3ZZPA

Circular permutant of ribosomal protein s6, lacking edge strand beta- 2 of wild-type s6.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
QGYTTWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLQNEKEIIQRALENYGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trimming Down a Protein Structure to its Bare Foldons: Spatial Organization of the Cooperative Unit.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords RIBOSOMAL PROTEIN S6
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zzpA00
1G1XA 2KJVA 4DV4F 4LF6F 2VQEF 1HNWF 1IBMF 4DR4F 4DR6F 4YHHF 4DR7F 5LMNF 4NXMF 2UXCF 4DUYF 4X65F 1CQMA 1N33F 4B3MF 2E5LF 4NXNF 1RISA 2UXBF 1CQNA 1XMQF 1VMBA 2UUAF 4YY3F 4JI7F 4JI6F 1LOUA 4B3RF 1XNQF 4DV7F 4JI2F 2UU9F 5AJ3F 1IBLF 4LF9F 4LFCF 1N34F 4K0KF 4DUZF 3T1HF 4JI1F 4DV3F 2BVZA 2UXDF 4DV1F 4DR2F 4JI8F 4AQYF 2YY3A 5IWAF 2F4VF 1GH8A 5BR8F 4B3TF 4LF4F 2UUBF 1FJGF 1N36F 4GKJF 4DV0F 4X66F 4GKKF 1IJEB 4JI5F 1N32F 4JV5F 2B7BB 1IBKF 4DR5F 4DV5F 3ZZPA 5LMUF 4DV2F 4LF7F 4LF8F 4X64F 1B64A 2KJWA 1J5EF 4JI0F 1HR0F 4OX9F 4LFBF 4B3SF 1XMOF 1G7CB 4X62F 2J5AA 3OTOF 1XNRF 1HNXF 1F60B 3T1YF 4JI3F 1IJFB 3R3TA 4LFAF 2VQFF 1QJHA 2ZM6F 1FKAF 2BXJA 4DV6F 4LF5F 4JYAF 2RJZA 4DR3F 2B7CB 2HHHF 4DR1F 4KHPF 2UUCF 4JI4F 1I94F 1HNZF
chains in the Genus database with same CATH superfamily
2QL5B 2H54B 1C2PA 2HBZB 1Q82T 1PJ7A 1R3NA 2YWGA 3E51A 3KHHA 1S10A 4I4BA 2VG5B 5F8IA 2DPIA 2Y9HA 3G9CA 2B43A 3VTIA 2HGLA 2RT3A 4ZP9A 3TW0A 4I56A 2HYIB 5HROB 4OZLA 2I8EA 2FYXA 4OYIA 3WZ0A 2Z56B 4ES3A 3SCJE 3TUZC 4JP8A 3X3UA 4CT8A 4IR1A 4NXMF 1DURA 5IT9Y 2PC6A 2AYEA 2GQCA 4GVBA 4R0EA 2NR0A 4CH0S 1JLGB 2RQCA 1HWKA 2RRAA 4B3MJ 3GCXP 3IBCB 1RWNB 1DFDA 2CJKA 2I5JB 4NOHA 1RT3A 1LK7A 3MM8B 4RNOA 2ZHAA 2N4DA 2E5LF 4O3QA 2UVWA 4USUA 4DN0A 5AE2A 1UMJA 3JAMU 2JSXA 3HSZA 1C1CB 2FGOA 2QA4G 2XS7A 1YK9A 1K44A 3LP0A 1TL1B 3DOKB 3QAEA 3ENVA 1GXLA 2X51A 2W01A 3ZZUA 3KYLA 4DS4A 3AD9C 1F2GA 2B3TB 3FUYA 5CAAA 2Q6CA 4QCLA 4LF9F 4HHJA 2F7VA 1WF2A 2QFIA 1RI7A 3BBBA 1REVA 3HPOA 1VQ8S 3ZTOA 1TK0A 1UEKA 4Y3CA 5HANA 3IS9B 4ED8A 2IC3B 2MKIA 1RTDB 3CC7S 3FVYA 5KT3A 1NU4A 1TV6A 1NK0A 1TKZA 2ZFHA 4OYWA 2JH3A 2L9WA 3DC2A 1YVFA 1S1WB 5I42A 1RCXB 2DGTA 2XMMA 4DUTA 3M9MB 3CJRA 4F4XA 2YNFA 1ZETA 3A13A 1HI0P 2DHHA 2VB6A 2ZZMA 4DPOA 3RB0A 5JVGQ 1B99A 2XYPB 4GO7X 5C25B 5IZHA 2HQCA 2KI2A 1U47A 4JI4J 1HNIA 3DFEA 1P1LA 3GWCA 3JQKA 1U49A 4Q5VA 4J9OA 2F3JA 1N36F 4K4ZA 4YS2A 3ITHB 2NYIA 2ZH5A 3I5AA 1NK7A 4GKKJ 2KZZA 1WC4A 2NUHA 4P73A 1CJUB 3DLEB 4EBDA 3J7A1 3D1QA 3R1LA 4JV5J 2RF2A 3D68A 2L08A 3TNVA 2PD1A 4A4JA 1TKDA 1WHWA 3KLGA 2W2PP 4A8WA 3KJQB 1KDNA 2DR6A 3F41A 5HBMA 3KLEA 1FRHA 2MKHA 2JEIA 1WACA 4PKDB 2WRMA 3PCOB 1T05B 2CJQA 2DCUB 2DGXA 3MWBA 3KMSA 3NWGA 1P9YA 2CXEA 1ELOA 1OQ6A 1X9MA 4B3SF 2GA7A 4FVCA 2B9XA 3T6JA 2W25A 1R8HA 2HRTA 4ALZA 4M5DB 1MLAA 1H74A 3TJAA 4YY3J 1WSVA 1LV5A 2V50A 3RAXA 3RW6A 3VAJA 1XNRF 2XZWA 2NXUA 2N3LA 1KBRA 1P6TA 2HBYB 3E2EA 4LSZB 3DLGA 3CCLS 1LQ9A 3PYGA 2PGCA 3FK4A 2OTJS 3CVKA 2DHAA 4F25A 2OPPA 3LANA 3OJSA 2FY8A 4A8SA 1TP7A 2LVWA 3H2LA 2CPEA 2KT5A 4DV6F 2PIIA 2OI2A 2J8SA 4C6AA 3GIKA 4JI8J 5F0WA 2XMJA 1XQIA 4ED5A 4DWIA 1FRLA 2DNOA 1RLDA 3W1YC 2CJXB 3TUPA 4RNFA 2KRBA 1FDBA 4E2FB 4ZIVA 4NCAA 1OY6A 3JSBA 5L8RC 3ZZOA 4QBUA 2HW3A 4QYZJ 3QMQA 4DV4J 4FDFA 1I94F 3MM7A 4DPWA 1T02A 2EFGA 2GVZA 4E98A 5AT1B 3PG9A 1S9EA 4F8RA 1E6YB 3QNWB 2R7XA 5HQ8A 1NDPA 2CQ0A 1RTDA 1FVQA 4FYWB 1Q95G 4LF6J 4ITSA 1M5PC 2HQDA 3M2UB 4LVNP 5CCMA 3M30A 2UZAA 3KLHA 1TK5A 4C11B 3GJQB 2HK2A 2V0NA 3OXFA 4FS1A 3RU0A 4KPYA 3QQCD 1WHXA 1UVJA 3ZZTA 1MNEA 2XLKA 1OY9A 2EEYA 3D66A 3U7JA 4QWDA 1XR6A 3R5GA 5HROA 2MKCA 4ZVGA 2FLPA 2FHKA 4K50A 4WFNQ 4H4OB 3AHPA 1VC6A 1TELA 5HSPA 1N33J 1SJ4P 3FMBA 3VALA 2V34A 4FXWA 4U7CA 2DHGA 2XLIA 3HJVA 1MWZA 3VWSA 2VQFJ 1K73T 2EW9A 1VMBA 4CLZA 3O6QA 5A2QY 2BE2A 1UJ5A 1FK9A 1YBTA 4JI7F 2HFNA 2M5YA 3NGKA 4DUYJ 3M05A 1UJ6A 3TZZA 2BR0A 3DM2A 4EZ9A 2PA8D 1RUSA 1C4AA 5J2MB 5EDWA 3FBBA 5KFKA 2DGSA 4C8OA 3NNAA 5L9NA 1C1CA 1VISA 1KTVA 2NXNA 2ABYA 2RDDA 1W2IA 1SJ1A 3EE3A 2BANA 4NE9C 4DCPB 1UZDA 1XC9A 1QSLA 4H4KC 4ID8A 4RW9A 3T9ZA 3Q22A 2DY1A 1J5OB 4OJGA 2VIHA 2UXDF 1VQ5S 1LEOA 1BWEA 1QE1A 2FJDB 1C0UB 4ZVEA 4ZMMA 1VBZA 3RJMB 4DX6A 3CNQP 4DI6A 2RRNA 3UD4P 1FERA 4NLOA 3U1LA 1Q78A 4OYPA 3QLHB 3MEGB 3ISNC 4K4VA 1F5AA 2IIHA 1PBUA 2C2MB 4HTIA 2VKZG 4X66J 3IGVA 2JC0A 1DTQA 2WBMA 4KH1B 3IBWA 4XO0A 2F4VF 1ZTWA 1SJRA 2B4OA 3TRGA 2VPXB 4USTA 3RTVA 5KOWA 2CVEA 3KXDA 3OTDA 3KFWX 3KNAA 1S6OA 1VR6A 2VL1A 3EVMA 3GMGA 3R27A 4OI2A 4ILLA 4DPTA 1ZPVA 4HI1A 5D0GA 2ZUAA 2FJWA 4B9LA 3VF0B 1IUJA 4LBPA 1N8RT 3DU6A 2ZNYA 1S6PB 2O5DA 3GB0A 5KG7A 3Q89A 2WONA 3O44A 2M88A 1BMQB 3CULA 2HEKA 3BH6B 3F0NA 5KFIA 3NCQA 1W7WA 3DHWC 5KFQA 4DL2A 2C2KB 1HLWA 3LWLA 2P9EA 1X7VA 2LXUA 4ZCLA 4ZOSA 4ZPCA 3K8VA 3PEHA 5IQQA 5J2QA 1FNMA 3M6VA 3TZXA 4KYZA 2LP4A 1R7IA 4NA2A 4WIIA 2HFSA 2RE1A 4ID5B 2C3YA 5A6WA 5G0RA 4OZ0A 5GAGU 2XMAA 2R2TA 5FLXU 1NDLA 4LSLA 1CJTB 1HQEA 2ZBRA 1L3VA 2YKNB 2K06A 2YX7A 3PHTA 2J76E 2DHXA 2QGFB 4RW8A 4ZP8A 4DL3A 4DR2J 4NZ0A 4GC6A 1SH2A 2Z30B 2BX6A 5KT6A 3OW2R 3B4DA 1NCLA 2APOA 3GFHA 2OMLA 4TNOA 2FQQB 4DV3J 2R8KA 3US5A 1HL6A 1WD6A 2D3UA 2XWYA 3M7VA 4R25A 3H40A 2RJZA 3M4XA 3F44A 4ED3A 1XBWA 3MAAB 4UZBA 2EG1A 4DQSA 2BA9A 2PSZA 1C1BB 3BPDA 3IO1A 3BF4A 3SBMA 2AEMA 3SFUA 3UQSA 2DISA 4H4KA 2VG5A 3ITHA 2KHDA 3Q8UA 1U4BA 1S1WA 3TEHB 1VK3A 4DQQA 1VK8A 5ETVA 3W60A 3NGSA 3CO0P 1NHVA 2AYMA 4G1PA 2DNYA 3FQLA 4NRUA 1RJJA 3HCXA 4RPFA 3R9LA 2L41A 4K4TA 4CZCA 2BACA 4USJC 2KB2A 2CQ4A 4YHHJ 3IAM9 3S7RA 4UOFA 3CF5Q 2UXBJ 4MK9A 2MSTA 5CD4H 3VAIA 3N01A 3NS6A 1MU2B 4I2PB 2IM0A 4OL8A 2PEHA 4ILMA 3MR6A 4OZ2A 4HHUA 5M2UA 2B4VA 2IVMA 1WEYA 3G86A 4P7VA 4CRJA 1CQMA 4QR2A 3R7BB 4ZPBA 4Z7YA 4LBHA 1R0AB 3EUNA 3KOAA 4P75A 1KHVA 2XHWA 3LQVA 2HVHA 3GJSB 3GP9A 4KB7A 2UVRA 2EC0A 1SC3B 4P10A 4V19J 4EO8A 1RAOA 2FJAB 3MGJA 2KXHA 1MWYA 2RQ4A 4PYAA 1U8WA 1ZAVA 3SCIE 3M9NB 4RUAA 4F4WA 3HFVA 2DXFA 3AODA 2KFZA 2A2DA 2ZBPA 4O4RA 4KH0B 3BN4A 5AJ3F 2D3OR 1N88A 1D9DA 4KJIA 2NLWA 1JMTA 2Q43A 1U1KA 5EWEA 2F9JA 2FC8A 2IMWP 2D9OA 3M2VB 4OI3A 4PABA 3OR1B 4FBUA 3KK3B 3ZO7A 5C42A 1HHQA 2HAFA 2WVBA 1RYRA 4WIQA 3IXQA 4M5HA 2M2BA 4F36A 3W63A 2PMZD 3M8WA 5LT5A 2YQ3A 2CA9A 3H59A 4YP3A 3KJFB 5CCLA 4RW9B 2FHJD 4ECUA 1J5OA 2HHHJ 3I0SA 2MKYA 4RBTA 3AFGA 1TV6B 2U1AA 1WI6A 3VCDA 9RUBA 1R43A 2RF2B 5GADU 2C42A 2YX1A 1HA1A 1SQGA 2AP6A 4J9RA 3WIVA 1T94A 4RUBA 3TA1A 3P4UB 4UW2A 3KKFA 5D0RA 4FPIA 2HBRB 2RS2A 4DV2J 1F3VA 4LSNA 1LKZA 1FFGB 2VASA 4K5SA 2VODA 1Q1KA 1XR5A 2M8DB 4X4UA 3DXBA 1S6QB 3L7UA 5B0FA 4ZITA 3V6KA 1FE4A 4OYBA 3GV8B 1N6QB 2OJ3A 4O0NA 4DV5F 3RR7A 4W90B 2UUBJ 2RS8A 3AJDA 3MMJA 5L1IA 2ZH2A 2FLLA 2GAHC 5GMDA 1BQMB 4DV2F 4LF7F 4LRCA 3P49B 3D6FB 2G4BA 9ATCB 4LF8F 5J1NA 3IG1A 3HLUA 2Z58B 1VHFA 3AB2B 3IBFB 1RAIB 2AMCB 4I0WA 1V3ZA 3MAHA 4TLRA 1S0OA 4DSIA 4WZMA 2EFQA 1EAYC 1GTEA 1S1VA 2LQBA 3DMJB 4TVAB 1G7CB 4Y65A 5DG7A 4JI7J 1U6BA 1VI7A 4JI1J 2HG4A 2F5GA 2K1RB 3SCLE 4Y2AA 4M5KA 2OSRA 2E1CA 3U1MA 5K8NA 2FTRA 1RT1B 2OGUA 2YVSA 3R3TA 2DNGA 1QTMA 5ETLA 1YX2A 2JC1A 3ISZA 4X2BA 1FT8A 1CJTA 1HQEB 1UP1A 2HWTA 3A4TA 4NPOA 1RE1B 3H5XA 5LM7E 3KG1A 4ZP6A 4BBYA 2MEWA 3QJPA 2IHR1 4C7QA 2P6TA 4MMOA 2ZH6A 1DY3A 1P27B 2B7CB 3M8ZA 2EBEA 3IR5B 2V4QA 4I6AA 5HQLA 3G71S 1DZ5A 2VFUA 2FPHX 3GIRA 2BDPA 4HACA 4DPUA 4L6V3 1HHTP 3CCTA 1TL4A 3PW5A 2OUGA 1HNZJ 4JI0J 5T14A 4DV4F 1HWLA 1FXRA 1NK5A 1I94J 3DRRA 1TUWA 3OTBA 4EU0A 3ENAA 3D2WA 2OH2A 4KGVB 1T03B 4CO2A 4ERDA 2R7TA 4MIAA 1FWLA 5C2GA 2JVOA 2G2ZA 1U24A 1TQLA 2LQJA 2HHTA 2IAJA 2DK2A 5LMNF 5DZ7A 2FY1A 1HW9A 3OTEA 1UEVA 3R5JB 2XG8A 3ILLA 4LUBA 4A8OA 4RW4A 4WYWA 4CDIA 1RSCA 4TU7A 1FVSA 2Q1LA 3ILOA 1EETA 4BLGA 2Q3PA 2W2QP 4CM2A 5BJRA 5J2NA 2HIYA 1NJIT 4CO3A 2M9KA 4ZN3A 3MUVP 3FBEA 4N41A 1RA6A 4ANDA 1BGXT 4JI6J 4YY3F 4A8KA 2ZDPA 3B54A 5CYMA 5BYRA 3BN7A 3HK2A 4CI0B 2DCLA 3V4IB 3L95X 3C8YA 3JQJA 3HZGA 4ZLPA 1ZPWX 4DV7F 3OXGA 4TN2A 2UU9F 3QRQA 3IGNA 3DLJA 2FLOA 2R7OA 5KG5A 4CLSA 5MLCV 1K8AT 5F0UA 1VRTB 4I68A 1S7IA 4N76A 2GVDB 4KO0A 2RH3A 3OVBA 2GW8A 1TR0A 3MUMP 4TKTA 4IDKA 5KT2A 2JNJA 4AL5A 3NP5A 2P6SA 3UE2A 2LA6A 1C1BA 4ZJLA 2D41A 3SEOA 1UVIA 4DR3J 2CYYA 4R8UB 2NPIA 5J2QB 2RKIA 1N52B 3H98A 4U9RA 4QW8A 3EYZA 1IR1A 3H5UA 3HT0A 3PHEA 5DJBA 5D3GA 4WF9Q 3DRSB 1JQGA 3BJYA 1WOSA 2DNKA 2HNYB 2V68A 3KLFA 1FJGF 2OKQA 3TWZA 3MM5A 2MB0B 2GHPA 3MEGA 1KFDA 2HQFA 4FNIA 5A8RA 3VV2B 5ITHA 1QVGR 5K14A 1AT1B 2WTFA 4ZIWA 5JXSA 1IBCB 4NI2A 1RTJA 4EFAC 2E5GA 3A8EA 3DKDA 1WUUA 2CNNB 3VAGA 4F0MA 4GKJJ 1OJ4A 3HULA 4KQZA 2PI5A 4CCHA 5KFGA 4LF8J 3EVOA 4NLQA 2WSEC 3RB6A 4L74A 3RAQA 2W7AA 3Q2SC 1AUSL 2NSBA 4C98A 5E3QA 2KJWA 1OWXA 3R7SB 4A8MP 2W2OP 3OFFA 1D3WA 3MR3A 2R8HA 2C2ZB 2HNDA 5ADZA 4R0JA 4WYLA 4B3SJ 1B0TA 5IOLA 3M9OB 4RU2A 1SC6A 3IG1B 4ZPVR 4YB6A 2D3ZA 3BO2A 2CJ9A 2VF3A 4KGKA 1Z1ZA 5C24B 4Z7CA 4DV7J 2MY8A 3QGPA 3MFHA 2YWEA 2E7XA 3DDKA 5M2RA 2HPUA 3W5YA 3Q8QB 3ENWA 5J2MA 3TARA 1IBLJ 2UXDJ 5IV3A 4KKOB 4A46A 1T9XA 5U47A 3FEYB 2KH9A 2WOMA 3KNGA 4EUVA 1FRIA 4I64A 3BSOA 2XMKA 2VKRA 1NXIA 2B5JA 3DRPB 1U25A 1RT2B 2A10A 2KHCA 3UCGA 3ILIA 1PC4A 1BUXA 2BMBA 3VQSA 5AE3A 3GYXB 3UR3C 3VHQA 4DBQA 3JSYA 3M6WA 3NGDA 3ETOA 3ICLA 4RBVA 4EEYA 2KDOA 3PW7A 1RHRB 2V9WA 3V81A 2YXLA 3UD5A 3U02A 2GX8A 4HTJA 4NLYA 2D69A 3BYRA 3MEEB 1DBDA 2IJNA 1H2TZ 2XYHB 3R6LB 2MKKA 2CNKB 5C42B 2BUNA 4URGA 2K3IA 3VGVA 2DHSA 2CFXA 4HT5A 3CCMS 1D9AA 3UN5A 4DX8H 5A8WB 1DRZA 2HHWA 1YHQS 2E29A 3G8QA 1M0SA 3QT6A 4Y2CA 4ZPTR 4S0MA 4KV8B 1TKXA 1RYSA 4EBCA 4PWUA 5IT4A 2FJBB 3CSKA 1VIOA 3NXZA 3H5SA 4IG3A 1R31A 2XO7A 1Q5YA 2MYFA 3OSNA 3ENQA 4K4WA 1JLEB 2UXBF 1RT7A 3ADAC 1ROFA 4DSLA 3L4BC 1Q7YT 3V6JA 4DDFA 1ZM3A 1UCNA 1IR2A 3MUTP 4NZ7A 4X62J 3FKBA 4I6YA 4N8OA 4ID5A 5LSOA 4UQGA 2IM2A 4FVMA 1TTHB 4X4SA 3D4JA 3GPAA 3MPVA 1N34F 1NKBA 3MZIA 4UOHA 1X4AA 3NCRA 3R2CJ 2YKNA 3LA0A 4ECRA 2CZ4A 4PWWA 2XNRA 3G6YA 2BVZA 5CH7B 1ULRA 1OIAA 3QT8A 1YJTA 2EFVA 3M6UA 2C3OA 4Y00A 1CC8A 2O67A 2RUGA 3M8PA 3KHLA 5I3QA 4JI3J 4ANCA 3K59A 1DARA 3Q0AA 3THTA 1VIXA 1GH8A 4U67Q 5DM6Q 5D0HA 1ZAWA 5BR8F 2R3VA 2C22A 1KQFB 1L3KA 4WZQA 1URRA 3T9NA 3TZYA 3DLGB 1I5OB 1V5IB 3L7OA 1T03A 2ZC3A 1B0PA 2JX2A 4DV0F 4OYMA 3DI6A 3P6YC 3A1YG 1S6UA 1KOOA 3V6DA 3CIMA 4R5PB 1KWMA 1FRXA 2BJ8A 1Q8IA 2HNYA 2VG7B 2A3JA 2WVEA 4LT6A 1U48A 3QPIA 3GU0A 3QT7A 1HKAA 3BQ1A 4JI5J 1N32F 4LVOP 3JTOA 1SI9A 2XQCA 4ELUA 1YGYA 2DGQA 3EJMA 1KHWA 2BKPA 3FBFA 4OYXA 4WP8A 1RAEB 3I55S 2CQPA 3BKFA 1KLNA 5DGAA 2YNHA 1S1VB 1A0OB 4C4WA 3VAKA 1U26A 4I69A 1JXLA 4NXNJ 4X4VA 4IFVA 1FD8A 4O3OA 4LQ3A 4WKRA 2EK6A 2FJVA 1PSDA 2DNRA 2KU7A 1H3DA 4OV6A 3SXLA 3OSPA 2C28A 3M2UA 1RT1A 2LEBA 3BPSP 1UFLA 3SMZA 5F9NA 2LECA 4M5GA 2KVIA 1D8YA 3KJVB 1RAAB 5HMYA 2E9TA 3QBCA 2G9OA 1CC7A 2J0WA 3FSXA 2GV1A 3N6NA 5D4PA 4O4GB 2V63A 3DHXA 3WBZA 2W9AA 5C2CA 2O3DA 4NWBA 3C16A 5CYQA 3H2VE 3THVA 1WNEA 4OLPA 2DEIA 2JFDA 5I3PA 3G96A 1MW7A 4FPRA 3ZFVA 4ICLA 4R8UA 3K5MA 4O3SA 2POKA 1F1BB 3MM9B 3G82A 4XAKA 3R1HA 2FJXA 3WC2A 1WTBA 4Y2MA 3R6GB 4TYAA 4WK1A 5LJ5Y 1FFWB 1UJ4A 4ZP7A 2ZOMA 3UVJA 4GO5X 1QLNA 1FK9B 2IYIA 4DR3F 2W8KA 1O6XA 1O51A 3A3OB 2AU0A 1FNXH 3DGPA 2X3DA 1Y0HA 2UUCF 3MFIA 1RT2A 3HI9A 1NPPA 5FIIA 3CJKA 3HVRA 1SPBP 2OPQA 3UCUP 2YH1A 2XWXA 1X5SA 2VQEJ 3HHNB 1SV5B 1NRKA 5HATA 1ZYQA 2RILA 1WKKA 4DN9A 1F5CA 4USWA 3NMRA 1RP5A 1Q8BA 1XMOJ 3CIZA 5L46A 1WWHA 2ASDA 1RACB 3DLKB 1TKTA 2AZ3A 1R6VA 1UVNA 5KG1A 2PO4A 2YKMA 4C2MA 5J1EB 3OHBA 1S48A 4QWAA 4ED6A 2V69A 3RBDA 2XI3A 2Y8WA 1YLXA 3JS9A 2NQPA 2L48A 2GIFA 4N77A 2KTQA 1HNWJ 2H3EB 4PG5A 1HBMA 1U1QA 1NJXA 2IRUA 2E5HA 4ECYA 1TKXB 4LREA 3OFGA 4BC9A 1XMQF 2V9KA 3BH7B 1M5OC 1OSCA 1IN0A 3JQMA 3PO4A 1BWVA 2HVEA 5C24A 4J9PA 1Q16B 4U8YA 1Y4ZB 1OSDA 1U6FA 3LP2A 1K1QA 3M8YA 3MMBB 4J7CA 1SKSA 1SKRA 5CA5A 3DMJA 1KSPA 1OYDA 3CE8A 1TVRB 2HNZA 3D1OA 3SFGA 5KT7A 3PACA 1PG5B 5K5MA 1BY9A 4HVZA 4TQRA 3TUJC 4LF5J 2OTLS 2KFNA 3P5TL 1JLFA 1AUDA 2AX1A 4Q2LA 3ZTRA 5IM0A 3G6VA 3T1YJ 1LXNA 3C2PA 1SJQA 1L5UA 5A0YA 3IM9A 2QA1A 1FDNA 4OHWA 2DNMA 2H48B 5IC4B 3W2WA 2JVRA 4CLUA 3PR4A 3VAFA 1PO6A 1RAGB 2KRRA 3KLIB 1N5VA 2V2KA 3LW5C 3CDEA 1TL3A 3QSYB 2MJUA 1H2VZ 1YJRA 3B6BA 3C6TA 3TR5A 2E9ZA 3BGUA 3PJ9A 1NJZA 3HHLA 3T5LA 3HSDA 3M1VA 3TEGA 1X4EA 1LFPA 1X31C 4YMEA 5C25A 2ADBA 2MPUA 2ROEA 2HVIA 1TMMA 2BJDA 1S76D 2V8GA 1ACMB 1DQAA 1N48A 2BQRA 5K9FA 2R7RA 3MOJB 1S9GA 5A76A 1M5VC 4NLXA 2HURA 5JMNA 5EX0A 2XC9A 1EKRA 1YZ6A 4KHRA 3LGHA 5B0CA 4HLBA 4HYKA 1WC6A 2G2OA 1X5PA 2E5JA 1B64A 1JLGA 4KGZB 1J5EF 2FVRA 2EWHA 1F5BA 1KS2A 1MG7A 2I9SA 4IQMA 4LR7A 4LFBF 2G13A 4OI4A 2E1MC 5GMKa 2Y1IA 5AXKA 1MU2A 4ED2A 1DQ8A 1RT7B 3MTJA 3GIMA 1V9OA 2J6TA 4NEYA 2IJRA 4O44A 1N34J 2RSQA 2HNDB 2X1GA 5L1LA 1RXOB 3PW2A 4CP5A 2EC2A 4FZVA 4LFAF 3C6UB 5D77A 4L73A 2FGCA 2FHOB 2LLZA 4O4GA 4ED7A 1KLMB 2XZTB 4LBIA 2GNKA 4Q0BB 4LF5F 1FWPA 2OEMA 2DY9A 3BO3A 4RNMA 4W92B 4DS5A 2KXFA 1VOMA 1X4GA 2W8LA 1S4EA 3QRPA 1IKYA 1TL5A 1WEXA 2D1CA 3BBFA 3DLHA 4A8YA 5F8HA 4J9VA 3CJTA 1GX6A 1WEZA 1VBKA 2MQMA 2RKIB 3MEKA 1M1HA 3Q86A 4I7FB 5K8MA 4MAKA 3BR8A 2DKOB 2NPFA 4J37A 1RBLA 3G8SA 4O23A 1REGX 4XPEA 4KIAA 3EWGA 5H9FJ 2VU5A 5CABA 4PQAA 1UWBB 2DGVA 4ILRA 1T9TA 1HNWF 2JL9A 4K4YA 1FRKA 1RT4A 2IFXA 2OD6A 3AAWB 3HHEA 5FDLB 2F4FA 4YR3A 3LWMA 1G3OA 2DXEA 2IC3A 1U1LA 3R5DA 3FCVA 3GCWP 5KAKA 4K8RA 3T6BA 3BGFA 1HWUA 3W5ZA 4ZN1A 3E01A 1HMVA 4IOAQ 4ZVFA 2PMWA 4CO0A 4Q2MA 1U2CA 3MXHP 1U1RA 2RDIA 3K5NA 4B3MF 2V4JA 1HBOA 1CULA 2BM0A 2H5JB 3UNGC 1R0CB 2BOPA 4CQ1A 1SB6A 3MCNA 2XMVA 2UUAF 2MZQA 5H1SV 2COLA 2LQ8A 4MKAA 3JSMA 1SBRA 5HLFA 1TAQA 1D9FA 3HSGA 3CGIA 4LIWA 1R8AA 2B0GA 2VBWA 3C16B 3AOBA 4HT7A 4DPYA 5M2PA 4KAIA 4ZVSB 4WXOA 1S6PA 3GFXA 4DV5J 3PZPA 3RBEA 1KVKA 1F6TA 1FEEA 3KLGB 1IBLF 1XNRJ 4PRFA 5HBMB 4YB5A 3J80U 4DF8A 4YFUA 5SZTA 2QLXA 1LWEB 1RLCL 1YG0A 2H51B 1QSSA 4Y2KA 1JJCB 1FKPA 3GYNA 4OYAA 4ZCIA 1RWWB 2G1HA 4ES2A 3G6ES 1WC5A 2ZH4A 2QT7A 3OPKA 2WOMB 2ZEJA 3GSIA 4I67A 3UVJB 5KFAA 5ETMA 3AY0A 3QIPB 2HKEA 3W7BA 3MEDB 4CYUA 3OHAA 1ZTTA 3HJFA 2K3KA 1JKHB 2VBYA 4GKJF 2HMIA 3B8HA 2RHSB 2IVFB 1YTYA 3FCWA 1ZZNA 2M7SA 4PUOA 3WQPA 3KLIA 4OI6A 4GKKF 2RHQB 1RBOB 3CDUA 2ACYA 4F2RA 3FJ2A 3NOGA 1LWFB 3T5KA 4HR2A 4DSEA 1MROB 4CLPA 4MJKA 4B3TJ 3U27A 5HJXA 3KLVA 4C9DA 2KO1A 1S0NA 4X84A 1WSRA 4USVA 1PC5A 4L76A 1ZBTA 4CNYA 1ZS6A 3Q83A 2ZOGA 3ET6B 1GXTA 4RUHA 1WTFA 5H9EK 2DNPA 4PXDA 1L3UA 5DLGA 1XK8A 4JV2A 3MMBA 5EN1A 7FDRA 2M70A 3H25A 2J7WA 2VFVA 2FB0A 4J9KA 5ETQA 4LF9J 2Q66A 1P1TA 1S5ZA 5LXRA 3ZC4A 4ZLNA 1NDKA 2WW4A 1HYSA 1IJFB 1FJEB 1LFWA 2F9DA 1TUGB 2YQ1A 3W8PA 1UL3A 1U8SA 3BEGB 1CJVB 1FKOB 3UW1A 2QLJB 2F4VJ 2X1BA 3K57A 3K2YA 1U2FA 2YX4A 1UTAA 3MF5A 3IM8A 4H4OA 4NLDA 4OJ3A 4OYZA 2ZD1A 1JLQB 3VGTA 3WX4A 2AW0A 4B3OA 1FHTA 2GGPB 2Y1JA 3HVAA 5KFBA 4DOZA 5H9FK 3C6UA 3N5BA 2CPZA 4U96A 1IM4A 1JLFB 1PYTA 4I6WA 2LDIA 4O3PA 1VQMS 3MM9A 4OV1A 1TL1A 2P9CA 1TL3B 3DOKA 2CVIA 3HVTA 3M8PB 1VC5A 4RKUC 3FC9A 3ILJA 3W65A 3OFHA 3QLHA 2HHUA 3RAMA 3VAMA 2BRLA 4QR0A 4DPXA 3UD3P 3PV8A 3CB4A 4M1KA 1UFWA 4NLPA 3PVXA 5B09A 5J1EA 4HDHA 2FLNA 1CBKA 3DN9A 4TY8B 3PIOQ 2FIUA 2V2VA 2OFHX 4NLUA 3ZXWA 4DLGA 4DR4F 3SV4A 1LXJA 4U6PA 3PDNA 1VFJA 1C0UA 4MH8A 3TUIC 3M1VB 4PPDA 5CXTA 4DR7F 2CAJA 4LSLB 1KQKA 3EZOA 4DL4A 2Y1LB 5DRKA 4P2SA 2J0XA 2XMWA 4WK3A 1VRUA 3KLFB 4N5SA 2YNGA 3NGRA 1DQ9A 1WF1A 3HFKA 1HQ2A 1NPRA 2YKMB 5B7WA 3I6PA 3E01B 1FD2A 3CD5A 3H2UB 1WF0A 4WFYA 1KVJA 3VZIA 3MR7A 2QE5A 2Y1RI 5KG4A 5EHHA 1H7XA 5DDRC 3M32A 1BLUA 1B4SA 4L3KA 4M5MA 1X5OA 2Z4PA 5KFCA 4J5OA 2DIUA 1AW0A 3QO9B 2R7WA 3K7RA 4H54A 5E0OA 3MAQA 2BEFA 2B56A 4QZVB 3DYAA 1SIWB 3AH6A 3LP1B 1FO1A 3N79A 1RWMB 3Q8YA 3TZWA 4JI1F 4NYOA 1U7LA 1BQNA 3P8BB 4CH7A 3SDEB 2PEBA 2PT0A 3M6XA 3RB3A 3FFIA 1DTTB 1WG5A 4LRDA 4NLRA 3W2VA 2XM3A 2W9CA 2W7OA 4GVBB 3Q23A 1K1SA 1RK8A 5IWAF 1X60A 3PKYA 5T41A 1T7PA 3WHIA 3IC1A 2R7QA 4ZVRB 2IY5B 2KT2A 2EFNA 3ZZ0A 4AUKA 3DOLB 2UUBF 4JBCA 3PW4A 2GAGC 1I6JA 2GQ2A 4X4QA 3OFEA 3I0SB 2MJNA 1F9HA 3TX8A 3PJXA 5D4NA 1M1KT 2CPHA 2DO0A 4M5LA 1HBNA 4KPCA 5FD1A 4WU3A 3TVKA 5DGBA 2UVVA 4J9MA 5J2PA 3R2DJ 1MMDA 2W9BB 1XTZA 4MIBA 3GFYA 2AV5A 2HVDA 2WVDA 3BQ0A 3AD7C 2WHOA 3GONA 1WHYA 3W8GA 3B82A 1CULB 1P8GA 2C2NA 1A7GE 1KD1T 1EZZB 1HMVB 2GIRA 3DLBA 4UY8T 2MHNA 1N6QA 2M4MA 3FNNA 3E3XA 4PR6A 3CJQA 3O8WA 4CO5A 4Q43A 4F0HA 4JV1A 2UUTA 2OELA 4KFBA 3S8SA 2OPRA 2MZSA 5DDOC 2BJ7A 3UFCX 2DRDA 2XI2A 2VD3A 2ZOFA 1HBMB 2XHCA 5DDPC 4F50A 2AGPA 2FC9A 3D6HB 2QMXA 3ET6A 4M63A 4KRWA 2WB1D 1A9NB 4WP9A 2AJ1A 1HD0A 1UEUA 3DOMA 1ZAXA 4OX6A 1HI8A 2G0IA 4AXIA 3T1YF 3NCPA 3OR2A 4ZHRB 2R8GA 2Y8YA 5RUBA 3LP2B 1RBAA 2OIHA 4EYHB 2PI4A 3E8OA 3HZEA 2PE8A 1RT3B 2B51A 2C2OB 1TZ0A 2ILZA 3SYZA 1UW4A 5CHCB 2ZHBA 2W2NP 3PNIA 4LF1A 4F04B 3OUYB 1Z2ZA 1UPPA 3L9ZA 4QR1A 1FNOA 4AQYJ 2NS1B 1WC3A 4NCGB 4OMFG 3S6EA 3JSMB 3CEDA 1C0TA 1JXVA 1NSPA 1KTQA 4QJVA 3DM2B 4ZVTB 4PG6A 1KLMA 2JOQA 4M5IA 1HIYA 4DR1F 4FP9A 4GVLA 4G65A 2CQ1A 1ZA2B 1IKWB 5KG2A 2V94A 1S1TB 4HH1A 3RUBL 5A0YB 4RO0A 2UV8A 4N7TA 1VHIA 2ZZTA 2EFPA 2LEAA 5B0EA 5GAHI 2DR9A 4FXDA 3SV3A 2DTJA 1T9WA 3TP2A 1S97A 3Q8SB 1LWFA 5IT0A 1FRMA 2X3GA 1VRTA 2V8DA 5C5JA 4QW9A 1IQZA 3Q8PB 2VQEF 1Y00A 2HHVA 4XIUA 1KNZA 2HQ3A 2LCWA 2YWHA 3OL6A 1HPZA 1FKPB 1TKZB 2M3DA 2MKSA 3I5BA 3R8YA 3ZNJ1 1SKWA 1S0MA 4ZCKA 2ZUGA 3UDLA 2GCFA 3CJ4A 4DUYF 2LA4A 4FYXB 4CTAB 5DM7Q 1ZZFA 2XSJA 4K4UA 5LMNJ 2ZC4A 1SIZA 3PXGa 2E66A 3KG0A 4DQPA 2BRKA 4DR7J 1LW2B 4KHPF 2MGZB 2KXNB 2FVCA 1S9GB 4B9TA 1XN9A 3P45B 3CPWR 3CMQA 4DR5J 2X7IA 6AT1B 1DJ0A 2ZH3A 5J2NB 2CQIA 3EZUA 3HD1A 5E2QA 5T7LB 2P9GA 2BV3A 4WPAA 1NAQA 1QY7A 1URNA 5KG6A 1HBOB 1AROP 4TXSA 1HNXJ 1EP4B 3DLLQ 3MPYA 3NEKA 1MROA 1RGVA 4IG0B 2XY5A 3TJ8A 3LUYA 1Q81T 1KR4A 3H4BA 3M8RA 4C3KA 2BW2A 1EQMA 3QJJA 4XK8C 4O44B 1Q0NA 2YNIB 2KG0A 1Q79A 5GAEI 4M94A 1NKEA 1VLOA 4QIEA 1TL7B 2MSSA 2VOPA 2CPYA 2JWNA 3AJ2A 3HVWA 3QSIA 1NB7A 1QAIA 1Y5NB 3MEDA 3MMCB 5LSLA 1KONA 4J9QA 2D7SA 4OJ1A 2DIVA 3CD0A 3W66A 2DO4A 4RBUA 2ZD1B 4OHXA 5K8PA 5F3ZA 3SQOP 4DL5A 2NREA 4F4YA 1Y10A 2XMTA 3PYFA 4B3TF 4OI0A 1E6VA 2BABA 4F3OA 2VPWB 1M5KC 1SJ3P 4DSJA 1UWAA 1H6KX 3OVSA 4BWMA 5L1KA 4DX7A 2UP1A 1UETA 3MOZA 3AD8C 4UF4A 3VVUA 2E9RX 4DV0J 3PFEA 3H5YA 1FKOA 3MMAA 1PYSB 4IKAA 1N5YA 2VDHA 5L1JA 3AT1B 3V4IA 2DNNA 1UWBA 2DNLA 1VC0A 2HMIB 3KHGA 2XGPA 1U09A 3RGIA 1JLBB 2VFTA 3POTB 2B8PA 3ZZPA 2H1YA 1WC1A 4WFZA 1W25A 2GVDA 2DH7A 3HHLD 3MPUB 3NGUA 3GV7B 4C8ZA 2JLFA 3T5HA 1Z4UA 4HL9A 1O5JA 3V5RA 1AYEA 3M32B 2E5LJ 1SUQA 1UVKA 3D1HA 2IA0A 1XMOF 2CJBA 1GMUA 3KTQA 1KKHA 2XTJP 3BR9A 4IO1A 2NXEA 1NJWA 1HYSB 2HQIA 3HKWA 2XS5A 3KLHB 3LTOA 4A8XA 2RQMA 4KE5A 3T1AA 1HQUB 5KFDA 1VBYA 2IA6A 3KK1B 4B3RJ 1T0TV 4BCAA 1CJKA 1RTIA 3JB9k 4JI3F 4ELTA 2YPYA 3CJSA 1SH0A 1EARA 3RRKA 1T3OA 2GJ2A 1IVZA 1HW8A 4USMA 4D3HA 5THWA 2U2FA 1NHKL 5HI7A 5LL6d 2YNGB 5GAEU 1NSAA 3OR2B 2WONB 3QYYA 1LWCB 1MMLA 2NSCA 4NI2B 4DXLA 4ZHRA 3CCUS 3K58A 1VQYA 4WP3A 3MURP 4IR9A 4ENOA 3K5OA 4TU8A 1MSWD 3LF0A 4IRKA 1PCAA 2OEJA 3CJ0A 4DQIA 1JLQA 1VQ9S 5HVGA 4Y28C 3EGZA 2B5JB 4B3OB 4DUZJ 4DR6J 1JLAA 4TY8A 4JI0F 3K5LA 4RWWA 1HNZF 4NYZA 1UAWA 4MIWA 2ROPA 2WVCA 4USKA 4U8VA 2C1EB 2H9ZA 3HVTB 5L39A 2DB1A 1U45A 4LMZA 2AYGA 2H5EA 1O0PA 1XWLA 2FUG9 3CWJA 3MI7X 1JKHA 4KT0C 4F3MA 1WKLA 4RR5A 3L7PA 2YQ0A 4DSKA 2R2SA 3T3FA 3ZTPA 3V81B 2OO4A 1V5VA 4JOUA 3LAKA 1RWPB 2MKJA 5F8MA 4FKXA 2OP5A 1GNKA 5J2PB 2I38A 5MAOA 1I51B 2H5IB 3IR7B 5I42B 4V19X 3QGIA 1RAFB 2F8MA 1LNQA 2R9LA 3TA2A 4NA1A 3TAMB 2GQQA 1WORA 3T1HJ 3JAMY 4YN3B 1UA0A 2K7JA 1Q8LA 3BKTA 3C14B 4HHHA 1VQ4S 4NXMJ 4LSNB 1U0SA 4LRAA 3R5AA 4JI6F 4DV6J 3RB4A 3KK2A 2R7UA 4QU7A 4NLTA 2QLFB 4XDDA 3GV5B 3HF5A 3NG8A 2ZZNA 4F0KA 1FE0A 4MFBB 4RL1A 5T7LA 4X4NA 2FHJA 4ECVA 1AFIA 3SDEA 1AFJA 2ADCA 4DR1J 3GG1A 1BQMA 1KOHA 1FTCA 5DG8A 2N7CA 4LRFA 5FJ4A 4DV3F 3NNCA 3CDWA 2UXCJ 5B0GA 4DV1F 1JLCB 2O66A 4NYPA 2R4FA 2LDYA 4OZNA 3WIUA 3P5BP 1B3TA 4O0IA 1IKVB 4DR2F 3L09A 4DSFA 4MK7A 2L3MA 3I31A 1D09B 2HWHA 4AT1B 1HBUA 3CDBA 3SCKE 2IDLA 3H42A 4H4MA 5IXUA 2VA3A 2Y3YA 1ZOTA 2HS4A 3H7HB 2BQUA 4J9UE 3QGHA 3W2VB 3FZBA 4WBFA 5F3TA 3A8IA 4URSA 5B0AA 2XO6A 5KFFA 2FHMA 3OT9A 4U7UK 3RZAA 1V3RA 2V2QA 3KG4A 4G1IA 2RD5C 1IJEB 1JWWA 2KT3A 2VC1A 2XS2A 1H73A 2EK1A 4DFJA 2XEXA 4WFXA 2LU1A 3IRXA 2B7BB 2HZCA 4KTQA 2KVQE 2AJQA 1IKYB 2MMYA 5KG0A 1RHQB 4R5PA 4NCGA 3NLCA 5LMUJ 4QYRA 1VJQA 1WOOA 4KFBB 3VAHA 1VQ6S 1WHVA 3DGPB 1HHSA 2GMHA 3OR1A 2XCPA 5HP1B 2WAQD 3AA9A 4YR0A 3SSRA 4UOCA 1FCAA 1JLBA 2CJAA 2C3UA 5GVQA 1H72C 2E7VA 2HBQB 1QUPA 4ZA1A 1VQPS 2ZHOA 3OBIA 4ZJQA 2DNQA 2XYGB 5E3RA 2VJVA 1L3SA 5KFEA 3MEEA 1TFWA 3LH2S 2UU9J 3I4HX 3MR5A 4JI2J 4IFVB 3OTOF 2KZMA 2QJ3A 4QIGA 4LFCJ 2N4CA 1Y3KA 3KDNA 3DLKA 1UVLA 3PYEA 1YBUA 3D3BJ 3PEJA 4USIA 3LO3A 4EK2A 4QWEA 2C2RA 1XMQJ 4G1QB 3R7NB 2HQGA 4C8YA 4KV8A 3CJ5A 1QUVA 1R89A 4TLQA 2V4JB 3D6TB 1IQTA 1U1PA 5BR8J 1CJUA 3DLEA 4PYDA 3K5PA 4YDXA 3LP1A 4D3GA 1OY8A 4X4PA 1OPIA 3PTWA 1UA1A 4JYAF 4HKQA 2P8IA 3MECB 1M5HA 3MM6A 5IWAJ 2G0CA 3MD1A 4OLOA 4CIOA 4E0DA 2MQOA 2CPJA 5DS7A 3C46A 3IN5A 2EKNA 3FFIB 2N7YA 2ZBQA 2MZJA 1IM6A 4PXEA 4CWBA 1XR7A 2CADA 4NZ6A 1RWOB 2QLWA 2K2PA 3HHDA 4IG0A 4CLTA 5HQMA 5LOQA 1NJYA 1OO0B 1BXNA 3HX9A 1NK8A 1LW0A 2PFDA 2G1DA 1FXDA 1MN9A 2KKHA 3DOLA 4P2MA 1FRJA 4ZPAA 5KFLA 3CCZA 1AA1B 4TU9A 1S1UA 1FXLA 1LWXA 2QL9B 5G0RB 2RU3A 3CDAA 1VQNS 2R7SA 3G8TA 2GC8A 5CZVA 5BYSA 3I56S 4Q8EA 3EGWB 2H65B 4DEZA 1TU0B 4IOBA 4MT1A 3W64A 2OMOA 1B0VA 4K5RA 1MN7A 3QIPA 2VONA 3EPGA 3KDOA 2R42A 2UV8G 1VQKS 1E6VB 2CNLB 3O2IA 4ECSA 4OX9J 5E3CA 3BGRB 2QEXS 4QPXA 5F41A 2CDQA 4JV0A 1NH8A 1H0HB 2DD8S 5KFVA 3PRDA 1RTJB 5GAGI 1RU1A 2B6AA 2QMWA 4X4RA 2P2CB 2OPRB 1EB0A 2HFUA 3QJLA 3PY8A 1K0TA 3CTRA 2B4UA 3HDSA 2R2RA 4LFAJ 5HMXA 3UWTA 1RHUB 3POTA 3PX0A 1A6LA 1S0VA 4USHA 3PX4A 4PWDB 1F3FA 4CM0A 2ROGA 2AWZA 1E6YA 4Y0FA 4DLEA 2AD9A 3ETMA 4FYDA 3CD7A 2XNQA 3O5TB 4RLEA 1YI2S 1YWXA 3QZ8A 5E41A 2HIQA 3G6XA 3VVTA 1GK8A 3V4MA 3CXCR 1S1XB 2NXCA 4KR0B 3TA0A 1JJ4A 3OV7A 1LWCA 1RDRA 4NRTA 5HO4A 4LF4F 2V67A 2W1BA 2I5JA 3H20A 1CVJA 1GXUA 1C0TB 2W4PA 4C8NA 4W98A 5KFPA 1R0AA 2UVUA 3W3SA 1F9EB 3NOCA 2GIQA 3K17A 3CCJS 1IKWA 1CJVA 2BM1A 2YKAA 2JRSA 1JLAB 2YBVA 3N0VA 5ETTA 1WI8A 3IMQJ 2AJ2A 3FMWA 3CJKB 5DDQC 2QSWA 2G0JA 2YH0A 4OQJA 5HMWA 4X66F 3MCSA 2F1FA 4AXJA 1SJFA 1FEHA 3C15A 1S7HA 3D9BA 4C0HA 4DU7A 3SQGB 5GAHU 1N4LA 3GILA 2JLGA 2V6AA 1NSQA 1X4DA 1NKCA 4OYOA 3OLBA 1HPZB 1SL0A 1SUQB 4ZS6A 3TX0A 1D8ZA 2HNZB 3IWXA 3BO4A 4I7FA 3FEXB 3BDEA 2RMLA 4YR2A 4IDKB 3EX7B 4FNHA 3PX6A 3IS9A 3HKZD 4DFPA 2ALZA 4NASA 1NBEB 2R8IA 4G6VB 1YBAA 4BS2A 4AL6A 2E44A 2RIJA 2FJEB 2W4DA 4PXCA 2W7PA 3HHKA 2ZH7A 1RT5B 4IUFA 5J1PA 3CJ8A 4X62F 3T5JA 4IFYB 2AT1B 5CQGA 4X65J 1AZSB 2LFVA 3C14A 4DMZA 2M52A 4I2PA 1RTHB 4RU9A 4RNNA 4EYIB 1RWKB 1PKUA 2GHVC 4WFAQ 2Z57B 4X4TA 5KFSA 5A8KB 2HZAA 4F4AA 1EETB 5CZXA 5KFMA 4OIXA 2GMLA 2W4CA 5H9EJ 2GJIA 3OL7A 3BS9A 3BV8A 1QJHA 3D0GE 4DHVA 5JVHQ 2DPJA 3HHLB 2JEFA 3OQ2A 1BQXA 3AQOA 3ZTQA 2YNFB 1NSKL 3F56A 3NKYA 5HAOA 3F73A 5DLFA 1JB0C 4Y2IA 5CYMB 4F4KA 4DCOB 4UT4A 1RHMB 4P2XA 2HLUA 2NXJA 2IPOB 1NZAA 2VV5A 4PG8A 1GEHA 2ACMA 3TQ1A 1X9WA 3MCMA 2DGUA 3QWPA 3TAQA 4MFBA 4NMLA 5K20B 4IO9Q 4B9VA 1VQLS 1F0XA 3M2VA 2R8JA 1SC1B 2IMOA 1RKIA 3W9IA 3ZZRA 5DZ6A 4B08A 2ZJQQ 5HP1A 4ES1A 2R7VA 5F8JA 1GMVA 2HZVA 3TAMA 2AEJA 2UXCF 2D9PA 1G2EA 5FDLA 3D28A 4LF7J 3W62A 1H7WA 2FVSA 2OPPB 2Z2YB 4EGLA 3M2RB 3PJWA 4CLWA 3LALA 2F8EX 2QYGA 4LFBJ 5B0DA 4LF2A 1VRQC 2CZ9A 1IWAA 2JLEA 3DDIA 4TY9A 1CS4B 2MLYA 3EGVA 3O1LA 4ETZA 4BDPA 1M90T 4IH6A 1F2HA 4PG7A 4QOTA 3UDVA 1R8BA 3IRXB 4JI2F 5EGYA 1BC6A 1FESA 2IVYA 2GVZB 2OEKA 3AOAA 3T19A 4Z2XA 1YRXA 2J6SA 3EZ5A 5HMZA 4FF3A 1IKVA 2MY7A 2ZKTA 3J7YI 1WG4A 1CJKB 1RTIB 3FGVA 3HFZB 4YB7A 3TVZA 5KOXA 2ASLA 2VBZA 3MPWA 3M30B 4Z37A 4UUXA 1HWIA 1U1OA 2AGQA 1QAXA 2YPZA 4F3QA 1PAUB 4RW6A 2JJ4D 1UFKA 1PJ6A 3D3CJ 2V8PA 4LIRA 1RU2A 4JI8F 2YY3A 4M5NA 2X1FA 2MZRA 4FYVB 2A2CA 3P96A 1XMBA 3BDPA 2I6WA 2JEGA 1RZMA 2FZCB 3QZ7A 3UI3A 5KFJA 2AZ1A 4DZ6A 3Q8RB 3GR0A 4NEZA 1X0PA 4EBEA 3SIPB 3OD2A 4KKOA 4WCEQ 1RAHB 1I3OB 2IM1A 1RA7A 2WW8A 2IYGA 5CD4A 4JI5F 3J81U 1N32J 1Y3JA 2ZITA 3RRHA 1EKSA 2VBXA 2QMUB 2MDAA 1N5SA 2KL8A 1V3SA 1OS5A 2YWKA 2ZBCA 3FBCA 2EI5A 3BGRA 4DQRA 3AJ1A 4ZDNA 3HP6A 5HL7Q 3QWUA 2OLWA 2CDRB 2GZOA 3WX8A 2XSFA 3J7Z5 2JEJA 1J5EJ 3R5CA 1RKJA 4BC7A 4A47A 2K7KA 2FVPA 3MDFA 2B6AB 1RT6A 1NLKL 2OAUA 3OL8A 1KC8T 1HR0F 4NLSA 1SKUB 1DLOA 1KN6A 1S79A 3DRRB 1PILA 2UUWA 2B9WA 1NEEA 4P7TA 4NX9A 3UPFA 3SZ2A 1NZ8A 1YJ9S 1ZH5A 4Q45A 4PPZA 2WBRA 2IAJB 4L75A 5DQIA 1LK5A 1SCJB 2QL7B 2ZJRQ 4CYUB 1N0UA 2J7KA 2VC0A 4I2QB 1S4FA 2FZKB 3MM5B 3RBZA 3CC4S 1LW2A 2J8AA 3NMAA 3THPA 4QQBA 4FXVA 4PG4A 1RB0A 2VG7A 5A8RB 5F8GA 5KT5A 3D7SB 5JUMA 3B4MA 3A3PB 3A3NB 2ALYB 3D67A 3GIJA 3BQ2A 3KJNB 3OL9A 2EG2A 2ZE2B 4CO4A 3JYTA 1S9EB 1SL1A 2FVQA 5KFNA 1HD1A 3D0IE 2C3PA 2VG6B 4JI4F 4WU2A 3JXOA 5L38A 3NAHA 4A48A 4X4OA 1M5SA 3GYGA 2BBEA 2FZGB 1RHJB 3JTPA 3I0RB 2AHOB 2IDEA 4N8NA 2Y0SD 3UN3A 1IXKA 3D6MB 1UKUA 1TL7A 2RVJA 4PAAA 4AYBD 3J7ZT 1H98A 4NLWA 1YJNS 4DR6F 2MQNA 4OZ3A 1U02A 1WOPA 4K4XA 1AXQA 1MWQA 3X1LB 3AQPA 3EXCX 4KBIA 1CEZA 1LW0B 2AJFE 2DR5A 3CMES 3J7AN 1ZM9A 5EX3A 1SH3A 1JXEA 3RR8A 2EKYA 2LEPA 2VICA 5IFMA 4NLGA 2BYCA 2J7UA 3TANA 2WCXA 1RT5A 1YZ7A 1U1MA 2NCKL 4HEA9 5E5NA 4DL0C 5A2QU 1FJ7A 4NXNF 5KTQA 3OTCA 1EIYB 4LJMA 2ASYA 2KM8B 4Y34A 3MAAA 5DQHA 3IWNC 2VPZB 1YQHA 1QAYA 5EWGA 4I1TA 4DCJB 2E1PA 1FX2A 2QRRA 3FZ2A 1HBNB 2EBGA 1T9UA 4P52A 2QN6B 4J9NA 2QTWA 4A8FA 2V8VA 1YDLA 2V2ZA 2CZVC 4QPTA 3SQGA 4B02A 5KFWA 1CS4A 4UZCA 1UVMA 3DDNA 3L3CA 2E7WA 4YOEA 1ICEB 1AZSA 4OZ1A 3ELHA 2MZ1A 2CQ2A 3I9ZA 1NB2A 1KEKA 2NZCA 1YRUA 1JIHA 1S49A 1JJ2R 1Y9OA 2HS3A 4AL7A 3BREA 3CJ2A 4QYZK 1RWVB 4ER8A 1VBXA 1KFSA 2QFJA 4FKYA 2VJUA 2ZJPQ 1DAXA 2LU2A 4DX5A 2BJ9A 2NZ4A 3KHRA 5KT4A 4ZVHA 2M8HA 4K4SA 1RCOB 3CO9A 1AB8A 3FCHA 2GGPA 2C3MA 2LXIA 1XEZA 2ZNZA 4IFYA 2VFSA 1APSA 4RWXA 1QD1A 2CG4A 2DJWA 2QSFA 2Z8QA 3W61A 1WELA 1T9VA 4P71A 3WC0A 1Q86T 2HVZA 3PR5B 2W24A 3QAUA 3TYTA 2KG1A 2W2MP 1HI1A 3C15B 5A8KA 4MKVA 4ZK7M 3IP0A 2ZBIA 2XMUA 1GMWA 3GTYX 1R6YA 7AT1B 4C8MA 2BQ3A 1CG2A 1HFEL 1U2RA 3UO0A 3FQKA 3FRYA 2AKWB 2RUSA 1CSJA 1JX4A 3LAMA 2ILYA 4ZCMA 3DRPA 4DG1B 4K59A 2BJEA 4WKYA 4LF4J 3AXKA 3HM9A 3NY0A 1VGYA 2QX0A 2CQCA 5D6GA 3J80Y 2CQ3A 3I4PA 2H4WB 1VLYA 5LMUF 3PW0A 1TFYA 2Z2MA 3MHYA 2F63A 1S1TA 2QG9B 1TMJA 3ZZZA 1K9MT 2Z2ZA 5D8HB 2WSCC 4G3IA 2DR8A 3RBXA 1NM2A 3BB5A 3P3DA 4UQTA 2BE9B 1GX5A 2OSQA 1RWXB 2J9CA 2OHDA 4E8UA 1DTTA 2QV6A 2DT9A 4KGMA 2PFFB 1VCTA 2HRYA 2JHEA 2CPIA 1RT6B 3DRSA 4MYTA 1HNXF 4K0KJ 2VH7A 4KY3A 1F60B 1NDCA 4ETXA 4CTAA 2DGWA 5F8LA 3V2UC 2C2EA 3GZ7A 4LQ9A 4YQWA 4V1Ak 3CCSS 3H8YA 4KC5A 1VRUB 3NGTA 3I32A 3DOMB 3TJ9A 5DO2A 4TQSA 3BZQA 4IG3B 8RUCA 3ULHA 4ECZA 4I2QA 4OZ5A 4FF2A 3NBPA 3FEZA 1J2VA 4WTOB 4PCQA 1Y5LB 2V5HG 1IBMJ 2QO3A 5D4OA 2YWWA 4Y6IA 3G2XA 5SUHA 5KFYA 5HVHA 3K0JA 1X5TA 2WK4A 2MQPA 2EXUA 2C2DA 1RWUA 1GAOA 1S1XA 2OD4A 3C66A 4EO6A 1DHMA 1TVRA 1RAJA 3NAIA 4NLVA 2H4YB 2CQBA 3BGOP 3CT9A 4MTPA 4OX8A 3J81j 4KHMA 1XIQA 1Y7PA 2LQ5A 2QC3A 4CT9A 4ZKAA 2DITA 2LKZA 2O1PA 4OI1A 4C0OC 4M8LA 1RTZA 1W26A 2MHEA 2ZWOA 5K8OA 2PDAA 4XPCA 4M5DA 1YIJS 2DXDA 1TAUA 3LGMA 3VGSA 1TK8A 3M2RA 3FSIA 3N6MA 3GSDA 1GQEA 3A8KA 2CQDA 1D0EA 1FDAA 2V4RA 2HFOA 2DNHA 3C3LA 2VA2A 3BSNA 1X4BA 4H4MB 3HT3A 2ASJA 2QIFA 2B4PA 3OXLA 3DRXA 4DFMA 1N33F 1DLOB 4XTTA 4Q0BA 2MQ8A 5C7PA 5LJ3Y 1HR0J 1S99A 3C6TB 1TUVA 5KFXA 4DJBA 2HGMA 1QSYA 1CQNA 3OUYA 1X9SA 3FDSA 3M8QA 5L9XA 5KFTA 2MGZA 3BKUA 3N9UC 2IBOA 4RX6A 3MMAB 2CWKA 3RG6A 3PM9A 5IQ6A 2XY6A 5AJ3J 3I87A 2VHGA 2ERRA 1X4CA 2W9BA 4IH7A 4RJVA 2RRBA 2BZ2A 2XULA 1GFWB 4HH0A 3OJUA 1VQOS 5AXMA 2SXLA 2NUUG 4LFCF 3EXYA 2OFGX 3TAPA 3N5FA 4K0KF 2QA2A 4ZVOB 1V6HA 1T9YA 4IQXA 1Q7LB 2OPSB 2YWFA 4EMDA 4L72B 3DU5A 4FF4A 1U0HA 4C97A 1FF2A 3QGGA 1XJWB 3C19A 5ETRA 2HHQA 1T11A 1GT8A 3QT5A 4RZRA 2CPFA 5F9LA 2ZVIA 2XCAA 4FS2A 4QU6A 3HO1A 3EDRB 1S57A 2CIMA 3N4WA 4NCBA 4ZPWR 5ETPA 4WE1B 1Y5IB 3DCAA 2QZ8A 4B17A 3AA8A 4ATNA 1O8BA 1HQUA 2EFOA 1SL2A 5EWFA 2LQ9A 3K89A 4EZ6A 7FD1A 1RHKB 4G1QA 5CYQB 2VUGA 2F65A 2I1RA 2HAIA 1GTHA 4OFZA 3QATA 1WDTA 5ETKA 4WJBA 2ZWPA 4CNZA 1PJ5A 3NS5A 3TQEA 3HHLC 3B78A 4OX7A 1SC4B 4F26A 4YB1P 3NL0A 2MTLA 4DR5F 3GLJA 1PBAA 3QFHA 3D54A 2WB4A 2ZE2A 4MK8A 4OHZA 3JYTB 3CCES 3CMAS 1K0VA 1LWEA 1ZM2A 3VGUA 2WVFA 4Q7AA 3I82A 4ZVQB 3ISND 2YNIA 2MQLA 2N3OA 4CLYA 4QIVA 1PGZA 5I3UB 3UNYA 5E7OB 3LP0B 2K1RA 4WXWA 3UR0A 2JDJA 1B70B 3KMQA 4NL5A 2AYBA 1JK9B 1B7YB 5G4DA 3MMCA 1H2UX 1RT4B 3BBCA 3HXMA 1FA0A 1OYEA 4AD6A 2J5AA 4XDCA 4X64J 3BSCA 4UOGA 2L9NA 1OPZA 5CYJA 2VFRA 2MXYA 4NMXA 3HMJG 2VQFF 3J7YU 5E33A 2GMJA 3AXMA 1MMNA 3TVYA 3J81Y 2KN4A 3LPYA 2D3O1 2BXJA 4YUDA 3IWLA 2V8HA 1YSJA 2G2YA 1S6QA 3UCZP 1ITPA 3DGVA 4C8KA 3CJ3A 5D3GB 2RAQA 3T41A 5DETA 2CJYB 2CNOB 1YJVA 2B8QA 4ECTA 5IV4A 1OMSA 1WG1A 1VS3A 2J9DA 2HWIA 5GMEA 5HVFA 4FYYB 5AE1A 4RW6B 4EWTA 2ZH9A 1FJCA 3I0RA 3NBPB 5LXYA 2YTCA 4ZVPB 2FD2A 3N28A 5ETOA 3DYAB 2BJ1A 2VDIA 5K14B 4U7UD 1X0FA 1SQEA 2GO8A 2PA3A 4EI2A 4PWDA 4LF6F 2X1AA 2R2UA 1JNZB 4ZLLA 3PKMA 2VG6A 4QWBA 5KG3A 2ZH8A 4DG1A 4ECXA 4KHPJ 4F2SA 3VQTA 2PN6A 2KFYA 3CC2S 4YHHF 2MLZA 1F9FA 1HWJA 4ED4A 3KUEA 4O3NA 4C3LA 1NMEB 3AOCA 5GADI 3KK1A 2XBPA 1X4HA 2RB7A 3UN2A 4X65F 3NWRA 1M1GA 5E3PA 4DL7A 3A8JA 4IH5A 1IKXB 4L3NA 3WDOA 4CO1A 5FLXY 1VYAA 2DRBA 2IBKA 4F02A 1YJ7A 3UDEA 2HK3A 3G82B 4FBTA 2O01C 1OQ3A 1I1GA 2A0FB 4MKYA 1RISA 4Q8FA 2BE7D 4ANEA 1YKWA 1ZM4A 1LOUA 4DL6A 2UUAJ 3NNHA 4B3RF 3MM8A 1XNQF 4M5JA 1REVB 3IR6B 4YEAA 1YJWS 4DU8A 1FI4A 3H0PA 5KFRA 2HLTA 1HNVA 5D4LA 4B9NA 4KGXB 2A18A 2MQQA 3M8SA 3H90A 3IA0A 2DRAA 4AE5A 3VZHA 4ED1A 1SV5A 4BHQA 4WTYA 1G6BA 3T1HF 1U1NA 4PQUB 1CLFA 5HK4A 1Z2LA 4LR9A 3SI8A 1KVIA 2ATCB 2LYVA 4IOCQ 2CUYA 1FDDA 3MPDA 5A8WA 4J9LA 4RNHA 3PYDA 3MCOA 4JYAJ 2DEJA 4RW4B 4AQYF 5JJBA 5D0EA 1KQGB 2E1AA 4LRBA 5KFOA 4DZDA 4ZJOA 4WFBQ 1FX4A 3CCQS 1NK4A 1N5QA 3OVAA 1P9QC 5HJYA 3CCVS 1YITS 1BE4A 3DXSX 1Q53A 4RW7A 1Q5VA 5BYQA 1EQ0A 3DNCA 4ZLJA 1HBUB 3H4DA 1C4CA 2ZDOA 2HS0A 1XERA 4MKBA 3A12A 2HSEB 2KYZA 5AXLA 1UPMB 2DGOA 3RRGA 4C3MA 1WJ9A 3KWMA 3LGNA 2RDJA 4IRDA 2HHXA 1SQFA 4J91A 3FRZA 2WZ1A 3KK2B 4ED0A 2BW7A 2BKNA 4LR8A 1HARA 3D5MA 4F4ZA 4KSEB 1SVDA 2I0XA 3EVWA 1FJGJ 3FSYA 1R8PA 4KO0B 4UUWA 4C0BA 3IRWP 2J6UA 2J0QD 1JLEA 1T95A 2LMIA 4BWJA 5IS2A 2A1BA 2VZ9A 1VQ7S 4C8LA 4B9SA 1GMWD 4X64F 4M95A 2AGOA 3SSSA 3KK3A 3PIPQ 2AEFA 1PIEA 4OX9F 1N56A 3NRBA 3EICA 2W9CB 4URQU 4DFKA 1FWKA 1IBKJ 2ZKUA 2Z2LA 3CW2C 2CQHA 6FD1A 4DV1J 3QFWA 4GRSA 4PEOA 2RNEA 4P74A 3SSQA 2DVIA 3N6LA 4JB8B 4W4MA 1VDHA 5EUHA 5IC6B 3M8QB 1S72S 2KM8C 1XNQJ 1BD6A 3JTNA 3BSAA 5D78A 3JSRA 3DI6B 1WC0A 3V6HA 2F8HA 1EHWA 1K47A 4ECWA 4PUOB 3K8WA 2AJ4A 2N82B 3PFOA 3QRRA 2AX0A 2XZDB 3EM1A 2BKOA 2DH8A 8AT1B 3OLAA 2MZTA 3KUHA 1Y11A 3ZTSA 2HHHF 3PO5A 3KLEB 5IT9U 4FN5A 1L3TA 1VJWA 3TO8A 1EP4A 3MR2A 1H38A 3GIIA 2JZ5A 1J27A 3GJRB 4CH1A 4WWSA 3QO9A 3G87A 3LOUA 2DYAA 3ONQA 3Q8VA 3MECA 4K7QA 1PYOB 4CLLA 1S77D 3CD6S 1EX8A 3GR1A 1G1XA 2KJVA 2HRUA 2BOAA 1Q4RA 3I96A 5A6PA 3R97A 4QIWD 1HNIB 3CCWA 1PAEX 1S12A 1NHUA 2BJ3A 2Q6BA 2QYCA 1BQNB 3EDQB 3EMTA 3R5BA 4OZJA 4CLKA 3KJVA 3RW7A 5KFHA 4N56A 1IBMF 1NUEA 1JNRB 1JLCA 2CPDA 3QIDA 4JUZA 1D1UA 4GMKA 2KYXA 4F7VA 3OTOJ 5I4MA 1S1UB 1N5TA 2A6OA 1VQSA 2IRYA 3PRVA 3UDCA 4C11A 2VPYB 4P72A 2HGNA 4U95A 3NS7B 3TI0A 4UY85 1B7FA 2RQKA 5F8NA 4MYUA 3GJTB 4OHYA 3BYPA 5ETSA 1YRTA 1T05A 1IR0A 1FTRA 2F40A 4PXBA 4DR4J 4NA3A 4N47A 2ZM6J 2HHPA 1R8CA 2IM3A 1IKXA 2CPXA 2CWXA 4ZPDA 4O3RA 1IWGA 3O3LA 5LSRA 3CCRS 4RW8B 1BHNA 5I3UA 2HHSA 2XGQA 2BANB 2DH9A 1NK9A 3GE9A 2QA4S 4B9MA 1U0HB 1R0BG 5ETNA 8ATCB 3W5XA 4ICLB 2YKOA 2J9EA 4HACB 1QE1B 2CG8A 2FDNA 4P6QA 3VR1A 3Q24A 1KP6A 2YNHB 2GFFA 2B9EA 4DUZF 2AJ0A 1RQ0A 2Y0BB 3BM7A 3AB4B 2ZVSA 4DF4A 3Q2TC 2AIRB 2DNZA 3PRBA 2A6MA 3GFZA 1N54B 1NH7A 2MLXA 2OPSA 2J9DE 2XSJB 2XY7A 1YJUA 3ZNUA 1N0VC 4IYQA 1U6ZA 3IFEA 1UZHA 2OPQB 2QLBB 5AXNA 2PMHA 1RADB 2B9YA 2GS8A 4Q44A 3V6DB 2J0SD 5D15A 3GG0A 2CQGA 3MD3A 2Z0GA 2UUCJ 1NPKA 3RYLA 4CLFA 3HSJA 1ZA1B 4HI2A 4ECQA 1QVFR 4WE1A 2ATLA 2IRXA 3MTKA 3HD2A 1NO8A 1R27B 2RU9A 1TKTB 4OHVA 4GC7A 4RW7B 4PZVA 1T3NA 5HLFB 2IJFA 4JV5F 3I5CA 1IBKF 1FFSB 1CPZA 4K2XA 4QWCA 1WKJA 4ELVA 3MM6B 2XB2D 1X8DA 4K2JA 6FDRA 1RABB 1X4FA 1JJHA 3D0HE 5B0BA 1S59A 1N36J 4ZVUB 3GQCA 1G4CA 3TOQA 2YKPA 1UW9A 4P9SA 1QM9A 2BE2B 2HFZA 2M0GB 2I2YA 2DR7A 2NYHA 5KFUA 2VOOA 4UTGA 5HN0A 4C48A 3ZZYA 5IM0B 3DRYA 4TYBA 2CKWA 1QDUB 4HDGA 4YDDB 4RUCA 5KFZA 4AFFA 2E5IA 5BXIA 2XLJA 2GO9A 4A8QA 2AF6A 2EVZA 1W2BR 1T8EA 4J9SA 2WSFC 4B9UA 4P2FA 2LXFA 2DBBA 5E3AA 1NNDA 3W9JA 2K8GA 4OJHA 1QTNB 3G4SS 4FF1A 1QAJA 5DG9A 3LPEA 1HNVB 3W9HA 2GJFA 2GHWA 3S1TA 1N5YB 1RTHA 2ZM6F 1KQSR 1FKAF 2YKQA 4QIFA 2EPIA 3BGLA 4IRCA 2CRLA 3W2WB 3S01A 1EJ7L 1Q8KA 3IAS9 3U1NA 2JFKA 3CUNA 1NK6A 4PQUA 1DTQB 1SXLA 3MM7B 5B08A 1KRPA 2L9DA 2D74B 1WDDA 2P5VA 4J90A 2AQ4A 2Q79A 3EGNA 2HFVA 1S9FA 3EPIA 2E1RA 3I9V9 3KUGA 2ZH1A 5DQGA 4F67A
chains in the Genus database with same CATH topology
1C2PA 1Q82T 1R3NA 3KHHA 2YWGA 3E51A 1S10A 3G9CA 4I4BA 2VG5B 5F8IA 2DPIA 2B43A 3VTIA 2HGLA 2RT3A 4ZP9A 3TW0A 4I56A 2HYIB 5HROB 4OZLA 2I8EA 3WZ0A 4ES3A 3SCJE 3TUZC 3X3UA 4CT8A 4IR1A 4NXMF 1DURA 5IT9Y 2PC6A 2AYEA 2GQCA 4R0EA 2NR0A 4CH0S 1JLGB 2RQCA 1HWKA 2RRAA 1DFDA 2CJKA 2I5JB 4NOHA 1RT3A 1LK7A 3MM8B 4RNOA 2ZHAA 2N4DA 2E5LF 4O3QA 2UVWA 4DN0A 5AE2A 1UMJA 2JSXA 1C1CB 2FGOA 2QA4G 2XS7A 3LP0A 1TL1B 3DOKB 3QAEA 3ENVA 1GXLA 2X51A 3ZZUA 3KYLA 4DS4A 1F2GA 2B3TB 4QCLA 2Q6CA 4LF9F 4HHJA 2F7VA 1WF2A 1RI7A 1REVA 3HPOA 1VQ8S 1TK0A 4Y3CA 1RTDB 3CC7S 3IS9B 4ED8A 2IC3B 2MKIA 3FVYA 5KT3A 1NU4A 1TV6A 1NK0A 1TKZA 2ZFHA 2JH3A 2L9WA 3DC2A 1YVFA 1S1WB 5I42A 2XMMA 2DGTA 3M9MB 1ZETA 1HI0P 4F4XA 2ZZMA 2YNFA 2VB6A 4DPOA 3RB0A 5JVGQ 4GO7X 5C25B 5IZHA 2KI2A 1U47A 1HNIA 3DFEA 1P1LA 3GWCA 1U49A 1N36F 4Q5VA 4J9OA 2F3JA 4K4ZA 3ITHB 2NYIA 2ZH5A 3I5AA 1NK7A 2KZZA 2NUHA 3DLEB 4EBDA 3J7A1 3D1QA 3R1LA 2RF2A 2L08A 3TNVA 2PD1A 4A4JA 1TKDA 1WHWA 3KLGA 4A8WA 5HBMA 3F41A 3KLEA 1FRHA 2MKHA 2JEIA 1WACA 4PKDB 2WRMA 1T05B 2CJQA 2DCUB 2DGXA 3MWBA 3KMSA 3NWGA 1ELOA 1OQ6A 1X9MA 4B3SF 2GA7A 4FVCA 2B9XA 3T6JA 2W25A 1R8HA 4ALZA 4M5DB 1LV5A 3RAXA 3RW6A 3VAJA 1XNRF 2XZWA 2NXUA 2N3LA 1P6TA 3E2EA 3DLGA 3CCLS 1LQ9A 2PGCA 2OTJS 3CVKA 2DHAA 4F25A 2OPPA 3LANA 3OJSA 4A8SA 1TP7A 2LVWA 3H2LA 2CPEA 2KT5A 4DV6F 2PIIA 3GIKA 5F0WA 2XMJA 4ED5A 4DWIA 1FRLA 2DNOA 4RNFA 2KRBA 1FDBA 4NCAA 5L8RC 3JSBA 3ZZOA 4QBUA 2HW3A 4QYZJ 3QMQA 1I94F 3MM7A 1T02A 2EFGA 4E98A 1S9EA 4F8RA 1E6YB 2R7XA 5HQ8A 2CQ0A 1FVQA 4ITSA 1M5PC 3M2UB 4LVNP 5CCMA 3M30A 2UZAA 3KLHA 1TK5A 4C11B 2V0NA 3OXFA 4FS1A 1UVJA 3RU0A 4KPYA 1WHXA 3ZZTA 1MNEA 2XLKA 3U7JA 4QWDA 1XR6A 5HROA 2MKCA 4ZVGA 2FLPA 2FHKA 4K50A 4WFNQ 4H4OB 3AHPA 1VC6A 1SJ4P 3FMBA 3VALA 2XLIA 4FXWA 4U7CA 2DHGA 3VWSA 1MWZA 1K73T 2EW9A 1VMBA 3O6QA 5A2QY 2BE2A 1UJ5A 1FK9A 4JI7F 2HFNA 2M5YA 3NGKA 2BR0A 3M05A 1UJ6A 3DM2A 2PA8D 1C4AA 5J2MB 5KFKA 2DGSA 4C8OA 3NNAA 5L9NA 1C1CA 1KTVA 2ABYA 1W2IA 1SJ1A 2BANA 1XC9A 1QSLA 4H4KC 4ID8A 4RW9A 3T9ZA 3Q22A 2UXDF 1J5OB 4OJGA 1BWEA 1VQ5S 1QE1A 2FJDB 1C0UB 4ZVEA 4ZMMA 1VBZA 2RRNA 3UD4P 1FERA 4NLOA 3U1LA 1Q78A 4K4VA 3QLHB 3MEGB 3ISNC 1F5AA 4HTIA 2IA6A 2VKZG 4XO0A 3IGVA 2JC0A 1DTQA 2WBMA 2F4VF 3IBWA 1ZTWA 1SJRA 2B4OA 3TRGA 2VPXB 3RTVA 5KOWA 2CVEA 3OTDA 3KNAA 3KFWX 1S6OA 2VL1A 3GMGA 3R27A 4OI2A 4ILLA 1ZPVA 4HI1A 2FJWA 4B9LA 3VF0B 1IUJA 1N8RT 3DU6A 2ZNYA 1S6PB 2O5DA 3GB0A 5KG7A 2WONA 3O44A 2M88A 3CULA 5KFIA 3NCQA 3DHWC 5KFQA 4DL2A 3LWLA 2P9EA 1X7VA 2LXUA 4ZCLA 4ZOSA 4ZPCA 3K8VA 3PEHA 5IQQA 5J2QA 1FNMA 3M6VA 4NA2A 1R7IA 4WIIA 2RE1A 4ID5B 2C3YA 5A6WA 5G0RA 4OZ0A 5GAGU 2R2TA 4LSLA 1HQEA 1L3VA 2YKNB 2YX7A 4RW8A 4ZP8A 2J76E 2DHXA 4DL3A 4NZ0A 4GC6A 1SH2A 5KT6A 3OW2R 3B4DA 2APOA 3GFHA 2OMLA 4TNOA 2R8KA 3US5A 1HL6A 1WD6A 2D3UA 2XWYA 4R25A 3H40A 2RJZA 3M4XA 3F44A 4ED3A 1XBWA 4DQSA 2EG1A 2BA9A 2PSZA 1C1BB 3SFUA 3IO1A 3BF4A 3UQSA 2DISA 4H4KA 2VG5A 3ITHA 2KHDA 1U4BA 1S1WA 1VK3A 4DQQA 1VK8A 1NHVA 2AYMA 4G1PA 2DNYA 3FQLA 4NRUA 1RJJA 2L41A 4K4TA 4CZCA 2BACA 4USJC 2KB2A 2CQ4A 3IAM9 3S7RA 3CF5Q 4MK9A 2MSTA 5CD4H 3VAIA 3N01A 3NS6A 1MU2B 4I2PB 2IM0A 4OL8A 2PEHA 4ILMA 3MR6A 5M2UA 2B4VA 2IVMA 1WEYA 3G86A 4P7VA 1CQMA 4QR2A 4ZPBA 1R0AB 3EUNA 3KOAA 1KHVA 2XHWA 3LQVA 2HVHA 2EC0A 2UVRA 4KB7A 4V19J 4EO8A 2FJAB 3MGJA 2KXHA 1MWYA 2RQ4A 1ZAVA 3SCIE 3M9NB 4RUAA 4F4WA 2KFZA 2A2DA 4O4RA 3BN4A 5AJ3F 2D3OR 1N88A 1D9DA 4KJIA 2NLWA 1JMTA 2Q43A 1U1KA 5EWEA 2F9JA 2FC8A 2IMWP 2D9OA 3M2VB 4OI3A 4FBUA 3OR1B 3KK3B 1RYRA 5C42A 3IXQA 2M2BA 5LT5A 2PMZD 2YQ3A 3H59A 4YP3A 4ECUA 5CCLA 4RW9B 2FHJD 1J5OA 3I0SA 4RBTA 1TV6B 2U1AA 1WI6A 3VCDA 1R43A 2RF2B 5GADU 2C42A 2YX1A 1HA1A 2AP6A 4J9RA 1T94A 3TA1A 4UW2A 3KKFA 2RS2A 4LSNA 1LKZA 2VASA 4K5SA 2VODA 1Q1KA 1XR5A 2M8DB 4X4UA 3DXBA 1S6QB 5B0FA 3V6KA 1FE4A 3GV8B 1N6QB 2OJ3A 4W90B 4DV5F 2RS8A 3MMJA 5L1IA 2FLLA 2ZH2A 4DV2F 1BQMB 4LF7F 3P49B 2G4BA 4LF8F 5J1NA 3IG1A 3HLUA 1VHFA 3AB2B 4I0WA 4TLRA 1V3ZA 3MAHA 4DSIA 1S0OA 4WZMA 2EFQA 1S1VA 1GTEA 2LQBA 4Y65A 3DMJB 1G7CB 5DG7A 1U6BA 1VI7A 2HG4A 2K1RB 3SCLE 4Y2AA 2OSRA 3U1MA 5K8NA 2FTRA 1RT1B 2YVSA 3R3TA 2DNGA 1QTMA 2JC1A 3ISZA 4X2BA 1FT8A 1HQEB 1UP1A 2HWTA 4NPOA 3H5XA 3KG1A 4ZP6A 4BBYA 3QJPA 2IHR1 4C7QA 2P6TA 4MMOA 2ZH6A 1P27B 2B7CB 2EBEA 3IR5B 2V4QA 4I6AA 3G71S 1DZ5A 2VFUA 2FPHX 2BDPA 1HHTP 4L6V3 3CCTA 1TL4A 3PW5A 5T14A 4DV4F 1HWLA 1FXRA 1NK5A 3DRRA 4EU0A 3OTBA 3D2WA 2R7TA 1T03B 4CO2A 4ERDA 4MIAA 2LQJA 2JVOA 1U24A 1TQLA 2IAJA 2DK2A 5LMNF 3RR7A 2FY1A 1HW9A 3OTEA 1UEVA 3J80Y 2XG8A 4LUBA 4A8OA 4RW4A 4WYWA 4TU7A 1FVSA 2Q1LA 5BJRA 1EETA 1NJIT 2Q3PA 5J2NA 4CO3A 2M9KA 4N41A 1RA6A 1BGXT 4YY3F 4A8KA 2ZDPA 3HK2A 5CYMA 5BYRA 3BN7A 4CI0B 2DCLA 3V4IB 3L95X 3C8YA 3HZGA 4ZLPA 1ZPWX 4DV7F 3OXGA 4TN2A 2UU9F 3IGNA 3DLJA 2FLOA 2R7OA 5KG5A 1K8AT 5MLCV 5F0UA 1VRTB 4I68A 4N76A 4KO0A 2RH3A 3OVBA 2GW8A 1TR0A 3MUMP 4TKTA 4IDKA 5KT2A 4AL5A 3NP5A 2P6SA 3UE2A 2LA6A 1C1BA 3SEOA 2D41A 1UVIA 2CYYA 4R8UB 2NPIA 5J2QB 2RKIA 1N52B 3H98A 4U9RA 4QW8A 3EYZA 3H5UA 3PHEA 5DJBA 5D3GA 4WF9Q 3DRSB 3BJYA 2DNKA 2HNYB 3KLFA 1FJGF 2OKQA 2MB0B 3MM5A 2GHPA 3MEGA 1KFDA 4FNIA 5A8RA 5ITHA 1QVGR 5K14A 2WTFA 5JXSA 1RTJA 4EFAC 2E5GA 3A8EA 3VAGA 2PI5A 4KQZA 4CCHA 5KFGA 3RB6A 4NLQA 2WSEC 3RAQA 2W7AA 3Q2SC 2NSBA 4C98A 5E3QA 2KJWA 1OWXA 4A8MP 3OFFA 1D3WA 3MR3A 2R8HA 2HNDA 5ADZA 4R0JA 4WYLA 1B0TA 3M9OB 4RU2A 1SC6A 3IG1B 4ZPVR 4YB6A 2D3ZA 3BO2A 2CJ9A 4KGKA 1Z1ZA 5C24B 2MY8A 3QGPA 3MFHA 2YWEA 2E7XA 3DDKA 5M2RA 2HPUA 3Q8QB 5J2MA 3ENWA 3TARA 4KKOB 4A46A 5U47A 3FEYB 2KH9A 2WOMA 3KNGA 4EUVA 1FRIA 4I64A 3BSOA 2XMKA 2VKRA 3DRPB 2B5JA 1U25A 1RT2B 2A10A 2KHCA 3UCGA 3VQSA 1PC4A 5AE3A 3GYXB 3UR3C 4DBQA 3JSYA 3M6WA 3NGDA 3ETOA 3ICLA 4RBVA 4EEYA 2KDOA 3PW7A 2V9WA 3V81A 3U02A 2GX8A 4HTJA 4NLYA 3MEEB 1DBDA 2IJNA 1H2TZ 2MKKA 5C42B 2BUNA 4URGA 2K3IA 2DHSA 2CFXA 4HT5A 3CCMS 1D9AA 5A8WB 4DX8H 1DRZA 2HHWA 2E29A 3G8QA 1M0SA 4Y2CA 4ZPTR 4KV8B 1TKXA 1RYSA 4EBCA 4PWUA 5IT4A 2FJBB 3CSKA 1VIOA 3H5SA 4IG3A 1R31A 2XO7A 2MYFA 3OSNA 3ENQA 4K4WA 1JLEB 2UXBF 1RT7A 1ROFA 4DSLA 1Q7YT 3V6JA 4DDFA 1ZM3A 3MUTP 4NZ7A 4I6YA 4N8OA 4ID5A 5LSOA 4UQGA 2IM2A 4FVMA 4X4SA 3MPVA 1N34F 1NKBA 3MZIA 1X4AA 3NCRA 2YKNA 4ECRA 2CZ4A 2XNRA 3G6YA 2BVZA 5CH7B 1ULRA 1OIAA 1YJTA 2EFVA 3M6UA 2C3OA 4Y00A 1CC8A 2O67A 2RUGA 3M8PA 3KHLA 5I3QA 3K59A 1DARA 3Q0AA 3THTA 1VIXA 1GH8A 4U67Q 5DM6Q 2C22A 1ZAWA 5BR8F 1KQFB 1L3KA 4WZQA 1URRA 3T9NA 1T03A 3DLGB 3L7OA 5CXTA 2ZC3A 1B0PA 2JX2A 4DV0F 3DI6A 3A1YG 1S6UA 1KOOA 3V6DA 3CIMA 4R5PB 1FRXA 1Q8IA 2HNYA 2VG7B 2A3JA 4LT6A 1U48A 3QPIA 3BQ1A 1N32F 4LVOP 3JTOA 1SI9A 4ELUA 1YGYA 2DGQA 1KHWA 3I55S 2CQPA 1KLNA 5DGAA 2YNHA 1S1VB 4C4WA 3VAKA 1U26A 4I69A 1JXLA 4X4VA 4IFVA 1FD8A 4O3OA 4LQ3A 4WKRA 2EK6A 2FJVA 1PSDA 2DNRA 2KU7A 1H3DA 3SXLA 3OSPA 2C28A 2E1CA 3M2UA 1RT1A 2LEBA 3NNCA 1UFLA 3SMZA 5F9NA 2LECA 2KVIA 1D8YA 3KJVB 5HMYA 2G9OA 1CC7A 2J0WA 3FSXA 2GV1A 3N6NA 5D4PA 4O4GB 3DHXA 4A48A 3WBZA 2W9AA 2O3DA 4NWBA 5CYQA 3H2VE 3THVA 1WNEA 4OLPA 2JFDA 5I3PA 3G96A 1MW7A 4FPRA 3ZFVA 4ICLA 4R8UA 3K5MA 4O3SA 2POKA 4XAKA 3MM9B 3R1HA 2FJXA 3WC2A 1WTBA 4Y2MA 4TYAA 4WK1A 5LJ5Y 1UJ4A 4ZP7A 2ZOMA 4GO5X 1QLNA 1FK9B 2IYIA 4DR3F 2W8KA 1O51A 2AU0A 1FNXH 3DGPA 1Y0HA 2UUCF 3MFIA 1RT2A 3HI9A 2YH1A 5FIIA 3CJKA 3HVRA 2OPQA 3UCUP 2XWXA 1X5SA 3HHNB 1SV5B 1NRKA 1ZYQA 2RILA 4DN9A 1F5CA 3NMRA 1RP5A 1Q8BA 3CIZA 1WWHA 2ASDA 3DLKB 1TKTA 1UVNA 5KG1A 2PO4A 2YKMA 4C2MA 5J1EB 3OHBA 1S48A 4QWAA 4ED6A 3RBDA 2XI3A 2NQPA 2L48A 4N77A 2KTQA 4PG5A 1U1QA 1HBMA 1NJXA 2IRUA 2E5HA 4ECYA 1TKXB 3OFGA 4BC9A 1XMQF 2V9KA 1M5OC 1OSCA 1IN0A 3PO4A 5C24A 4J9PA 1Q16B 1Y4ZB 1OSDA 1U6FA 3LP2A 1K1QA 3MMBB 1SKSA 1SKRA 3P6YC 5CA5A 3DMJA 1KSPA 3CE8A 1TVRB 2HNZA 3D1OA 3SFGA 5KT7A 3PACA 5K5MA 1BY9A 4HVZA 4TQRA 3TUJC 2KFNA 2OTLS 3P5TL 1JLFA 2AX1A 4Q2LA 5IM0A 3C2PA 3G6VA 1LXNA 1SJQA 1L5UA 5A0YA 2QA1A 1FDNA 4OHWA 2DNMA 3W2WA 1PO6A 3PR4A 2JVRA 1IQTA 3VAFA 2KRRA 3KLIB 1N5VA 2V2KA 3LW5C 3CDEA 1TL3A 2MJUA 1H2VZ 1YJRA 3C6TA 3TR5A 2E9ZA 3BGUA 1NJZA 3HHLA 3T5LA 3M1VA 4YMEA 1X4EA 1LFPA 5C25A