3ZZPA

Circular permutant of ribosomal protein s6, lacking edge strand beta- 2 of wild-type s6.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
QGYTTWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLQNEKEIIQRALENYGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN S6
publication title Trimming Down a Protein Structure to its Bare Foldons: Spatial Organization of the Cooperative Unit.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zzpA00
1HNZF 4DV6F 4JI3F 4DV3F 4YHHF 1N34F 4DV2F 4JYAF 5AJ3F 4NXMF 4DR7F 4GKKF 4AQYF 2BVZA 4OX9F 4LF4F 4LF5F 5IWAF 4LF8F 4JI0F 3OTOF 5BR8F 2UXBF 4X62F 1LOUA 4LF7F 4DV1F 2BXJA 2UXCF 1IJFB 1RISA 1N33F 2YY3A 4KHPF 1IBKF 2B7BB 4DV5F 4DR6F 4DV7F 4DR4F 4DR3F 2B7CB 1N36F 4LFCF 4X64F 4LFBF 2UXDF 1HNWF 2J5AA 3T1HF 1FKAF 2E5LF 4DUZF 2UUAF 4JI2F 2VQFF 4JV5F 4LFAF 1CQMA 4DV4F 4X66F 1B64A 3R3TA 4DV0F 2ZM6F 2VQEF 1IBLF 4JI7F 1IBMF 4B3TF 4DR1F 2F4VF 2HHHF 1QJHA 1I94F 2RJZA 1HNXF 4LF6F 4NXNF 1XNRF 4X65F 1XMOF 1IJEB 4LF9F 4DR5F 1G1XA 1G7CB 4YY3F 1J5EF 4B3MF 4JI8F 5LMUF 4JI5F 4GKJF 2UUBF 5LMNF 3T1YF 4JI6F 4B3SF 4DR2F 1FJGF 1N32F 4JI1F 1XMQF 1F60B 2KJVA 4JI4F 1XNQF 1CQNA 4K0KF 2UU9F 1GH8A 1VMBA 3ZZPA 2UUCF 4DUYF 1HR0F 4B3RF 2KJWA
chains in the Genus database with same CATH superfamily
4P9SA 3NP5A 3HSJA 4RW9B 5IV4A 1NPPA 1IWGA 4B9UA 3M6XA 3KOAA 1UFWA 1HI1A 3MGJA 4YDDB 2CPXA 1BLUA 3JQKA 3VQTA 3M6VA 1SL0A 3R5JB 1CJVA 4ED6A 1PSDA 1IBLJ 2KXNB 3F56A 2KYXA 3IAS9 2FYXA 5KFSA 1ZA1B 3W2VB 2DGSA 4TY8B 2UUAF 4B3MJ 4JV5F 2M9KA 4OZ2A 2Y1RI 2ZH5A 4YEAA 4MMOA 2Q3PA 1FVSA 3NOGA 1RWKB 3NGDA 3G6YA 3MTKA 1JQGA 2RDDA 4DN0A 2OSQA 2PMWA 2ILZA 2HIQA 5BYSA 2NPIA 4DX8H 3IAM9 4KFBB 3IWLA 2DHHA 4H4OA 1RHMB 3AA9A 2G0CA 4K50A 2VPYB 3GFYA 2V4QA 3WIVA 2CQ3A 2QSWA 4H4MB 5HJXA 3PYGA 1FRLA 4DS5A 4LSLA 3NAIA 3D0GE 3PX0A 2IBOA 1C0UA 1U2FA 3FBEA 3IFEA 1RHJB 1X8DA 4KGVB 2CYYA 3LPYA 5ETKA 2F1FA 5C25B 1TMJA 1RT7B 5HI7A 1HMVA 1K73T 4OZJA 1RHKB 1JJHA 3T5JA 2IM0A 1H2TZ 2LQ8A 3QLHA 3CT9A 2AT1B 2A1BA 4UZCA 3MMCA 1YBUA 1SJ4P 4YOEA 4IQMA 5HROA 1MG7A 2QX0A 3NNCA 4MKBA 3DLGA 1S10A 5THWA 4YR0A 1TL7B 3GJRB 3L4BC 1TR0A 1JKHB 2ZOGA 3GPAA 2VIHA 2MB0B 1BQNB 3I0RA 5IFMA 4NOHA 4I2QB 2G1DA 1DLOA 4B9SA 2ZH2A 2UUCF 4OYWA 4FPRA 4IG0B 3MCSA 1L3VA 1MWZA 5DZ7A 3VALA 3UNGC 4OX9J 3I4PA 3FNNA 1L3KA 2AGPA 4LF4F 2HQIA 1FCAA 3UD4P 1X9WA 1S99A 1HWJA 4P2MA 3WBZA 1MN9A 4FP9A 3ZZ0A 2MQLA 3QSIA 4F0HA 1U6BA 1SC4B 2W4PA 2OKQA 3N01A 4M5JA 1WI8A 2IVMA 3W1YC 3SV3A 3RW6A 1SC1B 4I67A 1SVDA 5HO4A 2KKHA 2L48A 3BYPA 4L6V3 4B3TF 4K4UA 3SDEA 1R8AA 3M9OB 1HNIB 2E7XA 2W9BB 3D9BA 3MZIA 3V6DA 2BJ1A 3CJ5A 4YHHJ 4ECXA 3FCHA 1GTHA 1RP5A 1TL1A 3AOAA 1QAIA 1MMDA 3RBXA 2ROEA 1UJ6A 1RHRB 8ATCB 1YRUA 4B3RF 2VB6A 3BGUA 5J2PA 1QAYA 3JAMU 1CJUB 2DNPA 5DJBA 3SCKE 2XY6A 4B9VA 6FDRA 4NX9A 5HMXA 4OYAA 3HVWA 1AA1B 1S0NA 4XAKA 5LSLA 5T7LA 1DQ8A 2E44A 4P73A 3QJJA 5B0CA 5FLXY 1X4HA 3BN7A 1BHNA 2ASLA 2JVRA 4Y65A 3BGFA 2MQQA 2G2ZA 2BEFA 2UVVA 4F04B 4P52A 1KP6A 3LQVA 4I6AA 4OJ1A 4Q7AA 3K7RA 1FJCA 2P6SA 2BOPA 1V9OA 3DOKB 1VQSA 3Q22A 2E1MC 3TJ9A 2HMIA 2R7SA 2HWIA 2C2NA 5KFUA 4BDPA 1VHIA 4DR7J 3KDOA 2YWWA 2E5HA 3VF0B 2GNKA 1XMQF 1UVJA 2HFOA 2A10A 1IR0A 2UZAA 2AKWB 1GH8A 3IGVA 3PYEA 2MSTA 2V2KA 4OZ1A 6FD1A 3MEEA 4ELUA 2OTJS 1U6FA 4YUDA 2YBVA 4ES2A 1FNXH 1NSAA 1RBLA 3AH6A 3M8SA 3MUTP 1OPIA 2OPRB 1NAQA 1Q81T 1U0SA 1JXEA 4LSZB 1YZ7A 1IQZA 3LGNA 2XGQA 2XHWA 4ZVPB 3H5YA 2LEPA 2W2PP 2ZITA 3NY0A 4LFBF 4WYLA 1VLOA 1R31A 3CJRA 3ILLA 2OMOA 1D8ZA 1JXVA 3DYAB 3GE9A 4DUZF 4ECSA 1U8WA 1RT5A 4U6PA 2OFHX 3OL9A 1BC6A 4LSNA 2LXFA 3JSMB 3W9JA 3QWPA 9RUBA 3R1LA 5J1EA 2HNYB 4TYAA 1O51A 2NR0A 4CO5A 1SC6A 1FDAA 3I31A 4OX8A 4HH1A 4G1IA 1ACMB 1N5YB 4FF2A 1A0OB 3G6ES 1SQGA 3DGVA 3SFUA 3E01B 3W66A 1HLWA 5IQQA 4OX6A 2BA9A 3Q2TC 3SYZA 4NYZA 3Q8SB 4PEOA 5K8OA 2WOMA 2RDJA 3WC2A 3IBCB 4V1Ak 2AF6A 3HDSA 2UUAJ 3R27A 3K5MA 4JV5J 2ZC3A 5K9FA 3R97A 1I1GA 4TLRA 4LR8A 1K47A 2Y8YA 5D8HB 1S6OA 1D9DA 3WC0A 2M88A 2FHOB 4A46A 1D9FA 1TVRA 2R2RA 2RQKA 2XNQA 4K4WA 4O3PA 2RD5C 3RAXA 1LFPA 3CJTA 4R5PB 4MIBA 2Y1JA 2DGTA 1RSCA 3CB4A 2DRAA 2VFRA 4L3KA 1M5OC 2M4MA 1GMUA 2ZZTA 3OW2R 3SI8A 4TU8A 4IRKA 3IRXA 1VC0A 4ID8A 2VHGA 2BQUA 1N88A 1JLEA 3P3DA 4C48A 4JP8A 2DR9A 4RO0A 2XO7A 3OFHA 4DL7A 2AYMA 5DDPC 2IRXA 4DFKA 4F4XA 2W9CB 4IFYB 3LAKA 3MTJA 2B9YA 1YRXA 2BJEA 3QAUA 3ZTPA 2LEAA 4V19X 3GB0A 2R2SA 1U2CA 3JXOA 3VV2B 4K4SA 4RW4A 1RHUB 2Y0BB 2WK4A 3H2LA 3C16B 4GRSA 1NHUA 4DSKA 3BR8A 3CCSS 5KT6A 4LVNP 1L3TA 1RBAA 2IPOB 3A12A 4HT5A 5BYRA 5DO2A 2GS8A 2IC3A 5DG9A 1ELOA 4WZMA 4KBIA 2W7PA 5L9NA 3VGTA 3U7JA 2Q6CA 3L09A 4KH1B 1HBOB 2CVIA 1VLYA 1PYSB 5HMYA 4NI2A 2UUCJ 4DL5A 1N52B 4PXBA 4ELVA 2B43A 1SCJB 4R25A 4UQTA 4LF4J 1AYEA 4RWWA 2Z57B 3G8QA 5KFNA 1NDPA 4ZJLA 3QIPA 2EI5A 3OFFA 1L5UA 3TX8A 2R7RA 3QBCA 4A4JA 3PRBA 3OXLA 1Y5LB 5AT1B 1EHWA 1WEYA 3GIMA 2FC9A 1YJRA 2RQCA 1REGX 3PFEA 3EGNA 5J1PA 2I5JB 2VBXA 2B9WA 2F7VA 5EDWA 4B3TJ 1EX8A 3PV8A 4AT1B 3ILIA 3DM2B 4OHZA 4WFBQ 1H73A 3RAMA 4CLYA 5IXUA 2MKKA 1R6YA 3CGIA 4HTJA 3AXMA 3I0SA 5CYQA 3MD1A 3NL0A 5KT3A 3EICA 3PR4A 4B3RJ 2GIFA 2R7QA 2CWKA 3AQPA 2HZVA 4GC7A 2GZOA 4PR6A 2YKOA 4CLZA 2EW9A 1CC7A 1N5QA 2ZWPA 4HVZA 4DL4A 5KFRA 3MM8B 2X1BA 4WKYA 4DQSA 1MROB 2D3O1 3D5MA 2LXIA 2ZBPA 3Q8QB 4YS2A 1A9NB 3CSKA 3AB2B 9ATCB 4IG3B 4DL2A 2MQ8A 2XSJA 2PI4A 1AT1B 2IAJB 1H2UX 3FFIA 5J2NA 1H98A 5IT4A 4OHYA 3TRGA 5K8NA 3UDCA 3CJ0A 3KLHB 3R3TA 1HI0P 1RJJA 1XMQJ 3MXHP 1RACB 1RT2A 2LLZA 3HJVA 3MCOA 2ATLA 2QL7B 5KT2A 3BBBA 1T9UA 1EKSA 1BMQB 3DOMA 5AE3A 1N32J 3LW5C 4O4GB 1FRMA 4Y6IA 2HGNA 1S9GB 2XULA 3OTCA 1RAEB 1NKCA 4A8FA 1V3RA 2GGPB 3PRVA 2FLLA 4F67A 2WVCA 1DTTB 2MKIA 4ECRA 1ROFA 3D1OA 2YKNB 4LFBJ 3AJ2A 3GONA 3OBIA 5LSOA 4X62F 3HVTB 3KNGA 2Z2LA 3H4DA 3GCWP 3L95X 2BUNA 1WHVA 4J9MA 3EVOA 1TUWA 4ZPVR 4DQPA 1NEEA 2YPZA 4Q44A 1SJ3P 2ZOFA 4WJBA 4OYZA 2D7SA 1OSDA 3D3BJ 4EFAC 5KG2A 5GMKa 2MLXA 1DBDA 1RTJA 5J2MB 3WHIA 1URNA 2IM1A 2OLWA 4OYPA 3KLVA 4LUBA 3M8QB 4O3RA 2BR0A 2W7OA 2I9SA 3GFZA 2ZEJA 3KDNA 2VKZG 2CPIA 3MECB 3NGUA 1KLMB 2DHGA 4NCGA 1XR6A 5HL7Q 3H5SA 1Q8BA 1HNZJ 1TFYA 1T11A 1H2VZ 4J91A 3PKMA 3IO1A 3HHLB 2VFUA 3EX7B 2Y8WA 2UXCJ 2KB2A 5KFXA 5KFCA 2AJ2A 3I32A 1MU2A 1S0OA 3H42A 4F7VA 1OSCA 3MFHA 3EWGA 4QWAA 3DFEA 1C0TA 2E7VA 4CLLA 5KG0A 1RABB 3PO5A 4HYKA 3OTEA 4X4SA 2YQ3A 2ABYA 3CXCR 1TL5A 3M6UA 1HBMA 2F4VF 3QT5A 3NS5A 3I56S 1ZTTA 4Y00A 3OLBA 2OPSB 5ETNA 1LWEA 3R7BB 5DZ6A 1NDLA 2L9NA 5EN1A 5IT9Y 4MKYA 1JLGA 2MZRA 4RW8B 2JEFA 4QYRA 5KAKA 2IA6A 1EZZB 1R8HA 2ATCB 2BX6A 1AROP 4EZ6A 3W2WA 2UVRA 1VYAA 3RYLA 3IG1A 3UDVA 1Z2ZA 2RH3A 3B4DA 4LF8F 2DIUA 4KKOA 3BDPA 4TLQA 2BXJA 3KLIB 4USJC 4IR1A 1F6TA 4IH5A 1UMJA 5L1LA 4YFUA 3RRKA 3T5KA 3ULHA 3QT8A 2DNYA 3QT6A 4CTAA 2BJDA 4WZQA 2GVZA 3R1HA 3IBFB 3VAGA 3DLKB 1FX4A 2OJ3A 1Y3JA 1NMEB 3Q23A 2Z8QA 1KLNA 3MAAA 3HFVA 3DI6B 2Z2ZA 1WG4A 1S0MA 2OEKA 4QIWD 2D9PA 4Y34A 1NM2A 4A48A 2VG7B 1TAUA 2AD9A 4TY8A 4YB6A 1HHTP 2OD6A 2DR7A 2RVJA 1TKTB 5BYQA 3ZZPA 3EZOA 2RUGA 2FZCB 1GX5A 2CG8A 2V2VA 4PPZA 1SC3B 5AE2A 4P6QA 5ETRA 4BC7A 2VPWB 4IO1A 4ANDA 4KHPJ 1F5CA 1S1WA 2MQOA 4TU7A 3K8WA 2NXUA 4N77A 2O67A 1TMMA 2CPDA 3ILJA 4RNMA 4X64F 1RT4B 4WP8A 1SQEA 2ZKTA 3NLCA 4I7FB 2JDJA 1M5VC 4K8RA 4WWSA 3IMQJ 3NBPA 3H4BA 3MOZA 1HKAA 3MR2A 1GEHA 1ZS6A 3EPGA 5LXYA 2ALZA 5IQ6A 4DMZA 3CD5A 2AGOA 3B8HA 3NCRA 1RA7A 1FXDA 4OLOA 1IVZA 1VK8A 2HK2A 1HBNB 3LA0A 4U7CA 4TKTA 4M5HA 1X4AA 2IJNA 3C66A 4OHWA 3HHEA 3K58A 5LMUF 2CJYB 5LMNF 4DCPB 4N76A 4KV8B 4ZHRB 2BRLA 4JUZA 4MAKA 4JV0A 2HIYA 5KFPA 4K4VA 4DUYF 4X84A 1MLAA 3FBCA 3DXBA 2EK1A 2RMLA 2OPPB 2Q1LA 4C8LA 2KRBA 1Q78A 3VWSA 1UVMA 3IRWP 1ZETA 3F0NA 2WCXA 4QR1A 1B0VA 3TAPA 3DRXA 4LRCA 3S1TA 4M5MA 2M5YA 4DLEA 3T1HF 2DH8A 1WSVA 1BWVA 3H25A 3D6FB 4LQ3A 1KOOA 2N7YA 1WG1A 2FHMA 2GMHA 4MTPA 4ED5A 2FGCA 3VQSA 5B0DA 1YK9A 4ED7A 1HNVB 2C3MA 2J9EA 4NEZA 2CQ4A 3THPA 2J0QD 2JC1A 1HQEA 4X62J 1DURA 2A2DA 5F9NA 3IXQA 3CWJA 4M8LA 1JMTA 2FPHX 2R3VA 2WSEC 2RHSB 5AXNA 1VRUB 1HNIA 1RKIA 2W9BA 5MAOA 2DCLA 1J2VA 2NXJA 3BKTA 3WIUA 3ONQA 3SXLA 2CNLB 5KFQA 3SSRA 1DQ9A 1WKLA 1ZTWA 1YIJS 3MMBB 2B7BB 4TY9A 5HMZA 1N8RT 2ADBA 3A3OB 1M0SA 4NLYA 4RW7B 2HBQB 4C0OC 5E33A 1W7WA 2KDOA 4ITSA 3PHTA 1CJUA 3KHLA 1D8YA 5KFIA 4DPUA 2DH7A 2PA8D 1VQ4S 1NKEA 5E3QA 2IYGA 2VQEF 5E3AA 3GIJA 4K5SA 1HWUA 3N5FA 4WU3A 4I69A 3BV8A 4NRTA 1UW4A 3ENVA 1HPZB 3LH2S 2CZ4A 3NKYA 5F9LA 4QWDA 4HACA 5ETSA 2E5GA 4XIUA 3T1YF 3P96A 4JI1F 4K0KJ 5JVGQ 1R8PA 2AYGA 2R42A 4C11A 3CCTA 1YJ9S 2L3MA 4JYAF 4LBHA 5HVFA 3M2VB 5IM0B 4HHUA 3UCZP 2YNHB 5I3UB 4FVCA 4X4VA 1KNZA 2F4VJ 4KC5A 2OEMA 1HNWF 2VA3A 3QJPA 4WXOA 2MHNA 2HQDA 1KHWA 3CCLS 1QSSA 3RRHA 5HP1A 4KJIA 4Y2IA 3CCMS 1CJVB 2J9DA 2FVPA 4TU9A 4LRBA 2HHQA 1AUSL 3TVKA 1I94F 2OPRA 1XMBA 3SCLE 1OO0B 2RU9A 2HAFA 3DU5A 1RAIB 5DETA 1GMWA 2F8EX 3HZEA 3MM7A 2BRKA 1OPZA 4OQJA 3UPFA 1NKBA 3ZZTA 1UPPA 1QM9A 3M4XA 2E1RA 4HT7A 3TEGA 2O1PA 4DHVA 3TVYA 2MXYA 3JSMA 3D2WA 3BBFA 1BQMA 2C3UA 5LT5A 2YX7A 2V8VA 2PD1A 1YBTA 2COLA 2VFTA 2BVZA 1X4EA 2VC1A 4FYYB 1KVJA 4N7TA 1B3TA 4W98A 3JAMY 4HDGA 4NLWA 3FBBA 2ZH3A 2ZUGA 4C8ZA 5F8LA 1U1PA 2OGUA 3GWCA 3RB0A 1FDBA 2VOOA 1RKJA 2UXDJ 4K7QA 2ZH4A 3DCAA 3OL6A 4LFCF 4UOFA 3PIPQ 2XCAA 1F9EB 5GADI 3QNWB 3CULA 3CEDA 4L75A 3FCVA 4QW8A 4RKUC 3ZNJ1 4LSLB 4Z7YA 4O0IA 1C0UB 3DC2A 4HI2A 3OXGA 3IBWA 3QJLA 3C14A 2CPZA 1EARA 1NK6A 4DQQA 3Q8RB 3A3PB 3ISZA 2DEJA 2LDYA 3LGHA 3AY0A 4IUFA 1Y4ZB 4UTGA 3HJFA 2MLZA 2R7VA 2VH7A 1HMVB 2KHCA 3WX4A 3NWRA 2LECA 2DR5A 3BDEA 1FI4A 2ZVSA 5HROB 4IFVA 1S76D 1NO8A 1XTZA 2HGMA 4R5PA 2G0JA 2IMOA 4IQXA 3GCXP 4N8NA 3PXGa 1T3OA 3NRBA 3DN9A 1FWLA 1GFWB 3MURP 1R0AA 1CS4B 1PAEX 5C42A 3R5CA 1RWVB 3I4HX 4ZP9A 4ZVQB 1VQ9S 5ETLA 3FSIA 2DEIA 4QU7A 1DLOB 1JLFB 3WZ0A 2N7CA 1BWEA 1QE1B 4DR6F 3W5YA 5HK4A 1YWXA 3I5AA 1KBRA 1RZMA 1U26A 5K5MA 4F50A 2FJVA 1AUDA 1D3WA 2HZAA 2GIRA 1QY7A 1TUVA 3P4UB 2DNQA 2C1EB 3DRRA 3C16A 1SH3A 3OJSA 2CAJA 3TZXA 2RRBA 1FE0A 3K2YA 5BJRA 3UN3A 1YZ6A 2CA9A 4J7CA 3U02A 3TARA 4LIRA 2WW4A 3N9UC 2MSSA 2FLPA 2QLXA 1Q95G 2AP6A 1S6UA 2W4DA 4NLQA 5I4MA 1Q8IA 1OIAA 4NXMF 1G6BA 2VBYA 3G71S 4OX7A 1RTIA 2UP1A 4DJBA 4UT4A 1TL1B 3NXZA 5ADZA 1SKUB 4EZ9A 2BW7A 3W9IA 3LUYA 4NZ7A 4URSA 3BPSP 3W8PA 2YH1A 2XMAA 3KJVA 2EBEA 1Q5YA 4YN3B 2LU1A 5AXKA 3I6PA 1MN7A 2CADA 2HEKA 3SEOA 2I5JA 2GJFA 1JB0C 5AXMA 3MFIA 4YDXA 1CULA 4KPYA 3TAMA 1S1TA 1SJ1A 1F5AA 3DRPA 2UVUA 1SH2A 4YY3F 4JI6J 4RNHA 2HQ3A 2HAIA 2A18A 3DM2A 4CH0S 3PR5B 2W2NP 3K57A 1N48A 2U2FA 3Q2SC 3BJYA 1NK7A 5A2QU 2OIHA 4OJHA 4QYZJ 2DXEA 2E1CA 2WRMA 2XMMA 2HMIB 1N34F 2NZ4A 5KG7A 1WD6A 2MDAA 3QATA 1KHVA 1UL3A 2NSBA 5CD4H 3T41A 5D3GB 4WFNQ 3IWXA 5HBMA 2HS4A 2RE1A 1X5TA 2VQEJ 1EQ0A 3MEEB 2XMKA 2VL1A 1PYOB 3BM7A 3D6HB 2HGLA 4DSFA 1X4GA 2XSFA 1R7IA 4NLDA 1YITS 4ZOSA 2QMXA 3BN4A 4F0KA 2HNZA 3T1YJ 1LFWA 3J7ZT 3PZPA 3TA1A 3NOCA 1VJQA 1PO6A 2LDIA 2ASDA 4P75A 4KSEB 2MJNA 2RS8A 3DDKA 3I96A 3FC9A 2H5JB 3KNAA 4JYAJ 2IAJA 4GVBB 1RT5B 5GMEA 1H74A 3EMTA 4EBDA 3P5TL 5J1EB 3GIRA 4U96A 2CFXA 1LW0A 3KLFA 3J80U 1IKWB 1H3DA 2CQPA 3MEKA 2EPIA 3D7SB 4Y28C 3RGIA 2QA4G 1YGYA 1HNWJ 4UUWA 3OTOJ 4PRFA 4A8QA 2J8AA 1RAHB 4MK8A 4O4GA 3T9ZA 3QFWA 3NGSA 1N33F 1F2HA 2A2CA 3T6JA 3PJ9A 4WFXA 4PUOB 2RAQA 1S9FA 1WORA 3LWMA 1I94J 3QGPA 2GGPA 4P72A 5E2QA 4TN2A 2QTWA 1GK8A 2WOMB 1NNDA 2E5LF 5JVHQ 3S8SA 1FXLA 2P6TA 1IM6A 3HVTA 3OUYA 1SH0A 1FEHA 3CD6S 4RLEA 4ZLNA 1D09B 4IDKA 5LSRA 1ZZNA 4I68A 4ID5B 1FJEB 2K3KA 1SQFA 4OFZA 1RWXB 5DG8A 1PC4A 2CZVC 4B3SF 3GR0A 3LPEA 2V4RA 2AEFA 1VRQC 4WFYA 1HW8A 1KN6A 2ZZNA 4JBCA 2KFNA 2XMJA 3CDBA 3IRXB 3NG8A 4LFCJ 3SMZA 5AJ3F 4U95A 4O44A 2BE9B 1BQXA 3P5BP 2YPYA 1KONA 1K1QA 1N5VA 2OPQA 3D28A 2ZDPA 1WACA 2H4YB 4BS2A 4BBYA 4AYBD 1I3OB 2I0XA 1B7FA 4JOUA 3BO2A 1G2EA 2HQCA 1KLMA 5HQLA 1U1NA 4EO6A 3TEHB 1DTQA 2HVIA 4F4YA 3BR9A 4CDIA 4RW4B 3KMQA 2QL9B 2HS3A 4X4TA 2I1RA 2ZNZA 1U6ZA 3V4MA 2M8HA 1L3SA 4DX5A 2D3ZA 3DLJA 1KVIA 4IOAQ 3MEDB 3JS9A 1Q5VA 2QV6A 2E5JA 4EO8A 2XZTB 3TZWA 1KSPA 4LF1A 4ED3A 1E6VB 3H20A 2MQNA 1HFEL 5A76A 2FVRA 4F3MA 3K0JA 2FY8A 1NSPA 2J9CA 4ILLA 3FZ2A 3RTVA 2YQ1A 1RCOB 4NI2B 1UA0A 4CH1A 4DR6J 1SKWA 1IUJA 1FERA 1Y00A 4C4WA 1Q8LA 3JYTB 5HJYA 4JV1A 2CPEA 2FHJA 4W92B 4JI0F 2B5JB 1SBRA 1BD6A 2VG5A 1DHMA 2KG0A 3QT7A 3QIPB 4O0NA 2YY3A 2DITA 4OL8A 3HHLD 2P2CB 2BJ3A 3JSBA 5H9EK 2OSRA 3W60A 2H51B 2YX1A 4X4OA 3G4SS 2MZJA 3I82A 2HPUA 3CW2C 1RYRA 4JI2F 4V19J 3FQLA 3PJWA 1RE1B 1Q86T 4ED0A 3IGNA 2Y9HA 2F63A 3MM9B 4ZJOA 3MD3A 2IVFB 4CLTA 2LQ5A 1IBCB 3CJ2A 2GW8A 3N5BA 1EKRA 3ZTQA 3G8SA 3HVRA 4NXMJ 2VG6B 3M30A 2J6UA 2DKOB 2W2OP 5C24B 3DLKA 3UO0A 3IR5B 4DFMA 3D3CJ 3KHGA 3UR3C 3BGLA 2NXNA 3NS6A 1FRHA 3DI6A 2R8IA 2EK6A 3IN5A 3FCWA 1EETB 4YQWA 1FKOA 1Y10A 1TKXA 2HKEA 4TNOA 3QGHA 3GR1A 3TUIC 1WTBA 1TKTA 2B9XA 2JH3A 3DLEA 2W8KA 1RAJA 3NAHA 2XWXA 4LT6A 3JSRA 2XMUA 2J7UA 4F2RA 4YY3J 2YKPA 1RUSA 3TNVA 4DU7A 4ZVOB 4NCBA 5B08A 3OSNA 2HVDA 2XSJB 1AZSB 3OL8A 3H98A 3QFHA 4F0MA 3FFIB 5J2NB 1LK5A 1N34J 1RT4A 2BQRA 3GZ7A 4ES3A 2LQBA 3MMJA 1R89A 2CNKB 1M1KT 4I7FA 4ZN3A 2K7KA 5CZVA 5KFYA 5T41A 2Y1LB 4Y2KA 1OJ4A 2I8EA 2R8HA 2K06A 1NDKA 4G6VB 1IKXA 1PIEA 1X0FA 4OX9F 3DOMB 5FIIA 2L41A 3N6MA 2HQFA 3RG6A 4U9RA 2H65B 2XG8A 4L76A 1VQ7S 4D3HA 2WB4A 4FPIA 4DR3F 1TZ0A 1H38A 1QSYA 5D0GA 3HVAA 4PG6A 2KT3A 4A8SA 3GYNA 3BYRA 3M05A 4N41A 2DHAA 5CAAA 3DU6A 4YB7A 1MMLA 2M8DB 3SQGB 5KFAA 3G9CA 3FMWA 2Y0SD 4EBCA 4LRAA 3FVYA 2WSFC 5LOQA 2QEXS 4M5DB 1T95A 1FRIA 2VJUA 3W7BA 5HVGA 1OWXA 3CDEA 3PJXA 2PA3A 2F3JA 3W64A 1J27A 2OH2A 2UU9F 4OYMA 4OYIA 1RTJB 4ZPTR 3A8JA 3BH7B 3ETOA 4JI3J 4ZP7A 2ZHBA 3QZ8A 8RUCA 2OMLA 1FXRA 3EDQB 4GO7X 4N56A 3BEGB 4RUAA 2E5LJ 1NXIA 2CZ9A 2CPHA 3SSQA 4DV1F 1K0TA 2Q66A 3H2UB 5D0EA 4NCGB 4LRDA 3NWGA 4ZLJA 5M2PA 1FD8A 5DDOC 1X4DA 3VAJA 4DSEA 4P7VA 3RAQA 4IR9A 4YR3A 1SL2A 1NDCA 1VGYA 2DNNA 3V4IA 3ICLA 2AEMA 1HBUB 2HHUA 4B3SJ 1JXLA 2LFVA 1BUXA 2FVQA 1MU2B 2KXFA 4DSJA 2ERRA 4G1PA 3MMBA 2RIJA 4IOCQ 2KFZA 4K4XA 1U48A 1I5OB 1EIYB 1C0TB 4RW7A 5AJ3J 3VAMA 1LKZA 4QIVA 1B4SA 3BO3A 3GJTB 1T9TA 4F02A 1YTYA 4I6YA 2JL9A 3HCXA 5F0UA 3OFGA 5IS2A 1VQMS 2AWZA 1DFDA 4DV2F 4Q8EA 1NSQA 2F40A 5D78A 3KG0A 1HPZA 1W25A 1A6LA 1X7VA 2NYHA 4LQ9A 1T03A 5CA5A 2R7TA 4KGXB 1Y5NB 4P74A 2QN6B 4NLVA 1IR2A 1IKYB 4URGA 2G0IA 2RU3A 1S6QA 3W2WB 3HPOA 5E3RA 1M5PC 4O3QA 3IG1B 4F26A 4G1QB 3CIZA 2NUUG 2KFYA 1RU2A 1VS3A 5IM0A 2MQMA 4L3NA 4EGLA 4QPXA 3QO9A 3D67A 2UVWA 1VC6A 4ZJQA 4ZIWA 2GQCA 4H4KA 1YJUA 3ILOA 2DNGA 4CTAB 2JHEA 4IO9Q 1DQAA 4DBQA 1ZPVA 1SV5A 2GVZB 2XTJP 2R8KA 1FFGB 2V34A 3OL7A 4JI0J 4DL0C 1P9YA 3QAEA 1Y11A 4ZA1A 2DCUB 1Q8KA 1FEEA 1RT1A 5KG5A 3K5NA 1YLXA 3MAAB 2WBRA 1ZYQA 3CE8A 1HWIA 3C15A 2VZ9A 2XZDB 1XN9A 2E7WA 1KS2A 2WZ1A 2POKA 1R3NA 2YKMB 1DZ5A 2GVDA 3FEYB 1U45A 3O44A 4JI2J 1T9VA 2GA7A 2W7AA 2VBZA 3PHEA 5DGBA 2V8HA 2DHXA 3M2RA 1S0VA 4USHA 5F8JA 5KT7A 1O5JA 4B9MA 1AB8A 2KN4A 4ICLB 2FTRA 1OQ3A 5FLXU 2AZ1A 2BMBA 4URQU 2JEJA 3UDLA 4D3GA 3DRYA 4DPOA 2X1AA 1S1WB 2NCKL 1WI6A 2FY1A 5EWGA 1WC6A 1Y0HA 2VA2A 1IR1A 1S12A 4XO0A 2GHPA 2M7SA 4J9LA 3RB3A 1V3SA 1VQ8S 3OR2B 3GLJA 3B4MA 3NBPB 3BH6B 1NJZA 3TW0A 3M8YA 2DNMA 1F60B 1TK8A 5C2CA 2FJXA 1H72C 4UOGA 3M2UB 2OUGA 1CG2A 3QRQA 4FS1A 3TP2A 3GYGA 4DZ6A 1U7LA 2JOQA 1BGXT 4QJVA 1F2GA 2RSQA 2CRLA 3QMQA 2KG1A 2FZGB 4M5KA 2ZH9A 2DJWA 4NMXA 5A0YB 2JJ4D 1LWFA 2HVEA 3U27A 4X4NA 2B7CB 3V6KA 4DPWA 2XO6A 3T5LA 4CH7A 3T3FA 3B6BA 2RRNA 5T14A 5DDRC 1G4CA 4ILMA 1XERA 2I6WA 1CS4A 4CNYA 1C1CB 1UEUA 4LREA 4AXIA 3RBDA 1B99A 4HL9A 5HN0A 2RB7A 3FKBA 1JLFA 3MMAA 1QE1A 1U24A 1XQIA 4ZPWR 1N6QA 3MHYA 1RA6A 2HSEB 4C0BA 2WAQD 2JRSA 4PG5A 1IXKA 3MM5A 3R7SB 4X4QA 2KZZA 1VDHA 2QG9B 5E3CA 3CDWA 1S6PA 4NE9C 5EX3A 1Q7YT 3POTA 4DR3J 2PI5A 2C2MB 2MTLA 1HQEB 1ZH5A 4NA3A 4NLUA 1IJFB 2KVQE 4N5SA 3JTPA 3ZO7A 4DEZA 3H90A 1CPZA 1WWHA 3PYDA 2J5AA 2PSZA 1VBXA 5DG7A 3G87A 3I5BA 3MEGB 2MZQA 5LJ3Y 2V9KA 4ELTA 3LO3A 3V5RA 4BLGA 2PFDA 2UU9J 2WBMA 1YVFA 1ZM3A 1X5OA 2V0NA 1U1MA 3N6LA 3HMJG 2LA6A 1VRTA 4LF2A 2RHQB 4ZCMA 3S7RA 4CLWA 4DV1J 2E9ZA 2H48B 2DD8S 1PBAA 4ED4A 2DO0A 3HHLC 4MFBA 3DRSA 1UJ4A 4HACB 1NU4A 4RU9A 3IR6B 2YQ0A 2AZ3A 2CG4A 2N4CA 3F41A 1VQKS 1K9MT 2DO4A 1RAFB 3O5TB 4C11B 2YWFA 3KJNB 2LYVA 3W63A 3SCIE 3ZTOA 3J81U 5EWEA 1UEKA 2AJ4A 3MPDA 2HZCA 3NNHA 5D3GA 3BSNA 2CJKA 3GYXB 1WF1A 4P10A 2RJZA 1HNXF 5HANA 2VASA 3PIOQ 1UFKA 4DV2J 2MEWA 3NCPA 1KEKA 5HP1B 1N32F 2ZKUA 4FYDA 1KTQA 1S1XB 3ZZRA 2HURA 2XLKA 1VHFA 2XEXA 1KWMA 2OFGX 2RUSA 3MM7B 1JLCA 1GAOA 4DPXA 3PM9A 4GVBA 5D4OA 1YHQS 2G13A 4H54A 4ATNA 4RPFA 2PN6A 1VBYA 2IRYA 2DYAA 5F3ZA 4O3OA 2M2BA 5L1JA 2A6MA 1BQMB 1P6TA 2RDIA 4WE1A 1HYSA 3GFXA 2BM1A 2IY5B 2MGZA 4U67Q 2B4UA 3R2DJ 1IKWA 2KO1A 4DLGA 2DR6A 3E3XA 1XR5A 3K17A 3VAFA 5AE1A 4LFAF 1PYTA 4DV0J 1DY3A 2NUHA 4L74A 3UW1A 1RT6A 3THVA 2GC8A 3DXSX 4J5OA 3RZAA 2V8PA 3FK4A 3FDSA 2F5GA 2YTCA 4PUOA 4AL6A 1N56A 3C2PA 2HHTA 4JB8B 3W65A 5CQGA 2HBRB 1UW9A 2B51A 2P5VA 1RWPB 2CXEA 3I9ZA 2J7KA 4PZVA 4CLSA 1O6XA 4NLTA 2B4VA 4EYIB 1VMBA 4OHXA 3C14B 4CO1A 4B17A 2ZWOA 4RUCA 1WOPA 1HNZF 1YQHA 1RWWB 5GAHI 3TYTA 3M6WA 3OT9A 2HBYB 5A2QY 5B0BA 1NJXA 2H1YA 4ID5A 5BR8F 1TAQA 1JJCB 2UXCF 3VAIA 4IFVB 2HBZB 1HW9A 4PWDB 3CCRS 4ZIVA 2CQ0A 1T8EA 4KHRA 2NYIA 3HXMA 4Q0BB 1BXNA 1YSJA 4XPEA 1R0AB 3O6QA 4DV4J 5C42B 1PJ7A 3BKUA 4DOZA 3JSYA 4TYBA 4DSLA 3ZFVA 1B0TA 4FS2A 1VFJA 1NK5A 3FMBA 1GXLA 4DR2J 2KI2A 2OHDA 4CM0A 2H4WB 3HK2A 2R7OA 1U1LA 4K4YA 3DRRB 3TA2A 1RHQB 4EBEA 3KLEB 2B4PA 3GSDA 1ZM9A 3CJ8A 1JIHA 1FVQA 1RWMB 3PW5A 2IJRA 2MQPA 3MEDA 3W9HA 4OZ0A 1FNMA 1JK9B 3J80Y 1E6VA 3BQ1A 1UVIA 3CUNA 4LF7F 3G8TA 4NLPA 2MPUA 4DV7J 2VODA 2P9GA 3OTDA 4DV5F 1QLNA 3MCMA 4OYOA 4IRDA 1UTAA 2UV8A 1AXQA 2C2ZB 3IR7B 2C3PA 2FJBB 1RTIB 1KQFB 3TWZA 3JYTA 2B56A 5B0FA 4DCOB 1U47A 2BQ3A 2B5JA 2CQHA 1LV5A 1F9FA 4JV2A 3GU0A 4DFJA 2APOA 4DR1F 4F25A 4NEYA 4NXNJ 2OO4A 2XHCA 2EWHA 2X51A 5DDQC 3KJVB 1FHTA 2D1CA 5KFBA 2NQPA 1N5SA 5IZHA 3R5DA 3PW7A 2VJVA 5H9FK 4QCLA 3CCQS 4OZ5A 1ZOTA 2F8HA 3OJUA 2ROPA 1YI2S 2V8DA 3P45B 4A47A 2WW8A 5E41A 1CULB 1KFSA 2C22A 5A8KB 3TAMB 1UWBA 3RB6A 1S48A 3MR7A 1S1TB 3MM9A 6AT1B 3DRPB 3M1VB 2AW0A 3J7Z5 4X4RA 1HIYA 5GVQA 1S1VA 3CC2S 2IDEA 3LP1B 4KHPF 2VG6A 4FKXA 5HQMA 2BDPA 2HYIB 5BXIA 3R2CJ 4U7UD 5C24A 1JLAA 4HEA9 4KYZA 2Q79A 2LP4A 3HFZB 4FKYA 7AT1B 4Q2MA 4UY8T 4I0WA 2M70A 3RB4A 4P2SA 1EETA 5HBMB 3O2IA 3PG9A 5F3TA 4ZPAA 4LR7A 4Z37A 4LVOP 3D6TB 1NH8A 4M94A 1SUQB 3FSYA 4NLSA 2FLOA 4ZVEA 2HVZA 1U0HB 1OMSA 4ZVRB 3IWNC 2EXUA 2V8GA 1RB0A 3FUYA 1YJWS 2HNZB 4CIOA 5GAGI 5K8MA 1NPKA 1XNQF 1MW7A 4FN5A 4M5NA 4WP9A 2QGFB 5B0EA 3CF5Q 5IT9U 3GG1A 4XDCA 2E29A 5CD4A 1RQ0A 1AZSA 1Z4UA 2EFNA 2Y3YA 2LEBA 2MZ1A 3DHWC 3T19A 3KLGA 5D0HA 2DXDA 3RRGA 3Q8UA 3BS9A 3K5OA 2VOPA 4GVLA 1QAXA 2HWHA 3HI9A 1UVLA 4MT1A 3MPVA 3QYYA 2UUWA 2QFIA 1LW0B 1ZBTA 3KLFB 4Q2LA 1HNXJ 3IS9B 3DGPA 2XNRA 3D1QA 2CQ2A 5D4NA 1N5TA 2FJAB 2KH9A 1FE4A 1V3ZA 4WKRA 1CEZA 5L46A 3BSOA 1D0EA 3PO4A 3KG4A 2HFUA 3AFGA 2CVEA 1XMOF 3LP0A 2L9WA 1YG0A 2B3TB 5F41A 5KG4A 4I4BA 2MKJA 1S9EB 2KL8A 3N79A 1K0VA 2BE2B 2O01C 1VBKA 2GHWA 2W4CA 3OUYB 2V5HG 4KGMA 3T5HA 1FO1A 3SQGA 2CJXB 5K20B 4IDKB 4NMLA 3W62A 4M5DA 2KT5A 1CBKA 2LKZA 1VQ5S 4LFAJ 3NCQA 4LJMA 2JC0A 3JB9k 3C46A 1IBKF 4RL1A 4MK7A 3R8YA 2QL5B 5A8WA 2HRUA 4AD6A 4O44B 5DM6Q 2FC8A 3TVZA 3JQJA 3NNAA 2OPQB 4FXDA 1VCTA 5LL6d 4QIFA 2GV1A 2W8LA 2DISA 1KVKA 3US5A 2Z58B 3GSIA 2EVZA 4I56A 1X5PA 3SIPB 4QWBA 3OVBA 4PKDB 2KVIA 4DR5J 2ZE2A 5EUHA 4U7UK 1DTQB 2BOAA 1U02A 2GO8A 3CC7S 3KMSA 2CPYA 2AIRB 1RAAB 5BR8J 1Q1KA 1ZPWX 3I5CA 4ZVSB 4K0KF 2ZD1A 1HBUA 1QVFR 2ZBQA 2RT3A 3J7YI 2ACMA 5DRKA 1UJ5A 5I42A 3R6GB 2O66A 2OEJA 5FDLA 2XLJA 4DG1B 2Z2MA 3A4TA 1UEVA 2V6AA 3RR7A 4F3QA 4GMKA 1I6JA 4MYTA 3L7UA 1ZM4A 3NGRA 2DNKA 1VQPS 2HWTA 2W01A 1FKAF 4KR0B 4WK1A 1FWPA 4I2PA 2J8SA 2VG5B 3D1HA 4XK8C 2VFSA 3CCUS 3NMAA 5KFJA 2EBGA 1JLQA 4S0MA 4UOCA 1UP1A 2ILYA 1XJWB 2KXHA 3PRDA 1IKYA 2F8MA 3PEJA 1UVNA 3GV5B 2B6AB 1KOHA 2Z4PA 4G1QA 1FK9A 2QFJA 4LF7J 5KFWA 1LXNA 2MZTA 2JX2A 5CXTA 1HR0F 2R7UA 5ETOA 4DV5J 1XEZA 2FB0A 4DV6J 2QIFA 5F8IA 1CSJA 2D74B 1LWCB 1WF2A 2ZJRQ 3ITHB 1ICEB 2HHVA 2V63A 1T05A 4FF1A 4ENOA 1CVJA 4AE5A 3M30B 1R8CA 2WONA 4DR1J 2VDIA 3C6TA 2R2TA 1PC5A 3BGRA 2W25A 3EJMA 3FGVA 2UXDF 3UR0A 4M95A 3IM8A 2IYIA 2MKYA 1C1BA 5ETMA 4UQGA 4PXDA 1RT3A 2XYPB 4DXLA 2YKMA 1FKOB 4N8OA 1TKXB 4CQ1A 2ZM6F 4ZPBA 2B9EA 1Q0NA 2E9RX 2MJUA 2KM8B 2AJ0A 3IP0A 2DK2A 4X65F 3DLEB 5KG1A 3JTOA 5D15A 3Q86A 3HO1A 1DRZA 1M5HA 4ICLA 4WTYA 1WC0A 2ZJPQ 1KQKA 2DRBA 1TP7A 1Q16B 1VIOA 4OMFG 3BZQA 1EP4A 3CD7A 2BJ7A 5IWAF 3KKFA 3A13A 1V6HA 5GAEU 3OR2A 2VFVA 4WYWA 1AFIA 2AJ1A 3UVJA 4A8WA 3K59A 5JJBA 1WC1A 4C7QA 1IKXB 3FEXB 5HVHA 4WIQA 1FX2A 3M2UA 3WQPA 4KE5A 1EAYC 2EG2A 2VV5A 2L9DA 1LW2A 2JWNA 3BKFA 3KHRA 2YKQA 4TXSA 4Y3CA 4JI7J 1IQTA 2DXFA 1XNQJ 1T9XA 4C3KA 3P49B 1KKHA 1QUVA 2D69A 3EM1A 1S5ZA 3PFOA 2HHHF 2D3UA 3ENQA 5A0YA 1Q7LB 3OLAA 2JFDA 4W4MA 5I3PA 4EK2A 3UWTA 3O1LA 1G7CB 2UUBF 2IM3A 3GP9A 1T7PA 2FDNA 1WKKA 4WTOB 2A6OA 1C1CA 3VTIA 5IOLA 1FJ7A 2D9OA 4UOHA 3M32A 4AL7A 4B9TA 1RDRA 1OS5A 1CC8A 2DGOA 4DN9A 4E0DA 2WVEA 2ZOMA 3W8GA 4ZP6A 3TQ1A 1LK7A 5JMNA 5GAHU 2A0FB 1WC4A 2LU2A 3A3NB 1YJ7A 5CYMB 3QRPA 1XMOJ 5CCLA 2HLUA 2V69A 1E6YA 1QTMA 1UZDA 1CQMA 1S1UA 2DGWA 4ER8A 3OD2A 3CPWR 4PQUA 2CUYA 3PEHA 4CLPA 4NA1A 1UETA 4OZNA 1XNRF 1R8BA 4Q5VA 1J5EJ 2NREA 3FBFA 3KXDA 3CJSA 4JI5F 2HS0A 4CRJA 4JI6F 3HHNB 3V4IB 3VAHA 2GQQA 3MEGA 2HFVA 4OIXA 2JNJA 4M1KA 1KTVA 3BF4A 3JTNA 4KAIA 1FD2A 1IBKJ 4U8YA 2IHR1 3VGUA 2H54B 5CYJA 4ZVHA 1HWLA 3A8IA 4QIGA 1MNEA 3J7AN 2HLTA 2V9WA 2DGVA 1NHKL 2I38A 1PGZA 1N0VC 1GXTA 4E8UA 3CO0P 4BWMA 3D68A 4HTIA 4MYUA 3LALA 4FZVA 3W5ZA 2JLGA 3OTBA 1OY6A 3LWLA 3CJ3A 1T03B 2VC0A 4ILRA 5F0WA 2FIUA 4J37A 3VVTA 1Y9OA 3O3LA 4HR2A 2FJWA 4ED1A 1XR7A 4ZKAA 3MDFA 4AUKA 1S6QB 3PACA 1TTHB 3IC1A 3S6EA 4ECQA 3DOLA 5KFMA 2XM3A 2B0GA 1Q79A 2X1GA 4CM2A 3AJDA 4KQZA 2B8PA 4OV6A 4OI0A 1Q4RA 4IH6A 2JEGA 1WEZA 4PWUA 4RU2A 1SKSA 2ZZMA 1SI9A 2EKYA 3QO9B 1P9QC 1WEXA 1T3NA 4QBUA 1RTZA 3D0HE 2QO3A 4DV3F 1WUUA 2JFKA 4OHVA 3KG1A 2ZH8A 3QGGA 4PYDA 2J76E 3OTOF 1SV5B 1VC5A 4F36A 3ISND 1F3FA 4Y2AA 4OJGA 3PW4A 3CMAS 5FJ4A 5KFKA 1RT1B 1WJ9A 2EG1A 3H59A 3J81j 1S1XA 4QQBA 4X4UA 3C15B 2AX1A 4ED8A 2XY5A 2X7IA 1VJWA 3HSZA 2H5EA 5GMDA 2CPJA 2U1AA 5ETQA 2ADCA 2R4FA 4A8KA 2GVDB 1WNEA 1WHWA 2WSCC 2N82B 4C8NA 1SIWB 3M2RB 4OV1A 2C3YA 1VOMA 5DQGA 3TANA 5HSPA 1HR0J 3M7VA 4WFZA 2QT7A 4CT8A 2GAGC 2R7WA 1RK8A 2PFFB 3ZTRA 2QE5A 3C6UA 2G9OA 1CLFA 3HZGA 2VD3A 4QIEA 3G6XA 1XC9A 3E51A 2QYCA 4ZVGA 1S77D 4OI4A 2D3OR 4QWCA 2RQ4A 1RYSA 2CNNB 5GAGU 4LMZA 4K2JA 3KHHA 2ZM6J 1GMWD 3U1NA 3QWUA 2NPFA 3FSXA 2OD4A 3M9MB 3AXKA 2DY9A 4CYUA 3G82A 2GIQA 1VQ6S 4P2XA 4X65J 2V67A 2NSCA 3M8RA 2VQFF 2JVOA 1HARA 1YRTA 1TL3A 2DPJA 4B9NA 4KT0C 4RZRA 3J81Y 2HRTA 2XZWA 3D4JA 1LWFB 2M3DA 4F4ZA 4K4TA 2KZMA 4PWDA 2X3DA 2FJEB 1OY8A 1WHYA 1WOSA 4Q0BA 3UCUP 5IWAJ 3EVMA 2RF2B 2BACA 2O5DA 4USTA 4JI4F 2MY8A 2FHKA 3QRRA 2W9AA 1CQNA 1RI7A 2DH9A 3A8KA 3PY8A 4CNZA 2FGOA 3MUMP 4G65A 2DNZA 3MMAB 4PXCA 3B54A 5ITHA 5ETPA 1N6QB 4B3OA 5KOWA 5E5NA 4CWBA 4DX6A 4K5RA 5G0RB 1KR4A 1R43A 1J5OA 1BE4A 3BSCA 3MM5B 2NXEA 5HLFB 4ZDNA 2XY7A 2AGQA 1WTFA 3SFGA 2HHHJ 4DQIA 1S6PB 2GMLA 3KLEA 4DS4A 3POTB 5KFEA 1L3UA 4EU0A 4C3MA 5B0GA 2QJ3A 4W90B 4RBUA 2ZH1A 2W24A 2KU7A 2UUBJ 1JJ4A 5CABA 3L7OA 5D0RA 2J6TA 1GXUA 4DL6A 3NS7B 4RJVA 2BJ8A 4P71A 4ZVTB 1U25A 8AT1B 1U1KA 2E1AA 3ZZOA 4MH8A 1FKPA 1S49A 3N4WA 3U1MA 2RRAA 5KFDA 2HW3A 2GCFA 3U1LA 3FQKA 3VHQA 4PAAA 1T02A 2LQJA 3CJKB 3KK1A 1D1UA 4PYAA 4Z7CA 3GILA 3DMJA 4UUXA 2XB2D 2BYCA 5IC4B 2YNGA 4DCJB 2GMJA 3AODA 4R0JA 2IDLA 4CP5A 4BC9A 4KO0B 3UD5A 2CDQA 4J9NA 2B8QA 1VRTB 4I64A 5KFVA 4EUVA 4TVAB 4ANCA 3HT0A 1RCXB 3Q24A 4C8OA 3PTWA 1VBZA 3L3CA 3J7YU 2CQGA 1ZAWA 4MFBB 5A8KA 2F4FA 2C3OA 3UQSA 1CJKA 1XNRJ 3DRSB 1XBWA 2E66A 3UCGA 5K14A 4KGKA 4QOTA 3M1VA 2AMCB 4JI5J 3CDUA 3K89A 2H5IB 3BPDA 2AYBA 1KD1T 2J9DE 3LP1A 4HLBA 2EC0A 5MLCV 4RR5A 4BCAA 1NJWA 1TFWA 3R5BA 4EWTA 4ZLLA 5A6PA 1ZZFA 1F0XA 1B7YB 3HD1A 2R8GA 1I51B 4DFPA 3AD7C 3KK2A 1NH7A 3IM9A 2QMWA 2V4JA 1R0CB 2K3IA 4WBFA 1RAGB 2YWHA 3MOJB 2UUTA 3Q8PB 4DPYA 4YP3A 3FZBA 5L9XA 4MIWA 2E9TA 3N0VA 2QSFA 1SUQA 2AV5A 2HG4A 3D6MB 5B09A 1U0HA 4M5LA 1DAXA 4AXJA 1S72S 1TV6B 1IKVA 3MPUB 3OR1B 3OVAA 1U49A 2YWGA 4P7TA 3ENWA 1NB7A 2ASYA 3LF0A 2ZH7A 4IOBA 3K5LA 3ET6A 5C7PA 4DUZJ 1JLCB 4O23A 3M8WA 1R6VA 1WDDA 3EGWB 1URRA 3E2EA 4J9UE 4FBTA 1WDTA 2AU0A 2DGXA 3KUEA 4WE1B 3G96A 1HYSB 2ZUAA 2MGZB 4DV3J 3IS9A 3DDIA 5KG6A 2DGUA 2HQGA 4A8YA 2BANA 1HQUA 2HNDB 5EHHA 2F9JA 1RT6B 1F1BB 4USVA 4NLGA 1HQ2A 1C4CA 4NYPA 3F44A 1TKZB 3G2XA 4NASA 2MKCA 4OLPA 3KJFB 2Q6BA 2E5IA 1FTCA 4NLXA 4Y2MA 4JI3F 4YR2A 2G2OA 3KK3A 4ZP8A 1WC5A 3MPWA 2H3EB 4UZBA 3IA0A 1RBOB 2UXBF 5K8PA 4HDHA 3OV7A 1S9EA 3T9NA 2EFQA 2ZHOA 3GIIA 3ZXWA 2BE2A 1NPRA 2RKIA 1OQ6A 1C4AA 1SPBP 5KT4A 3UD3P 3QSYB 1CJTA 4FXVA 5B7WA 4USIA 3LAMA 2QYGA 1JWWA 2C2EA 2YXLA 2CQDA 3X3UA 5ETVA 4KH0B 4LBPA 2HRYA 3MM6B 1RWUA 4PCQA 4RUHA 2X3GA 3DDNA 2N3LA 3NGTA 4ERDA 3V6JA 5EGYA 5CZXA 3SSSA 4HI1A 1FTRA 3M8ZA 5L39A 5KFOA 1RTDB 3ADAC 1W26A 2P9EA 3V81B 2YNFA 1HI8A 5SUHA 4DX7A 3GQCA 4OI3A 1X60A 2CNOB 3ZZYA 1JX4A 4NA2A 2VQFJ 1JLBA 1MWQA 3EVWA 5M2RA 2AYEA 2YVSA 4EMDA 1HD0A 1REVA 2XCPA 3F73A 2BBEA 2BJ9A 5KTQA 3EYZA 4ECTA 2BW2A 3Q89A 5L8RC 2EFVA 3TAQA 4JI4J 4DG1A 2WVDA 1VIXA 4FYVB 4FF3A 5J2QB 2XYGB 3AQOA 1HHQA 2XMVA 4RW9A 3PW0A 1PG5B 3OFEA 4C6AA 1NHVA 3PX4A 2Q43A 3KUHA 3TUJC 4P2FA 5E7OB 1SJRA 3AHPA 3D66A 2N4DA 1SJQA 4USUA 1W2BR 3RR8A 2K8GA 3CCZA 4MJKA 5KOXA 4UY85 3W2VA 1H7WA 1UCNA 3A1YG 2R7XA 1IM4A 2B6AA 2K1RB 3VR1A 1DJ0A 1Z2LA 5E0OA 4QR0A 4DF8A 1UWBB 3CCJS 3CCVS 4KHMA 1NUEA 4EEYA 3CVKA 1HD1A 2VONA 1LWCA 4A8XA 4KFBA 2YX4A 3ITHA 1P8GA 2WHOA 3FJ2A 4FVMA 1S1VB 3HP6A 4C8KA 2DHSA 5U47A 5CHCB 1Y5IB 2FHJD 3EGZA 1OY9A 4O4RA 1JLAB 2HFSA 1TL4A 4H4MA 1Y3KA 3PNIA 3B78A 1S97A 1VQLS 3ISNC 3TZZA 5KFGA 1FNOA 2IM2A 3KUGA 4AFFA 1NK0A 2XMTA 5C25A 3M8PB 3I9V9 1RT7A 4O3SA 4TQRA 1S59A 4GKKF 2IFXA 3GV8B 2CJAA 2C2KB 3TUPA 3MPYA 3LGMA 1LOUA 2VKRA 1U2RA 4A8OA 2A3JA 2ROGA 1HWKA 4DQRA 2CJ9A 1BY9A 1Y7PA 1B0PA 1TL7A 1M90T 3UI3A 1S7IA 2XC9A 1JKHA 3CCES 2R2UA 3KLGB 2GFFA 1MWYA 4ZPCA 1VISA 1BQNA 3H8YA 1PKUA 4I2QA 1O8BA 1QDUB 5E3PA 1U1OA 1F5BA 2IJFA 4IH7A 4IG0A 4N47A 2YNIB 2E1PA 2QMUB 3DGPB 4DPTA 2CQCA 3TX0A 2EFPA 2GAHC 4FNHA 2P9CA 4DDFA 3LOUA 4ZCIA 5LM7E 2ZVIA 4MKVA 5HATA 2BM0A 1X4CA 1RTHB 3DKDA 3KFWX 3SCJE 1RU1A 1K44A 2QA2A 3LP0B 2CQBA 1FT8A 4KPCA 2EFGA 3RUBL 3RW7A 1PJ5A 3UFCX 3LP2B 3W61A 2PE8A 1QAJA 3FRYA 2ZNYA 3CJQA 2YWEA 3HKZD 2ZJQQ 4Z2XA 4USWA 4CLKA 1S4FA 1F9HA 4KB7A 3TUZC 3C8YA 4OZ3A 3TJ8A 2VU5A 2Z30B 4OZLA 3OXFA 3HM9A 2MMYA 3EZ5A 1KQGB 3W3SA 3Q83A 2IMWP 2ALYB 5KT5A 1X0PA 5LJ5Y 3ZZZA 2LA4A 1X4BA 4ZLPA 4GC6A 2KRRA 2HHPA 4ZN1A 5A8WB 2XLIA 3T1AA 5EWFA 4HKQA 3R7NB 2BKPA 5CYMA 1N54B 2JSXA 3GFHA 2UXBJ 1A7GE 1JNRB 4OYBA 3HD2A 1T9WA 4Y2CA 1RLDA 2RS2A 1LWXA 4GO5X 4TQSA 2FLNA 4RX6A 1TK0A 1X9SA 2ZE2B 2F65A 5F8HA 2G2YA 4LF5F 3GG0A 1IWAA 3DNCA 2M0GB 3OSPA 4ECYA 1F3VA 1U1QA 1NK4A 4RBTA 4RUBA 1ULRA 2ZD1B 4RW6B 3HSDA 1PBUA 5KFFA 3DOKA 2OELA 4R8UB 2BZ2A 5I42B 2QA4S 2DNRA 4ETXA 5H9EJ 2XS7A 1T0TV 5FDLB 3MF5A 3I55S 3Q8VA 2L08A 3QZ7A 3SQOP 4X66F 3VCDA 3R5AA 4XDDA 3OHBA 5A8RB 4M63A 4YMEA 2LCWA 3G6VA 2AQ4A 3AT1B 1NK8A 1TELA 3R9LA 1M5KC 1UA1A 3OHAA 2EKNA 4I2PB 3EUNA 2W2MP 3ZZUA 4QYZK 1WSRA 2CJQA 3QIDA 2W1BA 4PWWA 4C98A 1JLQB 3T6BA 2V68A 1S79A 1TUGB 3AOCA 4LF8J 4WP3A 5F8NA 3DYAA 4X2BA 2FVCA 2PGCA 1FK9B 1S4EA 3TOQA 4ETZA 3PKYA 4J9RA 2HNYA 5DLFA 1T94A 3EXYA 5DS7A 2FZKB 3BGOP 1FESA 4ECUA 4RNNA 1WOOA 5C5JA 2PMZD 1P1TA 4H4OB 4F8RA 1T05B 3PDNA 2DNHA 3DLLQ 2RQMA 1H0HB 4MIAA 1N5YA 3UN2A 4DV0F 1MSWD 4XPCA 2Z56B 3E01A 1KFDA 2WONB 1XK8A 3C6TB 3VZIA 3CTRA 3BGRB 2QC3A 3EE3A 3VAKA 4EYHB 4LF9F 3UN5A 3I87A 4Q43A 5DGAA 2ACYA 1C1BB 3AB4B 2QA1A 1RT3B 3OQ2A 4NCAA 4B08A 4E2FB 2DTJA 1ZAXA 2FVSA 1VQNS 1IN0A 1B70B 1HA1A 3P6YC 1NZAA 2WVBA 2DB1A 1QVGR 3EDRB 2XI2A 3QLHB 1VI7A 3RU0A 3MMCB 1W2IA 3CDAA 3FRZA 4F4KA 1FFSB 1D9AA 5L1KA 1NK9A 3CD0A 4F4AA 2BV3A 2KT2A 2YWKA 3DLGB 4MKAA 2DR8A 3PVXA 1QSLA 1P27B 3O8WA 3SV4A 2CQ1A 4J9SA 5DM7Q 1LEOA 4X64J 1ZAVA 3CC4S 2KTQA 1GNKA 2LVWA 1EP4B 2DGQA 3I0RB 5LXRA 3EPIA 5FD1A 4ANEA 3EZUA 4ZCKA 4DV4F 4UW2A 3N28A 5DQHA 1U1RA 2W9CA 4IFYA 3UVJB 3UNYA 2XGPA 2ZDOA 2KYZA 2VPZB 4OI1A 2VICA 5H1SV 5LMUJ 2CDRB 4NLRA 5LMNJ 3H5UA 4GKKJ 1LW2B 3A8EA 4J90A 4DR2F 4DUTA 1WF0A 4B02A 2BKOA 3K8VA 4DZDA 4DUYJ 1G3OA 3CJ4A 3V6HA 2MHEA 4IKAA 3C19A 4L73A 3ZC4A 4F4WA 2CKWA 2NLWA 3CMQA 4C3LA 3VZHA 2UV8G 2NXCA 2IVYA 1HBOA 4USMA 2CPFA 2RF2A 3SDEB 1NSKL 2DBBA 4CLUA 4ZCLA 3NGKA 4DV7F 4DR4F 3PCOB 3V6DB 2JLFA 3M32B 3T1HJ 1KQSR 1U09A 3OVSA 5ETTA 4RNFA 2C28A 2J6SA 3GJSB 5G0RA 1PJ6A 1NZ8A 5J2PB 2J0WA 4NYOA 1AW0A 1Q53A 5HLFA 4K2XA 3V2UC 2CIMA 1N0UA 4NXNF 2CQIA 2C2OB 1M5SA 4QZVB 3GJQB 1E6YB 3LANA 1WKJA 3HLUA 5T7LB 1NJIT 3EGVA 1RLCL 2DY1A 4PQAA 1S1UB 3ELHA 2ZBCA 2AEJA 4PQUB 3HX9A 1C2PA 7FD1A 4C0HA 2VF3A 3MAHA 1NLKL 2WVFA 5AXLA 2QRRA 3BO4A 3RBZA 1RISA 2FJDB 2AHOB 3CJKA 4FBUA 2YKAA 2M52A 1GMVA 2W2QP 3NMRA 4QU6A 3CMES 2V2QA 2R8JA 4KO0A 4QPTA 1MMNA 1HHSA 2IIHA 1B64A 3ETMA 2QLJB 2ZC4A 3MM8A 1PILA 2GJIA 4FF4A 1MROA 2J7WA 1ZA2B 2ZH6A 3JQMA 4GKJF 4JI8F 2FQQB 4XTTA 5CCMA 4JI1J 1GQEA 3TI0A 4LF5J 5F8GA 4I6WA 5D6GA 1FJGF 4CO4A 2ZBIA 3TA0A 4IG3A 3HT3A 4PPDA 2NZCA 1YX2A 2XI3A 3DOLB 3THTA 3ZTSA 2EEYA 4AQYF 4LSNB 5HQ8A 3KLHA 2CWXA 3M9NB 1UPMB 3GIKA 4X66J 1SB6A 2XQCA 1HL6A 4ZPDA 4DU8A 2PT0A 4O3NA 2YH0A 2ZFHA 4KGZB 1LQ9A 1KC8T 2BKNA 2H9ZA 3QGIA 4K4ZA 1GX6A 3K5PA 3UDEA 1S9GA 5KFHA 2MY7A 1TKDA 3DHXA 1IBMF 3LTOA 4WFAQ 3VVUA 5GAEI 1TV6A 2QZ8A 5HMWA 3OR1A 1DTTA 4WXWA 3AD8C 4M5IA 2YKNA 3H0PA 1IJEB 2GX8A 1G1XA 1KRPA 5JXSA 4M5GA 2NS1B 2PEBA 3PW2A 2XMWA 4DL3A 4CZCA 3D54A 1WC3A 4A8MP 4ED2A 3L9ZA 3BQ0A 4USKA 1SL1A 1VR6A 1RAOA 4HH0A 4C8YA 2DVIA 2K2PA 4B9LA 1TVRB 4NZ0A 4CO0A 1FF2A 2G4BA 4WF9Q 3MR6A 3C6UB 2HVHA 1AFJA 4ECVA 3N6NA 2QLWA 1FDNA 4IYQA 5JUMA 5J2MA 2HNDA 3UE2A 4KY3A 1M1HA 1YBAA 4CLFA 3P8BB 2JEIA 1PCAA 5B0AA 1TKZA 1N36F 1JLEB 3SBMA 3M8QA 4LF9J 4LBIA 3MECA 2CJBA 4Q8FA 2KM8C 2Y1IA 4QWEA 1FDDA 1FFWB 3ZNUA 1V5VA 3KWMA 4CCHA 3Q8YA 1WG5A 1RXOB 2HFNA 3TO8A 4LF6F 4OI2A 3G82B 4CYUB 1DARA 1M1GA 4DR5F 2VPXB 3HHLA 4DSIA 5KFLA 1WHXA 3HF5A 2XS2A 1QD1A 1X5SA 4YB1P 1TL3B 3MI7X 5I3QA 3PX6A 2AJQA 2J0SD 2OI2A 2IC3B 5DQIA 3HKWA 3MM6A 4J9PA 3R5GA 3PYFA 2LXUA 2C2DA 2G1HA 1YKWA 1TQLA 4C9DA 7FDRA 1UFLA 1SKRA 4FXWA 1UAWA 4WCEQ 2HHWA 3MR3A 2DNLA 2OPSA 2ASJA 1K1SA 2HHSA 2X1FA 3SZ2A 1RTDA 1X31C 3V81A 4J9KA 1APSA 4B3OB 2VDHA 4WPAA 4R0EA 3WX8A 1J5OB 4RW8A 4NRUA 4NL5A 1IBLF 4I1TA 2HHXA 5D4LA 2ZHAA 1JJ2R 2B4OA 2I2YA 4FYWB 4B3MF 4EI2A 2XS5A 5IV3A 3X1LB 4OJ3A 4L72B 2PIIA 2HK3A 3R6LB 4PG8A 3KLIA 2GO9A 5L38A 1NCLA 5J1NA 1VQYA 2PO4A 4FNIA 1Q82T 5L1IA 3H7HB 1FA0A 2DT9A 1UVKA 1P1LA 1EJ7L 2GJ2A 3L7PA 2V2ZA 4DR4J 2C2RA 4DV6F 2OP5A 1FKPB 5J2QA 4PG7A 4X4PA 1K8AT 4PG4A 2JLEA 3I0SB 5CYQB 4NLOA 1SIZA 3KK1B 3NEKA 1OYDA 3DMJB 2XWYA 2GQ2A 1T9YA 3BREA 3VGSA 4QW9A 2YNGB 2DRDA 5A6WA 2Z2YB 1UWAA 4CO3A 2DIVA 1QTNB 1TK5A 1R0BG 1S57A 2WB1D 1FRXA 5EX0A 3CNQP 1XIQA 2XYHB 2VG7A 3BB5A 2PC6A 2JZ5A 1ITPA 1U4BA 3MR5A 2K1RA 2Z0GA 3QQCD 2V94A 4AL5A 3CIMA 3CCWA 3B82A 4G3IA 4ES1A 4PXEA 3DLHA 4Y0FA 1CJKB 2EC2A 5SZTA 3KTQA 5K14B 2J0XA 3DLBA 1X4FA 4UF4A 2SXLA 2F9DA 2PDAA 1LNQA 4HHHA 4K59A 5KFTA 3TQEA 4CI0B 3TZYA 1JNZB 2QLBB 1YJNS 4PABA 4RWXA 2AJFE 3VGVA 4HHJA 2VBWA 5HAOA 1RT2B 3G86A 3TR5A 3TJAA 4KIAA 4LR9A 3KK2B 3MWBA 1VK3A 4KTQA 3AOBA 1PAUB 2V4JB 5IC6B 3H5XA 3GMGA 2RILA 1S7HA 1EQMA 3MUVP 1HBNA 2HFZA 2O3DA 2PEHA 5RUBA 2D41A 3M8PA 4YB5A 1V5IB 1NBEB 4GKJJ 2EFOA 4JI8J 3BBCA 4BWJA 1FJGJ 4KV8A 1RWNB 4ZHRA 1IKVB 4ZVFA 4JI7F 2RNEA 4LRFA 5KFZA 4ALZA 4ZS6A 3AAWB 3MAQA 4J9OA 3ET6B 2MKHA 5D77A 4ZK7M 1UZHA 1KDNA 2OPPA 4AQYJ 3S01A 1YJTA 1X9MA 2R9LA 2XBPA 2KJVA 5CH7B 3CO9A 5D4PA 3ENAA 3QPIA 4H4KC 3RBEA 5GADU 4WK3A 1RGVA 2DNOA 3E8OA 4C8MA 1N4LA 3D0IE 4YHHF 4OYXA 3RJMB 2YNIA 4NWBA 3MCNA 4BHQA 1U8SA 4E98A 2BANB 5C2GA 1HQUB 1N33J 1FWKA 5G4DA 2BE7D 5F8MA 4RNOA 2LMIA 1VQOS 2WTFA 3HULA 3HFKA 2P8IA 1IBMJ 1RTHA 4J9QA 4RBVA 1QUPA 3EXCX 5KG3A 1H7XA 3KK3B 1HNVA 2MKSA 2BABA 2VUGA 3BQ2A 4KRWA 3HHKA 3HSGA 3HHDA 1YDLA 2FD2A 4ZMMA 2LQ9A 3LP2A 3AJ1A 4U8VA 1NJYA 4C2MA 4ZITA 2N3OA 3AD9C 2RKIB 1QJHA 3KJQB 3H40A 1OYEA 2IBKA 1CJTB 1TU0B 1R27B 1VRUA 4F3OA 1EB0A 1O0PA 1J5EF 4ZVUB 5IT0A 1NRKA 3FEZA 1XWLA 2DPIA 1WELA 4C97A 3GV7B 2PMHA 1NB2A 1RWOB 1YJVA 2KJWA 4NPOA 4CT9A 2FUG9 2C42A 3W5XA 4NZ6A 4DI6A 4LIWA 1N36J 3Q0AA 3GTYX 2MLYA 2MZSA 2OAUA 3AA8A 5DLGA 3OPKA 4DR7F 2KHDA 1FRKA 2ZBRA 1RADB 3KYLA 3C3LA 4DF4A 1LXJA 3WDOA 2OTLS 1HBMB 2QLFB 4MK9A 1UKUA 1LWEB 5M2UA 4WIIA 2MYFA 2YNFB 1SXLA 4FYXB 1H6KX 4DWIA 4LF6J 1SJFA 4F2SA 1JLGB 2IA0A 3J7A1 1JLBB 4CO2A 4ECWA 3BSAA 4IRCA 4Q45A 4QR2A 4ECZA 3H2VE 1REVB 1Z1ZA 4RW6A 2V50A 1GTEA 4WU2A 2K7JA 4KKOB 4FDFA 3M2VA 4R8UA 1GT8A 4J9VA 2YNHA 5I3UA 5H9FJ 1FRJA 2AX0A 4OI6A 2GHVC 2IRUA 5A8RA 1ZM2A
chains in the Genus database with same CATH topology
2YNFA 5LT5A 3NP5A 1HNZF 1HI8A 4RW9B 1YQHA 2YX7A 4B9UA 2V8VA 2PD1A 5GAHI 3M6XA 5SUHA 3KOAA 3GQCA 2COLA 2VFTA 3TYTA 1UFWA 4OI3A 3M6WA 1HI1A 3ZZYA 2BVZA 3MGJA 1X4EA 5A2QY 4YDDB 1JX4A 5B0BA 2CPXA 2VC1A 1BLUA 1NJXA 4ID5A 4NA2A 1KVJA 3VQTA 5BR8F 3M6VA 1TAQA 3JAMY 1JLBA 1SL0A 4HDGA 4NLWA 2ZH3A 2UXCF 3VAIA 4IFVB 5M2RA 4ED6A 1PSDA 2AYEA 2ZUGA 4C8ZA 2YVSA 5F8LA 1HW9A 2KXNB 1U1PA 3F56A 1HD0A 3GWCA 3RB0A 4PWDB 1REVA 1FDBA 2XCPA 2VOOA 2KYXA 3CCRS 3F73A 1RKJA 3IAS9 2ZH4A 3DCAA 2CQ0A 5KFSA 3OL6A 4LFCF 2BBEA 1T8EA 3PIPQ 5KTQA 4KHRA 2XCAA 3EYZA 2NYIA 3HXMA 3W2VB 4ECTA 4Q0BB 2BW2A 5GADI 3CULA 3CEDA 2DGSA 1YSJA 4XPEA 1R0AB 4TY8B 4QW8A 2UUAF 3O6QA 4RKUC 5C42B 4JV5F 4LSLB 2M9KA 4DOZA 2Y1RI 4O0IA 2ZH5A 1C0UB 3JSYA 3DC2A 5L8RC 2EFVA 3TAQA 4TYBA 4DG1A 4DSLA 4YEAA 4HI2A 3OXGA 3IBWA 3QJLA 4MMOA 2CPZA 2Q3PA 1NK6A 3ZFVA 4DQQA 1VIXA 3Q8RB 1B0TA 4FS2A 4FF3A 5J2QB 1FVSA 3NGDA 1VFJA 2LDYA 3AQOA 3ISZA 2XMVA 4RW9A 3PW0A 3AY0A 3G6YA 4IUFA 1Y4ZB 3MTKA 3HJFA 3OFEA 2R7VA 4DN0A 1NK5A 2VH7A 2OSQA 2ILZA 3FMBA 1NHVA 2HIQA 1GXLA 1HMVB 5BYSA 3PX4A 2KHCA 2NPIA 3WX4A 2Q43A 4DX8H 3IAM9 2KI2A 2LECA 4KFBB 3TUJC 3IWLA 4H4OA 2DR5A 3BDEA 5E7OB 3AA9A 2ZVSA 3HK2A 5HROB 2R7OA 1SJRA 4IFVA 2G0CA 3AHPA 3DRRB 4K4YA 1U1LA 4K50A 1S76D 3TA2A 2N4DA 1NO8A 1XTZA 2HGMA 4EBEA 3KLEB 4R5PA 2B4PA 3GSDA 2VPYB 2IMOA 3GFYA 4IQXA 1SJQA 1ZM9A 4N8NA 3PXGa 1T3OA 3NRBA 1JIHA 3DN9A 1W2BR 2K8GA 3CCZA 3RR8A 1FVQA 3PW5A 4MJKA 5KOXA 2MQPA 3MEDA 2V4QA 4UY85 2CQ3A 3W2VA 2QSWA 4OZ0A 4H4MB 1H7WA 1FRLA 3A1YG 3MURP 1FNMA 4DS5A 1R0AA 1JK9B 2R7XA 3J80Y 1E6VA 5C42A 3R5CA 4LSLA 3NAIA 1IM4A 3I4HX 3BQ1A 1UVIA 3D0GE 4ZP9A 1VQ9S 3CUNA 4LF7F 2B6AA 3G8TA 3PX0A 4NLPA 2IBOA 2MPUA 1C0UA 2K1RB 3VR1A 3FSIA 1DJ0A 1U2FA 3IFEA 4QU7A 1DLOB 2VODA 1JLFB 1Z2LA 1X8DA 2P9GA 3OTDA 3WZ0A 5E0OA 2N7CA 4DV5F 1QE1B 1QLNA 4DR6F 1BWEA 2CYYA 3LPYA 4IRDA 4QR0A 4DF8A 1UWBB 2UV8A 3CCJS 1AXQA 3CCVS 2F1FA 3IR7B 5C25B 1YWXA 4KHMA 3I5AA 1RT7B 1U26A 2C3PA 4EEYA 3CVKA 5HI7A 5K5MA 4F50A 1HD1A 2FJVA 1AUDA 2FJBB 1HMVA 1K73T 1D3WA 4OZJA 1RTIB 1KQFB 2VONA 3T5JA 1JJHA 3JYTA 2IM0A 1LWCA 1H2TZ 2B56A 4A8XA 2GIRA 4KFBA 2YX4A 3ITHA 5B0FA 3QLHA 3CT9A 1P8GA 2WHOA 3FJ2A 2A1BA 3MMCA 1S1VB 4FVMA 3HP6A 1QY7A 1TUVA 1U47A 1SJ4P 4YOEA 4IQMA 2B5JA 2DNQA 5HROA 2BQ3A 3DRRA 4C8KA 2DHSA 2CQHA 1SH3A 1LV5A 1F9FA 4JV2A 3OJSA 5U47A 4DFJA 2APOA 3NNCA 2RRBA 4DR1F 5CHCB 4F25A 1Y5IB 1FE0A 3K2YA 4MKBA 5BJRA 3DLGA 2FHJD 1S10A 3EGZA 5THWA 2OO4A 4YR0A 4O4RA 1JLAB 1TL4A 2EWHA 2X51A 5DDQC 3KJVB 1TR0A 1FHTA 2D1CA 1JKHB 5KFBA 2NQPA 2ZOGA 1N5SA 5IZHA 3U02A 3R5DA 3TARA 3PW7A 4H4MA 4LIRA 1Y3KA 2MB0B 3PNIA 4QCLA 3CCQS 1BQNB 3I0RA 3N9UC 5IFMA 4NOHA 1ZOTA 4OZ5A 3B78A 2MSSA 1S97A 2F8HA 1VQLS 2FLPA 4I2QB 3OJUA 2ROPA 3ISNC 5KFGA 1YI2S 2V8DA 2QLXA 2G1DA 4A47A 2AP6A 1FNOA 1DLOA 2WW8A 4B9SA 1S6UA 2IM2A 2ZH2A 2UUCF 2W4DA 5E41A 4AFFA 1KFSA 2C22A 4FPRA 5A8KB 3TAMB 1NK0A 2XMTA 1UWBA 3RB6A 4IG0B 3MCSA 4NLQA 1S48A 1L3VA 5I4MA 5C25A 1Q8IA 1S1TB 3I9V9 3M8PB 1RT7A 1MWZA 3MM9A 3DRPB 3VALA 4O3SA 3UNGC 3M1VB 4TQRA 1OIAA 3I4PA 3FNNA 1G6BA 4NXMF 4GKKF 2IFXA 1L3KA 2VBYA 3G71S 4OX7A 3GV8B 1RTIA 2AGPA 2UP1A 4LF4F 4DJBA 2CJAA 1TL1B 2AW0A 2HQIA 3J7Z5 1FCAA 3MPYA 5ADZA 4X4RA 3UD4P 3LGMA 4EZ9A 1LOUA 2VKRA 5GVQA 1X9WA 1S99A 1S1VA 1U2RA 1HWJA 3WBZA 4A8OA 4FP9A 3ZZ0A 3CC2S 2MQLA 2A3JA 3LP1B 4KHPF 2VG6A 2ROGA 3LUYA 1U6BA 1HWKA 4NZ7A 4URSA 2W4PA 4DQRA 2CJ9A 2OKQA 3N01A 1WI8A 2HYIB 2IVMA 2BDPA 2YH1A 1BY9A 1Y7PA 5C24A 1B0PA 1JLAA 3SV3A 4HEA9 1M90T 3UI3A 2XC9A 3KJVA 3RW6A 1JKHA 2Q79A 2EBEA 3CCES 4I67A 2R2UA 3KLGB 2GFFA 1MWYA 4Q2MA 4UY8T 4ZPCA 2LU1A 4I0WA 1BQNA 5HO4A 2M70A 3H8YA 4P2SA 5AXKA 2KKHA 3RB4A 3I6PA 1EETA 4I2QA 2L48A 4L6V3 5HBMB 3SEOA 3O2IA 5F3TA 1O8BA 2I5JA 1JB0C 4ZPAA 5AXMA 3MFIA 4YDXA 4B3TF 4KPYA 5E3PA 4Z37A 1U1OA 1F5BA 4K4UA 3SDEA 4LVOP 2IJFA 3TAMA 4IH7A 4IG0A 4N47A 1R8AA 2YNIB 3M9OB 1HNIB 1NH8A 4M94A 1S1TA 2E7XA 2W9BB 1SJ1A 1F5AA 1SUQB 3DRPA 3FSYA 4NLSA 2FLOA 3MZIA 3V6DA 2CQCA 4ZVEA 3CJ5A 2HVZA 4ECXA 2EFPA 3FCHA 2UVUA 1SH2A 3IWNC 4FNHA 4YY3F 2P9CA 4RNHA 1GTHA 2HQ3A 2V8GA 1RP5A 2HAIA 1TL1A 2A18A 3DM2A 4CH0S 4DDFA 1YJWS 3LOUA 4ZCIA 2HNZB 4CIOA 5GAGI 5K8MA 1QAIA 3PR5B 1MMDA 1XNQF 1MW7A 2BM0A 1X4CA 3K57A 1N48A 4FN5A 2ROEA 2U2FA 1RTHB 1UJ6A 3Q2SC 3BJYA 1NK7A 5B0EA 3CF5Q 3KFWX 1YRUA 3GG1A 4B3RF 2OIHA 2VB6A 4OJHA 3BGUA 5J2PA 4XDCA 4QYZJ 1QAYA 2E29A 2E1CA 2WRMA 1RQ0A 2XMMA 3SCJE 1Z4UA 2DNPA 5DJBA 3SCKE 2EFNA 1N34F 2HMIB 2QA2A 3LP0B 2CQBA 2NZ4A 2XY6A 1FT8A 4B9VA 5KG7A 2LEBA 1WD6A 6FDRA 4NX9A 5HMXA 2MZ1A 3DHWC 2EFGA 3T19A 3KLGA 3HVWA 3RW7A 2MDAA 3RRGA 3UFCX 1KHVA 1UL3A 3BS9A 2NSBA 3LP2B 1S0NA 5CD4H 3K5OA 2PE8A 2VOPA 4XAKA 1QAJA 3FRYA 5D3GB 4WFNQ 2ZNYA 5LSLA 3IWXA 5T7LA 1QAXA 5HBMA 1DQ8A 2HWHA 2HS4A 2RE1A 3HI9A 1UVLA 2E44A 1X5TA 2YWEA 3QJJA 3HKZD 3MPVA 3QYYA 2ZJQQ 5B0CA 2UUWA 5FLXY 1X4HA 4Z2XA 1LW0B 1ZBTA 1S4FA 3KLFB 3BN7A 4Q2LA 3MEEB 2XMKA 2VL1A 3BM7A 3IS9B 2HGLA 4DSFA 3DGPA 4KB7A 3TUZC 2ASLA 2XNRA 2JVRA 1X4GA 3C8YA 3D1QA 3BGFA 4Y65A 2CQ2A 2XSFA 1R7IA 4NLDA 5D4NA 1YITS 2MQQA 4ZOSA 1N5TA 2FJAB 2QMXA 4OZLA 3BN4A 3OXFA 2HNZA 3HM9A 2UVVA 1LFWA 2MMYA 2KH9A 1FE4A 1V3ZA 4WKRA 3EZ5A 1KQGB 3J7ZT 1CEZA 3LQVA 4I6AA 4OJ1A 3W3SA 3PZPA 2IMWP 4Q7AA 3BSOA 3TA1A 3K7RA 5KT5A 1X0PA 1D0EA 1FJCA 3PO4A 5LJ5Y 2P6SA 2BOPA 1V9OA 1PO6A 3DOKB 3KG4A 3ZZZA 1VQSA 2LA4A 2LDIA 3Q22A 2E1MC 2ASDA 1X4BA 4ZLPA 2CVEA 4KSEB 4GC6A 2KRRA 2HHPA 2MJNA 2RS8A 3DDKA 3I96A 2HMIA 2R7SA 5A8WB 1XMOF 3LP0A 2L9WA 1YG0A 2XLIA 3T1AA 5EWFA 2HWIA 3KNAA 2B3TB 5KFUA 2IAJA 5F41A 5KG4A 4BDPA 4HKQA 4I4BA 2MKJA 1S9EB 5CYMA 1N54B 1RT5B 2JSXA 3N79A 2E5HA 3VF0B 2BE2B 2GNKA 2O01C 1XMQF 1UVJA 1K0VA 2GHWA 3GFHA 2HFOA 1A7GE 1IR0A 2A10A 2UZAA 1JNRB 4EBDA 1GH8A 3IGVA 2W4CA 3P5TL 3OUYB 2V5HG 5J1EB 4Y2CA 4KGMA 2MSTA 1ZM2A 2RS2A 2V2KA 4GO5X 3T5HA 4TQSA 2CFXA 1LW0A 3KLFA 2FLNA 1FO1A 4OZ1A 3SQGA 4RX6A 1IKWB 1H3DA 2CQPA 3MEEA 6FD1A 1TK0A 4ELUA 1X9SA 2OTJS 1U6FA 4IDKB 2ZE2B 4NMLA 4YUDA 3MEKA 2EPIA 4Y28C 5F8HA 2QA4G 4ES2A 1YGYA 4UUWA 4M5DA 4PRFA 4A8QA 4LF5F 2KT5A 3GG0A 1FNXH 3DNCA 2J8AA 2M0GB 3OSPA 2LKZA 4ECYA 1U1QA 1VQ5S 3AH6A 4MK8A 4O4GA 3NCQA 4LJMA 3T9ZA 3M8SA 4RBTA 2JC0A 3MUTP 1NK4A 1N33F 1OPIA 3JB9k 2OPRB 1ULRA 2ZD1B 3C46A 1IBKF 2A2CA 4RW6B 1NAQA 1Q81T 3T6JA 1JXEA 3LGNA 1IQZA 4WFXA 4PUOB 2XGQA 2XHWA 4MK7A 5KFFA 3DOKA 1S9FA 3H5YA 2LEPA 3LWMA 3QGPA 2ZITA 2GGPA 5E2QA 4TN2A 4R8UB 4LFBF 4WYLA 5A8WA 1R31A 2HRUA 2BZ2A 4O44B 5I42B 5DM6Q 2FC8A 2OMOA 2WOMB 2DNRA 2QA4S 1D8ZA 4ETXA 3TVZA 3GE9A 3DYAB 1NNDA 5H9EJ 3NNAA 2E5LF 4DUZF 4ECSA 2XS7A 2OPQB 5FDLB 3MF5A 3I55S 5JVHQ 3S8SA 1RT5A 4U6PA 2OFHX 2L08A 1FXLA 3QZ7A 3OL9A 1BC6A 4LSNA 4X66F 4FXDA 2LXFA 5LL6d 4QIFA 2GV1A 3VCDA 2DISA 2W8LA 2P6TA 3US5A 3R5AA 4XDDA 3OHBA 5A8RB 3HVTA 3JSMB 3QWPA 4M63A 2EVZA 3OUYA 3R1LA 5J1EA 2HNYB 4YMEA 2LCWA 1SH0A 4I56A 3G6VA 1X5PA 2AQ4A 1FEHA 4TYAA 3CD6S 1O51A 4QWBA 2NR0A 3OVBA 4RLEA 4PKDB 2KVIA 1NK8A 4IDKA 2ZE2A 4CO5A 1SC6A 5EUHA 5LSRA 4U7UK 1ZZNA 4I68A 1FDAA 1DTQB 3I31A 4ID5B 4OX8A 1M5KC 2GO8A 1UA1A 1FJEB 2K3KA 3CC7S 3OHAA 4HH1A 3KMSA 4G1IA 4OFZA 2CPYA 5DG8A 1PC4A 2CZVC 4B3SF 3GR0A 4I2PB 1N5YB 1Q1KA 2V4RA 1ZPWX 4FF2A 3I5CA 3EUNA 4K0KF 4WFYA 3G6ES 3ZZUA 2ZD1A 1HBUA 1QVFR 2CJQA 1HW8A 3SFUA 1KN6A 3QIDA 3E01B 2ZZNA 5IQQA 4C98A 4JBCA 1JLQB 4OX6A 3T6BA 2RT3A 3J7YI 2BA9A 5DRKA 2XMJA 3Q2TC 2KFNA 3CDBA 3IRXB 1S79A 1UJ5A 3SYZA 3NG8A 3SMZA 5AJ3F 4NYZA 3Q8SB 4O44A 5K8OA 1BQXA 2WOMA 5I42A 2RDJA 2O66A 5F8NA 3WC2A 3DYAA 1KONA 1K1QA 4X2BA 1N5VA 2OPQA 5FDLA 2XLJA 2FVCA 2AF6A 2PGCA 3D28A 3HDSA 1FK9B 4DG1B 2ZDPA 3R27A 1WACA 3K5MA 4BS2A 4BBYA 4AYBD 2ZC3A 2Z2MA 3TOQA 2I0XA 4ETZA 1B7FA 3PKYA 4JOUA 3BO2A 4J9RA 1UEVA 5K9FA 1G2EA 1I1GA 4TLRA 2HNYA 1KLMA 5DLFA 1T94A 1U1NA 3EXYA 5DS7A 4EO6A 5D8HB 1S6OA 3RR7A 4F3QA 4GMKA 1D9DA 1I6JA 1FESA 4ECUA 4MYTA 4RNNA 3WC0A 1ZM4A 2FHOB 2M88A 4A46A 5C5JA 1DTQA 2PMZD 1D9FA 2HVIA 2DNKA 4F4YA 1P1TA 1TVRA 2R2RA 1VQPS 2HWTA 3BR9A 4RW4B 4H4OB 3KMQA 2RQKA 1FKAF 4F8RA 1T05B 4KR0B 3PDNA 2XNQA 2DNHA 4WK1A 3DLLQ 4K4WA 4O3PA 2RQMA 1H0HB 2RD5C </