5FER A;  4GU5 A;  1OWN A;  1LD7 A;  4HBD A;  1XNF A;  5LX8 A;  3PRE A;  2L6J A;  2QJ0 A;  3T9K A;  5LP0 A;  5LCW B;  3UT4 A;  4I7C A;  1N94 A;  2EIK E;  1MJ0 A;  4AY5 A;  2BUG A;  1S0P A;  3D9I A;  5EX0 A;  3ZKJ A;  1OXJ A;  1K1B A;  2Y4U A;  2WXK A;  2XOY A;  4GA0 A;  1JWG A;  3ASG A;  2V4L A;  4TUU A;  1H19 A;  4B0Z A;  4HLE A;  3URZ A;  4KT6 B;  3O36 A;  3MKQ B;  1IQU A;  2VYI A;  3PE3 A;  1H6K A;  3ZYM A;  4HRM B;  3TWQ A;  2KAT A;  3SO8 A;  1K2F A;  2RKK A;  2J07 A;  3Q49 B;  4F53 A;  4GZC A;  4Q96 A;  2MA5 A;  4EZL A;  4LRZ A;  5JJT A;  4G2V A;  2LDR A;  4CCG X;  5CER B;  5CMW A;  3C3R A;  1E96 B;  4U8V D;  3ZYK A;  4F7A A;  3PH0 C;  3J5P A;  1N11 A;  4QQI A;  3CVL A;  2K17 A;  4GYY A;  1SQM A;  3GZ2 A;  2XGM A;  3HXB A;  3VLF A;  2OWA A;  5AIT A;  2GRM A;  4GYO A;  4GND A;  4L2L A;  2LGL A;  2IQC A;  4E6H A;  4GYW A;  1E8Z A;  1IYG A;  3DPL R;  4HNA D;  1FT2 A;  2Y1N A;  5G2N A;  3ULY A;  4QF2 A;  2WXF A;  3LJN A;  3I4G A;  1VDY A;  1FBV A;  5G05 J;  3CEQ A;  1NI1 A;  5G04 C;  3U4T A;  2LSU A;  3DST A;  5FB1 A;  4CDR A;  1W3B A;  3E37 A;  5FZR A;  4OYS A;  1H2T C;  3V2O A;  5D1K B;  3C5R A;  4ZUX U;  4GPM A;  3FM8 C;  3FEY A;  1TJF A;  4P5O B;  4BES A;  2FUU A;  1H6P A;  2M3H A;  1JCS A;  2P9L G;  3Q7F A;  2WXO A;  3Q9N C;  5HI7 A;  4FC8 A;  2EIJ E;  4LNU D;  3SFZ A;  3PDN A;  4EEC A;  5SVY A;  3HXE A;  4J8S A;  4MRU A;  5ENP D;  1WIL A;  3SI5 A;  1S64 A;  3R7Q A;  4KZ0 A;  2XRY A;  3N9L A;  1N52 A;  5B8D A;  5CEA A;  1H2U A;  4KXK B;  2DZO A;  2ETB A;  3FUM A;  2KKY A;  2WM9 A;  5AIU A;  4GTV A;  5AN8 A;  2ECT A;  1BI7 B;  5AQ9 A;  4QF3 A;  4WZ3 B;  1O5M A;  3Q47 B;  4HOQ A;  2LUH A;  5AJD A;  3UTM A;  4AVX A;  2XEU A;  1H2V C;  5C11 A;  4Q94 A;  3UPV A;  4S3O C;  1JM7 B;  5LKX A;  3LS8 A;  3EHM A;  3FTY A;  2J9Q A;  4EBA A;  5KH7 A;  3ASO E;  3TXM A;  1X5B A;  3MCX A;  4ATG A;  3DRA A;  4F3V A;  3ABL E;  3TWX A;  3Q7A A;  4I17 A;  2IOL A;  1ELK A;  3PZ4 A;  3AS8 A;  4V3K C;  3HXD A;  3RKV A;  4JVS A;  5EIL A;  2PUY A;  2YIN A;  2DSM A;  1BOR A;  4CCA A;  4N3W A;  2VJF A;  3R7R A;  3ESL A;  3MDB C;  2K16 A;  2V5Q C;  4U96 D;  4WNE A;  3FUI A;  2GRN B;  3RRM B;  3BG0 B;  3N9M A;  4I1A A;  2FBN A;  4I1M A;  2G43 A;  3PVL A;  2L80 A;  3LY7 A;  4ABN A;  3N9N A;  1TNO A;  2A5U A;  2ION A;  4RG6 A;  3T8M A;  3ZGQ A;  2WXQ A;  4R8P K;  3G2W A;  5AAR A;  3O35 A;  3UM2 A;  4HS2 A;  5ENS D;  4O6F A;  2Y4T A;  1LF8 A;  2J4D A;  3FEH A;  4AJW A;  3GV4 A;  5HRY A;  4JL0 A;  4BX9 A;  5BXU A;  4GCO A;  4A1G A;  1QZ2 A;  1SW6 A;  3K9I A;  1NA3 A;  4AYC B;  4CGW A;  4IYP A;  4MBG A;  4WND A;  3DSV A;  2LXH C;  2XGO A;  2CKL A;  1ZBP A;  3SOU A;  3D9P A;  2AVP A;  2F37 A;  2OCC E;  2KGI A;  3ULQ A;  3NBN B;  3ASF A;  3IBE A;  3KEA A;  4J8E A;  2PZI A;  3AG1 E;  1LDJ B;  3LJ3 A;  4HFG A;  2FUL A;  5ARF A;  3CGH A;  4FUL A;  2FD4 A;  3FU5 A;  2R05 A;  2IOS A;  3QWW A;  1QQE A;  3EJN A;  4U04 A;  2XP0 A;  4YDW A;  4U95 D;  1SA4 A;  3KD7 A;  2E6R A;  3ULE G;  3PZ2 A;  4PS7 A;  5ENQ D;  3VTY A;  3UUX A;  2WMN A;  3NB2 A;  4ACL A;  1XGW A;  3SHB A;  1D9S A;  3L22 A;  3L13 A;  2BF0 X;  3FAN A;  2ECJ A;  1EF1 C;  3ASD A;  4F1P A;  2L75 A;  4K0R A;  3D9J A;  4LAD B;  4GMJ A;  3N9P A;  3UM1 A;  2PNX A;  3KDE C;  2YU4 A;  1HYJ A;  1FP0 A;  3ZHE A;  4BSZ B;  2CT2 A;  1OCR E;  4G25 A;  1NZN A;  1PY1 A;  2UZG A;  2ZU6 B;  3O33 A;  3EHQ A;  4G23 A;  2ZGG A;  1HF8 A;  3ZNG A;  3TWR A;  3HXF A;  1V87 A;  2C2L A;  1DCQ A;  4FHK A;  2LGG A;  3D9L A;  3B7U X;  1Z2Q A;  3UIO C;  3L6A A;  3CST A;  5CEC B;  2YQM A;  3QAR A;  1OWP A;  2RFA A;  4YBT A;  4I6E A;  2BAY A;  3L1X A;  1ZU2 A;  4A3V A;  2C2V S;  3FU3 A;  3PS6 A;  2M6M A;  4GTM A;  5KCM A;  1MYO A;  1JWF A;  2XPY A;  3CKB A;  3V43 A;  1HXI A;  4B7Y C;  1V55 E;  5FQ4 A;  5EYL A;  1WY6 A;  5B1A E;  3QWP A;  5B77 A;  2FO7 A;  5G05 C;  1AP7 A;  3HCS A;  3L54 A;  4EZK A;  2JMJ A;  1Z3X A;  2YYR A;  3EIJ A;  4H7Y A;  4WZ2 A;  3MV3 B;  1E7U A;  4I6J A;  2XQ0 A;  3RU0 A;  1UJJ A;  1TYQ G;  1E8Y A;  4GTT A;  1WEW A;  2EXU A;  4A4B A;  5FWQ A;  4UWL A;  2CRW A;  3SD5 A;  4N2S A;  3DSS A;  3FUJ A;  1N9A A;  4G11 A;  2VJE A;  4JC8 A;  3QAQ A;  4JHR A;  2E0I A;  3DWL G;  5C13 A;  2YUC A;  3L08 A;  4U0S A;  3AS4 A;  4HB5 A;  5AQ7 A;  5G0F A;  2FUI A;  2BTD A;  2BED A;  3CK8 A;  5CBO A;  2WPV A;  1SVX A;  4R7E A;  3CHR A;  3UI2 A;  5EDS A;  4N5Q A;  3DXM G;  4GNE A;  1QYM A;  2P58 C;  3U5N A;  2ZXW E;  3FU0 A;  2RD0 A;  4IN3 B;  1OCC E;  5H1V A;  3TAX A;  2YSJ A;  2KU3 A;  4JPS A;  4JD2 G;  4NRH B;  5C1D A;  1INZ A;  3DSW A;  2ETA A;  3LDY A;  2IU1 A;  4C0M A;  4YDE A;  2NYJ A;  3JQ0 A;  1K3Z D;  2JLB A;  4U07 A;  5E75 A;  2IDA A;  3MHS A;  2GRO B;  4JEH A;  4ANV A;  4Y6C A;  4MS6 A;  2F6J A;  2MRI A;  3FDH A;  2JM3 A;  5T3R A;  4F1S A;  3ML8 A;  3D9N A;  4LK9 A;  5JJ6 A;  2LNI A;  3QWV A;  5CRU A;  5BUZ A;  5LCW J;  4OVV A;  4ZFH A;  2HR2 A;  2A5E A;  2XS8 A;  2XOZ A;  4ANU A;  2M1R A;  4WAF A;  1NL4 A;  4XI0 A;  4C9B B;  1WE9 A;  3NOC D;  3FEX A;  4OGE A;  1WEO A;  2ETC A;  2VGY A;  2YUR A;  4UQY A;  3IEG A;  2VPE A;  2XEV A;  2OXQ C;  3VLD A;  3C72 A;  4IC2 A;  1Z5S C;  4LUN U;  4H7X A;  1MBM A;  3ONL A;  4DJA A;  5LCW C;  3OXG A;  2XZT G;  4N4F A;  1OWO A;  1JOC A;  3ZYQ A;  2LAI A;  3FUH A;  4KBQ A;  4OGC A;  1FCH A;  2AW6 A;  3FL2 A;  2KKX A;  2PQR A;  1L5J A;  1WEU A;  2FI7 A;  4L1B A;  1TEZ A;  4WWN A;  2DIW A;  4DUI A;  2B0O E;  3SBS A;  4K5B A;  3ZVV A;  3DSU A;  5CCL A;  5FQ8 A;  5D0Q D;  1A5E A;  3CHS A;  4OVU A;  3CHO A;  2XCC A;  4I2W A;  2EIN E;  3G2S A;  4L7T A;  1MHQ A;  1YA0 A;  3N9Q A;  5KH9 A;  4BFR A;  3LDZ A;  3HIZ A;  4R7L A;  1HG2 A;  4GZ6 A;  2RFM A;  5FTP A;  4TXP A;  4BER A;  3LCA A;  4L58 A;  4UI9 B;  3C98 A;  4GNF A;  3M63 A;  4C48 B;  2KCV A;  1OWL A;  4V3L C;  1HZ4 A;  4DPR A;  4IRU A;  3BG1 B;  2HE0 A;  3FU6 A;  3TG5 A;  2VGE A;  1WES A;  4I43 A;  1IHG A;  1Y8M A;  1O1R A;  2XEE A;  4O64 A;  4ACK A;  2VSN A;  4PH4 B;  4AYC A;  3SF4 A;  3CK7 A;  4BTB A;  2LAH A;  2I1K A;  3SFX A;  3O7A A;  3HG0 D;  3M7K A;  3QK0 A;  3JCK C;  5DBK A;  5D1L B;  3UM3 A;  4UI9 K;  3T5V A;  4YAD A;  4A1S A;  4E85 A;  1IXV A;  3E34 A;  2WXL A;  2P9N G;  2YHC A;  1KZP A;  4J6I A;  4B94 A;  3M99 A;  2IFU A;  2JUN A;  3PUJ A;  3NZS A;  2VJF B;  4GAA A;  2V4H C;  5M72 A;  4N3C A;  4FLB A;  1H6O A;  4CDM A;  5CMY A;  3FH5 A;  3RIB A;  2WMO A;  3DXK G;  2DYS E;  3CVP A;  1N87 A;  3QC1 A;  3T8K A;  1P5Q A;  2GRR B;  2KC7 A;  1WEM A;  2R2L A;  4V3I A;  3Q78 A;  2KWJ A;  3IHY A;  5EX3 A;  2H0D A;  3PEU B;  4XX5 A;  2X6K A;  4BTA A;  2Y0B G;  2KRE A;  2C0M A;  3TG4 A;  4B89 A;  4I7B A;  1JCR A;  3EU9 A;  4FIP A;  5TDR A;  4XI9 A;  2P57 A;  5H9M A;  2F8X K;  5BPP A;  4B8A A;  3TWW A;  4AV7 A;  4A63 B;  4UQZ A;  1WGM A;  4LER A;  2WXI A;  4R2Y A;  2J08 A;  4GZD A;  3PEV B;  3DDT A;  4AM9 A;  4NQ0 A;  1FT1 A;  3ZRH A;  4HOS A;  1HFA A;  2DCP A;  2YRE A;  5C2Y A;  4MKT A;  2X6I A;  1MX4 A;  2KE1 A;  2UY1 B;  5DIZ A;  4BX8 A;  4O1O A;  4KYO B;  1OCO E;  4GCN A;  3U5M A;  1TNU A;  1KPS B;  5I3L A;  4NUR A;  2AXU A;  2QC9 A;  2CFZ A;  3KEZ A;  2I2O A;  3D3M A;  3FH7 A;  3MX3 A;  4ATZ D;  4HQD A;  2VQ2 A;  2MNY A;  2CFU A;  4XZ4 A;  4YDY A;  1WIM A;  2WQ6 A;  1IKN D;  1N4S A;  3PUQ A;  4XI1 A;  3D9M A;  3PZ1 A;  5LKT A;  2OVF A;  3UT7 A;  3JXI A;  3SFY A;  1A17 A;  2RG8 A;  2D8U A;  1N54 A;  5T8I A;  2QIZ A;  4PPE A;  2CON A;  1OT8 A;  2MT5 A;  4H9D A;  2DYR E;  3C6W A;  2XHE A;  1WAO 1;  2MD7 B;  5BV0 A;  3FY4 A;  3ENE A;  2YNQ A;  5IY5 E;  4JB8 P;  3FUN A;  1JPL A;  1ZBD B;  3G2V A;  1YMP A;  2JAB A;  2MIQ A;  3E4B A;  2CSV A;  3G2T A;  3ZPJ A;  1TNZ A;  3Q5M A;  4UP0 A;  1ELW A;  3HHM A;  1HX8 A;  4B8C B;  3SUB A;  5FZS A;  3MGB A;  4FJY A;  5A7D B;  1HYI A;  3ML9 A;  4MVT A;  3FUF A;  3T5X A;  3PLW A;  2MYO A;  2YQ8 A;  1OCZ E;  4U8H A;  3R9M A;  3AG3 E;  1DCE A;  3P2B A;  1Z60 A;  1MX2 A;  4JXT A;  1TR4 A;  2KYU A;  4J8F A;  2KCL A;  3SGH A;  4U7E B;  5J08 A;  5KJL A;  4GB0 A;  1E8X A;  3QDN A;  3SZ7 A;  2YVR A;  2QYU A;  3FTW A;  2KWK A;  4DX6 D;  2I9C A;  4L7X A;  4TXQ A;  5SVI A;  4AOF A;  4ME2 A;  3RTR B;  4G1T A;  4CDN A;  2LXL A;  4ZQL A;  2XB1 A;  1NP7 A;  1CHC A;  4IC3 A;  2PM6 A;  4PS3 A;  1FVF A;  2I6H A;  4KZC A;  3TWS A;  3U64 A;  1IYM A;  3WG7 E;  2KR4 A;  2X6H A;  2ZIS A;  4BT8 A;  3TWT A;  3L9T A;  3JXJ A;  3DEP A;  4CYM D;  4XEI G;  4HVB A;  4RG9 A;  3S7J A;  5E76 A;  5H7P A;  5SVX A;  3O48 A;  3RPG B;  3GZ1 A;  4UWK A;  2MOW A;  5EYP F;  2BKG A;  4PDX A;  2VSO E;  4CRW A;  3GW4 A;  3O34 A;  1BPO A;  2JMI A;  3CR3 A;  1E90 A;  3EU5 A;  4J7W A;  3QNK A;  2OND A;  4HOU A;  2AN6 A;  3VK6 A;  3FHE A;  3HVE A;  3LQI A;  1IQR A;  2FFW A;  1EDU A;  4FLH A;  4CT4 A;  4FU3 A;  4TKP B;  4TUM A;  3FP3 A;  2L7P A;  4I2Z A;  4O60 A;  3L17 A;  2K4D A;  3UQ3 A;  3D9H A;  5G04 J;  2Y3A A;  3U5P A;  3HYM B;  3KNV A;  2HYE D;  4GML A;  5B76 A;  4LEU A;  2R17 C;  2DBA A;  3LY9 A;  1HO8 A;  4GZ3 A;  1PC2 A;  3U66 A;  2XRZ A;  2IEJ A;  3I3N A;  2KCK A;  1TNY A;  1BI8 B;  1UN8 A;  1UW4 B;  4LG6 A;  4LCT A;  2MD8 C;  4L23 A;  2JMD A;  3EIQ C;  4MSX A;  3U9W A;  3E30 A;  1RMD A;  1K8K G;  1N4R A;  1EYH A;  4HOR A;  3FUK A;  3HXC A;  1AWC B;  2VPG A;  3FUD A;  2IF4 A;  1XWH A;  3AG4 E;  2YW8 A;  1BD8 A;  4M3O A;  5TRB A;  3V79 K;  4I9C A;  5EYA F;  3MKQ A;  4LSZ E;  2AXV A;  2ECW A;  3V30 A;  5D0O D;  3HDX A;  3FUL A;  3CVW A;  3RSE G;  1BLX B;  2X6J A;  2P2C P;  3DBS A;  4DX7 D;  3L1Z B;  5ANR A;  4ILI A;  4RVB A;  3UKR G;  5EN5 D;  2L43 A;  3B7T A;  3CKC A;  1JUQ A;  4W9R A;  3V31 A;  2CHX A;  4APF A;  4QQ4 A;  4AP4 A;  4NN2 A;  4ZHB A;  3CQC B;  1MM2 A;  4CGV A;  2Q7F A;  2MKE A;  3N71 A;  5AJL A;  1G25 A;  1KZO A;  3O37 A;  4K5C A;  3EB5 A;  3ONK A;  1D8E A;  4Z0O A;  4UWF A;  1S63 A;  3NOG D;  1SZA A;  3MEK A;  5FJY A;  3UIP C;  4EHM A;  4RSY A;  3JUE A;  2F8Y A;  2JRJ A;  5BNW A;  3B13 A;  3CLJ A;  1N4P A;  4KVO A;  4A3T A;  2YHO A;  1O1T A;  1X4I A;  3L11 A;  1QNF A;  3DQV R;  5BXO A;  4HLL A;  4JA7 A;  3ZXP A;  1E8W A;  3AAA C;  4FJC A;  4ILG A;  4LNG A;  1MZC A;  4JZY A;  1DNP A;  3OAW A;  4ILH B;  3Q75 A;  2CHZ A;  5B78 A;  5D66 A;  5A6C A;  1Z6U A;  3BUA A;  2H6H A;  3KS2 A;  3EUV A;  3ABM E;  5CHE E;  5EIB E;  2QIC A;  4GTR A;  2F0Y A;  4YVO A;  1Z6T A;  3LVQ E;  1E4U A;  3ASL A;  2OEV A;  1UN9 A;  2VTB A;  4B86 C;  2IJG X;  4TXR A;  1B89 A;  2KIZ A;  3J5Q B;  4PUC A;  5ANL A;  3WXX A;  4J8D A;  4U8Y D;  5HQ8 A;  2YQL A;  1WEE A;  3FTZ A;  3Q15 A;  3R9A B;  5B1B E;  5FZQ A;  3LKU A;  5D2M C;  4M7C A;  4WNF A;  2ZGD A;  2R03 A;  3LRQ A;  3RK6 A;  3DWD A;  2XEH A;  1V54 E;  3PNL B;  4LKA A;  5AAO A;  2FSA A;  3LQJ A;  3DSX A;  1S70 B;  5JA4 D;  3PZD A;  2HDP A;  3KSL A;  2RI7 A;  4LLB A;  5K3Q A;  2L6B A;  4YAB A;  4AXH A;  2WQ7 A;  2VP7 A;  2G6Q A;  5ITZ F;  3B7R L;  2AJA A;  2I1J A;  1DC2 A;  2F42 A;  2OOE A;  5T4Y A;  3DPY A;  4DX5 D;  2WXG A;  4GA2 A;  5CED B;  5G04 B;  2CG2 A;  4Q6F A;  2NAA A;  3C5K A;  5TAB A;  3KQI A;  3B7B A;  2XOC A;  1DVP A;  1N4Q A;  3IXE A;  3APF A;  4HXI A;  5FIO A;  3SOW A;  1X4U A;  3CHQ A;  4XKC A;  3FTU A;  3CIA A;  1N0Q A;  2CKL B;  3B95 A;  4I7D A;  1WFK A;  4GPK A;  3NG2 A;  1VFY A;  3GZS A;  3W9F A;  2LGK A;  2YT5 A;  1NA0 A;  2L0I A;  3MHH A;  3IHV A;  3UX4 A;  4G8L A;  4DX2 A;  2QYJ A;  1MM3 A;  4Z68 A;  5AIJ A;  3ZNI A;  3LPZ A;  4BBQ A;  3JQ1 A;  3FH8 A;  1BU9 A;  4CZ2 D;  4GNG A;  2KGG A;  4X3G A;  2GW1 A;  4GMR A;  4OAU C;  3CHM A;  3KSQ A;  5LFA A;  2VGX B;  2KXP C;  2GRQ B;  2WVI A;  2B6C A;  4S3O B;  3S7F A;  3Q73 A;  4C0E A;  5B79 A;  4U63 A;  5H1T A;  2M63 A;  4K5A B;  2A4Z A;  5AYW D;  2OV8 A;  2EGP A;  2PM7 A;  2WXM A;  4HI8 A;  2VSX E;  4KVM A;  5J3X A;  2EIL E;  3RRN B;  2BKK B;  4N3A A;  2R02 A;  3CSF A;  3RPG C;  2UY1 A;  2P9P G;  4PTB A;  4UWH A;  4I9E A;  4NIK A;  1HS6 A;  1H0A A;  4FO9 A;  4I6G A;  3ZFW A;  3ZVY A;  4URK A;  1K1A A;  3CVQ A;  3L82 A;  2V8S E;  2P9U G;  3LXU X;  5KNG A;  4RLY A;  3KV6 A;  3C3O A;  2C0L A;  3ABK E;  1LDK C;  3MA5 A;  4HRL A;  5H1U A;  4BWR A;  1TNB A;  3ZXS A;  2E6S A;  2WXR A;  3FUE A;  3DPD A;  4JHK A;  4MLP A;  4FA6 A;  2QZA A;  2OEW A;  3LY8 A;  3SQV A;  1G3N B;  3FFL A;  3JYS A;  4K03 A;  4IUL A;  4GA1 A;  4KMO A;  5HS0 A;  3AU5 A;  3NQP A;  3QJZ A;  2L0B A;  2CHW A;  2V0P A;  2R5S A;  2DVW A;  4UQX A;  1Z3Y A;  4CEM A;  3CVU A;  2MA6 A;  1UG3 A;  4UI9 C;  4JW1 A;  3G2U A;  2LRI C;  3UM0 A;  3SOX A;  2LN0 A;  2CSY A;  3VTX A;  1Q2Z A;  2M85 A;  1WEN A;  2G45 A;  2NC9 A;  2HO1 A;  3EDT B;  2YHE A;  3PUK A;  3OXL A;  1TN8 A;  1NFI E;  2Y69 E;  2GRP B;  3FAO A;  2X6F A;  4J0U A;  1EPU A;  4WNG A;  2F6N A;  3SHF A;  3NZU A;  2H6F A;  2FEZ A;  4APO A;  1U3C A;  2V5F A;  3ASH A;  5G55 A;  1GW6 A;  5BV1 A;  3LEW A;  3E32 A;  3M62 A;  4QFV A;  3ZN3 A;  5ENT D;  4FP7 A;  5JHB A;  2D8S A;  4OAV B;  2H0D B;  5CBN A;  4BT9 A;  5KJN A;  2FF4 A;  1X81 A;  1ZB1 A;  2E61 A;  3ZU7 B;  4DLO A;  5DIN A;  5EID A;  3ZPV 1;  3APD A;  3ESK A;  3LJU X;  4GTO A;  2CG3 A;  2LSV A;  4NAC A;  5ARG A;  4A4C A;  4RQI A;  4BHW A;  3B7S A;  3C3Q A;  4I1O B;  5AQB A;  1T1H A;  3MZL B;  2DWZ A;  2WXN A;  4DK5 A;  3LYA A;  2VTB B;  2M13 A;  5B75 A;  4N39 A;  2IQJ A;  3ISM C;  2QFC A;  5JG6 A;  2ZIR A;  3CVV A;  1X4J A;  1FVH A;  5LOZ A;  5KJK A;  3NF1 A;  1F62 A;  3UXG A;  2L0T B;  3F6Q A;  3MJW A;  4J8Y A;  4GZ5 A;  3ZYL A;  3W9G A;  3AG2 E;  4W4U A;  5FIN A;  1SA5 A;  2LGV A;  1QBQ A;  3LQH A;  3GYZ A;  2WQH A;  3HCU A;  4WZ0 A;  3D9K A;  3RO3 A;  3TL5 A;  4FJZ A;  2IY0 C;  3CK9 A;  1YYH A;  4HI9 A;  5DKA A;  1HH8 A;  3KAE A;  4B93 B;  2KFT A;  3HCT A;  5AEN A;  1E7V A;  3VLE A;  1UJK A;  3AS5 A;  3MYV A;  5FT9 A;  2DJA A;  4JEU A;  2CSZ A;  2RSD A;  2J09 A;  3FTX A;  3AJI A;  3RRU A;  1N0R A;  3ZHE B;  4BY6 A;  1KLX A;  3TJP A;  4EQF A;  4YBS A;  2WXJ A;  3I4R B;  2XPI A;  2VJE B;  4G26 A;  1OUV A;  2LO6 A;  1YCS B;  4EZJ A;  3QB2 A;  4AEZ C;  2DZN A;  2YHN A;  3ASN E;  2RR4 A;  3S7D A;  1U2V G;  2IO2 C;  2I50 A;  2OVB A;  4N2Q A;  1WEQ A;  2EGM A;  5KJM A;  4JA9 A;  4UUC A;  4U0Z A;  4BSX A;  3TWU A;  2K1J A;  4DRX E;  5LKZ A;  3PUR A;  3E33 A;  4PS8 A;  5TDW A;  2IO3 C;  1WEP A;  1Y6I A;  4Z0R A;  1IHB A;  3TWV A;  3BEE A;  4ANW A;  3ZW3 A;  3FWV A;  5BW8 C;  2J8S D;  4DI4 A;  3O4Z A;  2EA6 A;  1KT1 A;  3CQG B;  3EHR A;  4UWG A;  4DLQ A;  3HVE B;  4UI9 J;  3UIN C;  4XKB A;  2KZT B;  2P9S G;  2KZT A;  3PE4 A;  4A0C D;  3ZIM A;  3V2X A;  4AUQ B;  1PAQ A;  4Q69 A;  1HG5 A;  1KT0 A;  5JHA A;  4ZDT A;  1OWM A;  3QOU A;  3SBT B;  4G8K A;  2ECI A;  4L2Y A;  3JUI A;  2Y43 A;  2AXZ A;  3T6R A;  3EHN A;  4X8Q A;  3SY2 A;  2DX8 A;  4N5C A;  4GTQ A;  4EBA G;  1OY3 D;  3APC A;  2WXH A;  2NXP A;  3FTV A;  2XZD G;  4YVQ C;  3MV2 B;  2ECG A;  3IKO B;  3LVR E;  2X38 A;  4N3B A;  5ENR D;  3PHD A;  4FAD A;  3O47 A;  5JJ7 A;  2E2E A;  2XCB A;  3RAU A;  3QKY A;  2EIM E;  1MX6 A;  4FK5 A;  4LNB A;  2MHK A; 
#chains in the Genus database with same CATH homology
 3IHY A;  4I1M A;  2G43 A;  3PVL A;  2L80 A;  3LY7 A;  5EX3 A;  4ABN A;  3N9N A;  4F52 B;  3TXN A;  2H0D A;  4Y6W A;  4YAB A;  3PEU B;  2A5U A;  2ION A;  2X6K A;  3CHP A;  2NSZ A;  4XX5 A;  4AXH A;  2WQ7 A;  2VP7 A;  4BTA A;  2KRE A;  5LKU A;  2C0M A;  4RG6 A;  3TG4 A;  3T8M A;  3ZGQ A;  4B89 A;  4I7B A;  2WXQ A;  2PQN A;  2G6Q A;  5TDR A;  3B7R L;  4FIP A;  4R8P K;  3G2W A;  2I1J A;  4XI9 A;  3O35 A;  2F42 A;  3I2D A;  5H9M A;  4HS2 A;  2OOE A;  3CV0 A;  5BPP A;  5T4Y A;  4O6F A;  4B8A A;  2WXG A;  4AV7 A;  4GA2 A;  2Y4T A;  4UQZ A;  1LF8 A;  4XE0 A;  1WGM A;  4LER A;  5G04 B;  2J4D A;  4CT0 A;  2CG2 A;  2WXI A;  4Q6F A;  3S7B A;  2NAA A;  3C5K A;  3AU4 A;  4AJW A;  4R2Y A;  2J08 A;  3GV4 A;  4GZD A;  4JL0 A;  3PEV B;  4BX9 A;  4AIF A;  4NQ0 A;  4AM9 A;  4YND A;  3KQI A;  3ZRH A;  4HOS A;  3QZV A;  5TAB A;  4GCO A;  1HFA A;  2DCP A;  2HM8 A;  1JM7 A;  1DVP A;  4TRQ A;  2YRE A;  5C2Y A;  4A1G A;  1QZ2 A;  3APF A;  2X6I A;  4HXI A;  4MKT A;  2KE1 A;  2UY1 B;  3K9I A;  2GRL A;  2XGS A;  5DIZ A;  3SOW A;  1NA3 A;  1X4U A;  4WWP A;  4BX8 A;  4AYC B;  3Q4A B;  4KYO B;  2VGX A;  2VJ8 A;  3CHQ A;  4GCN A;  4IYP A;  4XKC A;  4CGW A;  3U5M A;  3FTU A;  2LQ6 A;  3N9O A;  2R59 A;  3CIA A;  4WND A;  5I3L A;  3UMV A;  2CKL B;  3OXF A;  2LXH C;  2XGO A;  2AXU A;  4NUR A;  4ANX A;  1U3D A;  2CKL A;  4I7D A;  1ZBP A;  1WFK A;  3U5O A;  3SOU A;  3D9P A;  2AVP A;  4GPK A;  3NG2 A;  2CFZ A;  1TJC A;  3KEZ A;  3GZS A;  2I2O A;  5J90 A;  1VFY A;  3D3M A;  2KGI A;  3FH7 A;  3MX3 A;  3ASF A;  3IBE A;  3ULQ A;  4EPZ A;  2X3M A;  2VQ2 A;  2PZI A;  4J8E A;  2MNY A;  3KV5 A;  1LDJ B;  2QY7 A;  2LGK A;  2CFU A;  4XZ4 A;  3O70 A;  4ZDT A;  2YT5 A;  3LJ3 A;  4HFG A;  1WIM A;  2WQ6 A;  2FUL A;  5ARF A;  1NA0 A;  2L0I A;  2KWN A;  3MHH A;  3CGH A;  2ECV A;  3I5P A;  3IHV A;  4FUL A;  3UX4 A;  3PUQ A;  4XI1 A;  5FB0 A;  3FU5 A;  2AWI A;  1VYX A;  2IOS A;  3D9M A;  3QWW A;  1QQE A;  5LKT A;  3EJN A;  4U04 A;  2OVF A;  1MM3 A;  3UT7 A;  1MQS A;  2ILR A;  3FTS A;  2E6R A;  1A17 A;  2RG8 A;  3KD7 A;  1N54 A;  5AIJ A;  3ZNI A;  3LPZ A;  4PS7 A;  4BBQ A;  2L5U A;  2MNZ A;  5T8I A;  2QIZ A;  3JQ1 A;  3FH8 A;  4PPE A;  4GNG A;  2MT5 A;  3VTY A;  4LJN A;  3C6W A;  1U6G B;  2XHE A;  3UUX A;  2KGG A;  2WMN A;  2JEK A;  4X3G A;  2GW1 A;  1WAO 1;  2MD7 B;  4DI3 A;  5BV0 A;  3FY4 A;  1XGW A;  4ACL A;  3ENE A;  3D9O A;  3PRZ A;  5G05 B;  2YNQ A;  3SHB A;  3L22 A;  4UP5 A;  3L13 A;  2BF0 X;  3FUN A;  3ZVZ B;  2ECJ A;  1JPL A;  3CHM A;  5LFA A;  1ZBD B;  3G2V A;  2XPZ A;  1EF1 C;  2VGX B;  3ASD A;  2VSY A;  5D1M B;  2L75 A;  3CVN A;  2MIQ A;  4K0R A;  3E4B A;  2VNF A;  3G2T A;  2EQX A;  3D9J A;  2WVI A;  2J4B A;  4LAD B;  4GMJ A;  4S3O B;  3N9P A;  3TGO A;  3S7F A;  2VPB A;  3ZPJ A;  2PNX A;  2YU4 A;  1HYJ A;  4C0E A;  5B79 A;  1FP0 A;  1VD4 A;  4U63 A;  5FQ7 A;  3RJV A;  3ZHE A;  5H1T A;  3CVY A;  2M63 A;  2Y1M A;  4CA1 A;  3Q5M A;  4UP0 A;  2CT2 A;  3SNX A;  2A4Z A;  1ELW A;  3HHM A;  3ZTG A;  4HOT A;  3P1U A;  2OV8 A;  5AYW D;  2PM7 A;  4G25 A;  1NZN A;  1PY1 A;  1HX8 A;  4B8C B;  2WXM A;  2EGP A;  2VSX E;  5FZS A;  2HYZ A;  3MGB A;  2ZU6 B;  4FJY A;  4KVM A;  5A7D B;  2UZG A;  3O33 A;  5J3X A;  1HYI A;  3RRN B;  4G23 A;  1WM5 A;  4YAX A;  4N3A A;  3CSF A;  3RPG C;  2UY1 A;  3ML9 A;  2PL2 A;  1HF8 A;  4XIF A;  2LV9 A;  4MVT A;  4PTB A;  2ZET C;  4UWH A;  3FUF A;  5EKQ D;  2J49 A;  3T5X A;  3S2A A;  4I9E A;  2C2L A;  1HS6 A;  1V87 A;  1H0A A;  2YQ8 A;  5CCM A;  4U8H A;  4I6G A;  3ZFW A;  3PNT B;  4FHK A;  4FO9 A;  3ZVY A;  2LGG A;  4URK A;  4WUY A;  3D9L A;  3CVQ A;  3B7U X;  3LXU X;  2V8S E;  2WXP A;  3P2B A;  3GL6 A;  1Z2Q A;  3MKR A;  3UT8 A;  3L6A A;  3CST A;  3IV0 A;  1Z60 A;  3KV6 A;  4JXT A;  3T7L A;  2YQM A;  2KYU A;  4D10 C;  4YAT A;  4J8F A;  2KCL A;  4WWO A;  2C0L A;  3QAR A;  5BT1 A;  1OWP A;  3SGH A;  4YBT A;  3RO2 A;  5A23 A;  5J08 A;  4I6E A;  5KJL A;  2BAY A;  3L1X A;  1ZU2 A;  3MA5 A;  1E8X A;  1LDK C;  4GB0 A;  4A3V A;  2C2V S;  3FU3 A;  3QDN A;  3PS6 A;  2M6M A;  3EB6 A;  5KCM A;  4BWR A;  4A49 A;  3ZXS A;  5H1U A;  3SZ7 A;  3ZPV E;  3FTW A;  2KWK A;  4P29 A;  2E6S A;  2WXR A;  4A55 A;  3FUE A;  3DPD A;  1JWF A;  2XPY A;  4JHK A;  4MLP A;  4FA6 A;  2I9C A;  3CKB A;  1HXI A;  3V43 A;  3LY8 A;  4JHJ A;  4B7Y C;  5KH3 A;  4L7X A;  3JYS A;  3FFL A;  4U0U A;  5FQ4 A;  2L9B A;  2VPD A;  4K03 A;  4IUL A;  1WY6 A;  4AY6 A;  4GA1 A;  4KMO A;  4AOF A;  4ME2 A;  5FEY A;  3RTR B;  3QWP A;  4G1T A;  3AU5 A;  2GGF A;  4CDN A;  3NQP A;  3QJZ A;  4ZQL A;  2ECN A;  2EOD A;  2L0B A;  2XB1 A;  5B77 A;  2CHW A;  2FO7 A;  1NP7 A;  5G05 C;  1CHC A;  3HCS A;  3L54 A;  4C9Z A;  4IC3 A;  3HTK C;  4EZK A;  2PM6 A;  2JMJ A;  1Z3X A;  2V0P A;  3EIJ A;  5ENN A;  2R5S A;  2LXP C;  2YYR A;  4H7Y A;  4PS3 A;  1Z3Y A;  4UQX A;  4FHJ A;  4WA6 A;  4WZ2 A;  1FVF A;  1HE8 A;  2I6H A;  3MV3 B;  1E7U A;  4I6J A;  2XQ0 A;  4CEM A;  2UWJ G;  3CVU A;  4GB9 A;  4KZC A;  2MA6 A;  4G24 A;  3RU0 A;  1UG3 A;  4UI9 C;  4JW1 A;  2YSM A;  3U3W A;  3G2U A;  4YBM A;  1UJJ A;  4AP2 A;  1E8Y A;  2LRI C;  3SOX A;  2LN0 A;  3U64 A;  2CSY A;  5FQ6 A;  2KWO A;  1IYM A;  3VTX A;  5TBN A;  1WEW A;  2KR4 A;  3CVX A;  2X6H A;  4BT8 A;  3L16 A;  1ELR A;  4A4B A;  5FWQ A;  2M85 A;  4UWL A;  1WEN A;  2G45 A;  2NC9 A;  2HO1 A;  3ZEF A;  3EDT B;  3IHP A;  1SZ9 A;  3SD5 A;  1WEV A;  4N2S A;  4TV3 A;  3OTN A;  3FUJ A;  2KM4 A;  2WB2 A;  2YHE A;  4HVB A;  4G11 A;  1HU3 A;  4JC8 A;  4RG9 A;  3PUK A;  3OXL A;  2MUM A;  2VJE A;  4YC9 A;  3S7J A;  5FER A;  5E76 A;  3QAQ A;  4JHR A;  2X6F A;  4J0U A;  1EPU A;  2E0I A;  4GU5 A;  4WNG A;  1OWN A;  3O48 A;  2F6N A;  3RPG B;  3SHF A;  3NZU A;  5C13 A;  3GZ1 A;  3L08 A;  4UWK A;  2YUC A;  2MOW A;  3AS4 A;  4U0S A;  2FEZ A;  1XNF A;  5LX8 A;  4APO A;  3PRE A;  1U3C A;  2V5F A;  3ASH A;  4PDX A;  5G0F A;  2FUI A;  5G55 A;  1GW6 A;  2BTD A;  2VSO E;  4CRW A;  2L6J A;  3GW4 A;  5BV1 A;  3CK8 A;  2QJ0 A;  3O34 A;  1BPO A;  2JMI A;  3LEW A;  3M62 A;  2WPV A;  3CR3 A;  5LP0 A;  5LCW B;  4QFV A;  1E90 A;  3UT4 A;  3CHR A;  4I7C A;  4R7E A;  3ZN3 A;  5JHB A;  4FP7 A;  5EDS A;  2D8S A;  4AY5 A;  2H0D B;  2BUG A;  1S0P A;  4GNE A;  3QNK A;  2OND A;  4HOU A;  2P58 C;  2AN6 A;  3D9I A;  3FHE A;  3VK6 A;  5EX0 A;  3U5N A;  3HVE A;  4BT9 A;  3LQI A;  1IQR A;  3FU0 A;  1EDU A;  2RD0 A;  2Y4U A;  2WXK A;  4FLH A;  2FF4 A;  4IN3 B;  4GA0 A;  4CT4 A;  1JWG A;  5KJN A;  3TAX A;  5H1V A;  4FU3 A;  2YSJ A;  3ASG A;  2V4L A;  2KU3 A;  4TKP B;  3FP3 A;  4JPS A;  4NRH B;  5C1D A;  4TUU A;  4I2Z A;  1H19 A;  4B0Z A;  4DLO A;  4HLE A;  3URZ A;  1INZ A;  5DIN A;  3L17 A;  4KT6 B;  3O36 A;  3MKQ B;  2K4D A;  1IQU A;  3UQ3 A;  5G04 J;  2Y3A A;  2VYI A;  3HYM B;  3ZPV 1;  3KNV A;  3U5P A;  2HYE D;  4GML A;  5B76 A;  2IU1 A;  3PE3 A;  3APD A;  4LEU A;  1H6K A;  3ESK A;  3ZYM A;  4C0M A;  2R17 C;  2CG3 A;  2DBA A;  2JLB A;  2KAT A;  2LSV A;  3JQ0 A;  1HO8 A;  3LY9 A;  4NAC A;  4GZ3 A;  1PC2 A;  4U07 A;  5E75 A;  5ARG A;  3U66 A;  2IDA A;  3MHS A;  4A4C A;  4BHW A;  1K2F A;  2XRZ A;  3B7S A;  4JEH A;  4ANV A;  4Y6C A;  3I3N A;  4MS6 A;  2F6J A;  2RI7 A;  2KCK A;  4I1O B;  2MRI A;  1UN8 A;  1UW4 B;  2J07 A;  3FDH A;  3Q49 B;  4LCT A;  3MZL B;  4F53 A;  1T1H A;  2MD8 C;  4GZC A;  4L23 A;  4Q96 A;  2JMD A;  3EIQ C;  5T3R A;  2MA5 A;  4EZL A;  4LRZ A;  2WXN A;  4F1S A;  3ML8 A;  4DK5 A;  5JJT A;  4MSX A;  3U9W A;  3D9N A;  3LYA A;  2VTB B;  4LK9 A;  4G2V A;  2LDR A;  4CCG X;  5JJ6 A;  5CMW A;  5B75 A;  4N39 A;  2LNI A;  1E96 B;  3QWV A;  3ZYK A;  4F7A A;  5BUZ A;  1RMD A;  3PH0 C;  2QFC A;  5LCW J;  1X4J A;  3CVV A;  5JG6 A;  4OVV A;  1FVH A;  5LOZ A;  1EYH A;  3CVL A;  2HR2 A;  5KJK A;  3NF1 A;  1F62 A;  2K17 A;  4GYY A;  4HOR A;  4ANU A;  3FUK A;  2M1R A;  1SQM A;  3GZ2 A;  4WAF A;  2XGM A;  4XI0 A;  3VLF A;  4C9B B;  5AIT A;  2GRM A;  4GYO A;  1WE9 A;  4GND A;  4L2L A;  2VPG A;  2LGL A;  2L0T B;  3FEX A;  2IQC A;  1WEO A;  3FUD A;  2IF4 A;  1XWH A;  3MJW A;  3ZYL A;  4GZ5 A;  4E6H A;  2YW8 A;  4M3O A;  4GYW A;  5TRB A;  4W4U A;  2LGV A;  1E8Z A;  4I9C A;  3LQH A;  2VGY A;  3GYZ A;  4UQY A;  1IYG A;  2YUR A;  3DPL R;  3IEG A;  5EYA F;  3MKQ A;  2VPE A;  2XEV A;  2OXQ C;  2AXV A;  3VLD A;  4IC2 A;  2WQH A;  4LUN U;  3HCU A;  4H7X A;  4WZ0 A;  2Y1N A;  5G2N A;  3ONL A;  3D9K A;  3RO3 A;  3TL5 A;  4FJZ A;  4DJA A;  2ECW A;  2WXF A;  4QF2 A;  3I4G A;  5D0O D;  3HDX A;  5LCW C;  3FUL A;  3OXG A;  3CVW A;  1VDY A;  3CK9 A;  2X6J A;  4N4F A;  1FBV A;  3DBS A;  5G05 J;  3CEQ A;  1OWO A;  3L1Z B;  5G04 C;  5DKA A;  1HH8 A;  5ANR A;  1JOC A;  3U4T A;  2LSU A;  3KAE A;  5FB1 A;  3ZYQ A;  2LAI A;  4CDR A;  3FUH A;  1W3B A;  4ILI A;  4KBQ A;  2KFT A;  5FZR A;  4RVB A;  3HCT A;  4OYS A;  5AEN A;  1H2T C;  1FCH A;  2L43 A;  1E7V A;  3VLE A;  2AW6 A;  3FL2 A;  1UJK A;  5D1K B;  3AS5 A;  3MYV A;  4ZUX U;  2PQR A;  5FT9 A;  1L5J A;  4JEU A;  3B7T A;  1WEU A;  2FI7 A;  2CSZ A;  2J09 A;  3CKC A;  3FTX A;  3RRU A;  2RSD A;  1JUQ A;  4W9R A;  3ZHE B;  4BY6 A;  4L1B A;  1TEZ A;  3FEY A;  1TJF A;  2CHX A;  1KLX A;  4APF A;  4P5O B;  4WWN A;  4AP4 A;  3TJP A;  4EQF A;  4YBS A;  2WXJ A;  2DIW A;  4NN2 A;  3I4R B;  2FUU A;  2XPI A;  2VJE B;  4G26 A;  2M3H A;  3CQC B;  1OUV A;  1MM2 A;  2WXO A;  4CGV A;  2Q7F A;  2LO6 A;  3N71 A;  5HI7 A;  3SBS A;  3ZVV A;  4FC8 A;  5AJL A;  1G25 A;  3O37 A;  3SFZ A;  4EZJ A;  5CCL A;  3PDN A;  5FQ8 A;  5D0Q D;  4EEC A;  3EB5 A;  3ONK A;  4J8S A;  4MRU A;  3CHS A;  3QB2 A;  4UWF A;  4AEZ C;  4OVU A;  1WIL A;  1SZA A;  3MEK A;  5FJY A;  3SI5 A;  3CHO A;  2YHN A;  4RSY A;  2XCC A;  4I2W A;  3S7D A;  3G2S A;  4L7T A;  3R7Q A;  1MHQ A;  4KZ0 A;  1YA0 A;  3N9Q A;  2JRJ A;  2XRY A;  5BNW A;  2I50 A;  3B13 A;  3N9L A;  1N52 A;  2OVB A;  5KH9 A;  3CLJ A;  4N2Q A;  1WEQ A;  5B8D A;  1H2U A;  4KXK B;  4KVO A;  4A3T A;  4BFR A;  3LDZ A;  5KJM A;  2YHO A;  3HIZ A;  4R7L A;  4JA9 A;  1X4I A;  3L11 A;  4U0Z A;  1HG2 A;  4GZ6 A;  4BSX A;  1QNF A;  5FTP A;  3FUM A;  3DQV R;  2K1J A;  3LCA A;  5LKZ A;  2WM9 A;  4JA7 A;  3PUR A;  1E8W A;  4L58 A;  4UI9 B;  3C98 A;  4FJC A;  4PS8 A;  4ILG A;  3M63 A;  4GNF A;  5AIU A;  2KCV A;  2ECT A;  1OWL A;  5TDW A;  4V3L C;  4QF3 A;  1HZ4 A;  4DPR A;  4WZ3 B;  4JZY A;  3Q47 B;  4HOQ A;  1DNP A;  1WEP A;  4IRU A;  3BG1 B;  1Y6I A;  3FU6 A;  3OAW A;  4ILH B;  5AJD A;  2CHZ A;  3TG5 A;  5B78 A;  1WES A;  4I43 A;  1IHG A;  4AVX A;  2XEU A;  1H2V C;  1Y8M A;  4O64 A;  3BEE A;  4ANW A;  5C11 A;  4Q94 A;  5A6C A;  4ACK A;  3ZW3 A;  3KS2 A;  1Z6U A;  3FWV A;  3UPV A;  5BW8 C;  4S3O C;  2VSN A;  5CHE E;  3O4Z A;  4PH4 B;  4DI4 A;  1JM7 B;  2EA6 A;  3LS8 A;  5LKX A;  3EHM A;  3FTY A;  2QIC A;  2J9Q A;  4EBA A;  4AYC A;  3SF4 A;  4YVO A;  1KT1 A;  3CQG B;  3TXM A;  5KH7 A;  1X5B A;  3CK7 A;  3MCX A;  4ATG A;  4UWG A;  1Z6T A;  4BTB A;  4DLQ A;  3LVQ E;  4F3V A;  1E4U A;  2LAH A;  3HVE B;  4I17 A;  4UI9 J;  3ASL A;  2IOL A;  2I1K A;  1ELK A;  3O7A A;  4XKB A;  3AS8 A;  2KZT B;  3PE4 A;  2KZT A;  4A0C D;  4V3K C;  1UN9 A;  2VTB A;  4B86 C;  3ZIM A;  4AUQ B;  1PAQ A;  3QK0 A;  4Q69 A;  3RKV A;  1HG5 A;  1KT0 A;  5JHA A;  3JCK C;  4JVS A;  2IJG X;  1OWM A;  5DBK A;  4UI9 K;  5D1L B;  3QOU A;  1B89 A;  3T5V A;  3SBT B;  4YAD A;  2KIZ A;  4PUC A;  5ANL A;  4A1S A;  4E85 A;  3WXX A;  2PUY A;  4J8D A;  2ECI A;  4L2Y A;  3JUI A;  2Y43 A;  2AXZ A;  2WXL A;  2YIN A;  3T6R A;  5HQ8 A;  1BOR A;  2YQL A;  2YHC A;  1WEE A;  3EHN A;  3FTZ A;  2DX8 A;  4J6I A;  3Q15 A;  4N5C A;  2IFU A;  3R9A B;  4B94 A;  5FZQ A;  3LKU A;  4CCA A;  4EBA G;  3M99 A;  3PUJ A;  4N3W A;  2VJF A;  4WNF A;  3NZS A;  3LRQ A;  2VJF B;  3APC A;  3R7R A;  4GAA A;  5M72 A;  3ESL A;  2WXH A;  4FLB A;  2NXP A;  4N3C A;  3FTV A;  4YVQ C;  3MV2 B;  3RK6 A;  2ECG A;  2K16 A;  4CDM A;  3IKO B;  5CMY A;  3FH5 A;  3RIB A;  3LVR E;  3PNL B;  2X38 A;  4N3B A;  4LKA A;  2WMO A;  3PHD A;  4WNE A;  3FUI A;  4FAD A;  3CVP A;  3RRM B;  1N87 A;  3BG0 B;  2FSA A;  3LQJ A;  3N9M A;  3QC1 A;  1P5Q A;  2E2E A;  2XCB A;  5JJ7 A;  3PZD A;  4I1A A;  2FBN A;  3QKY A;  2HDP A;  2KC7 A;  1WEM A;  4V3I A;  4FK5 A;  2KWJ A;  2MHK A;  4LLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...