3ZYTA

Structure determination of esta from arthrobacter nitroguajacolicus rue61a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
372
structure length
372
Chain Sequence
b'MHSQVIAPGFEPVAELFGVFLEQDPDYSAQVAAYHRGVKVLDLSGGPHIRPDSVTGVFSCSKGMAGLVMALLVQDGELDLEAEVVKYWPEFGVEGKSSITVAQLLSHRAGLLGVEGGLTLHEVNNSELAAAKLAELPPLWKPGTAFGYHALTIGIFMEELCRRITGSTLQEVFEQRIRAVTGANFYLGLPESEESRFAQFRWAADPSWPWVDPASHFGLAANAAVGDILDLPNIREVRAAGLSSAAGVASAEGMARIYAAALTGLEGKSAMPPLLTEETIRTVSAEQVFGIDRVFGETGCFGTVFMKSHTRMPFGSYRAFGHDGASASLGFADPVYELGFGYVPQTAEPGGVGCRNFQLSSAVREVIAGFAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE A
publication title Crystal Structure Analysis of Esta from Arthrobacter Sp. Rue61A--an Insight Into Catalytic Promiscuity.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
molecule tags Hydrolase
total genus 116
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.30 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase Beta-lactamase 3zytA00
3ZYTA
chains in the Genus database with same CATH superfamily
3C2WA 3UE3A 4E3LA 4GKUA 5CHJA 4OOYA 1YMXA 1KOUA 5DFXA 5FQKA 4GD6A 3E4OA 2JN7A 3B42A 3JVUA 3MMHA 1W63M 1RGYA 3VP0A 4UA7A 1OT9A 1LHYA 1LSVA 2HP9A 5HZHA 1FIKA 1GHIA 4DF6A 2ZBBA 3VSLA 3IX3A 3T1SA 1FQGA 3UMEA 3CPTA 2E8JA 3HCYA 3MSHA 1IYOA 4S2NA 3D3OA 5U47A 3Q81A 1TF1A 1PNEA 3ZCZA 3HUMA 1XA7A 3BY9A 4BD1A 3S1YA 1TS0A 1F5MA 1MXOA 4YWZA 4D2OA 3DTEA 4QPRA 4MN5A 4EEPA 4WM9A 3IH8A 4F3LB 4Y5FA 4HJ4A 1ESIA 1L0EA 1JTDA 1XFNA 1PWCA 3DTKA 3VOZA 2H5SA 2V8CA 4HBTA 3HUNA 3MFXA 4CLCD 4X56A 2R9WA 1N4OA 2NUTC 2V20A 2HDSA 4WBGA 1VB6A 5G4YA 1OMEA 3TRCA 2HDRA 1ERQA 2JE5A 3UB5P 4WZ4A 3A3IA 2ZMAA 4ZTKA 3A3FA 5AQ7A 2OLVA 3CUEA 2BG1A 1OJGA 4PM7A 5EVID 4NG2A 3OZHA 1MWUA 4FD8A 2M1CA 4B4XA 3W8KA 5FA7A 2Y2JA 2WGWA 1TDLA 2Z6CA 3PR6A 3IF6B 1X0OA 1PZPA 3BLSA 3GECA 3ITAA 3M6BA 2B18A 2XA7M 4JLFA 3GVBA 3MKEA 4GS9B 4HNBA 4KUOA 5A93A 2HDUA 1SKFA 1KDWA 4MLLA 2V1ZA 5F82A 3O88A 4DJ2A 3UB8A 3ZG0A 1RP5A 3JVVA 1WA9A 1ZG4A 5EFWA 1YAXA 2WKEA 1G28A 5FDSA 1TEMA 2EX8A 5DF9A 3SH8A 3AGDA 3A0SA 1BLSA 2HZ5A 1NLZA 5J3WA 4HBUA 1YLWA 1T1BA 3MQ0A 5IS1A 4HP4A 3NECA 1DP6A 1KE4A 4KQOA 5KSHA 3OPHA 1JTGA 4Q0JA 4YINA 3E0YA 4R4RA 4QWOA 5CHMA 3W4OA 3HUOA 3DW0A 3A3EA 3UB6A 3SOIA 5E2FA 4PKYA 2IWDA 4Y13A 3VSKA 4DE2A 3SW1A 4LENA 2HJEA 1FOFA 2WZXA 2ACGA 5TJJA 5E2GA 3IHAA 3IS2B 1IKIA 4O8GA 4KENB 3NI9A 4LV0A 1QMEA 2PU2A 1A0KA 5L10A 4D60A 4HJ6A 2EX6A 5HDCA 4ESPA 4OPQA 3NJAA 5FEGA 3B3XA 5BOHA 4MBKA 3IX8A 4RA7A 3EGDC 3LY3A 4GB7A 3FYZA 2HP6A 5A90A 4EUVA 2EX9A 4BLMA 3CITA 4HP9A 2QWSA 3VP2A 3VP4A 1PRQA 1N9BA 3R4KA 1STZA 3OPLA 2HJ9C 3T4QA 4JXWA 2ZC3B 4P6ZM 1ESUA 1YLZA 4QY5A 3LR5A 3ZGAB 3F1PA 1G68A 4Y0TA 4IEDA 1ZC2A 1MKIA 3UPNA 5HPFA 5L2FA 1M6KA 2PBDP 5HWVA 2VGKA 4EWFA 1E3UD 2OV5A 1DP9A 3KYEA 4WL9A 2R9XA 2Z6DA 3IWQA 3QP4A 4GDBA 4EEUA 2J3WA 5CEDA 1S4SA 1SDNA 2WGWB 3O5YA 3IQAA 1LL9A 2JKRI 3OBFA 3N8LA 3T4JA 1VEUB 1Y28A 4XXRA 3FKWA 4JPMA 3BW6A 3LIAA 1F98A 3FPWA 2XDMA 4OQ0A 1L0FA 5TBMA 4BBVA 1WE4A 1S1ZA 1L3LA 1YPRA 2QYBA 3BECA 3IH9A 1ES2A 4UA6A 2GX5A 1D7EA 5F6AA 3SS5A 1S0WA 4UHUA 2OAQ1 2OOLA 3CZDA 3DTMA 4M4XA 5HAQA 3UY6A 4E3JA 3NY4A 5JYOA 3PBOA 3DTIA 3T4SA 4WEJA 2UV0E 5HAPA 2CMNA 4KQQA 1MWTA 3HLWA 3D4FA 1YM1A 3N6IA 4I39A 2FH5A 1XA1A 5DF8A 4Y15A 3VE3A 3QP1A 2Y91A 2ZQCA 3LO7A 4GNUA 3S7QA 5J8XA 2XFSA 5J4EA 4OVDA 1XFQA 3FKVA 2P08A 2WKPA 3SH9A 2W0NA 3G34A 2QZ6A 3ZNTA 4RYEA 4LRXC 4PHTA 3UN7A 3G2ZA 1MWRA 4EUZA 1XPBA 4KZ8A 2Z2MB 5E43A 2XF3A 2XD5A 1IELA 3UDIA 2IWBA 4KUKA 4EW7A 1J9MA 5AVEA 3CG5A 2RCXA 2WAFA 4JXGA 2XQZA 1SHVA 2J9OA 3CHWP 4IUHA 1P9WA 4PM5A 1FILA 5TFQA 5HARA 5EUAA 1PYYA 3SS4A 1UWNX 4R6LA 5F83A 4CQHA 1LL5A 4EQ1A 1K6RA 4HESA 3OLOA 3EWKA 1XGIA 1KE3A 2K7SA 4LLOB 2Y2KA 4MBHA 4R0QA 3T4TA 3LEQA 2BTFP 2Y59A 2PR6A 2W3DA 5EECA 5EPHA 2XGNA 3P7NA 2AVXA 2M7UA 4X69A 2WK0A 4HH2A 3E2KA 3GDIA 4Y7PA 4QD4A 1NYMA 1T1CA 2P74A 1GSVA 3HL9A 2JHEA 1NLYA 2X71A 3V3SA 3MZDA 3AGFA 5HWTA 1DP8A 4BBUA 3BFGA 3BFDA 2OWJA 5FAPA 1JWVA 1DY6A 4HIAA 2GJ3A 4DDYA 3OCNA 2VGLS 1WYCA 4H8RA 3Q07A 3F1PB 2A24A 1ODVA 4QHCA 4FSFA 4WELA 4DXBA 3TW8A 1BT5A 4NXEA 4S2JA 1SKOA 4NK3A 3Q7ZA 5G18A 3P09A 3IWOA 3Q7VA 3UE6A 1T1AA 5EM0A 3IBJA 5FI7A 1MKMA 1TS7A 4XT2A 2PR5A 5EOOA 4I38A 3O87A 3KYZA 5DJTA 4I5SA 2HV1A 1SDEA 5TBMB 1DRMA 1G6OA 3OCLA 3UB7A 2XEPA 4LCLA 1OTDA 3L9KA 4JXSA 3VE4A 5HAIA 3T4OA 2JC7A 2V1BA 5HD3A 3PBRA 1D1JA 3HVFA 1GA0A 4RVAA 5M19A 4Z1WA 2D01A 4CLCC 3S22A 2VJWA 3LIEA 4JGQA 1KGFA 3ZDJA 3CAXA 3ZVTA 4ME4A 1YKDA 2P9VB 2GNXA 4O7DA 1XJ2A 1BYWA 3VFHA 5FEFA 4KZ6A 2EWVA 4HY8A 3BQAA 3CWFA 1YLYA 4ID4A 1VQQA 2KOIA 2W27A 4GHIB 4DRTA 5CERA 3S4XA 1KDSA 3EGXC 4O0PA 5FATA 4L9GA 1FCMA 4BBTA 4P85A 1Z09A 2BASA 3LR3A 3H82A 3SS3A 4MNRA 1F2KA 4N92A 4NEED 3E2LA 3IHBA 4LRYC 3HLBA 1EWZA 5GHZA 1HVBA 1LI0A 4BWIA 4ZRRA 4Z9QA 1PWGA 1H8YA 3JPUA 3UPOA 1NZUA 4WZ5C 2JKTM 1W5DA 2Y2GA 3LIBA 1L2SA 1O7EA 3V3RA 1G5UA 5HX9A 4P0MA 3E98A 3U4LP 1VETA 1BLCA 2EX2A 4MCWA 2ZOIA 3N8RA 4NXFA 4X55A 2VLGA 2Y2OA 4R1GA 3IXBA 4OLGA 1XJ6A 2J3TC 2XA7S 4BENA 3FG8A 3UO9A 3WWXA 4WMCA 3G32A 5E2EA 4GLQA 1I2WA 2JKGA 2VV8A 3LUQA 2J9PA 2PYRA 2QMIA 3T1QB 1K4FA 1MY8A 5EE8A 2XSSA 3ZG5A 4DKIA 1FCNA 3KX0X 2H10A 4KG2A 3NIAA 4R3JA 2V0WA 2WZZA 3MXSA 1QMFA 2XLNA 2Z2LB 4HEFA 1Y54A 1SKOB 2ZOHA 4DDSA 1U60A 5M1AA 3BRMA 2M7VA 2O0YA 3Q7VB 4X68A 1K6SA 4E04A 4XT2B 1ES3A 1GA9A 2K31A 3RXXA 2K2NA 1VM1A 4JF5A 2DCFA 2OSUA 2HGVA 3BJNA 2Y55A 4KZ7A 1K57C 1NRJA 3HLEA 4OONA 1YQSA 2VX8A 3DBAA 4IVIA 3KSHA 1JWPA 2PAVP 4FH2A 2Y2PA 1XP4A 3H7WA 3MS6A 1BULA 2QHKA 5D3OA 3ZVWA 4P6BA 1ZTUA 5I5LA 5IU1A 2XD1A 1GHMA 3VFFA 5F1GA 1N9OA 3ICYA 2WGVA 1CEFA 4B4ZA 1OTIA 4JBFA 3TOIA 1W7FA 5CGSA 1GCEA 2PRFA 4K0XA 2G2UA 5EOEA 4KZ5A 3LIDA 1I5QA 3T1XA 5J7EA 2C5WB 1PW1A 4GZBA 4K0WA 1JVJA 3GV9A 3NOTC 3DWKA 3KSFA 4Q0IA 2WAEA 3CPTB 4DE3A 1TS6A 5EVLA 2HP5A 4PKYG 3H82B 3QP6A 3C7UA 2XH9A 1FSWA 1MPLA 3GTCA 3ZG8B 4M3KA 2L0WA 3HLCA 1KVMA 3DWZA 1BUEA 3BLMA 4P6ZS 2R78A 5M18A 1LSWA 1P97A 1BLPA 1O07A 2V9AA 1D06A 5HWWA 3I7JA 3T1RA 5AQAA 1PW8A 5A8BA 2B95A 3FC7A 3C7VA 2Y2QA 4GW9A 4X25A 2E8IA 3C4PA 5TR7A 3LR0A 4PPRA 1BZAA 1NYYA 1VETB 5IHVA 4CPKA 4K91A 3G4PA 1SZVA 4CLCA 4LV1A 4JGPA 4GDNA 5HL1A 4G3WA 1PI4A 4ARZA 5DKKA 1LLBA 4HQAA 1PWDA 5DF7A 3NCKA 5F1FA 1H5XA 4P87A 2EFXA 3MKFA 4B88A 1OTBA 3R7WA 1HLUP 4EERA 4C75A 2HPBA 3UDXA 2Q9NA 5GLCA 2ZL1A 3LFVA 1BTLA 4LGWA 4NETA 1JNUA 1TS8A 3PAEA 4LRZE 5AVFA 4QB8A 1TVFA 1OJ5A 4ZDXA 3V5MA 2ZMVA 5JYPA 2PDRA 5A92A 2PU4A 4BL2A 4PM8A 3M6HA 1GSWA 1OT6A 3D72A 4DE1A 2EWWA 2Y2NA 4I3JA 5CEBA 3H9WA 1GHPA 1VHMA 2XK1A 4LCMA 3A0VA 1NXYA 4F94A 3RJUA 5C5KA 2QPNA 4QY6A 1CI9A 3PTEA 3C8CA 5HPIA 4WZ5A 2WADA 5KZHA 1XJ4A 4OLDA 3H7WB 3IBRA 5HFOA 3NDGA 2QKPA 4ZJ2A 2FZ0A 1DJAA 5GHYA 4FOFA 1KVLA 4NXGA 2ZJ9A 5HDDA 5FQJA 4UEYA 3WS2A 3ZG9B 1NY0A 3ZQ5A 4L9EA 1Y4OA 3QHYA 1W79A 3FZCA 2P7JA 1H8ZA 2O9CA 3E4QA 1IKGA 3N7WA 4N9LA 4R70A 4PM6A 4S2IA 4QJGA 5F68A 5HL6A 4IJGA 1YMSA 4JF4A 2DNSA 2NUPC 4Y0OA 2A2LA 1K0KA 3QP5A 5AQ9A 4JXVA 4S2PA 5FI2A 3UE1A 5CXWA 4EBLA 2P04A 4Y3IA 1ERMA 3N8SA 4PM9A 4X1MA 5L09A 4HJ3A 2Y2MA 3UE0A 3N4IA 5HD5A 3W4QA 1BLHA 2GZAA 1H3QA 5CGWA 5FQIA 4OP8A 4CLCE 4LV3A 3BFEA 2ZMFA 3BYDA 4IBXA 4E3OA 1K57A 3MF0A 1Z6FA 2W3FA 2VV6A 2V8FA 2IA2A 3K3CA 3G30A 1RGZA 1AWIA 2JKFA 3C5AA 4EU0A 1GSXA 5CECA 4GD8A 2JBFA 4E3KA 3BFFA 3GQZA 3IXGA 3D9YA 5I94A 2I9VA 1TD5A 2G7UA 4WMCD 3WRTA 2FFFB 3UMDA 3OOVA 5DVAA 2ZQ9A 4K08A 1KGEA 2DRWA 2UWXA 1LL8A 2B5RA 3R7WB 3M2JA 2Y8HA 2PBYA 4E3IA 1L0DA 1E25A 2ZL1B 3ITBA 1E3UA 5K5BA 4JGOA 3FV7A 3UNWA 4GOGA 4ZAMA 4BD0A 3C4OA 4XUZA 2XROA 2CC1A 3IF6A 5EM1A 3MFDA 1CK3A 3LR4A 2ZM8A 3PHYA 1XXMA 3TSGA 4GS9A 4EBNA 1CQAA 4MBFA 2ZM0A 3T4KA 1XKZA 3IT9A 3O3VA 5CTMA 4ZJ1A 3GRJA 3E4PA 5EV0A 5DJUA 3VMAA 4N1XA 2VEAA 1K25A 3ZNYA 5FASA 5CHUA 1XJ3A 4UA9A 4U3TA 3BWLA 1OPXA 5FQ9A 1IYQA 3PYPA 4OPZA 2YKFA 4OQIA 4JF6A 3F1OA 2V0UA 2VK3A 2ZC5B 3F1NA 1W8QA 1K54C 2ZC6B 3FWLA 4BMWA 2WYXA 4E3MA 2W3GA 5EVIC 1NJ4A 2XR0A 3UDFA 2QJ5A 3IXHA 3MJQA 1SCWA 3T4LA 3G2YA 3WRZA 5DFYA 1BSGA 4YFMA 4R23A 5A91A 1MWSA 1KE0A 4Y2FA 3GMWA 3KYQA 4N1HA 2H0TA 1ZHHB 2Y4AA 1L0GA 1MBLA 3IXDA 4PMAA 1P0ZA 3IX4A 2BLSA 2O99A 3IS2A 3A0RA 1YSQA 1HZOA 1UWPX 3G6OA 5DKLA 1OTEA 4N9KA 3V50A 3S7OA 4FCFA 1S4RA 3MZFA 3BFCA 1TDGA 4IHQA 3LEZA 4KQRA 3TE8A 1YSPA 4DMZA 2PHYA 5KIZA 2JCHA 1AXBA 3PAGA 2KDKA 2INWA 4E6WA 4JGRA 5IT5A 4LV2A 3TG9A 5FSRA 3KSGA 4UQIS 4G3VA 2IWCA 2H28A 3ZYTA 4OKPA 4R3BA 3PBNA 3C30A 4EBPA 4U0TA 1CEGA 4IUKA 2VV7A 5GHXA 2A24B 3IF5A 5FQQA 4C3QA 1E4DA 2Y2HA 4WLAA 3LICA 3U2AA 3K3DA 4R4SA 5FDHA 4L0LA 3C38A 3BY8A 2QJ7A 4O01A 4B9OA 5EVEA 4L9FA 5DTSA 1FSYA 3WS5A 4UQIM 2C6WB 2H0YA 2ZC4B 3PBSA 3VOLA 4E6XA 3W2ZA 4WN5A 2VGJA 2WKRA 3VV4A 3MXQA 4Y0UA 5KMWA 1PFLA 1VEUA 3SH7A 2EXBA 1K56A 2GDNA 4GN2A 1S1YA 3SZTA 3UPPA 2VA0A 4JKTA 2JKRM 2W1RA 2ZLYA 2ZQ7A 1S6RA 1EW0A 5FI6A 3EEHA 1W8YA 3NC8A 4MN7A 3RXWA 4MMNA 3T50A 4S2MA 3WS4A 3F1OB 4H6JA 4U0XA 2WKHA 3EEAA 4DXCA 3F1NB 4OPRA 3HLFA 2A49A 3G31A 1V9YA 4IBRA 5CTNA 2I72A 4YNRA 1W63Q 4EETB 2ZD8A 5HSQA 3LI9A 1ES4A 2J3TD 3CLOA 4R3AA 5MC7A 3LYXA 4KG5A 3IF6C 3ZFZA 4LPZA 3ULFA 3ZHHA 3HLDA 3CMZA 1EROA 2OAP1 3O86A 4GJ4A 2B02A 5L07A 4XUXA 1JWZA 4BQMA 2JKTI 4FTXA 3WS0A 3P01A 2WGIA 5DTTA 1LT0A 1MZUA 2PD8A 5AQBA 1ZKJA 1YLTA 4GCZA 1K55C 1S66L 1MC0A 3UB9A 3OC2A 1FR1A 5HDSA 2XRNA 2DMWA 4S2KA 4KZAA 3CI6A 4RQ9A 3L7HA 2PYPA 4NKPA 3HBRA 2O9BA 3B47A 2V1AA 2WKIA 1N9LA 2W3HA 4AFIA 1KGGA 3MBZA 2HDQA 2Q0OA 1UGUA 3PXPA 3OPRA 4Q8IA 1IFQA 2YKHA 2Y2IA 3K2NA 3IWIA 4OOLA 4NXBA 1RCJA 5FAOA 3MXRA 3Q82A 3RH8B 1H0MA 3NDEA 4IVKA 3BEBA 5CGXA 1K54A 2ZQDA 3KO6A 3PBTA 4MN6A 1V9ZA 3EQVA 2D02A 5EVIA 4ZBEA 1CI8A 1K38A 3HREA 3MQOA 2W1TA 3KSIA 2XFTA 3TJZC 3BQ8A 4X1LA 2EA9A 3LY4A 3RFBA 1IYSA 4S2NC 4RX3A 1CF0A 4OOMA 2LB9A 5E2HA 4OQHA 3S7PA 3MR0A 3EOIA 3QP8A 3MZEA 4KZ4A 5GL9A 3CJMA 1NRFA 1T19A 1FCOA 1G6AA 1XGJA 3FPVA 1Q2PA 3AGEA 2ZC7A 5GLDA 3HLGA 4Y17A 4HHDA 2HF6A 2ZQ8A 3WS1A 1S67L 2PD7A 1ACFA 2OWHA 3RTYA 4BL3A 4HH3A 4RX2A 4WUJA 3HJIA 4WEKA 1CJFA 4H6JB 4PAUA 4HOIA 3S7NA 4EV4A 4EESA 3PBQA 1ALQA 5F5YA 5HW3A 2P9VA 5GLAA 4HI4A 3CUEC 1ZG6A 1PIOA 4X6TA 1DJBA 3A3DA 4KZ9A 3EQUA 3Q1FA 3V67A 1ONGA 5KSCA 4X53A 1I2SA 2G2WA 4KQDA 1PZOA 3B33A 3GR2A 3JYIA 2J80A 1NZOA 4GHIA 3LIFA 1ES5A 5GLBA 3ISGA 4LFUA 4UAAA 3OPPA 1IYPA 3T12B 3LI8A 5L8MA 4EXOA 2O9AA 2V2FF 1OTAA 2Y2LA 3QP2A 3VP3A 1WYBA 2X01A 5AJGA 1H8MA 2MJ6A 1J3WA 3M2KA 3NOUC 4QU3A 1PI5A 2Y79A 4I3AA 4II7A 1XX2A 3P98A 1ONHA 4ETXA 3HJKA 1IOUA 4FUWA 1C3BA 4R38A 3LGOA 1FR6A 4E3NA 4BJPA 2W3EA 5DTKA 3V39A 2A3UA 4F3LA 1P9RA 1DJCA 2EXAA 4MDZA 2KLIA 2L1MA 4I3IA 4CLCB 2Q9MA 5TGFA 3G35A 1YLJA 4ARZB 4DJ3A 2RL3A 1HTZA 1K4EA 2WKQA 4WYYA 2OLUA 4YOFA 5FQMA 3NBLA 1YLPA 4ETZA 2L4RA 3VOYA 4C6YA 2EFUA 4S2OA 3VP1A 5EVIB 2VKSA 4KZBA 4DE0A 1LSXA 1HD8A 4WF0A 4DN0A 1EI5A 2FFYA 2W1TB 3NHQA 2VZWA 5G4ZA 3ZG7B 4ZJ3A 4B93A 1Q2QA 5CRFA 2VGLM 4G3KA 3QNCA 4KG6A 5CX7A 5FL3A 3NOPC 3W4PA 4EQIA 4S2LA 3NULA 5F69A 2J7VA 4FH4A 4OP5A 4OPYA 2J8YA 1K56D 1YT4A 3MQQA 4OQGA 4KZ3A 3GSGA 1K55A 1M40A 3QNBA 4A5RA 2ZQAA 2X02A 1F9IA 1NWZA 4CJNA 2ZM2A 2PT7A 4OH0A 1LI9A 3BM6A 3DAVA 3LCEA 4MEZA 5LBRA 1N9NA 5FAQA 2WUQA 1IEMA 2LB5A 1T18A 2KX6A 3A3JA 4Q0HA
chains in the Genus database with same CATH topology
3C2WA 4CLCA 4EW7A 3MXQA 5AVEA 3UE3A 4JGPA 4G3WA 4IUHA 1P9WA 4ARZA 1KOUA 5DFXA 5DKKA 4HQAA 3E4OA 1UWNX 4R6LA 1S1YA 2JN7A 3B42A 4CQHA 4EQ1A 3JVUA 3MMHA 2VA0A 3OLOA 1W63M 3EWKA 2JKRM 1OTBA 1OT9A 2W1RA 3R7WA 2K7SA 4LLOB 1LSVA 3T4TA 4EERA 1EW0A 2PR6A 2W3DA 5HZHA 3LFVA 3EEHA 3P7NA 2M7UA 4HH2A 4MN7A 2ZBBA 3GDIA 1JNUA 1TS8A 1T1CA 4MMNA 4LRZE 3T50A 3UMEA 5AVFA 1GSVA 2JHEA 1OJ5A 1NLYA 3F1OB 4H6JA 2ZMVA 3HCYA 2PDRA 5HWTA 1DP8A 4BBUA 3EEAA 2OWJA 3F1NB 3D3OA 4HIAA 2GJ3A 3OCNA 1GSWA 1V9YA 1OT6A 2VGLS 3D72A 1TF1A 4YNRA 3F1PB 1W63Q 4EETB 5HSQA 2A24A 2EWWA 3LI9A 1ODVA 2J3TD 4I3JA 3CLOA 1VHMA 3BY9A 3H9WA 4FSFA 3A0VA 4R3AA 4WELA 1TS0A 5C5KA 1F5MA 5MC7A 4YWZA 3TW8A 4QPRA 4MN5A 3LYXA 4EEPA 3C8CA 5HPIA 4NXEA 4LPZA 4F3LB 4Y5FA 3ULFA 1XJ4A 4HJ4A 2OAP1 1XFNA 4GJ4A 3H7WB 3IBRA 2B02A 3MFXA 4CLCD 2JKTI 3UE6A 1T1AA 2QKPA 2NUTC 2FZ0A 3IBJA 3P01A 1LT0A 1VB6A 1MKMA 1MZUA 2PD8A 5G4YA 1TS7A 4XT2A 3TRCA 2PR5A 4FOFA 4NXGA 5HDDA 4I38A 4UEYA 4GCZA 1MC0A 1S66L 3UB9A 3OC2A 3KYZA 5DJTA 4I5SA 3ZQ5A 4L9EA 2HV1A 5TBMB 5HDSA 2XRNA 1DRMA 2DMWA 1G6OA 3CUEA 3OCLA 1OJGA 2P7JA 3UB7A 3CI6A 1OTDA 4RQ9A 3VE4A 2O9CA 3T4OA 3E4QA 2PYPA 4NKPA 2V1BA 5HD3A 2O9BA 4R70A 3PBRA 3B47A 2M1CA 2V1AA 1N9LA 2W3HA 4AFIA 5F68A 5HL6A 4Z1WA 4IJGA 2D01A 4CLCC 2VJWA 2NUPC 3LIEA 4JGQA 1UGUA 2Z6CA 3PR6A 3PXPA 1IFQA 2A2LA 3CAXA 1X0OA 3GECA 4ME4A 2YKHA 3K2NA 2B18A 2XA7M 1YKDA 4OOLA 4NXBA 2GNXA 4GS9B 1XJ2A 1BYWA 2P04A 4HNBA 4KUOA 4Y3IA 3RH8B 2EWVA 4HJ3A 4HY8A 5HD5A 2GZAA 1H3QA 3BQAA 3KO6A 3PBTA 4DJ2A 4MN6A 1V9ZA 3UB8A 3CWFA 2D02A 3EQVA 3JVVA 4CLCE 1WA9A 2ZMFA 5EFWA 2KOIA 2W27A 4GHIB 1YAXA 1G28A 3MQOA 2W1TA 3KSIA 3MF0A 2W3FA 5DF9A 2VV6A 3EGXC 4O0PA 3TJZC 3BQ8A 2IA2A 4L9GA 3A0SA 3K3CA 4BBTA 2EA9A 3RFBA 2BASA 3LR3A 1NLZA 3H82A 5J3WA 4OOMA 2LB9A 3S7PA 4EU0A 1GSXA 3MR0A 3EOIA 1T19A 1T1BA 3MQ0A 5IS1A 4NEED 2I9VA 4HP4A 4LRYC 1DP6A 1TD5A 2G7UA 4KQOA 4BWIA 3FPVA 5KSHA 4ZRRA 4Q0JA 3UMDA 3OOVA 3E0YA 4HHDA 4K08A 2HF6A 2JKTM 1LL8A 1S67L 2PD7A 3R7WB 2OWHA 2Y8HA 3UB6A 3LIBA 3RTYA 4PKYA 5K5BA 3SW1A 4HH3A 4WUJA 4JGOA 3HJIA 4WEKA 3E98A 2HJEA 4H6JB 5TJJA 4PAUA 4MCWA 2XROA 4HOIA 3S7NA 3IS2B 4O8GA 2ZOIA 4NXFA 2VLGA 4EESA 3PBQA 5F5YA 1XJ6A 2J3TC 2XA7S 3LR4A 3PHYA 3FG8A 4HI4A 4HJ6A 4GS9A 3CUEC 5HDCA 4GLQA 3NJAA 3T4KA 2VV8A 3EQUA 3LUQA 3V67A 3EGDC 2PYRA 3E4PA 4KQDA 5DJUA 3B33A 2J80A 2VEAA 2XSSA 4EUVA 3KX0X 1XJ3A 4GHIA 3LIFA 3CITA 2V0WA 3BWLA 4HP9A 1OPXA 2QWSA 3PYPA 2YKFA 2ZOHA 3F1OA 3LI8A 2M7VA 2O0YA 3R4KA 5L8MA 2O9AA 4EXOA 1STZA 2V0UA 2HJ9C 3T4QA 4E04A 1OTAA 3F1NA 4P6ZM 4XT2B 5AJGA 1H8MA 2MJ6A 3LR5A 3NOUC 4BMWA 2Y79A 4I3AA 3F1PA 2K31A 2W3GA 4II7A 2K2NA 2HGVA 2QJ5A 3BJNA 5HPFA 4ETXA 3HJKA 1NRJA 5HWVA 1IOUA 3MJQA 3T4LA 4R38A 5DFYA 2VX8A 1DP9A 3DBAA 3KSHA 4BJPA 2W3EA 4WL9A 2Z6DA 4F3LA 4EEUA 2J3WA 4Y2FA 1P9RA 1S4SA 4MDZA 2KLIA 3H7WA 3KYQA 2QHKA 1ZHHB 3O5YA 2L1MA 4I3IA 1ZTUA 4CLCB 5I5LA 2JKRI 3OBFA 5IU1A 3T4JA 1N9OA 3ICYA 1P0ZA 1Y28A 4ARZB 4DJ3A 2O99A 1OTIA 3BW6A 2WKQA 3IS2A 3A0RA 1YSQA 1UWPX 3G6OA 5DKLA 1OTEA 3LIAA 1F98A 4YOFA 3LIDA 3FPWA 3S7OA 4ETZA 1S4RA 2L4RA 5TBMA 4BBVA 4IHQA 5J7EA 1S1ZA 3TE8A 1YSPA 2QYBA 4DMZA 2VKSA 2PHYA 1LSXA 2GX5A 1D7EA 5KIZA 4WF0A 3NOTC 5F6AA 4DN0A 3KSFA 2W1TB 3NHQA 2KDKA 2VZWA 4Q0IA 2INWA 1TS6A 4JGRA 5G4ZA 5IT5A 2OAQ1 2OOLA 4B93A 4PKYG 3H82B 3KSGA 4M4XA 4UQIS 4G3VA 2H28A 3ZYTA 3PBOA 2L0WA 2VGLM 4G3KA 3T4SA 3PBNA 3C30A 4WEJA 5CX7A 5FL3A 2CMNA 3NOPC 4IUKA 2VV7A 2A24B 4P6ZS 5F69A 2R78A 1LSWA 4I39A 2FH5A 3VE3A 3MQQA 1P97A 4WLAA 3LICA 3U2AA 2V9AA 3K3DA 3S7QA 1D06A 4L0LA 5HWWA 3C38A 5J4EA 3BY8A 2QJ7A 1XFQA 1F9IA 4O01A 1NWZA 4B9OA 2P08A 2WKPA 2PT7A 5A8BA 4L9FA 2W0NA 3FC7A 5LBRA 4UQIM 1N9NA 4GW9A 4LRXC 4PHTA 3PBSA 2LB5A 1T18A 3VOLA 2KX6A 3W2ZA 3LR0A 4WN5A 2WKRA 4KUKA 4Q0HA 3VV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYT A; 
#chains in the Genus database with same CATH topology
 3C2W A;  3UE3 A;  4E3L A;  4GKU A;  5CHJ A;  4OOY A;  1YMX A;  1KOU A;  5DFX A;  5FQK A;  4GD6 A;  3E4O A;  2JN7 A;  3B42 A;  3JVU A;  3MMH A;  1W63 M;  1RGY A;  3VP0 A;  4UA7 A;  1OT9 A;  1LHY A;  1LSV A;  2HP9 A;  5HZH A;  1FIK A;  1GHI A;  4DF6 A;  2ZBB A;  3VSL A;  3IX3 A;  3T1S A;  1FQG A;  3UME A;  3CPT A;  2E8J A;  3HCY A;  3MSH A;  1IYO A;  4S2N A;  3D3O A;  5U47 A;  3Q81 A;  1TF1 A;  1PNE A;  3ZCZ A;  3HUM A;  1XA7 A;  3BY9 A;  4BD1 A;  3S1Y A;  1TS0 A;  1F5M A;  1MXO A;  4YWZ A;  4D2O A;  3DTE A;  4QPR A;  4MN5 A;  4EEP A;  4WM9 A;  3IH8 A;  4F3L B;  4Y5F A;  4HJ4 A;  1ESI A;  1L0E A;  1JTD A;  1XFN A;  1PWC A;  3DTK A;  3VOZ A;  2H5S A;  2V8C A;  4HBT A;  3HUN A;  3MFX A;  4CLC D;  4X56 A;  2R9W A;  1N4O A;  2NUT C;  2V20 A;  2HDS A;  4WBG A;  1VB6 A;  5G4Y A;  1OME A;  3TRC A;  2HDR A;  1ERQ A;  2JE5 A;  3UB5 P;  4WZ4 A;  3A3I A;  2ZMA A;  4ZTK A;  3A3F A;  5AQ7 A;  2OLV A;  3CUE A;  2BG1 A;  1OJG A;  4PM7 A;  5EVI D;  4NG2 A;  3OZH A;  1MWU A;  4FD8 A;  2M1C A;  4B4X A;  3W8K A;  5FA7 A;  2Y2J A;  2WGW A;  1TDL A;  2Z6C A;  3PR6 A;  3IF6 B;  1X0O A;  1PZP A;  3BLS A;  3GEC A;  3ITA A;  3M6B A;  2B18 A;  2XA7 M;  4JLF A;  3GVB A;  3MKE A;  4GS9 B;  4HNB A;  4KUO A;  5A93 A;  2HDU A;  1SKF A;  1KDW A;  4MLL A;  2V1Z A;  5F82 A;  3O88 A;  4DJ2 A;  3UB8 A;  3ZG0 A;  1RP5 A;  3JVV A;  1WA9 A;  1ZG4 A;  5EFW A;  1YAX A;  2WKE A;  1G28 A;  5FDS A;  1TEM A;  2EX8 A;  5DF9 A;  3SH8 A;  3AGD A;  3A0S A;  1BLS A;  2HZ5 A;  1NLZ A;  5J3W A;  4HBU A;  1YLW A;  1T1B A;  3MQ0 A;  5IS1 A;  4HP4 A;  3NEC A;  1DP6 A;  1KE4 A;  4KQO A;  5KSH A;  3OPH A;  1JTG A;  4Q0J A;  4YIN A;  3E0Y A;  4R4R A;  4QWO A;  5CHM A;  3W4O A;  3HUO A;  3DW0 A;  3A3E A;  3UB6 A;  3SOI A;  5E2F A;  4PKY A;  2IWD A;  4Y13 A;  3VSK A;  4DE2 A;  3SW1 A;  4LEN A;  2HJE A;  1FOF A;  2WZX A;  2ACG A;  5TJJ A;  5E2G A;  3IHA A;  3IS2 B;  1IKI A;  4O8G A;  4KEN B;  3NI9 A;  4LV0 A;  1QME A;  2PU2 A;  1A0K A;  5L10 A;  4D60 A;  4HJ6 A;  2EX6 A;  5HDC A;  4ESP A;  4OPQ A;  3NJA A;  5FEG A;  3B3X A;  5BOH A;  4MBK A;  3IX8 A;  4RA7 A;  3EGD C;  3LY3 A;  4GB7 A;  3FYZ A;  2HP6 A;  5A90 A;  4EUV A;  2EX9 A;  4BLM A;  3CIT A;  4HP9 A;  2QWS A;  3VP2 A;  3VP4 A;  1PRQ A;  1N9B A;  3R4K A;  1STZ A;  3OPL A;  2HJ9 C;  3T4Q A;  4JXW A;  2ZC3 B;  4P6Z M;  1ESU A;  1YLZ A;  4QY5 A;  3LR5 A;  3ZGA B;  3F1P A;  1G68 A;  4Y0T A;  4IED A;  1ZC2 A;  1MKI A;  3UPN A;  5HPF A;  5L2F A;  1M6K A;  2PBD P;  5HWV A;  2VGK A;  4EWF A;  1E3U D;  2OV5 A;  1DP9 A;  3KYE A;  4WL9 A;  2R9X A;  2Z6D A;  3IWQ A;  3QP4 A;  4GDB A;  4EEU A;  2J3W A;  5CED A;  1S4S A;  1SDN A;  2WGW B;  3O5Y A;  3IQA A;  1LL9 A;  2JKR I;  3OBF A;  3N8L A;  3T4J A;  1VEU B;  1Y28 A;  4XXR A;  3FKW A;  4JPM A;  3BW6 A;  3LIA A;  1F98 A;  3FPW A;  2XDM A;  4OQ0 A;  1L0F A;  5TBM A;  4BBV A;  1WE4 A;  1S1Z A;  1L3L A;  1YPR A;  2QYB A;  3BEC A;  3IH9 A;  1ES2 A;  4UA6 A;  2GX5 A;  1D7E A;  5F6A A;  3SS5 A;  1S0W A;  4UHU A;  2OAQ 1;  2OOL A;  3CZD A;  3DTM A;  4M4X A;  5HAQ A;  3UY6 A;  4E3J A;  3NY4 A;  5JYO A;  3PBO A;  3DTI A;  3T4S A;  4WEJ A;  2UV0 E;  5HAP A;  2CMN A;  4KQQ A;  1MWT A;  3HLW A;  3D4F A;  1YM1 A;  3N6I A;  4I39 A;  2FH5 A;  1XA1 A;  5DF8 A;  4Y15 A;  3VE3 A;  3QP1 A;  2Y91 A;  2ZQC A;  3LO7 A;  4GNU A;  3S7Q A;  5J8X A;  2XFS A;  5J4E A;  4OVD A;  1XFQ A;  3FKV A;  2P08 A;  2WKP A;  3SH9 A;  2W0N A;  3G34 A;  2QZ6 A;  3ZNT A;  4RYE A;  4LRX C;  4PHT A;  3UN7 A;  3G2Z A;  1MWR A;  4EUZ A;  1XPB A;  4KZ8 A;  2Z2M B;  5E43 A;  2XF3 A;  2XD5 A;  1IEL A;  3UDI A;  2IWB A;  4KUK A;  4EW7 A;  1J9M A;  5AVE A;  3CG5 A;  2RCX A;  2WAF A;  4JXG A;  2XQZ A;  1SHV A;  2J9O A;  3CHW P;  4IUH A;  1P9W A;  4PM5 A;  1FIL A;  5TFQ A;  5HAR A;  5EUA A;  1PYY A;  3SS4 A;  1UWN X;  4R6L A;  5F83 A;  4CQH A;  1LL5 A;  4EQ1 A;  1K6R A;  4HES A;  3OLO A;  3EWK A;  1XGI A;  1KE3 A;  2K7S A;  4LLO B;  2Y2K A;  4MBH A;  4R0Q A;  3T4T A;  3LEQ A;  2BTF P;  2Y59 A;  2PR6 A;  2W3D A;  5EEC A;  5EPH A;  2XGN A;  3P7N A;  2AVX A;  2M7U A;  4X69 A;  2WK0 A;  4HH2 A;  3E2K A;  3GDI A;  4Y7P A;  4QD4 A;  1NYM A;  1T1C A;  2P74 A;  1GSV A;  3HL9 A;  2JHE A;  1NLY A;  2X71 A;  3V3S A;  3MZD A;  3AGF A;  5HWT A;  1DP8 A;  4BBU A;  3BFG A;  3BFD A;  2OWJ A;  5FAP A;  1JWV A;  1DY6 A;  4HIA A;  2GJ3 A;  4DDY A;  3OCN A;  2VGL S;  1WYC A;  4H8R A;  3Q07 A;  3F1P B;  2A24 A;  1ODV A;  4QHC A;  4FSF A;  4WEL A;  4DXB A;  3TW8 A;  1BT5 A;  4NXE A;  4S2J A;  1SKO A;  4NK3 A;  3Q7Z A;  5G18 A;  3P09 A;  3IWO A;  3Q7V A;  3UE6 A;  1T1A A;  5EM0 A;  3IBJ A;  5FI7 A;  1MKM A;  1TS7 A;  4XT2 A;  2PR5 A;  5EOO A;  4I38 A;  3O87 A;  3KYZ A;  5DJT A;  4I5S A;  2HV1 A;  1SDE A;  5TBM B;  1DRM A;  1G6O A;  3OCL A;  3UB7 A;  2XEP A;  4LCL A;  1OTD A;  3L9K A;  4JXS A;  3VE4 A;  5HAI A;  3T4O A;  2JC7 A;  2V1B A;  5HD3 A;  3PBR A;  1D1J A;  3HVF A;  1GA0 A;  4RVA A;  5M19 A;  4Z1W A;  2D01 A;  4CLC C;  3S22 A;  2VJW A;  3LIE A;  4JGQ A;  1KGF A;  3ZDJ A;  3CAX A;  3ZVT A;  4ME4 A;  1YKD A;  2P9V B;  2GNX A;  4O7D A;  1XJ2 A;  1BYW A;  3VFH A;  5FEF A;  4KZ6 A;  2EWV A;  4HY8 A;  3BQA A;  3CWF A;  1YLY A;  4ID4 A;  1VQQ A;  2KOI A;  2W27 A;  4GHI B;  4DRT A;  5CER A;  3S4X A;  1KDS A;  3EGX C;  4O0P A;  5FAT A;  4L9G A;  1FCM A;  4BBT A;  4P85 A;  1Z09 A;  2BAS A;  3LR3 A;  3H82 A;  3SS3 A;  4MNR A;  1F2K A;  4N92 A;  4NEE D;  3E2L A;  3IHB A;  4LRY C;  3HLB A;  1EWZ A;  5GHZ A;  1HVB A;  1LI0 A;  4BWI A;  4ZRR A;  4Z9Q A;  1PWG A;  1H8Y A;  3JPU A;  3UPO A;  1NZU A;  4WZ5 C;  2JKT M;  1W5D A;  2Y2G A;  3LIB A;  1L2S A;  1O7E A;  3V3R A;  1G5U A;  5HX9 A;  4P0M A;  3E98 A;  3U4L P;  1VET A;  1BLC A;  2EX2 A;  4MCW A;  2ZOI A;  3N8R A;  4NXF A;  4X55 A;  2VLG A;  2Y2O A;  4R1G A;  3IXB A;  4OLG A;  1XJ6 A;  2J3T C;  2XA7 S;  4BEN A;  3FG8 A;  3UO9 A;  3WWX A;  4WMC A;  3G32 A;  5E2E A;  4GLQ A;  1I2W A;  2JKG A;  2VV8 A;  3LUQ A;  2J9P A;  2PYR A;  2QMI A;  3T1Q B;  1K4F A;  1MY8 A;  5EE8 A;  2XSS A;  3ZG5 A;  4DKI A;  1FCN A;  3KX0 X;  2H10 A;  4KG2 A;  3NIA A;  4R3J A;  2V0W A;  2WZZ A;  3MXS A;  1QMF A;  2XLN A;  2Z2L B;  4HEF A;  1Y54 A;  1SKO B;  2ZOH A;  4DDS A;  1U60 A;  5M1A A;  3BRM A;  2M7V A;  2O0Y A;  3Q7V B;  4X68 A;  1K6S A;  4E04 A;  4XT2 B;  1ES3 A;  1GA9 A;  2K31 A;  3RXX A;  2K2N A;  1VM1 A;  4JF5 A;  2DCF A;  2OSU A;  2HGV A;  3BJN A;  2Y55 A;  4KZ7 A;  1K57 C;  1NRJ A;  3HLE A;  4OON A;  1YQS A;  2VX8 A;  3DBA A;  4IVI A;  3KSH A;  1JWP A;  2PAV P;  4FH2 A;  2Y2P A;  1XP4 A;  3H7W A;  3MS6 A;  1BUL A;  2QHK A;  5D3O A;  3ZVW A;  4P6B A;  1ZTU A;  5I5L A;  5IU1 A;  2XD1 A;  1GHM A;  3VFF A;  5F1G A;  1N9O A;  3ICY A;  2WGV A;  1CEF A;  4B4Z A;  1OTI A;  4JBF A;  3TOI A;  1W7F A;  5CGS A;  1GCE A;  2PRF A;  4K0X A;  2G2U A;  5EOE A;  4KZ5 A;  3LID A;  1I5Q A;  3T1X A;  5J7E A;  2C5W B;  1PW1 A;  4GZB A;  4K0W A;  1JVJ A;  3GV9 A;  3NOT C;  3DWK A;  3KSF A;  4Q0I A;  2WAE A;  3CPT B;  4DE3 A;  1TS6 A;  5EVL A;  2HP5 A;  4PKY G;  3H82 B;  3QP6 A;  3C7U A;  2XH9 A;  1FSW A;  1MPL A;  3GTC A;  3ZG8 B;  4M3K A;  2L0W A;  3HLC A;  1KVM A;  3DWZ A;  1BUE A;  3BLM A;  4P6Z S;  2R78 A;  5M18 A;  1LSW A;  1P97 A;  1BLP A;  1O07 A;  2V9A A;  1D06 A;  5HWW A;  3I7J A;  3T1R A;  5AQA A;  1PW8 A;  5A8B A;  2B95 A;  3FC7 A;  3C7V A;  2Y2Q A;  4GW9 A;  4X25 A;  2E8I A;  3C4P A;  5TR7 A;  3LR0 A;  4PPR A;  1BZA A;  1NYY A;  1VET B;  5IHV A;  4CPK A;  4K91 A;  3G4P A;  1SZV A;  4CLC A;  4LV1 A;  4JGP A;  4GDN A;  5HL1 A;  4G3W A;  1PI4 A;  4ARZ A;  5DKK A;  1LLB A;  4HQA A;  1PWD A;  5DF7 A;  3NCK A;  5F1F A;  1H5X A;  4P87 A;  2EFX A;  3MKF A;  4B88 A;  1OTB A;  3R7W A;  1HLU P;  4EER A;  4C75 A;  2HPB A;  3UDX A;  2Q9N A;  5GLC A;  2ZL1 A;  3LFV A;  1BTL A;  4LGW A;  4NET A;  1JNU A;  1TS8 A;  3PAE A;  4LRZ E;  5AVF A;  4QB8 A;  1TVF A;  1OJ5 A;  4ZDX A;  3V5M A;  2ZMV A;  5JYP A;  2PDR A;  5A92 A;  2PU4 A;  4BL2 A;  4PM8 A;  3M6H A;  1GSW A;  1OT6 A;  3D72 A;  4DE1 A;  2EWW A;  2Y2N A;  4I3J A;  5CEB A;  3H9W A;  1GHP A;  1VHM A;  2XK1 A;  4LCM A;  3A0V A;  1NXY A;  4F94 A;  3RJU A;  5C5K A;  2QPN A;  4QY6 A;  1CI9 A;  3PTE A;  3C8C A;  5HPI A;  4WZ5 A;  2WAD A;  5KZH A;  1XJ4 A;  4OLD A;  3H7W B;  3IBR A;  5HFO A;  3NDG A;  2QKP A;  4ZJ2 A;  2FZ0 A;  1DJA A;  5GHY A;  4FOF A;  1KVL A;  4NXG A;  2ZJ9 A;  5HDD A;  5FQJ A;  4UEY A;  3WS2 A;  3ZG9 B;  1NY0 A;  3ZQ5 A;  4L9E A;  1Y4O A;  3QHY A;  1W79 A;  3FZC A;  2P7J A;  1H8Z A;  2O9C A;  3E4Q A;  1IKG A;  3N7W A;  4N9L A;  4R70 A;  4PM6 A;  4S2I A;  4QJG A;  5F68 A;  5HL6 A;  4IJG A;  1YMS A;  4JF4 A;  2DNS A;  2NUP C;  4Y0O A;  2A2L A;  1K0K A;  3QP5 A;  5AQ9 A;  4JXV A;  4S2P A;  5FI2 A;  3UE1 A;  5CXW A;  4EBL A;  2P04 A;  4Y3I A;  1ERM A;  3N8S A;  4PM9 A;  4X1M A;  5L09 A;  4HJ3 A;  2Y2M A;  3UE0 A;  3N4I A;  5HD5 A;  3W4Q A;  1BLH A;  2GZA A;  1H3Q A;  5CGW A;  5FQI A;  4OP8 A;  4CLC E;  4LV3 A;  3BFE A;  2ZMF A;  3BYD A;  4IBX A;  4E3O A;  1K57 A;  3MF0 A;  1Z6F A;  2W3F A;  2VV6 A;  2V8F A;  2IA2 A;  3K3C A;  3G30 A;  1RGZ A;  1AWI A;  2JKF A;  3C5A A;  4EU0 A;  1GSX A;  5CEC A;  4GD8 A;  2JBF A;  4E3K A;  3BFF A;  3GQZ A;  3IXG A;  3D9Y A;  5I94 A;  2I9V A;  1TD5 A;  2G7U A;  4WMC D;  3WRT A;  2FFF B;  3UMD A;  3OOV A;  5DVA A;  2ZQ9 A;  4K08 A;  1KGE A;  2DRW A;  2UWX A;  1LL8 A;  2B5R A;  3R7W B;  3M2J A;  2Y8H A;  2PBY A;  4E3I A;  1L0D A;  1E25 A;  2ZL1 B;  3ITB A;  1E3U A;  5K5B A;  4JGO A;  3FV7 A;  3UNW A;  4GOG A;  4ZAM A;  4BD0 A;  3C4O A;  4XUZ A;  2XRO A;  2CC1 A;  3IF6 A;  5EM1 A;  3MFD A;  1CK3 A;  3LR4 A;  2ZM8 A;  3PHY A;  1XXM A;  3TSG A;  4GS9 A;  4EBN A;  1CQA A;  4MBF A;  2ZM0 A;  3T4K A;  1XKZ A;  3IT9 A;  3O3V A;  5CTM A;  4ZJ1 A;  3GRJ A;  3E4P A;  5EV0 A;  5DJU A;  3VMA A;  4N1X A;  2VEA A;  1K25 A;  3ZNY A;  5FAS A;  5CHU A;  1XJ3 A;  4UA9 A;  4U3T A;  3BWL A;  1OPX A;  5FQ9 A;  1IYQ A;  3PYP A;  4OPZ A;  2YKF A;  4OQI A;  4JF6 A;  3F1O A;  2V0U A;  2VK3 A;  2ZC5 B;  3F1N A;  1W8Q A;  1K54 C;  2ZC6 B;  3FWL A;  4BMW A;  2WYX A;  4E3M A;  2W3G A;  5EVI C;  1NJ4 A;  2XR0 A;  3UDF A;  2QJ5 A;  3IXH A;  3MJQ A;  1SCW A;  3T4L A;  3G2Y A;  3WRZ A;  5DFY A;  1BSG A;  4YFM A;  4R23 A;  5A91 A;  1MWS A;  1KE0 A;  4Y2F A;  3GMW A;  3KYQ A;  4N1H A;  2H0T A;  1ZHH B;  2Y4A A;  1L0G A;  1MBL A;  3IXD A;  4PMA A;  1P0Z A;  3IX4 A;  2BLS A;  2O99 A;  3IS2 A;  3A0R A;  1YSQ A;  1HZO A;  1UWP X;  3G6O A;  5DKL A;  1OTE A;  4N9K A;  3V50 A;  3S7O A;  4FCF A;  1S4R A;  3MZF A;  3BFC A;  1TDG A;  4IHQ A;  3LEZ A;  4KQR A;  3TE8 A;  1YSP A;  4DMZ A;  2PHY A;  5KIZ A;  2JCH A;  1AXB A;  3PAG A;  2KDK A;  2INW A;  4E6W A;  4JGR A;  5IT5 A;  4LV2 A;  3TG9 A;  5FSR A;  3KSG A;  4UQI S;  4G3V A;  2IWC A;  2H28 A;  3ZYT A;  4OKP A;  4R3B A;  3PBN A;  3C30 A;  4EBP A;  4U0T A;  1CEG A;  4IUK A;  2VV7 A;  5GHX A;  2A24 B;  3IF5 A;  5FQQ A;  4C3Q A;  1E4D A;  2Y2H A;  4WLA A;  3LIC A;  3U2A A;  3K3D A;  4R4S A;  5FDH A;  4L0L A;  3C38 A;  3BY8 A;  2QJ7 A;  4O01 A;  4B9O A;  5EVE A;  4L9F A;  5DTS A;  1FSY A;  3WS5 A;  4UQI M;  2C6W B;  2H0Y A;  2ZC4 B;  3PBS A;  3VOL A;  4E6X A;  3W2Z A;  4WN5 A;  2VGJ A;  2WKR A;  3VV4 A;  3MXQ A;  4Y0U A;  5KMW A;  1PFL A;  1VEU A;  3SH7 A;  2EXB A;  1K56 A;  2GDN A;  4GN2 A;  1S1Y A;  3SZT A;  3UPP A;  2VA0 A;  4JKT A;  2JKR M;  2W1R A;  2ZLY A;  2ZQ7 A;  1S6R A;  1EW0 A;  5FI6 A;  3EEH A;  1W8Y A;  3NC8 A;  4MN7 A;  3RXW A;  4MMN A;  3T50 A;  4S2M A;  3WS4 A;  3F1O B;  4H6J A;  4U0X A;  2WKH A;  3EEA A;  4DXC A;  3F1N B;  4OPR A;  3HLF A;  2A49 A;  3G31 A;  1V9Y A;  4IBR A;  5CTN A;  2I72 A;  4YNR A;  1W63 Q;  4EET B;  2ZD8 A;  5HSQ A;  3LI9 A;  1ES4 A;  2J3T D;  3CLO A;  4R3A A;  5MC7 A;  3LYX A;  4KG5 A;  3IF6 C;  3ZFZ A;  4LPZ A;  3ULF A;  3ZHH A;  3HLD A;  3CMZ A;  1ERO A;  2OAP 1;  3O86 A;  4GJ4 A;  2B02 A;  5L07 A;  4XUX A;  1JWZ A;  4BQM A;  2JKT I;  4FTX A;  3WS0 A;  3P01 A;  2WGI A;  5DTT A;  1LT0 A;  1MZU A;  2PD8 A;  5AQB A;  1ZKJ A;  1YLT A;  4GCZ A;  1K55 C;  1S66 L;  1MC0 A;  3UB9 A;  3OC2 A;  1FR1 A;  5HDS A;  2XRN A;  2DMW A;  4S2K A;  4KZA A;  3CI6 A;  4RQ9 A;  3L7H A;  2PYP A;  4NKP A;  3HBR A;  2O9B A;  3B47 A;  2V1A A;  2WKI A;  1N9L A;  2W3H A;  4AFI A;  1KGG A;  3MBZ A;  2HDQ A;  2Q0O A;  1UGU A;  3PXP A;  3OPR A;  4Q8I A;  1IFQ A;  2YKH A;  2Y2I A;  3K2N A;  3IWI A;  4OOL A;  4NXB A;  1RCJ A;  5FAO A;  3MXR A;  3Q82 A;  3RH8 B;  1H0M A;  3NDE A;  4IVK A;  3BEB A;  5CGX A;  1K54 A;  2ZQD A;  3KO6 A;  3PBT A;  4MN6 A;  1V9Z A;  3EQV A;  2D02 A;  5EVI A;  4ZBE A;  1CI8 A;  1K38 A;  3HRE A;  3MQO A;  2W1T A;  3KSI A;  2XFT A;  3TJZ C;  3BQ8 A;  4X1L A;  2EA9 A;  3LY4 A;  3RFB A;  1IYS A;  4S2N C;  4RX3 A;  1CF0 A;  4OOM A;  2LB9 A;  5E2H A;  4OQH A;  3S7P A;  3MR0 A;  3EOI A;  3QP8 A;  3MZE A;  4KZ4 A;  5GL9 A;  3CJM A;  1NRF A;  1T19 A;  1FCO A;  1G6A A;  1XGJ A;  3FPV A;  1Q2P A;  3AGE A;  2ZC7 A;  5GLD A;  3HLG A;  4Y17 A;  4HHD A;  2HF6 A;  2ZQ8 A;  3WS1 A;  1S67 L;  2PD7 A;  1ACF A;  2OWH A;  3RTY A;  4BL3 A;  4HH3 A;  4RX2 A;  4WUJ A;  3HJI A;  4WEK A;  1CJF A;  4H6J B;  4PAU A;  4HOI A;  3S7N A;  4EV4 A;  4EES A;  3PBQ A;  1ALQ A;  5F5Y A;  5HW3 A;  2P9V A;  5GLA A;  4HI4 A;  3CUE C;  1ZG6 A;  1PIO A;  4X6T A;  1DJB A;  3A3D A;  4KZ9 A;  3EQU A;  3Q1F A;  3V67 A;  1ONG A;  5KSC A;  4X53 A;  1I2S A;  2G2W A;  4KQD A;  1PZO A;  3B33 A;  3GR2 A;  3JYI A;  2J80 A;  1NZO A;  4GHI A;  3LIF A;  1ES5 A;  5GLB A;  3ISG A;  4LFU A;  4UAA A;  3OPP A;  1IYP A;  3T12 B;  3LI8 A;  5L8M A;  4EXO A;  2O9A A;  2V2F F;  1OTA A;  2Y2L A;  3QP2 A;  3VP3 A;  1WYB A;  2X01 A;  5AJG A;  1H8M A;  2MJ6 A;  1J3W A;  3M2K A;  3NOU C;  4QU3 A;  1PI5 A;  2Y79 A;  4I3A A;  4II7 A;  1XX2 A;  3P98 A;  1ONH A;  4ETX A;  3HJK A;  1IOU A;  4FUW A;  1C3B A;  4R38 A;  3LGO A;  1FR6 A;  4E3N A;  4BJP A;  2W3E A;  5DTK A;  3V39 A;  2A3U A;  4F3L A;  1P9R A;  1DJC A;  2EXA A;  4MDZ A;  2KLI A;  2L1M A;  4I3I A;  4CLC B;  2Q9M A;  5TGF A;  3G35 A;  1YLJ A;  4ARZ B;  4DJ3 A;  2RL3 A;  1HTZ A;  1K4E A;  2WKQ A;  4WYY A;  2OLU A;  4YOF A;  5FQM A;  3NBL A;  1YLP A;  4ETZ A;  2L4R A;  3VOY A;  4C6Y A;  2EFU A;  4S2O A;  3VP1 A;  5EVI B;  2VKS A;  4KZB A;  4DE0 A;  1LSX A;  1HD8 A;  4WF0 A;  4DN0 A;  1EI5 A;  2FFY A;  2W1T B;  3NHQ A;  2VZW A;  5G4Z A;  3ZG7 B;  4ZJ3 A;  4B93 A;  1Q2Q A;  5CRF A;  2VGL M;  4G3K A;  3QNC A;  4KG6 A;  5CX7 A;  5FL3 A;  3NOP C;  3W4P A;  4EQI A;  4S2L A;  3NUL A;  5F69 A;  2J7V A;  4FH4 A;  4OP5 A;  4OPY A;  2J8Y A;  1K56 D;  1YT4 A;  3MQQ A;  4OQG A;  4KZ3 A;  3GSG A;  1K55 A;  1M40 A;  3QNB A;  4A5R A;  2ZQA A;  2X02 A;  1F9I A;  1NWZ A;  4CJN A;  2ZM2 A;  2PT7 A;  4OH0 A;  1LI9 A;  3BM6 A;  3DAV A;  3LCE A;  4MEZ A;  5LBR A;  1N9N A;  5FAQ A;  2WUQ A;  1IEM A;  2LB5 A;  1T18 A;  2KX6 A;  3A3J A;  4Q0H A; 
#chains in the Genus database with same CATH homology
 3C2W A;  4CLC A;  4EW7 A;  3MXQ A;  5AVE A;  3UE3 A;  4JGP A;  4G3W A;  4IUH A;  1P9W A;  4ARZ A;  1KOU A;  5DFX A;  5DKK A;  4HQA A;  3E4O A;  1UWN X;  4R6L A;  1S1Y A;  2JN7 A;  3B42 A;  4CQH A;  4EQ1 A;  3JVU A;  3MMH A;  2VA0 A;  3OLO A;  1W63 M;  3EWK A;  2JKR M;  1OTB A;  1OT9 A;  2W1R A;  3R7W A;  2K7S A;  4LLO B;  1LSV A;  3T4T A;  4EER A;  1EW0 A;  2PR6 A;  2W3D A;  5HZH A;  3LFV A;  3EEH A;  3P7N A;  2M7U A;  4HH2 A;  4MN7 A;  2ZBB A;  3GDI A;  1JNU A;  1TS8 A;  1T1C A;  4MMN A;  4LRZ E;  3T50 A;  3UME A;  5AVF A;  1GSV A;  2JHE A;  1OJ5 A;  1NLY A;  3F1O B;  4H6J A;  2ZMV A;  3HCY A;  2PDR A;  5HWT A;  1DP8 A;  4BBU A;  3EEA A;  2OWJ A;  3F1N B;  3D3O A;  4HIA A;  2GJ3 A;  3OCN A;  1GSW A;  1V9Y A;  1OT6 A;  2VGL S;  3D72 A;  1TF1 A;  4YNR A;  3F1P B;  1W63 Q;  4EET B;  5HSQ A;  2A24 A;  2EWW A;  3LI9 A;  1ODV A;  2J3T D;  4I3J A;  3CLO A;  1VHM A;  3BY9 A;  3H9W A;  4FSF A;  3A0V A;  4R3A A;  4WEL A;  1TS0 A;  5C5K A;  1F5M A;  5MC7 A;  4YWZ A;  3TW8 A;  4QPR A;  4MN5 A;  3LYX A;  4EEP A;  3C8C A;  5HPI A;  4NXE A;  4LPZ A;  4F3L B;  4Y5F A;  3ULF A;  1XJ4 A;  4HJ4 A;  2OAP 1;  1XFN A;  4GJ4 A;  3H7W B;  3IBR A;  2B02 A;  3MFX A;  4CLC D;  2JKT I;  3UE6 A;  1T1A A;  2QKP A;  2NUT C;  2FZ0 A;  3IBJ A;  3P01 A;  1LT0 A;  1VB6 A;  1MKM A;  1MZU A;  2PD8 A;  5G4Y A;  1TS7 A;  4XT2 A;  3TRC A;  2PR5 A;  4FOF A;  4NXG A;  5HDD A;  4I38 A;  4UEY A;  4GCZ A;  1MC0 A;  1S66 L;  3UB9 A;  3OC2 A;  3KYZ A;  5DJT A;  4I5S A;  3ZQ5 A;  4L9E A;  2HV1 A;  5TBM B;  5HDS A;  2XRN A;  1DRM A;  2DMW A;  1G6O A;  3CUE A;  3OCL A;  1OJG A;  2P7J A;  3UB7 A;  3CI6 A;  1OTD A;  4RQ9 A;  3VE4 A;  2O9C A;  3T4O A;  3E4Q A;  2PYP A;  4NKP A;  2V1B A;  5HD3 A;  2O9B A;  4R70 A;  3PBR A;  3B47 A;  2M1C A;  2V1A A;  1N9L A;  2W3H A;  4AFI A;  5F68 A;  5HL6 A;  4Z1W A;  4IJG A;  2D01 A;  4CLC C;  2VJW A;  2NUP C;  3LIE A;  4JGQ A;  1UGU A;  2Z6C A;  3PR6 A;  3PXP A;  1IFQ A;  2A2L A;  3CAX A;  1X0O A;  3GEC A;  4ME4 A;  2YKH A;  3K2N A;  2B18 A;  2XA7 M;  1YKD A;  4OOL A;  4NXB A;  2GNX A;  4GS9 B;  1XJ2 A;  1BYW A;  2P04 A;  4HNB A;  4KUO A;  4Y3I A;  3RH8 B;  2EWV A;  4HJ3 A;  4HY8 A;  5HD5 A;  2GZA A;  1H3Q A;  3BQA A;  3KO6 A;  3PBT A;  4DJ2 A;  4MN6 A;  1V9Z A;  3UB8 A;  3CWF A;  2D02 A;  3EQV A;  3JVV A;  4CLC E;  1WA9 A;  2ZMF A;  5EFW A;  2KOI A;  2W27 A;  4GHI B;  1YAX A;  1G28 A;  3MQO A;  2W1T A;  3KSI A;  3MF0 A;  2W3F A;  5DF9 A;  2VV6 A;  3EGX C;  4O0P A;  3TJZ C;  3BQ8 A;  2IA2 A;  4L9G A;  3A0S A;  3K3C A;  4BBT A;  2EA9 A;  3RFB A;  2BAS A;  3LR3 A;  1NLZ A;  3H82 A;  5J3W A;  4OOM A;  2LB9 A;  3S7P A;  4EU0 A;  1GSX A;  3MR0 A;  3EOI A;  1T19 A;  1T1B A;  3MQ0 A;  5IS1 A;  4NEE D;  2I9V A;  4HP4 A;  4LRY C;  1DP6 A;  1TD5 A;  2G7U A;  4KQO A;  4BWI A;  3FPV A;  5KSH A;  4ZRR A;  4Q0J A;  3UMD A;  3OOV A;  3E0Y A;  4HHD A;  4K08 A;  2HF6 A;  2JKT M;  1LL8 A;  1S67 L;  2PD7 A;  3R7W B;  2OWH A;  2Y8H A;  3UB6 A;  3LIB A;  3RTY A;  4PKY A;  5K5B A;  3SW1 A;  4HH3 A;  4WUJ A;  4JGO A;  3HJI A;  4WEK A;  3E98 A;  2HJE A;  4H6J B;  5TJJ A;  4PAU A;  4MCW A;  2XRO A;  4HOI A;  3S7N A;  3IS2 B;  4O8G A;  2ZOI A;  4NXF A;  2VLG A;  4EES A;  3PBQ A;  5F5Y A;  1XJ6 A;  2J3T C;  2XA7 S;  3LR4 A;  3PHY A;  3FG8 A;  4HI4 A;  4HJ6 A;  4GS9 A;  3CUE C;  5HDC A;  4GLQ A;  3NJA A;  3T4K A;  2VV8 A;  3EQU A;  3LUQ A;  3V67 A;  3EGD C;  2PYR A;  3E4P A;  4KQD A;  5DJU A;  3B33 A;  2J80 A;  2VEA A;  2XSS A;  4EUV A;  3KX0 X;  1XJ3 A;  4GHI A;  3LIF A;  3CIT A;  2V0W A;  3BWL A;  4HP9 A;  1OPX A;  2QWS A;  3PYP A;  2YKF A;  2ZOH A;  3F1O A;  3LI8 A;  2M7V A;  2O0Y A;  3R4K A;  5L8M A;  2O9A A;  4EXO A;  1STZ A;  2V0U A;  2HJ9 C;  3T4Q A;  4E04 A;  1OTA A;  3F1N A;  4P6Z M;  4XT2 B;  5AJG A;  1H8M A;  2MJ6 A;  3LR5 A;  3NOU C;  4BMW A;  2Y79 A;  4I3A A;  3F1P A;  2K31 A;  2W3G A;  4II7 A;  2K2N A;  2HGV A;  2QJ5 A;  3BJN A;  5HPF A;  4ETX A;  3HJK A;  1NRJ A;  5HWV A;  1IOU A;  3MJQ A;  3T4L A;  4R38 A;  5DFY A;  2VX8 A;  1DP9 A;  3DBA A;  3KSH A;  4BJP A;  2W3E A;  4WL9 A;  2Z6D A;  4F3L A;  4EEU A;  2J3W A;  4Y2F A;  1P9R A;  1S4S A;  4MDZ A;  2KLI A;  3H7W A;  3KYQ A;  2QHK A;  1ZHH B;  3O5Y A;  2L1M A;  4I3I A;  1ZTU A;  4CLC B;  5I5L A;  2JKR I;  3OBF A;  5IU1 A;  3T4J A;  1N9O A;  3ICY A;  1P0Z A;  1Y28 A;  4ARZ B;  4DJ3 A;  2O99 A;  1OTI A;  3BW6 A;  2WKQ A;  3IS2 A;  3A0R A;  1YSQ A;  1UWP X;  3G6O A;  5DKL A;  1OTE A;  3LIA A;  1F98 A;  4YOF A;  3LID A;  3FPW A;  3S7O A;  4ETZ A;  1S4R A;  2L4R A;  5TBM A;  4BBV A;  4IHQ A;  5J7E A;  1S1Z A;  3TE8 A;  1YSP A;  2QYB A;  4DMZ A;  2VKS A;  2PHY A;  1LSX A;  2GX5 A;  1D7E A;  5KIZ A;  4WF0 A;  3NOT C;  5F6A A;  4DN0 A;  3KSF A;  2W1T B;  3NHQ A;  2KDK A;  2VZW A;  4Q0I A;  2INW A;  1TS6 A;  4JGR A;  5G4Z A;  5IT5 A;  2OAQ 1;  2OOL A;  4B93 A;  4PKY G;  3H82 B;  3KSG A;  4M4X A;  4UQI S;  4G3V A;  2H28 A;  3ZYT A;  3PBO A;  2L0W A;  2VGL M;  4G3K A;  3T4S A;  3PBN A;  3C30 A;  4WEJ A;  5CX7 A;  5FL3 A;  2CMN A;  3NOP C;  4IUK A;  2VV7 A;  2A24 B;  4P6Z S;  5F69 A;  2R78 A;  1LSW A;  4I39 A;  2FH5 A;  3VE3 A;  3MQQ A;  1P97 A;  4WLA A;  3LIC A;  3U2A A;  2V9A A;  3K3D A;  3S7Q A;  1D06 A;  4L0L A;  5HWW A;  3C38 A;  5J4E A;  3BY8 A;  2QJ7 A;  1XFQ A;  1F9I A;  4O01 A;  1NWZ A;  4B9O A;  2P08 A;  2WKP A;  2PT7 A;  5A8B A;  4L9F A;  2W0N A;  3FC7 A;  5LBR A;  4UQI M;  1N9N A;  4GW9 A;  4LRX C;  4PHT A;  3PBS A;  2LB5 A;  1T18 A;  3VOL A;  2KX6 A;  3W2Z A;  3LR0 A;  4WN5 A;  2WKR A;  4KUK A;  4Q0H A;  3VV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...