3ZZQA

Engineered 12-subunit bacillus subtilis trp rna-binding attenuation protein (trap)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'SDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGEALIQTAYGEMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ATTENUATION PROTEIN MTRB
publication title How to Change the Oligomeric State of a Circular Protein Assembly: Switch from 11-Subunit to 12-Subunit Trap Suggests a General Mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 3zzqA00
5EEVA 1WAPA 2ZP9A 3ZZSA 3ZZQA 2ZD0A 5EEXA 2EXSA 5EF1A 2ZP8A 3ZZLA 1GTNA 2EXTA 1QAWA 5EEZA 1C9SA 3ZTEA 5EF2A 5EEWA 5EF3A 5EEYA 5EEUA 5EF0A 1UTDA 1GTFA 2ZCZA 3AQDA 4B27A
chains in the Genus database with same CATH superfamily
2BHUA 3E80A 1ZS8B 3L5HA 4Z7OF 2P5EA 4E9RA 1FFPB 2OMNA 4MMZA 1AAJA 1A7QL 3RUGE 2VXUL 2AANA 4DN4L 2Q2LA 3VXPB 3GRWL 5C8JB 3X1FA 3FO0H 3O6FA 3ARWA 3HE7D 2A6JB 4RNRB 5EBMA 1USQA 1V10A 5CP3A 5L2KD 2EUXA 3BJ91 1WCQA 4ZYKA 1SJMA 4JN2A 3MZTA 2PTTA 2VTFA 4HW6A 4M1GL 4EIZC 3FT1A 4XB3A 3JV4A 3ZTCC 2UUDH 1G7LA 2XACC 3B9EA 3JV0A 2KQNA 1OF0A 4PRHE 4PRAB 3U36B 2YRBA 1ZSDB 2CE6A 1D2OA 4X7EC 5DHEA 1ZAGA 3R06B 3AU0A 1YO4A 2IAMD 3G6DH 5L2JB 4JDEB 1Z3GH 1WO2A 1UA3A 5B3JE 1NL0L 1UOWA 3EYSH 5I71C 4JRYD 3ULUD 2Y07L 4GAYB 5DDHB 1OQXA 1AYRA 1Q94B 2YAOA 3NCCB 4LFHD 5KYYB 1MCWM 3LY6A 1SHXA 4F8NA 1QR1A 2C3VB 2G2PA 1ZLWK 3N1FC 4L3EE 2WZAA 3K6DA 3FB8A 2CXGA 4Z1PA 3ZMNA 4XRCA 3CCHA 3DHPA 4M1DL 5DUPL 4AYDC 1YEJL 1EWHA 2QPDB 2W5PA 3AXLA 1ED3B 1UB6B 1HHKB 4WWID 4JVPA 4KK5C 3WY2A 4DKEH 1CDHA 3TBWA 1O7VA 2GCYB 2X0WA 3GTTA 3OXRB 1NFDA 4LVNC 2JK5B 3C6LC 4BSVB 4AGLA 5F7FA 4GG6A 2UWEB 4I18B 3U6RB 5TDOA 3BUIA 5JW5B 4JHZA 2VN5A 3OPZH 2ITDA 3HMWH 2Q5BA 4C56B 5BVPL 3EJYD 2HFEB 3ZE2F 3CLWA 4WEMB 3IDYC 2JKSA 3RX7A 2YD9A 4WEBH 3L3OC 2D4FA 4WTZA 4XO3A 1D6EA 4D8OA 3VGEA 2YSSB 4KI5E 5ISZA 3EO9L 3G08B 2BVQB 4JRXA 1QSEB 2JELL 1GZPB 2XPGB 2O1AA 4IK7A 3BWUF 4HF5L 4IRSC 3EO1B 2AK4E 3N85H 1PGRB 3ZIYA 3GHBL 2BP3A 3LIUA 5DJDB 2BNQE 5DJXB 2Z92A 4CW1B 4ZAKB 5DJ0B 4WKZB 5JLZB 1MJ8H 1BVNP 4G6FB 3GMPB 5CEZH 3L9BA 1H3WM 1XH1A 1WP6A 4LAQH 3CHOA 5F7BA 5GISL 3ARUA 2XKNA 4KFZC 1OCCB 3FO2B 4LEXL 3VB9A 2ZXDA 2WY3B 1E9QB 1I3VA 4LPXA 2DI8A 5CJOL 4JCMA 2BM3A 1NCAH 3OVUB 4KVCH 1TJHL 3BT0A 5I0VA 3TA3A 4IOIB 4NCC1 4XWGL 3BZEA 4W93A 4IJ3B 3SKOB 4A7SA 4JLRA 3MJ9A 4ELKA 3C12A 4IRJC 4M4PA 4WSKA 5JR1L 1WCBA 1JI1A 5IHWA 1FL3B 3EHBB 2I24N 3MQIA 1MCHA 4NZRL 2JQZA 4WEEA 5IV2A 4HPHA 2PN5A 4NDMB 1OXYA 1NKGA 1LILA 2GIMA 4PLOB 4R7VA 3MNMA 4ZXBD 4G8FB 3STLB 4BFRA 1L9QA 3T0ED 2ZYHA 1UH3A 4KROB 5I1AB 4FG2A 4PJIA 3MVSA 1FYTB 3OMIB 3UAAA 4PSRA 1DCLA 3K4ZA 7FABL 3QUZC 2OI9B 3CFCH 5J6GA 2B2XH 3QORB 3CN2A 3QUYC 2DTML 1S9XA 4JKPL 3MRDB 2VLKB 1U8PA 4KTDH 3FBKA 5DSCB 5I1JH 1Z9NA 4EDXB 2F1AA 2BC4B 2QQLH 2VC2B 2Y3NA 4FQCL 4XC3L 5DRZA 1PZ5B 4BH8A 2XV2A 3H1ZA 5I6XB 2BNRB 1T1WA 3H9YA 4G8GA 5C0BE 3DX3A 4QTHA 3SY0B 3GM0A 4GBXC 2Y36H 1KF9B 4YZFE 4HJ1A 1AXSB 3P4OB 1CTMA 4OJDH 5I6KA 4BINA 3KPOB 4UI2A 1QLRA 2EDBA 5T1JA 4Z7WE 1XGQB 1XGTB 3GRBA 3TJEH 1J5OH 4ABQA 3QPXH 2A77L 3WFHB 4G43B 5MEPB 3RGHA 3QDMB 1NANH 1YN6B 2BK8A 4AV5A 2Q0ZX 3D8MA 3H53A 1U8HB 2GBUA 2WWMD 1KBPA 4E42B 5HJ3B 4HUCA 4OBRA 5CSZA 1DL7L 1JTPA 2FYYA 4OCWL 4YUEH 3TA4D 3OLDA 2Y7SA 3BGFC 1LDSA 3FSVA 2ZUWA 1KLGA 4P46B 2NY1C 1VADA 4FQJL 1AG6A 4TVPE 1Q9WA 3BQUD 4JG9A 1CICC 1EAQA 1T1ZA 2OJZL 3ARVA 3ZZ1A 4JFDD 5KVEL 1H8OA 2ESVD 3HAEG 5DQDL 2HVBA 1B0WA 2ZNXA 2KZBA 5DMJB 4NJ9L 3FFDA 2FUTA 3BAIA 1NFDF 3KBPA 1PFOA 1AY1L 3V0FA 5E5UB 4OLZH 3OQ3B 2WZ5A 1XBDA 3II3A 3D4CA 2EIKB 4G80A 5DRXB 2VJXA 2CKBB 2BSTB 4BD4A 1MCPH 1Q8MA 1RUMH 5LAXA 2D31A 3FQWB 3OAWA 2PR9A 2PUQT 4MCZB 1Z5LB 3NVQA 1L9RA 3A4EA 2EH8L 2A0LD 1ZLEA 3ECUA 5J56B 1AGCA 1CVRA 3QPKA 4A6YB 4OW6A 1G6RL 2VL5B 1MVUB 1DVTA 1T83C 3TWCH 2QQKL 2FJSA 4LOUC 3D39E 3MUZ1 3QJQB 5EC2A 32C2B 2APTA 2XIDA 4NQQA 3DX6A 4Z7AA 1ACYH 4U3SB 3ZQXA 3DSNB 1R5IB 3P0YH 1UA7A 3QQ4A 3S8GB 4C58B 3FU5A 5E2UL 4P2OB 2FBJH 1YJDH 2OTUB 2EIZA 2GJ6B 5C71A 3FT0A 3GSWB 3DX7A 5DUBA 4DIXA 1IVLA 1U8NA 5D5MA 2E27H 3A6BL 1RZJC 2GEEA 4TQ8A 3WCYA 1OK8A 3D4GA 3X3FH 4M6AA 5DC0A 2V7NA 3DX9B 2KC0A 3U2JA 2R8SL 1PX3A 2ZP8A 4NHUB 2D3JA 4LDCA 4TUOB 6PAZA 1S7UA 4XPGL 3LKPB 3RHWF 4EN3A 4AKQA 2L7EA 4K3GA 2OZ4A 1R1CA 2PYFA 1G1YA 3QCUH 5D2NC 4IBVA 4L9DA 4NWUH 4PP2A 4L5FH 4F7MA 4IBTA 4X8XA 2QTEA 4K3HA 2C7UB 2RQEA 2K4WA 2W91A 3TZVD 3CN0A 1Y1DA 3TN0C 3IWUA 5IVOA 4PJ5B 3HLAB 5C0CE 4OZIA 1E9OB 1KENH 1RFDL 4J3TA 1EK3A 2EIDA 4AL8C 1NMBH 4PJEB 3DMMA 3NIDB 4Q7DA 3NEXA 5ACLA 3MLTB 5IROC 4HBQA 1DLFL 2WIIB 1NUNB 1RVFH 4PJIF 2P46B 1AYOA 3EDEA 3N1MC 3UTSD 2JJVA 4DP5X 2XN1A 4E9XA 1UWEL 1IBYA 2XRAL 4YS4A 4MA3B 1Q38A 2VMJA 4DEPB 1BMGA 5SV4A 2NY4D 2EC9T 1FNEB 3BSHA 3GMNB 3WN5B 1G9NC 3OTTA 2Q20A 3IMTA 4LU5L 1CFNA 3S5YA 5FB8A 1TZHB 3HRZC 3PDOB 5IQ7L 2I60H 2YK1L 3E2HB 1CTOA 4UAHA 1DVUA 2EYTA 1TMCB 3RKDD 1MG3C 4KC3B 1P5UC 4IBZA 2OCJA 2OR8A 3HS0A 4JNXA 2KKQA 4G3YH 4G8EB 3F7RA 3LKQB 4EI0A 3IFOB 3MX0B 4QCIA 3SDCB 2HFGH 4LPWA 4FXKA 3H85A 3MOAH 1IFGA 1PZDA 4A7GA 4OCLC 2W1NA 2A38A 2I85A 5KS9B 5H2BA 1FNHA 3P3RA 3C5SB 4L5FE 1AGBA 4XP6H 3SZ6A 3K7UA 3AMLA 3R4RA 2VABA 3O2VL 4IGBB 2Y2WA 3DUUB 4Q9RH 2AJVH 4JO2L 4WU5A 4MYPA 1OY3B 1NGPH 1NINA 1X5AA 3WNJA 3LIZA 1RJYA 4JFOA 2CDEA 4RIRB 3TV3L 1IEHA 1IKNC 4A2DA 3S5LA 4JCLA 3C08H 2KDYA 1CT8B 2V5MA 3B2MA 5JOPD 2X09A 1UOLA 1QWUA 2BVUA 2UX6A 4JY5H 1V3MA 2LU5A 4JZJB 3BWUC 5DJ6A 3TIDB 2XVLA 1BVOA 2FX8H 2LW3A 1EJ8A 3NJVA 4QHUA 2B1AH 3B1UA 1ICTA 4E41A 1TVDA 1U36A 2DAVA 1TMQA 2A6IB 3H3PH 1T2XA 5D96C 3IGUA 5GQBA 2YZ8A 4WJG3 1BZ8A 4ANXA 4OI8A 2AK4B 4LRNL 4IIZA 4PTUB 1OM3H 1TETH 1PJWA 1T5WA 2BNQB 1GMEA 5JQIB 4XVUC 4KTYA 1ZVYA 1MUJA 2MPAL 4XI5D 4AEIL 4RGND 3VYNA 4KDVA 4JFEE 3L5XH 1A3LL 3BD5A 4NQXB 4HIJB 3NGBB 4EI6B 3JTBA 4LCUA 5D5MF 3IMRA 3LZRA 2OK0H 4LRIC 4V1DA 1EZSA 1X3DA 4NUPA 2YXMA 4R4FL 2MOVA 3H2QA 5KJ4A 4OUUA 2FSEA 3DVNB 4HWBL 1YPZE 1HOCB 1QABA 3BKML 2JJTA 4IEFB 3T3MB 1S5HA 3JUYA 3OR7B 4XR8C 2FO8A 5BUPA 1CGSH 4CSPA 4Z7VA 3INUH 2XKUA 1JNJA 1XIWC 5I19L 1TJGL 4QJ3B 1WVZA 4DK5A 4PJ8C 3DGGB 4LK4A 5CJBA 3T09A 4Y1AD 1HXYB 5EZJA 1UJ3B 1BFTA 1D9KD 4Y4HA 5K5YA 4NSKA 1ODAA 2VOTA 5JA8B 3O6LL 4OZIF 1XGUA 1GYCA 1CPUA 1DQDL 4XMLL 4HV8B 4MMZC 3QUGA 5JORB 1WBZB 4DP8X 1FL6B 3FRUB 1J8HA 3DDGA 1JF5A 3FK3A 4NP4H 5EIIB 3SCMB 1MSPA 3OWRA 3QJUB 5F7UA 5IEKB 1DVFC 4AQ8C 1G7MA 4P4KA 4Y5VC 1ZK5A 2C9RA 3NCWA 3K91A 1KELL 4H25B 3SPGA 3OAZH 2P5WB 2X1XR 3CN4A 3O6FC 3AABA 4GQ9H 5CJXC 5LCVL 5JPMB 1DFXA 2V3EA 4JFXB 3MKGA 2B5IB 3RX8A 4BRJA 2HG0A 1A6AA 1DSFL 4JO3H 3QDJE 3SO3C 4HC1L 4O02H 4PJXA 3RIFF 3A4FA 3L16A 3TP4A 4NN7C 2GBTA 1KWGA 1M6UA 1I8KB 3ZK0A 3N42B 3B3IB 1G1OA 3MV9E 4IIQC 2O5XH 3WELA 1DEEA 2XIIA 1I7TB 5AQ0A 4HG4J 1L9OA 3J8F7 1T89A 1LTXA 2XBZA 3SBRA 2WNGA 1CG9B 1TLMA 1KTLB 1NOAA 2DF3A 1ZV2A 1AD0A 3WUWA 4G9FA 4NC0B 3MLXL 1IL1A 5T5FA 4KU1A 3LRKA 4N90D 5IJVB 2J1YA 4XH2A 1EJOL 1NH6A 2WAQA 2VR4A 2L7UA 3F00A 4FQHB 2XKSA 1NUDA 3B6SB 2PKDA 3HZVB 2O93L 2N56A 4QHMA 1QI4A 1MRFH 1RZJL 2R29H 1HQRA 2DL9A 2MCMA 1OZUA 4A7GF 4F7CB 1BQHG 4JGMA 4WK4B 4J12A 4PMEA 1ZDSA 5ITFB 1RSYA 3DRTB 5D1XD 1SYSB 1IVTA 2P80D 4ODXB 1GOFA 3AQDA 3AFLA 3UTTD 3SBWC 2H9GA 4U3HA 3BH9A 1NEZA 4P0DA 4BSJA 4YK4C 5B39B 1YEKH 3BP6A 4C55A 4TLSA 4ZX5A 3NJMA 1SJEA 1DUZA 2DQEH 3OX8A 1LYQA 2GYSA 5I6NA 1F97A 2QELA 1E65A 2SEBA 4JHAL 4DP4X 1UM6L 1QWNA 4LDLB 4C4KT 2JCWA 4H20L 3TFBA 1UKSA 1OSYA 4PR5B 1XH3A 2GFBB 2YPLD 1EMTL 1JNLL 4AL8L 1RULL 4EDWL 1TSHA 1EHNA 4OBSA 4KK6D 4I0KA 4LSQH 1SY6A 5IVXB 2AEQL 3GO1L 4XNUL 4DTGH 2VDKL 2P24A 4O2CB 2W9DL 2WK2A 2NW3A 3ZSTA 3QEUA 1YECL 4OIIH 3TVMB 2O5ZL 4RMUA 4PJ9D 5HGDB 1RSFA 4MNGE 4HEME 3C5ZD 1A9VA 3OBAA 3CFUA 1CFVL 2ROYA 5AEAA 3DIFA 1F1DA 3K0WA 4J3SA 4X7SH 5CEXB 1JHTB 1RIHH 4LP4A 1NJ9A 3EYOA 1A14H 3O0RL 2VMDA 3K0YA 3UO1H 3F7KA 5IHHA 2DTSA 2Z1PA 4KKPA 4LVOB 4MDIA 3MRGA 5AKTA 1SN0A 2NNRA 4NPJA 1J8KA 1QHQA 4AV0A 4PW3A 1G9NL 1AOZA 2L3BA 1DR9A 4KDWA 3KVQA 4LCIH 5BMFH 2ICWI 3RDTD 2FEEL 4Z3HA 5B8CB 4G7SB 4JB9H 4PG9B 4UV4L 3IXTA 3MRJA 5FWRA 3T4AC 1XGRA 1FGVL 2IG2H 4DVRH 2NSQA 1Q72H 2W9EL 4F58H 4CILA 4BA0A 5CBEB 1YYMH 2COQA 1IFHL 4UBDD 3QRGL 5M95B 1GJIA 1KY7A 5EU5B 3ZE1E 35C8H 5C0CB 1C08A 4MNQA 2IPUK 3B2XA 1ETA1 2E7CA 2HT4D 3SDAB 1GZHA 4OAWA 5C08A 4R96B 4MAYB 1EO8L 2FQFA 4WW1B 2EO1A 1QYGL 4J6RL 6FABH 4NHCL 2DOCA 3GSQB 3C60B 3CAFA 1A7OL 5KAQG 3SKUD 5B1AB 5EO1B 1KCSL 4A39A 2YBRA 1YMME 4LFHG 1CXKA 2J44A 3O6MH 43C9B 2OR9L 4IKIA 3VXME 3NAAL 3T04D 2ZE0A 5D7SH 3VFPB 2X6CA 3ZKXB 1OSPL 4ODBD 3GK8H 4MJ6B 4KMTL 5JW4N 4JJ5B 1OGTB 5EBWA 1WFIA 4QJ4B 1NAMB 3MRLB 1DQQB 1PTZA 1W9XA 3AREB 5F7KC 1BXVA 1QVOB 2OJEB 3V9EA 5AWNL 2Y0SA 1YSOA 3MLVL 3BIAX 3GSOA 4RDBA 3FT3A 1L7TH 5EORH 3TJHC 1UWGH 2BSSB 1QLEL 4KQ3L 4B9PA 1S3RA 4KGJA 4PRDB 1QRND 4EOWL 4TTDD 2HJLB 3KJ4C 2A1WH 3FCUB 1I1FB 1UURA 5DF0A 4HDIA 3TT3H 3U46B 4KAQH 4TF4A 4XNYL 2OL3A 3MRCB 3SDYL 1XL6A 1PMYA 1Q4NX 1PIFA 2B4CC 4M7KH 2WKLA 4FYRA 3IDNA 4Z0BL 4M3KB 4WDIA 4CNIB 4CN1A 1CD8A 1ECYA 3UTQB 3KHOA 4MQSB 3D25B 4G5AA 4Q9QL 3MUY1 3NACH 4KK5D 1BZQK 2OMVA 1T20A 1MPAL 3C6LD 4YSEA 3QJTB 1UC6A 3VXNA 5LN8A 2UYLA 1CZ8H 5E95B 2G30A 3HC2A 1WISA 3A47A 3LV3A 2D2CC 3V55A 2VZUA 2V3FA 3GPEA 1HDMB 3PL6A 1CO1A 3HG3A 2FB4H 4PRPE 1KIUB 2IPTL 1TVHA 3F05A 3L9RA 3CVHL 4IRSD 3DK0A 4WGVB 3WEOA 2VDRL 1ONQB 3L3DA 4OU3A 1UUNA 3ZUNC 3LRGA 2WANA 1HAWA 4ONHA 2OW7A 3BSGA 3DK2A 5B1BB 4Z7NB 3ABGA 2IF7A 3LRHA 5CM1A 1OB0A 3KW7A 2FZ3A 5CZXC 1DJWA 4HG4K 1JXJA 3KMDA 3ZO9A 3T4YA 2X4QA 5EOCH 3CU7A 4NO3B 4HBCH 5IB4A 1AQ8A 4DP0X 4EO5A 2LV4A 2F54A 3J2PA 5DO2C 1Q0EA 2GY7B 4RFEA 4EN3C 1N10A 3DDFA 4U0RC 1U8QB 4NKOA 2APWA 3ZN6A 1E8WA 3MMEA 4L3AA 2IVFC 2VLLB 3BIBX 4NOFA 2K9UA 4BDVA 4QI3A 1G9MH 4IRJD 1LP9E 2N7AA 4FEMA 3FQRB 5KG9B 1N0LA 1UZ8A 4ICWA 2M2DA 4M7LT 1JFHA 1GGYA 4R2GB 4NPYB 1LEGB 4FTVA 2QGBA 1OAZL 1IBHA 2AXHA 3ULSB 2VITA 2IADB 3OC8A 2A9AA 1PF3A 2A99A 4RGOH 1KJ3L 1U92A 4NZUH 3FS9A 4X5LA 4JFZH 2VWEC 3JYCA 1B0GA 1YEGL 4PCSA 3IS0X 3N44F 5DMGC 1I7RB 4YE4L 4F7PA 1FCCA 4Y5YB 3EH2A 4WI7A 1T2QL 3QUZD 3DIDA 3EJJX 2O5YH 3HG1D 4J3XA 5FKAB 3VH8G 2VXVH 1NBVH 2EEFA 2EEXA 2WMPB 4M3JA 2QADC 4LXFA 5ID1A 2E6PA 2GSMB 3QFDA 3QUYD 1ZLSH 3BP7B 4A67A 2BS8A 1RAMA 3O9WA 4BFFA 2K3HA 3QC6X 4LNRB 4FP8H 4P2CG 4U1SB 1T1XA 1ZD6A 5AZ2L 1IQDA 4YIQB 1YMHB 3RILA 4PW4A 4ZFGL 1BREA 3QNYA 3VFOB 3P4MA 2DIJA 3QDJB 4YSSA 3P4NB 3MXVL 1A2YB 3IN2A 1H6EA 3TBTB 3CHQA 4NRYB 1PLGH 3CDZB 3K6IA 4GLRH 4B6ZA 1RJCA 4DP1X 5JHDE 5EUKA 5GGSA 4IHBA 3DX4A 5FGBC 4FL4B 1L0XA 1D5MB 3PWJA 3QB7C 3CFQA 1G5GA 4HEPA 4I87A 1ETZB 2GBVA 4JFTA 4KNTA 4AVIA 1EZVX 1TFHA 4WTXA 1KJ2L 4HSAC 3IU4L 1QA9A 1JZJA 2H32H 1DJYA 1E4XL 4HCFA 5IQ9B 2E7LA 3QS3A 2IANA 5E4EC 3SY6A 2EE6A 1P4LB 3BKJH 2NY1D 3P0VL 5EEVA 2UVFA 2ORBL 3MV8D 1CICD 4JUTA 1OTSC 4Y9EA 1KGCE 4MJ2A 1FHNA 3HUJE 2KMWA 2WD0A 3BUTA 1FV1A 2ZXAA 4HS3B 2YGPA 4H0HB 5IKCA 3UTZA 3MA7A 1G7IB 5I1IL 3VFGL 4Y4KB 3NSJA 5I75C 2YN3A 1HK6A 3CDGA 4O58H 2OXGB 4CC4C 3MCLH 4EUPH 4N6RB 4WK0B 3RZCC 1R5VA 2EDOA 1BEXA 1YYLH 4JAMA 4GW5B 5E51A 4B95C 2AHIA 4OB5H 1AQKL 4H5SB 4XP5L 4MD5A 1C7TA 4KVNH 3VRIB 4JPIB 1X9LA 1UB6A 4OD2A 5D72L 3ARBC 1WS8A 4DCQA 4UQEA 3V4PL 3GM8A 4M4RA 4YXLH 2BP0B 2DS4A 4LOUD 3TYFA 4YWGH 2EE3A 1NGYA 2HKFL 3GGWB 3VWJB 2ZCLL 4NYLA 1T0NA 3VXSB 4G6MH 2GIYA 2X4OA 2OMXA 2EILB 3NA9H 2AQRA 4ISVB 3LEXB 5D7IF 1BQLL 3VJ6A 4ZW6A 1S8DB 1N8ZA 2WXPA 4PRIE 4JM2C 1I1AB 3VMOA 4RAHA 1Z9OA 3IU3B 4ORGA 1XB8A 2AJXH 3ARDA 3OJ2C 5I1KL 4JFQA 2NZ9C 1NM9A 4CW1A 1HU8A 3NFSH 1CLYL 3VX1A 4HGWA 2JJTC 4NC1C 1GGBL 2Z4QA 4FQIH 5CSBA 2DLIA 4UQ2A 4LE8A 4TNVK 5C07D 1NA8A 4AG4L 5GIRA 4D9QD 4NRZA 4Z18A 5FYKU 5F7DA 3QEQE 5D1QB 1ZLUH 4YHKH 1AIFA 4RH4A 3TN0D 1AJ7H 1PD6A 4AEEA 5IFAH 2F0CA 2Y7MA 4JFYA 5FOJA 5TH2B 4M93C 1H6TA 2B39A 3SQBA 5E56A 4GKSB 4KK8C 3OGCB 3LKSA 2B4CL 3SE3A 3EAKA 1UHVA 4LMQI 3QWOA 2DH3A 4NQCB 3HAEB 3ZE1B 1BEYL 5IROD 1MCWW 3KPRA 4L8SB 1CI5A 3GI9H 2YAMA 4FF9A 5TD4A 3Q9PA 3RB5A 4MMXB 3D2UB 5F89B 5FW6A 2F7IA 4R97B 2ENQA 2F5AH 43CAA 1N3NB 5DVLA 4PJCE 2HH0L 4JJHA 1DBMH 1JPFA 1YN7A 4HIXH 4GSRA 3WXVL 2EUVA 2NQDA 3AQXA 3H4FA 1ZANL 5IGXL 2ETWA 3FB5B 4LBEA 4UNVA 1JFQH 1WFTA 4XNDA 1I8IA 2FJFB 4PREB 5IBLC 4EJ1C 5J13B 4WW2A 3ZDYF 4OZHF 3BVUA 5TE4L 3BCFA 2QVMA 1T89C 3MTRA 4U1HB 3REWB 2ICCA 4DO5A 4G7YL 5FF6B 2X42A 1V7MH 3L1GA 3MRDA 4O4YH 2A6DB 5C9JA 4BGDA 1J1PH 4PP1C 1PG7L 2G75B 4JZNB 1XXDC 4HVBA 5JW3H 1NWPA 1P7QB 4WENB 2D3NA 3RIFK 4Z77A 1J1OL 2H1PL 1Y0LA 1J5HA 2Z65C 1FE8H 4X9YA 5FYKH 4ZFZB 4PJGB 1WLHA 3EJPA 4UIMB 4ICXA 3VU2A 2UZXB 3FQ4A 4P3WA 3HMXA 1PSKH 2X89D 3FAWA 2H5UA 1TTBA 2H47C 3FPYA 4X6BB 1JTTA 4AC2A 1G87A 3DROA 1FUNA 1U8CA 1UA6H 3CVIH 4FRWA 3MACH 2OZ4L 3KPSA 3CFEB 3O4LD 3VXOA 2P26A 1B4JH 1GIGL 2EE2A 4AH2A 5EF0A 4C83A 3MRHB 5F44A 5L2KE 2VLJD 5HJ3A 4CSSA 2PYEB 2G60H 3GZPA 4NQDB 4QO1A 4WUKH 3TNNA 3JWNG 4D0DA 3BH8A 3D34A 2L7JA 1T3FA 2X70A 2J57A 4IQHA 1RURH 3GSNA 4QRPA 4GOSA 2DM2A 3S2CA 1DQJA 2J88H 4W4OA 1J0YA 5IEHA 2GJRA 5ECJE 4JRYE 4PRPB 5KYXB 3ULUE 4GAGL 3D06A 1AHWA 3P40A 2Z31A 2OLDA 4AYFA 4MJID 3TO4C 4OFKA 5GZNA 4FG0A 2C4XA 4GW4A 5CCHE 3V6OC 1GJUA 4XVUD 4WI0A 4ZW5A 3G5ZA 4QNPF 4W9KC 2VC2H 3MJ8B 3SJVB 1HI6A 4UOQA 5CWSA 2E47A 1NANI 1KCKA 5LN4A 1FVCB 2W92A 3GSUB 1JPGB 3AG1B 4PJ7A 2Q76B 4XC1H 1LK3H 1KZYA 2XWXA 1OT4A 1JZ5A 5A2IH 1NFAA 3F7YA 1NEUA 4ZQTA 4JDTH 5C0GB 1IGJA 3DPBA 4GKLA 5EO9B 4K8RC 3IPEA 1G7QB 4XNXH 3IDMB 5CS7A 1PG7X 4UIKL 3ZQ9A 2FGWH 5C6TH 4POYA 2DB8A 3WSQL 4E5XA 1AGDB 5EG6C 1QFUH 2WTRA 3ABKB 1DJHA 25C8H 1NCBH 5HGAB 3V0IA 3H9HB 1XIWD 4JDVA 1JGLL 3CZUB 3ZYOA 1QO3B 3CC1A 3PGCA 3UPCA 4PJ8D 2ADGA 3N3EA 2FWSA 4B9GA 1IM9A 5FK9B 3L3HA 2J3SA 4ZOEA 5CZVL 3UXFA 5BCAA 1JGUL 2P5ED 4TNEA 4KPHL 3JV6B 3VVWA 2ADIB 3C6SB 3QZWG 2YS4A 3GJFB 4BQ9A 4EXKA 2C3WA 3LIZL 1DVFD 4X0KA 4WWKB 4D0BB 4X5RA 4L4TB 3GMMB 3L4WA 1QHPA 3QXTA 3V0JA 1I9RL 4XN7A 1CMOA 3O6FD 2Y1AA 1EDQA 4UT9A 2ZKMX 2CKBH 4KNUA 2HJKA 3FC8A 1TENA 4QWWC 2NQCA 1IAOA 4LO9A 4Q9CA 3K80A 1EX0A 3DSFH 1KGIA 3QJZA 5H37H 4BKLB 3VI3F 5IFHL 1E0OB 1M71A 4HKBA 1UUSA 4A6YH 1HOEA 3M17B 1EXHA 3MLTA 3P1VA 1XF5A 3F7LA 3KLAB 4I77H 3QHZL 4PJHB 2PTVA 3OB0H 2IWKA 3CSGA 2PWHA 4BZ1H 4WW2F 2CDGA 2ZWSA 3RUGA 4P23B 1BOYA 2QFRA 5KVMC 2YQGA 4KH2A 1O7DC 4U1MB 5JHDB 3O8XC 2V5RA 1AS6A 4YHOL 4IBLT 2ZSWB 3BSZH 4RA3A 4HUMB 4CGUB 4Q97A 3QQNA 3JQOB 3LH2L 5HI3C 3RNQB 3QNZA 3T0EE 2XPYA 4YHLH 5J9PB 3VSTA 4PRHA 4CKQA 2A7BA 1HH6B 5FW7A 3C5JA 2XZZA 1H3PL 3G5VB 3V0VB 2XWTA 4KJYA 1M9WA 3FF7A 4X83A 1RIUL 2ZUQB 5K9QI 1ZHKB 1N5AA 2ITCA 3MX0A 1NBZB 1S3KL 4JHUA 3B7RL 1B6UA 1X5XA 3UG4A 3ML9A 2OMWA 5HI5C 3TIEA 1M4KA 3JZ7A 1FORL 3BVXA 1NC4A 5E6IA 4OT1H 4OCRL 5TE6L 3IE4A 3ATFA 3LPPA 1FVDA 4XPBH 5IQNA 1NBYA 4KY2A 3IDIB 4GYBA 2Y5TB 3SE9H 5ISZD 4XVTL 2VUOA 1N8OE 4L3EA 3UTOA 4HULB 5ADPL 1KY6A 2XYBA 4HETA 3CK0H 4RLDA 4UUJB 1OAJA 5E8EB 1ZT4B 3NSXA 3KD4A 2Y06L 2CO3A 2OS7A 3ZYJA 4DK3A 3MLYL 4Y19A 5FA4A 3Q6FB 5I8CA 3W9DA 2XA8L 2V9UA 1WWBX 4MAZA 3BE1L 2D03H 3MGAA 2GK0A 4DGIH 3I85A 1RHHA 2B3RA 1OSZB 3TEZA 3CD4A 3OKNB 4XN4A 1HSAA 3FU6A 4ZPTB 3O41B 3C87A 3ES6A 2WNKA 5I1LB 4HXAL 2EIJB 3TONA 3V4VB 4R7DB 4W9GC 3O3UN 4JFUA 2A6KB 2FSDA 3BLBA 3MYJA 1NC2B 1V3JA 4FQLH 1F4WH 1KG0A 1HQ4A 3I75B 2H3NB 1XGPB 4GMTL 4JFDE 1IC1A 2ESVE 4L1DA 5KJ7E 4PJ7F 4RFOH 1J5DA 1MEXL 3PAZA 2NTFB 3L54A 1AGFB 1OCWL 2BRQA 2VDLL 3I50H 3QJFB 4HQQL 4ODTH 3AWEA 4ZTEA 3FOLB 3GZOA 4Y4FB 5EA0H 4NKIL 1IGML 4ODHL 5T5FL 1JOIA 3GI8L 1F45A 2DEYX 4EI6A 5E2VH 3QEQB 4PJFB 3UPAA 3HNVH 1VF5C 4PS4H 4ELMB 2XN2A 3NPSB 4PWGA 3D85B 1KCVH 1KXTA 2WV3A 4LPYA 4TMPA 5AAPA 1BG9A 1T7YA 2W9LA 2CO6A 4U6XB 2DYPA 1BLNB 1IV8A 2FDBP 2V2XB 4I9XA 1U6AH 4KOBA 5EWIL 3FB6A 3W3BA 3TEUA 3SGEI 1MHEB 4U6VH 3K4DA 3O9WC 3NTCL 5CCJA 3BPOB 2ID5A 5DT1L 3O3AA 9PCYA 1XCQB 3BPCA 4J8RA 1ETJA 1YEEH 2XQYA 3UZVA 1M2VB 2GSIA 5BV7H 4G8GD 1TCRB 2N7SA 3VFWB 3DRQB 4XZUB 1QX1A 2H2SC 1A7PL 4N2FA 4AQ1C 1F3RB 1B9KA 5AKSA 5DD0H 4JM4H 2AV7A 3NSCA 2W0FA 2XN9B 1NKRA 3QNFA 4NKDA 1AACA 1NCCL 4WNQB 1H8SA 3ILPA 4N0FA 3SO5A 1SY6L 2Z8SA 4QRRB 3KYKL 3C5XA 3QAZC 4GEIA 1OAQL 4BRVA 5BUGA 1UXWB 2C9PA 2IC2A 3TJHD 3GB7A 3TXAA 1GRWA 1EHAA 4BFEA 2EDYA 3RUGF 2YMOA 2OULB 4HIQA 5T1KA 5EOTB 1P0SE 5D71L 4AOFA 5KBMA 1A9BB 2OMUA 4IRZH 4QHLA 3AG3B 3KCPB 3V6ZB 4WCYL 5C0BA 3VD4A 2LOEA 1I7TA 3PDDA 5T1LA 5BXFA 3A6CH 2LR4A 1BZ7A 5E8PB 5BPPA 5FOBA 3GKWL 3GLZA 2DJMA 2BP8B 3Q6GH 2E6QA 1MFDL 1ZKAA 1C5BL 3UTSE 4Z7WA 2BIOA 1TQSA 4DNLA 1CURA 3QE5A 2DI9A 3I6KA 4X80L 4K8RL 4UQDA 5TDPB 5FM4A 2ZD0A 3DVGA 3HBZA 3KPLA 3MLWH 2P28B 5J3HC 4EF3A 5B3JF 1ZGLA 2AAAA 4C4UA 4X4XA 3GBLA 3L45A 5I0YA 5INCB 2P8MB 5IVZA 2DQDL 2CSPA 4ODSH 4TUKH 4YFLI 5INDB 3K74B 4MQ7B 5C0AB 4DN3H 1X9RA 5AVUB 4N2LA 4BKTC 3H9SA 3LOWA 3JWNH 3QO1A 5ESAA 1A0QH 1QLFA 4I3GA 5AVWB 3BWAB 5D7EA 1MWAA 1MFAL 2Z93B 3WFBL 2AJZB 1SOXA 4JRYB 3RL2B 3T2PA 3VFTA 3W9EB 1ACZA 2WQRA 3MNWB 4XMVA 5GGQL 3MREA 3LKRA 4NUGH 4U3CA 3EUDA 4W9IC 5AW0B 5JO5A 5EEXA 4KFMA 1NIBA 4GP8B 4ONGL 5CZXD 2V9TA 2X1PA 4I5BA 2VDPB 4WY7H 1DLHA 3GLEA 5KBNC 3EDFA 5DO2D 3U25A 3BYYA 1SOKA 1OLLA 1KIRB 4AIOA 3P3TA 4JPSA 4UDTA 4D3CH 4HIEB 4EN3D 4MBOA 1AHMA 1VFBB 5H94A 2IIJA 4KI5F 5DMIL 3R7RA 3ZU8A 4X6EA 1U41A 3D39A 4TL4A 5JOPE 3LNFA 3ROOA 4O51B 4ZO9A 3SOBL 4NN5B 4DKAA 1T5XA 1ILUA 2A9ML 1SLWA 4MVBD 4GG8A 1KFAH 2OXHA 2WVVB 3GC3A 2B77A 3HC4H 4JRLA 3LHPL 5DC2A 2OP4L 1EBAA 2ZKHL 5T1MB 3FTVA 2PW2B 5H4YA 2D7PA 3CFDA 5IW6A 4XCYA 5J1AB 1REIA 2ATPB 1H5BA 1HE8A 5FUZL 3SE3C 3FU3A 5EPMA 4WWPA 3RA7L 2LFGA 2DQHL 2FD6H 2ZSVB 4MSWB 5JOEA 4QTIL 2X4PB 3WNIA 4WUUA 3MAWA 2BFVH 2G9HB 2XZCH 2NY3B 4OSUL 5CJOH 4M02A 1HCFX 4TNWF 4IBQA 1TXKA 2QADD 4OFYD 3JWNE 4RGNE 4GUOA 4XNBA 5I8KL 2MH4A 4TSCL 1DBJL 3UTPD 3NIGE 3WNMA 4F3FB 3SYAA 1DVXA 2WLKA 5E6ZA 3P30H 4YAQA 5C0CA 5ITBH 1MI5B 5TQ0H 4AK2A 3WTSA 2AQ3A 2WAHA 3OM3B 3TYGH 2JI1A 1KBBA 3HZKB 4WNJA 1VENA 1F6AB 5HTSA 3GSQA 4ATTA 1G7HB 4QDGA 3IDXH 2VDQL 1ML0A 2VN7A 3CQQA 1NAKL 2CJSA 3KBFA 2ZPKH 5FX3A 4CMHB 1NCHA 4UTAH 2DQFA 2NY6B 1CD1A 2FL5B 5EIVA 3X12B 4LSUL 2XWBA 2QQQA 4ZMVA 3ZDXB 3NEEA 4KKAD 1M9SA 2R56L 3BAYA 2X2HA 4MJHA 1OTTC 1MH5B 4F8QA 4ZXBB 4KXBA 3T0EB 2F7PA 3MOQA 2FTAA 1OTSD 3PHQB 8FABA 4M48H 3GBEA 2NY5L 4YZFF 4ZO8A 3FTGA 1Z5HA 3BH4A 4XBMA 1ZPLA 3BAEL 4PU2A 5E08H 3GUTA 3UCRA 3ZUCA 1HILA 4WI4A 4MMYA 4RSVA 4ECNA 1D5XB 1UOKA 3ZYIA 4Z7WF 1ITCA 2YGVA 3CFKB 4ZMWA 3IRPX 3AGVA 1AZCA 5HVFB 2QHRH 4YXKH 1LJMA 1QQDA 3AS0A 1C16B 4L8BB 2BNUA 3RZCD 5HGHA 3UGXA 1WIPA 5DFTA 3UTQA 1Y6KR 4E41D 4NQSA 1W0YT 1WTGT 4K2UH 4OCWH 1FLRL 2F7QA 4QT5B 5FXCH 3ARBD 4IBYA 6PCYA 1OOWA 2GUOB 1MCDA 4QYOA 4WI8A 2VUYA 1RP8A 1D7BA 3IF1B 2MTPA 4N90E 2ALWA 4APXA 1LO5B 5KVEH 4PI2A 4U1NA 5LGJA 4WO4C 5T1DL 3O2DH 2NUPB 4MKMA 1AC6A 1CB4A 3B2PA 5DJCA 2JTYA 5CFAA 4B9FA 4MHHI 4L1TA 1GVIA 4ZSOB 1VSCA 1SOQA 5L4IA 1XFPA 4V1DD 4LSVL 3P9MB 3FRPB 4N0YL 1KGYE 4XPFL 4AQAB 2NZ9D 2EUWA 1ORSA 3UTTE 2WOBA 3ZGIA 1CFQA 4G9DA 5DJZA 1L9TA 3T0WA 1BZEA 1Z3RA 5H4ZA 3K6OA 1ZA3A 4YDIL 2VDNH 1HL9A 3BFWA 3O11A 1G6RH 2H6PA 4TUJB 4YHIB 1U8KB 1BWWA 1IKFH 4P06A 3FSWA 3VXUB 4FMKA 4ZS6C 1MW0A 1RUKL 3CDYA 2YA0A 4ZUUA 4L9LC 5ANME 3VI4E 2KT6A 4OZFB 2X4SB 2YPLE 4JFEA 4NX0A 4X9GA 1CVSC 3CUPA 3T6ZA 1K8DA 1U8QA 1PCXA 1EVTC 1NGZB 2DM7A 2HX7A 3FDWA 3QFJD 4JMXA 4KK8D 4R7NB 4X99A 4BSWA 5GRJL 2UXTA 3H55A 2BERA 3QVAA 1EZVY 4P4KD 3AXIA 4AENB 2OMYB 1PDKB 4XCEA 1YPZA 2BWIA 3HC3H 3CWGA 1NSNH 1BD2D 3F7QA 3U2SA 2ED8A 3N40F 2J6EH 1TTFA 1UT9A 5I8OL 2BSRA 3OKLA 4FNRA 2GBAA 4XCFL 5E94B 5KVEE 5EZOL 3L5JA 2AABL 4HPOL 4HT1H 2H2PC 1DO6A 5IESH 4QXUH 1LO4H 5IBLD 2BHYA 1K3IA 4HD9A 2PPEA 2Z64C 4H1LB 5HHMD 4HS8L 2R0LL 1BJ1J 4MXVF 3FKUS 1P9MC 4ZUSA 3QI9B 3VSQA 1JK8B 4G9FD 4PIRF 3QUKA 4PP1D 4WHYH 4NO2A 1FFTB 4N2BA 2Y6SC 2QZ5A 3MR9B 5KSUB 1WHPA 2JJSA 1YUHB 3UTTB 3I02A 2WQSA 5GRZA 3PP3K 3Q2VA 3O6KL 1CU4L 5TPWH 4UOW0 1WIOA 4M8UA 3FUHA 5ADOL 2DQIL 3MV9A 3JTSA 1JDDA 3FQNA 3NJIA 2FT6A 1KDJA 1FDLL 1UCBL 1FJ1B 2MOQA 3CMOL 3T3PE 1N2RB 5F21B 4G7RB 4GIOA 2WNWA 3ELQA 3W5MA 2B9BA 1E4WL 2ILLA 3UTSB 3VGFA 4GIPD 1E27A 4ZRGA 1E7VA 1CDJA 5B1JA 5GS1A 4HJJL 5TGBB 1CF8L 4Z3TA 2YC1B 2UX7A 1S9YB 3DHJA 3RL1A 1TZGH 2FWOB 3U1SH 2EADA 2YRPA 5SWZD 5BOPA 1J48A 4OTXL 1WS7A 3WD5L 3QWQB 3ZZQA 2IGFH 1JNHB 3HI6H 4FNPA 1LEIA 1L0PA 3AB0B 3KCWA 2XG4B 5CFHA 4OD1L 2I7OA 4QRBA 5EU6E 2ZOKB 1VRSA 2YUXA 3TO4D 3WFEH 1QRNE 1TQWA 5C0DB 5DVMA 2QQNL 3AROA 1GS8A 3K2MC 1F90H 4X4ZA 1KPVA 3WXWH 4FG4A 2R2HA 2KLSA 5IK3A 1NDGA 3LKNA 2OMTB 2YPKA 5JIPA 2YR3A 3VRLF 4N3TA 3GSVB 3B7UX 2QL1A 5FCUH 3EYFB 4JFFB 1B9ZA 2B59A 1LE5A 2WLIA 1OGAE 4NGHL 1EEZA 1VB9A 2MCPH 4D9LH 4Y2DA 4JX0A 4NAMA 3MO1B 5SX5K 1FH2A 3I6LD 3BDYH 3L95B 4K8RD 3S3CB 1A7NL 1I9JH 5DZPA 4QHKI 2ZXEB 4OJYA 3S48A 1ZA6A 4MNGA 5CMAA 1BBJB 4M5ZL 1F1AA 3FJTA 3S96B 3BGAA 3VW3L 5CJ8A 3QIUA 1Q1JL 4HIPA 1QPXA 4NFDA 2BOCA 4HOXA 1BJ8A 4L1BA 5DK2B 2ADYA 4JPWL 1T66C 4MNQD 4F92B 5MEQA 4D7BA 1ES0B 1W0VB 1P4UA 2V2WA 1V5JA 3MGTA 4XVSH 5D1ZI 4KKZA 5C08D 1A6VL 3HMXL 1LWHA 4MDJB 1HHJA 2Z91A 4MRBA 3QIWA 3SB3A 5C0JB 2HRHA 3HI5H 3U6XS 1TO4A 5AD0B 2R29A 4LGSB 2X4TA 1RKRA 3HB3C 3G5XA 5BQ7B 4TRPH 4I85A 2VQTA 1YPZF 1MIML 4H0LC 1OP5H 1XH0A 4XX5A 2FLRT 5TH2A 3VWKC 1Q9KA 3H0TA 4QWWD 1FNGB 3C8HA 5GS3A 1NDMA 4X5QA 3G9AB 4HH8A 5KSAC 3F85A 4CDGC 3HAEA 2Y69B 4GRWB 4S0HA 2FX9L 2PO6A 1OF2B 4QRTA 4X6DF 1RP9A 1KC5L 4R90L 4MMXA 3B9KB 5C0NC 4PRBB 3ZL4H 1AR1C 2I9LB 1BQKA 4X6CF 4PJBB 2VXTH 2CK0L 5C3LD 1ERNA 2WXJA 3V0WH 3AU1A 4MFHA 2XPZA 3O8XD 5L0QB 2Y5EA 4OLVH 1HWGB 4ZUWB 4DF9A 4PIBA 3ARGB 1YMMA 2IPKA 4G11A 4BFNA 4NQEB 1RJLB 4LCCA 3VXMA 1YNLH 1EIBA 4MX7B 4Y1AB 1A3RH 5HY9A 5HI3D 5LXGL 4AGQA 2H0EA 2VM9A 3D0LA 3NCJL 3REWA 3WU1A 3K2IA 1DVZA 1A65A 1NMCC 3HG1E 3KPTA 1CE6B 2YKKA 4YO0B 1LXMA 2ZX9A 2E86A 2UY6A 4Z76A 4JY4B 3NSDA 1L9MA 4PFEA 3U0PB 2EVFA 1IFRA 3O2WL 5DA4A 1ZWIB 3X1EA 4F2ME 5HI5D 4OCMC 3L3KA 2EO7A 4PY7A 5J12C 3RAJL 4ABVA 4LCYA 4ZMQA 4P4RB 3UADA 3ZE0F 2FIKB 3IFPA 4I13B 4JPKH 5F97E 4F8PA 2P8LB 2H8PA 3C9NA 1ZHLA 3MLXH 5IT2H 5GSRB 1L7IL 4QJ5B 4MA7L 1OLZA 1S7XA 5FGCE 1SHSA 3QG6A 3MJWA 4J3VA 3L48A 4XVJL 2VXQA 3QDGB 1UKTA 2YD5A 4AM0Q 2NYZA 1A8JH 1W72A 4DKFH 2YWYA 4M9OA 4YHPB 1GL4B 2ZJSH 5MEOB 3IDGB 3MLUL 3Q1EA 5L8KB 3WJLA 5TJWK 2RQ8A 1PL3A 2MPVA 3AXHA 1DZBA 4M62L 4OJFH 4V33A 5AW9B 1QFPA 2EDKA 5FS5A 3REVB 3W5NA 4UT9L 1JVOA 2YEZA 1UD4A 2F54D 2K8MA 1SFDA 1I1YB 2DKMA 3OHXC 3MV8E 1TPXC 4MA8H 5GJSH 2H6OA 5TF1H 3LKOB 4NCDA 4OGXL 5K9KA 3LRSA 1SRDA 3S37H 5F0PB 5D70L 4BFIB 4XGZA 2BO0A 4QD2E 5HYQB 5BRZB 5D1XB 4POZC 3ZHFA 4K5LA 3THMH 2CZNA 4HJIA 4O00A 3MNVB 4RX4A 4YFLF 2PPAA 3CHXA 4UANA 5GRWA 1GAFL 1TEGA 4JO1L 4I3SL 3GHEL 3IMWA 3QJXA 4B9JA 1DBAL 1E9PA 1WFJA 2J8OA 4B0MM 4IK6A 4XNUH 1Q9LB 2VDKH 3ZO0A 5F9WB 3QO0A 3II1A 3S0PA 2YARA 2CJ3A 1WIUA 1IGIL 3ISRA 2F7RA 1BVKA 3KPQB 1N0XL 1WZAA 2FE0A 3L1EA 3CDFA 5M7QA 4XE0A 1NCOA 5DHYB 4P3CL 3MJ7A 5E6RB 2X4UA 5ANMB 1AXTL 4N9GB 1H6FA 2YPLB 4XP1H 4G1EA 3HR5B 1BZ9A 3ZDWA 5GGTH 4CMMB 5DVKA 1S5IH 3EBHA 1SDAB 1S7WB 4R4BA 3SDXE 5K9OA 5HGAA 4J8QA 1HHIA 3LTVA 4F33B 3Q5TA 4OLWL 1LO0L 3O9WD 4PJ9B 2WBJC 1LP9A 3BX7C 2HVJA 2XIBA 2VRQA 2G2RA 5C3IA 2EDHA 4J28A 1PQZA 1WZ1H 3UDWC 5J11B 3SDDA 3FPXA 1LGVA 2HN7A 5DEFB 3O3EB 4R8WL 4QRSB 5B7MA 3QDHA 3NQKA 2H2SD 3VG9B 2APSA 5IWLC 2YAHA 3FUDA 1E28A 4U1KA 2WKOA 4HD5A 1JYNA 4TNWK 2JB5H 3MBEA 4YHNA 5C07E 4B5ZA 5C0FA 5D2NE 1JXDA 4D9QE 3AG2B 1JF1A 5DD1H 5J6HA 4HSQA 4GW1A 5I1GL 2QBWA 3LZQA 2F19L 2GY5A 1MAJA 3S6CA 1FN4A 1J86A 1I3RB 2IAND 4CSTA 1Q9OA 2XQYK 1SDDB 5C97A 4JFHD 1YJDC 4GAAA 3VFUB 4AZ8B 2NNXA 5DHVB 1PZSA 2M1KA 1EV2E 3NAAH 4WLCA 3QJHB 1BOGA 1H6UA 3FO0L 3B7TA 1MIEH 2Y7NA 5BRQA 2F8VA 2ZUSA 4JHWH 4HK3J 2RALA 3RGVB 4E0RA 1Y18B 5FV1L 4NNXB 4UM8B 4I0PA 2X4NB 5CGBA 4ZPVB 3TH3T 3T3PB 4R0LA 5AZEH 3I9GH 2DM3A 3BDBA 3L6FA 3QQXA 5J3HD 5C09B 2B9AA 1CK0H 5D7LB 1SXZA 3D05A 3G6DL 3NEOA 4DZ8A 2CJUH 5HDQH 2YJLA 1KPRA 2WLJA 4FZEH 4RMVA 5IOPB 2DLGA 4L37B 3EYSL 5E7BA 5DU7A 2WYZA 5IZ7A 1HL5A 2DBLH 2ARJQ 1KDIA 4NJAH 3G6AB 4Q6IA 5MP6H 3S35H 2ODHA 4F24A 4M00A 3HUJA 1Q0XH 3FQUB 3WGVB 4A2EA 1T0OA 2EYRB 5K93A 4Q9QH 3KDMA 3C8KA 5B3NA 2WM0A 1YCSA 4OM0H 1X4XA 3M1BB 4GKZA 3VXRB 1KCUH 3QQDB 4PGEA 4DKEL 2DWTA 3SGKC 4I48A 3WKNA 1X5KA 4R26H 3SEPA 2CA4A 3PV6B 3GIZH 3POCA 4CAGA 5I2IB 5JXEA 1MF2H 1XF2A 4C59B 3OPZL 3UCQA 2DM4A 3HMWL 4ANKA 3ZE2E 5E4OA 1U91A 5F0LB 5HHNB 3O4LE 1X5IA 5AB1A 2CLZB 3N9GH 2E5EA 4JG0H 3TPKA 4WEBL 5IB2A 1FFNA 3MJGX 3STZA 2VLJE 2X4RB 1X5GA 3IETA 1LD9A 1PYWA 3BAXA 4HHWA 4KKLC 1JCKA 2XETA 4ZQKA 4Y2OA 2ZOLA 4UB0H 4GUPB 3UBHA 3N85L 2GKIA 2AJ3B 4PRIA 4PUBH 1DVYA 3BO8B 6TAAA 2DQCH 1CDGA 1MJ8L 4GS7C 4OVVA 1XQ4A 1JG9A 5DJAB 3ZIMA 3TOPA 5CEZL 1AOHA 3ZY7A 1BIIB 3IKCA 4IRSB 4LAQL 2H32A 4MJIE 1G7PB 2FGZA 1CXIA 4RAUA 3S4SB 3EJQA 5AKRA 4BUHA 2FHFA 4LVHB 3B2DC 2HFFB 3VGHA 1DQMH 2MNWA 4WI2A 1IM3A 1UVQA 1NCAL 4P9HC 4YC2C 1CUOA 4KVCL 4S1SH 4N9OB 1LP9F 3UBXG 1TOXA 3VFVA 1BQHA 4U7MA 1D7DA 5FC9A 2DWDB 2FNWA 4RZCB 4FQXC 5E0QA 3HZ3A 4AMWA 1WICA 1T7XA 2CR6A 4XPHH 1NIAA 1X7QA 3QUXC 3ZMRA 4GH7B 4OJCA 4Z5RA 4MNHA 5LQBH 2XQ0A 5EU4B 4BFGA 1JUFA 2WKOF 1NEPA 4NT6A 4YBLC 4YFDB 2YMXH 4UT6H 2GTWB 3QA3B 4IRJB 2E7MA 1P7BA 2EZ0C 5I1CH 2WN2A 1BMWA 3V4VH 1SDYA 2FR4B 2JJUA 4GRLC 3EF4A 4NO0A 2X7LA 5JMRA 3F7VA 4PJCA 3KLDA 4YDVB 5AVTB 5L8LB 3DRQA 2O72A 3PXHA 3IVKA 3W0WB 2WB7A 5HDBB 1QG3A 4LHUD 4YGVA 3WL9A 1I7ZB 3VQLA 5FO9B 2XYCA 3CFCL 2DZEA 2B2XL 4N8CH 4MBRA 1OTTD 3WTWA 3Q13A 1CI3M 1TJIH 4KTDL 5FA3B 1FH5H 3WEXB 1KXQE 1EANA 3RTQB 5I1JL 1NIFA 4YDNA 1F2XK 5KVFH 2QQLL 3X1BA 1VFOA 5IQMA 5IJDC 1KTDA 3L3GB 1Z0NA 4ZI8A 3MRPA 3BT2H 2YUWA 1FAIH 2Y36L 3QUYB 5IMLB 3NJHA 2X10A 1XMWA 2R69H 2J1KA 3MLSH 4F2MB 2AKRB 4XBGB 3NH7H 3TCLB 5T3XH 3V6ZA 1JZEA 3TJEL 1J5OL 4QRPD 3QPXL 1MDTA 1AZUA 5F7MC 3SZKC 4A63A 1YEHH 3IU4H 5ILTH 2N59A 1VACB 3EFOB 3SODB 4Y16C 3OKYA 4MD0B 4ZK8A 4YMPA 3VXTA 2NPLX 3DA0A 3WNNA 3QP3A 3S8FB 4YUEL 3T1FB 3FONA 3WS3B 5BZWA 1OPGH 5JUEH 1UJTA 1DDHB 4J6IA 2J1WA 4PBXA 3TASA 3HE7A 4BM7A 5E1AB 3HUJF 4WO4D 5F3FA 5L2KA 1HHHB 2KS0A 1ASPA 4NFCA 5EO0A 2CUHA 3O4OC 5E1GA 1R5WB 2CR0A 2BVPA 4C57C 5B1CA 1JGDA 1R3JA 3FCTA 1GYAA 3X14A 2A74B 1JPTH 4ZFFB 4J3UA 1T04B 1P7HL 4WV1B 2NY1B 2IAMA 3CXDL 3ATDA 4RDQG 1QUNB 3CSBA 3QZPA 4OLZL 3SYPA 4B9CA 3HBQA 1CYWA 2J21A 3FSOA 2ZKWA 1IGYB 1MCPL 1DUYB 3KPPB 4QY8B 3IJ9A 3I3BA 3WIHH 2BOBA 3ULVH 1R3KB 2FCBA 3MRBB 4J3OC 4XNQA 2CIIA 1CLOH 1JV5B 3X2QB 3O45B 1EFXA 4EI5B 4ZS6D 5FKPA 3QIUC 3TWCL 3FU7A 4ETQB 1KYDA 2CD0A 2JCCB 2ZWKA 2EDRA 4W70A 2ALAA 4XBPA 2A83B 1ACYL 3P0YL 5GS0H 4P5TA 3DURB 1MCLA 3T2OA 2I9TA 2FBJL 1YJDL 1VLXA 2AEIT 4HLZG 2HA1A 2OBGA 3QIWC 5DRWA 2E27L 2ZKXA 3BHBA 3RWIB 2D7TH 3L4UA 4JGNA 4F7TB 3CZJA 1T0PB 5E23A 3E3QC 3X3FL 4ODWA 1MLCB 3HNSH 5FECA 4A1RA 1HL4A 1NTDA 1N59B 5E8OB 3SDXB 3QULA 2NLJB 3MV7D 4XO4A 2PW2A 1CQYA 2CKNA 2HT3C 2V8MA 2NUTB 2CDFA 2G3ZA 4Q9BA 2H2PD 5GGUB 3IGKA 4G2AA 4MSWA 2R59A 3QCUL 3WUZA 4HIIA 4NWUL 4ZFOA 4JCWA 2X4PA 1VZHA 5AAMA 1FG2A 4S1RH 2QPUA 3ALPA 4XP9H 3RZWA 2WBWB 2QKIA 4F37F 1KENL 1E6OH 2Z1KA 3AACA 2C9SA 3HPJB 1EXUB 5ELIA 4AY0A 5C07B 1M2OA 2O5NA 1G9HA 1NMBL 1MJ7H 1SQ2N 4LLWB 5HGGS 2Y6SD 3ARFB 3SN6N 2JIXD 4OLXH 4NZTH 4YX2H 1KJMA 1YG9A 4Z7OB 2ZF8A 5JW4M 2XG5B 5DQJA 1RVFL 2C7FA 1NMAH 4PJCF 2J5LC 3DTDA 4HUUA 5KVGH 1AI1H 4I2XA 4XXDB 3Q43A 4U6YB 4F7EB 3N06B 2YKLH 5G5DA 5D2LE 2YUZA 3FOMB 1AFVH 3TM6A 1HSBB 4DP6X 1RCYA 4F91B 2IBZY 3ZXAC 3UZQA 3FUIA 4HJGB 3CFJA 4QF1A 5MI0C 2I60L 4G8GE 3BUYB 4Q2ZB 1MCRA 4DGUA 5I73C 4NERA 3N1PC 4J4PC 3M88A 3VD2A 1AO7D 4N0UE 3UL4A 3ZHLA 3VD0A 1UXLA 4HOMA 4NLHA 4G3YL 2WQUA 3T0EA 4ZODA 5AYUH 2NZIA 1I7UB 4DT2A 4J1UB 2VNCA 2HFGL 3OKEB 3KXFD 2H1PH 3QXAA 1SYVB 3MRFA 1E5UI 4RAVB 4PGDA 3MOAL 2A9CA 3FSZA 4LLVA 4XAWH 4MLIA 4Y19D 4P3DA 3E1ZA 3QQ9C 4UYPA 1P5UB 4HLJA 5ICXA 5IR1A 3V0GA 3RJOA 3ESNA 3F12A 1XO8A 4XP6L 1QI3A 3BVWA 2HPOA 4XWOC 4S1DC 3UYPA 1BGXH 1U8LB 1D2PA 3VFRB 2AJVL 1E8ZA 3ZHKA 4Q9RL 3D3VA 1NGPL 2A9NH 2OYPA 4ABUA 3RVVC 2DMCA 2ICES 4X5WB 1AIZA 3W39A 1QR4A 3E9TA 4UTCA 1MY7A 3C08L 4KJWC 4PY8I 2ZG2A 4NZ8A 1TUPA 3BZFB 2Q7YA 2PP9A 4W9EC 3VH8A 1A1NA 1ZHBA 3EOBA 3MODH 2C9QA 3HHRB 4LGPB 1MCCA 4S0SD 2Q8AH 4JY5L 4KV5E 4WJKB 5KUKA 1AQDB 3MRKA 3ZE2B 1OAUH 3OKMA 1THAA 2FX8L 4HAGA 2JNZA 1S4IA 2OYLA 3L4CA 2B1AL 4HXBH 5KAQF 3Q05A 1Z6JT 1CGYA 2B8OT 3CN3A 4PJDF 3H3PL 4BZ1A 2VGLM 2BIMA 5A43C 3BQUA 3NZSA 3ZDZF 1TETL 5LNGA 3BAJA 3RY6C 3QZLA 4JFDA 2ESVA 4PWJA 3N40P 3SKMA 4AEFA 1H8NA 2XNAB 1FZMB 3WIFA 3JWOC 4B97A 2WLYA 4YHIA 3CSYB 3L5XL 3WDHA 2KYIA 1QLEB 3F5WA 4FHJA 4NNYB 2OA9A 4YDLC 1X5MA 1FVEA 3GS4A 3HB3D 5D7JB 1ZMYA 3SQRA 3PQYA 2OK0L 5F0JB 5G4OA 4ACTA 1U3HC 5EU3B 4UNUA 2JKIS 3SDDC 7TAAA 2I27N 4RMBA 5GGSY 2W80C 1GSMA 3T6WA 3VWKD 5IMKB 1KGWA 4OF7A 5IIEA 1K4DB 2X1WL 4OIAA 3RFZC 5KSAD 1G0DA 1A1OB 5DZVA 5I74B 3INUL 3T6VA 3MBEC 1H15A 5ESVA 4BFBD 3SHSA 2X0VA 1ZT1B 4ZMAT 1IE4A 2VERA 5CZVH 5C0ND 4BEIA 4BUQA 1AR1D 5KYWA 1T80A 3KYOB 3RP1A 3KR3H 1UYWH 4O2FB 3ZKNC 4YHYB 3ME0B 4FAAB 1JE6A 4LSRH 1G1KA 4FCHA 1XIWB 2DYRB 3EOAB 4XNMA 4NP4L 2QVTA 3S3BB 1EJFA 2YQ3A 4L4VD 5CEZD 4AJ0A 4KXAA 2VWEE 1FZJB 4NB7A 1EEQA 2AXFA 3HE6B 4OJAA 2H7WA 4GQ9L 5LBSH 4DPBX 1B0RA 2VDRB 1Z9PA 2P5EB 2PETA 3LZOA 1X4ZA 4NWTH 4QXWA 4MMZB 5CEYA 1J5CA 1MW3A 3DC0A 4WO0A 3Q8FA 3S98A 4BZ2H 4G6KH 2E8YA 4JO3L 4NPKA 4PJAE 1T2JA 2AITA 1ADQH 2CBPA 3UTPE 4O02L 3X3GH 3QHZH 3TZVA 3O6FB 4N8VG 3ILDA 3TT1L 2O5XL 2XFXA 5I18H 4NNPH 4PGCA 4ZYKB 4JN2B 3EZ8A 2PTTB 2EXWC 2BXZA 1ZTXH 5JXAH 1F58H 2Z9TA 1CC3A 3JV4B 1G7LB 4F15C 3T8VA 4X7TA 1JDCA 1FP5A 3H9SD 3RWDA 3OC5A 2BRRL 3PXJA 1JHKH 2IH9A 4FXGA 1N2RA 1S78C 2YOCA 4GI9A 4J27A 1JZ6A 3T8XA 4LEOA 2VR6A 2R29L 1MRFL 5TGBA 2CM5A 2W38A 4LLQA 5DLMH 1QR1B 1XEDA 4BUGA 3QUHA 1R3IH 4IMLA 2O6CA 1MCIA 5ETUA 4G8IA 3FB8B 2K3TA 5AOZA 2X5PA 4XRCB 4ZMTA 3CCHB 2QMJA 1YEKL 3AXLB 1PZCA 4M1CC 1GGCH 4B60A 4EIUA 3TBWB 4X4MA 1AXIB 1NFDB 2D7QA 2DQEL 3D30A 3PNWA 4YOKA 2DW5A 4POZD 5ADPH 4GG6B 2IDCA 5TDOB 3GXDA 3X13A 2NY2C 2XY1A 1D5BA 2ITDB 3NJNA 2R1XA 4KWUA 5IW3A 4AMKH 4W9DC 1VPOH 3EO0A 2EP6A 5LG6A 2QEJA 3P73B 3H3KA 2ZCZA 2V33A 4LSQL 4E41E 2IQAA 1GOHA 1D6EB 1WG3A 3K3QA 3FFCD 5ISZB 5KUMA 5AW7B 5BOJA 4JRXB 1NCJA 4YPJA 1DVQA 2IAAC 3KVPA 2BLFA 4XOCA 4OIIL 2Y22A 4ZJ9A 2YLHA 5KANI 4KXDA 2Z92B 2FVNA 4WUUD 3O3DA 1PKQA 1BPVA 3EGDA 3P3YA 1F3DJ 4X7SL 1DANU 5EF2A 1U93A 4RFNB 1RIHL 2PPDA 3UO1L 1A14L 1VEPA 3VFNA 2XU9A 4TNGA 1N18A 5HYJD 2WLLA 2XFGB 4YXHH 3CE1A 2RD0A 2WBJD 2GJZA 4YPGA 3DJSA 3GD1C 1UEMA 2XKNB 4WFGD 5CGYC 1X5JA 4LCIL 5BMFL 5EOQL 4OCYH 1IGMH 4JB9L 4IYKA 5SWSA 3KWUA 2NT1A 1E4KA 5IHUH 4NC1E 1QBMH 5C7ZA 5JPNC 4P5MA 2IG2L 2ZYIA 2R1YA 4DVRL 3BAKA 1Q72L 1E3XA 5D1ZC 4YJZL 1U95A 3TA3B 4F58L 3BZEB 1OE3A 1W80A 3FZUC 1OP9A 1YYML 3HCVA 4JLRB 4QXVA 4ELKB 1LK2A 1DN0A 2LQRA 1WCBB 4F2EA 3V6FA 1IARB 35C8L 2R2CA 1WT5A 5FYJU 5IV2B 3QFGA 4A38A 1RERA 3QFJE 5BJTA 1SHMA 1DZ0A 4DUVA 1JIBA 2DEXX 6FABL 2XI9A 4XN8A 5J1TC 4PJIB 2Z7WA 3ET9F 3O6ML 2F53E 4JFWA 1BD2E 1XSKA 2QT6A 5D7SL 5J6GB 3H8NA 1X6LA 2AW2A 4LB8A 1UD5A 1BF5A 5DZLA 3MN8A 1JF6A 1J12A 2GAZA 2V5YA 2V7HA 3GK8L 1S9XB 4BH7A 3AAZA 1U8PB 3UH8A 2NXYB 1XTLA 2CCLA 5DRZB 4BH8B 3WE1A 4H0GA 1MNUH 1D9KA 1T1WB 4Z0XA 4G8GB 4QTHB 3KWXA 2BWDA 3RPKA 1BAWA 1L7TL 3CBRA 5EORL 1UWGL 3ZR6A 1S7VA 2QDVA 4WVRA 4Z3EA 1QLRB 3UC2A 1NOLA 1JWSA 1O6TA 2A1WL 3P2DA 4G9FE 3TT3L 3LVTA 1ZV9A 4KAQL 5ALBH 1KWKA 4M7KL 3L2NA 3JWOL 4Q8BA 3ROLA 3N50A 5BW7A 3ECQA 4Q6KA 3WJJA 4I18C 1P5VA 5CSZB 4HX1A 2YD2A 2FYYB 3FH7A 3NACL 3Q1SH 4K8RH 4U6TA 4M7ZB 2IFFH 1KLGB 3H6JA 3RVTC 1VADB 4L3CA 5FYJH 5F3BA 3AWGA 3IAPA 1H0DA 3MI6A 4GRWH 2DPKA 1T1ZB 3QZWA 4H8QA 5GS2D 1CZ8L 2R51A 5D55A 1BXUA 1IU1A 1HT6A 3F7PC 3KYNA 3GSRA 4PLKC 4KMLB 1A6ZA 2XVKA 3FFDB 1JZDC 2FB4L 4KKLD 1F4HA 4ZAKC 4R9HA 4G80B 2Y2YA 4YFEA 1C1EH 3DBSA 5LAXB 2D31B 5SWZE 2HLEB 4W6WB 1HXMB 2VN3A 1OGSA 4ERSL 3AQYA 3FUKA 2EDLA 4UTAA 3JWDH 1S46A 4H26A 5EULV 5E5RB 1AGCB 3RVUC 3AY2A 2P80A 5DS8B 3I3EA 4ODUA 5EC2B 3STBA 3DX6B 4CKVX 5EOCL 3OJDA 3QQ4B 5EBLA 5F3HB 4HBCL 3V6OE 3SPJA 3B83A 5I76A 4XMTA 2V9QA 4EQ2A 2EIZB 2EKSA 1R33A 5DUBB 2K6WA 3DX7B 1IAIM 4HUVA 3T65A 2C4FU 1U8NB 3DX8A 4IJ3C 5D5MB 5GRVK 3EW3B 5D6DA 3KH4A 4BXVA 5ACZA 2OPCA 5CKGA 4XNAA 1A3QA 3EHBC 2V7NB 1QHOA 2JB6A 3VI4A 2HLFC 4LHUG 4HWZA 1G9ML 5JNYA 1S7UB 3VTAA 3HKZA 4NKQB 4FQXD 3I6LE 4EN3B 1KGXA 1QEXA 2I25N 3HA0A 1EA9C 2PYFB 4JFPA 3QUXD 2EDTA 2N0KA 1O9WA 4CL7A 4HGKC 4KROC 1QUPA 1A4AA 3UG3A 4OH2A 1J0ZA 3C5ZA 4PP2B 4F7MB 4RGOL 1F11A 4CVZA 1BFOA 4TTGA 3HVNA 1MCEA 2EZ0D 4JFZL 4P2QD 2OI9C 4LF3A 2OM5A 4OZGE 5I28A 4B7LA 4GRLD 1B0IA 4P04A 4NUMA 4OZIB 1F5WA 4OI7A 4MNQE 3EGXA 4PAZA 5GHWH 4YLCA 4OFDA 2O5YL 2AVFA 1NBVL 2VXVL 3NIGF 2OYKA 5C08E 3DMMB 2WVSA 3O2DA 4HYTB 1ZLSL 5JQHC 3FQ1A 5I6XC 4F37K 4RWYH 3UPRA 1F6FB 1A6WH 4TV3A 3I6GA 3RDTA 4FP8L 3R1GH 1VFAA 3BPNC 4N28A 2NXZD 1XD1A 1XR8A 1KYFA 4P48A 2VAAA 3LQMA 2IDSA 3GMLA 4AUUA 1TNMA 2G0LA 1HJCA 5CF3A 1CXFA 2J72A 3DV6A 5CR8A 5GRVL 3CQFA 1FI8C 4OY9A 1PLGL 4OF0A 1IIKA 2OMZA 1G6RA 1CFNB 3U4EA 5FB8B 1GZQA 1VCAA 4Y16D 2CMRH 1SHWA 3BEVA 4MA1B 1WD9A 4TM9A 4HISA 2EYTB 4JHVA 5HGBA 4P46C 3MLPA 1Y1UA 4H13C 2MWCA 3HS0B 1O7DE 3MHZA 3GMOA 5F9JA 4TL5A 4QCIB 4WZ9A 3BKJL 2QLYA 4KKCC 4FXKB 4OFQA 5DD3L 3BAEH 1JJUA 1IBBA 1AGEA 3EFDH 2EXSA 1OCOB 5H2BB 1XSJA 5E4EB 1AGBB 3WDJA 4HKXA 2VABB 5MERA 4J5VA 4WU5B 2J6EA 4XHJC 5FO8A 4TSAH 1ZLUK 2HWZL 1RJYB 4GFTB 2CDEB 4JFOB 1KJVA 4O58L 3MCLL 2EC9U 5BOZG 3NJXA 3ZQWA 3O3BA 4CN6A 1JYWA 1U2YA 2YPVH 2NMSA 1YYLL 3BD3A 5EU6A 1OGPA 4IW4C 4OB5L 3KE0A 4ZS7H 4YQXH 5KJRH 3S36H 4KVNL 1ZY9A 1QRNA 2WWKO 4J3OD 4S2SA 2BSCA 4YXLL 1H9DA 5DJ6B 3QIUD 4FEIA 4P2OC 3RWCB 4K3EH 4GQRA 5IVXF 4YWGL 5AFAA 4BV1A 2P5PA 4AYEC 3RI5F 3V5KA 4QHUB 4GQPH 4HHAA 4BHUI 4E41B 4YDKH 1MRDH 2AEPH 3QWRD 4G6ML 3NA9L 3OR6A 5K1JA 1OGAA 5D7IE 2CLZA 3C6LA 3QIWD 2KPNA 2XVGA 5D9SA 4AIZA 3KGSA 1T5WB 2AJXL 4KOCA 2BOLA 2BIPA 1MCQA 2B20A 2CHNA 1ITBB 2F54E 3BFOA 3L3OA 9CGTA 2R0ZH 3NFSL 5DA0B 4HUNB 1SVZA 4GT0A 3TEYA 1QSVA 2KQMA 1UXSA 2HT3D 2X3CA 4FQIL 4LCUB 4QAMB 1H3VA 3WLWD 4LDEB 4V1DB 4OCNC 3SKJH 1JDAA 3RYMA 5DS2A 2FSEB 3VTTA 4YHKL 3OV6A 1NUGA 4OF3A 1AJ7L 5IFAL 2C1PA 1S5HB 3CVDA 4KKNA 4E36A 3NFPA 4Z7VB 1COBA 1CBVH 4NKMA 3IFNH 3QH3A 3VQ1C 1S9VA 4Z7UE 3D07A 5EZJB 2Q6WB 4NSKB 1JCVA 1UT2A 3HFMH 5HHOD 4DEPC 1XGUB 3JTTA 5EEUA 2F5AL 2J55A 4TVUA 4K4KA 2QJDA 1J8HB 1CCZA 1RZ8B 3WN5C 1MFMA 1T0MA 1G7MB 3GEWB 4P4KB 3V5DA 1DBML 4HIXL 3E2HC 2VDOH 5C2BH 3D48R 2YD6A 5B38G 1RMFH 3A5VA 5GSVA 1BD2B 4KI1A 2R0LH 4UM9A 3V8CA 5KEZA 3K8KA 2IOIA 3AADB 1J9SA 2HZHA 4OZHE 2J12B 2NSMA 2VDMH 1A6AB 3L8QA 2F15A 3SDCC 2BCKA 4J4PD 2P43B 4PJXB 1KMGA 1I4FA 1V7ML 4O4YL 1ZLVH 4KQ4H 5HHQA 2LAAA 1DEEB 1I85C 1J1PL 2PLTA 5CP7A 4P2RD 3FQ2A 5HHMB 5JW3L 1B4RA 3QUZA 3KL3A 2B1OA 3HG1A 4NN6C 3V5HA 3HW7A 3QQ9D 2MKLC 3QXVA 2P49B 1ZHNA 2EEBA 1FE8L 4LARH 4Y2LA 5FYKL 1AD0B 3TFKC 3WUWB 4G9FB 3WJMA 5A16A 1IL1B 4XXWC 2IANE 4S1DD 4XH2B 2PR4H 5E6UB 3OJMB 1PSKL 1FCGA 3RVVD 1QNZH 1UA6L 3CVIL 4GBXA 4M7JH 3MACL 4UINH 1HQRB 5IBUG 5DHXB 1B4JL 2NY0B 3QRLA 3U0WH 5DMKA 2N3JA 1TO5A 4JZJC 5E5MA 4KJWD 2GITA 4B7IA 4E9WA 2G60L 2JKLA 3K46A 4ZFOL 1B3JA 5BV7C 4WUKL 1UD6A 5E2JA 4MAUH 2H9GB 2PP7A 4JO5A 1RPUA 3BH9B 1DDHA 1NEZB 4HU8A 3BP6B 2VISA 1RURL 4UNIA 3DXAA 2J88L 1R5WA 1SJEB 1DUZB 4X9BA 3QUMH 5A6MA 3NP3A 2SEBB 1X44A 5E8NA 5LVEA 4N2KA 2WXHA 3N1GC 5DJ2A 1J1XH 4ETYA 1L9NA 1XH3B 2Y7OA 3N43F 3MV8A 1CICA 1QUNA 2OTPA 4DWHA 4EAEA 4AJWA 1IBDA 3NIFE 4QNPE 5IFJA 5AENA 2VC2L 1VIWA 4G6JH 2P24B 4LT7A 2HVKA 2NW3B 4N6QA 2WXQA 4GSDH 1TG8A 3QEUB 3CNKA 2Y1ZA 4XC1L 1LK3L 3W38A 1NPUA 3R8BB 1U3HD 4HC1A 3BMWA 3DIFB 3SDDD 5F7EH 2PTUA 1AD9A 1NJ9B 3EYOB 4JDTL 5BRPA 3DURA 4XNXL 4MDIB 4OGAC 2VCOA 3MRGB 2FGWL 5C6TL 2HLAB 1WV7T 5HYSG 1QFUL 3KPNA 25C8L 5HD8C 1VJSA 1NCBL 2KPWA 3MBED 3MA9H 5E6SB 2YA2A 5CLZA 2F9BT 2JV6A 3PABA 3IXTB 3MRJB 1EFQA 3SPCA 5H35A 2WP3O 1WT5C 2C26A 1XGRB 3SCMC 4FZ8H 2XTJB 3N55A 3QQ3A 4LLYA 4QHNA 3ZKND 4FOMA 5DUJA 4BGLA 3QARA 2ZTBA 5GGUA 1PZ2A 3D50A 2O30A 3B4NA 2BSDA 2DMBA 4XZ4A 4E9VA 2EAEA 4FABH 5JPMC 5EFIA 4YLQT 3R7QA 1C08B 3N44B 4FQ1H 1QD0A 2B5IC 2K78A 4MNQB 4A2GA 2V2TA 1FSKB 3V0AC 3UOAB 5F1KC 2CKBL 2R7EA 5IB1A 2YRLA 4OAWB 5C08B 3AGWA 3LZFH 2QSVA 4FERA 1JI2A 4KRPB 1UGNA 4LHJB 1FYHB 3DSFL 2NTSP 3VI3E 5KYNA 5D2NA 2NY7H 3B9DA 5FFGA 4A6YL 4CJ0A 1A8ZA 4PVMA 2YBRB 3TN0A 3IDJA 2G4EA 3IM1A 4JEGB 3MCG1 4QAWA 4I77L 4YDJA 1M6OA 3AZUA 4FNLH 3LH9A 4BK8A 2VSKB 4BZ1L 5SWQA 1BFSA 4N85A 1F6LL 3DV4A 2XQBH 5EBWB 4A55A 4U6YA 1XSIA 3UEQA 3FU9A 3BZDA 4QOKD 2B7DT 5IROA 5HVHB 3KL5A 5K9JH 4GRMA 1EAOA 2AMUA 2WUCH 4A2LA 3GSOB 1N5YH 4HZLA 3BSZL 4UZUA 1LHZA 3FT3B 2YD3A 3B1TA 5E9DA 4G70B 4DPAX 3S88H 4YHLL 3ECVA 1E3ZA 5EU7C 2VW7A 4Z7QF 5GGTA 4D8PA 3H7BA 4HDIB 4IDLA 3PUCA 3V0EA 5IB3A 1CE1H 2OL3B 1VCBC 3W1ZA 4K7FA 3IDNB 4WDIB 1MCFA 3HRZA 5AKVA 1P1VA 4M1CD 3EYVA 4PBDA 5I6PA 2LT9A 3PREA 1WBYA 5F9AC 2OMVB 1T20B 4OT1L 1ZDQA 3TEXA 4XPBL 2ZX6A 4YLBA 2QVFB 3U9UA 1D3CA 3GTVA 3KLLA 3SE9L 1RY7B 2NY2D 3VXNB 1JPST 2UYLB 2NRDA 3CK0L 3MLUH 4LPVA 4UYQA 3QCTH 3HZYA 4HAKA 3VD5A 3VO0A 3LV3B 3GIVA 3TVMC 1YC7A 1SQMA 4RSYA 5HYIA 2PXYA 5DTFA 3PL6B 3MCKA 4UZSA 3VUAA 4PB0H 1TVHB 15C8H 1FFRA 2X89A 3L9RB 2D03L 5I82A 4DGIL 4YL9A 2MRYA 2NQ3A 1IKNA 4LVOC 2VDQB 3LMJL 3L3DB 3O4LA 1IGTA 2FAUA 4FQLL 4ONHB 4WNSA 4F9PC 1F4WL 2VLJA 3PF2A 3AMKA 5DD5H 1KBGH 1BVNT 1JNNH 1MG2C 4N8VB 2X40A 1NCWH 4F9LA 2FZ3B 3C2AH 4EZMA 3ALWA 5D6DC 1PEWA 1IM3D 4G71B 2X6BA 5B8CC 2X4QB 2GT9A 5GRUH 2GC7C 3RNKA 5IB4B 2UZIH 1INQA 5CGYD 3MRRA 1SXCA 4K71C 4LDOB 1RU9H 2F54B 1EDHA 3LRMA 3I50L 3JZYA 4CGTA 4ODTL 1IGIH 4RFEB 3NA4A 4XAKD 1IEAA 4ZW8A 5CR1A 2OKMA 1N0XH 2FK9A 1HXKA 4NKOB 1F42A 4UTBH 3MMEB 5EA0L 3OMNB 5D1ZD 4MJIA 4QXGH 4BDVB 1FHGA 1XCXA 5E2VL 3P11H 4ZX3A 2ZX5A 3HNVL 3SDAC 3CFBA 4GY4A 4PS4L 3LS4H 1KCVL 1N0LB 1WRFA 1UZ8B 3VM5A 4XO9A 4FTVB 4KZDH 4UQ3A 2CO7A 3NCYS 1U6AL 2VITB 4HLEA 2BFGA 3IN0A 4LRIA 1U92B 2IFGA 1BJMA 5GPRA 4P5KA 4U6VL 3ZKXC 1B0GB 4KJQC 3IJ8A 3IEAA 3UBGA 4R8WH 5GGVH 4F7PB 5AVVB 3L4VA 3P2TA 1M1XA 1TLKA 3H56A 1PLBA 5BV7L 3D33A 2HRPH 1JZHA 4LSSH 5F7AA 5ID1B 2N4IA 3AREC 3QFDB 3MV7E 3WO3B 3B34A 5K9QG 2WXFA 4HAFA 1XIWA 5E00A 3O9WB 5AB0A 1ET8A 1EPFA 1S7QA 2DQUH 4JM4L 5DD0L 4PJ8A 1IQDB 3OZ9H 2K6YA 3ZDYB 4KZEH 4OZHB 1RIVH 3CVHA 4K3JH 3QNYB 3P4MB 1JRHH 1AANA 1CFTA 1I3UA 1TZOA 1J0JA 3PWUA 1DVFA 4AQ8A 1QSFA 4AJVA 2F61A 2Y3AA 4P07A 1KXQA 4Y5VA 5EUKB 5GGSB 4AV4A 1R47A 4IRZL 1INDH 2ARWA 3PWJB 2BS9A 5EN2A 3W37A 5CJXA 3UBXI 4PJGF 3H9ZA 1L3NA 5DYOA 1QKZH 3D2TA 3QT2A 3A6CL 2ZAIA 1QA9B 1ROWA 3CXHJ 2IANB 1GPOH 3Q6GL 3NZ8A 2BZDA 2CNZA 1VGEH 3RWGA 4N20A 3RVTD 4APQA 4IIQA 4FFYH 3PIQA 1HCVA 2P1YA 1UCTA 2Q3ZA 3GNMH 3HI1A 3MLWL 2CGYA 3PRZA 1X7SA 1KB5H 2K0RA 3CPUA 3CZNA 4JZOA 1FV1B 2YEQA 4AYGA 4CC0A 1QSED 4PLKD 2R83A 3IKKA 5IKCB 3UTZB 3MA7B 1TNNA 1SMDA 2VZ3A 4Z3IA 1XF4A 4ODSL 4HSCX 5I17A 4TUKL 3KW8A 1EFXD 3SD2A 1MXDA 1WC7A 4ZAKD 3CDGB 4DN3L 3U79A 1AO7E 1R5VB 1A0QL 4G6FD 4JAMB 3U82B 2VR7A 1DANT 4FI6A 5DEGA 2Y7QA 4L0YA 1XHHA 4P5TD 4MD5B 2AP2A 3JVFC 3HG0A 3KXFE 4RBPH 3NP4A 5TTRA 4OD2B 1MLBA 4NUGL 4DCQB 4LLMA 3RVUD 3AC0A 1KFGA 3F3HA 4M4RB 4N0RA 4Y19E 3SOTA 3WAJA 1HEJC 3PFQA 3TYFB 3L81A 3LPWA 3RWHA 3SBWA 3DUHA 2UXGA 1NGYB 5FYKD 4BQ8A 3WEMA 4M7LH 4WY7L 2OV0A 1YEIH 4NYLB 2CQVA 1SEBA 1T0NB 2X4OB 2OMXB 5DVNA 5LG1A 5CP3H 3P73A 3VJ6B 4D3CL 1N8ZB 5HHVH 5JQ6H 3J07A 3RI5K 4TLTA 5LAPA 4ORGB 1LNUA 3CVCA 3BRDA 4DK6A 3QNXB 3ARDB 3D12B 3EHBD 2Z0BA 1RK1A 1JMZA 4JFQB 5HDWA 3LAFA 2HLFD 4MKTA 1YZZA 4BXSV 5F8QC 5KVDH 2ZXGA 4Q74A 1T21A 3FT4A 4AYID 3D51A 4HGWB 3ZSSA 4GQQA 1KFAL 2E9GA 4WFFD 2Z4QB 3HC4L 1P6AB 4UQ2B 4N8PA 4EZKA 1KEMH 1KJ2A 4L1LA 1EAPA 5GIRB 4NRZB 1CR9H 5F7DB 3K71A 4ZMPA 4Y5YC 1FC1A 3HN5A 3ARQA 1AIFB 5B1KA 3GMRA 1FZOA 2FD6L 2YAPA 3GLAA 4JFYB 3B9AA 8CGTA 2BFVL 4CU6A 2XZCL 3SQBB 1U58A 1QW8A 5KSBB 4A04A 2C1OA 3LKSB 2ZXQA 3QWOB 1LVEA 4X5XA 2BNRD 2DICA 2FRGP 5J6SA 4AQEA 3KPRB 3VCLA 1IB5A 1SMAA 4Y9BA 4JO4H 4I4WA 2V17H 5ITBL 3P30L 3T4AA 3NRFA 1OZTG 5TQ0L 1WZKA 3UMNA 3FU0A 4W9JC 43CAB 3PU7A 2QSTA 3SPVA 1X5HA 5HI4C 4XPAH 1KB9J 3TYGL 4NO5A 1JPFB 1YDPA 1YN7B 4MYWB 1MAMH 3QDMD 2OSLA 2QLVB 3WO4B 3V4PA 4LBEB 2GTZA 1RJZA 3WIHA 3IDXL 1CDIA 4LMQE 1I8IB 2ZPKL 3QJOA 4Q4EA 4UTAL 4WW2B 1IAIH 1L3WA 3Q48A 3LB6C 2PCPA 2X6AA 3GMQA 3DECA 4N68A 3NCYP 4LSTH 4P46D 4WHCA 5D2LA 3RX5A 3G6JE 3MUJA 2X9ZA 5C9JB 2NCMA 3DO4A 4U3XA 3AQZA 4U0QB 4RRPM 3R0MA 4KKCD 4J3OG 3RBSA 3LHAA 3D3VD 4L4VE 1N4XH 4KTEH 2CNYA 5CEZE 5E8DH 1HL8A 1A21A 1JHLH 5LHDA 1ZOXA 4Z77B 1Y0LB 2FO4A 4Y4KC 4M48L 3MRNA 5E08L 1A1MB 4N0UA 4X6FA 1TSRA 3UG5A 4OZ4A 4XHJD 1F0LA 1UOVA 4PVBA 3BI9X 5M94B 1GGIH 1OANA 3DROB 1U8CB 3MJ9H 2QHRL 4YXKL 1JS4A 1JXKA 3KPSB 4TQEL 3VXOB 3M7FB 4AH2B 4RVBA 3B5HA 4C83B 2Q8BH 3R8QA 5A2LH 4K2UL 3FU8A 3VWJC 3LNEA 4JDZA 4QO1B 3VAEA 4G1MA 3TNNB 4DQAA 4D0DB 3BH8B 1RZIA 4XNZC 2EC8A 1T3FB 4P2OD 1R6VA 2X70B 3A3YB 3H9SE 4NLAA 3GSNB 5DEJA 4QRPB 4LBAA 5I8EA 3T08A 1DQJB 2AJYH 4LSPH 4BWWA 1C8QA 2C3XA 3TL5A 4WJ5A 2C4FT 5IEHB 3O2DL 3PP4H 1L0YA 3ESVF 1AHWB 1DDTA 4GO8A 4LKXB 4RMTA 4XBEH 4WAFA 2Z31B 5ICYA 1UM4L 3CXDH 4AYFB 3ZTJG 1CN4A 5IBTH 4GW4B 4ZZKA 4OV5A 4KZ0A 1U8MA 3PQYD 4WI0B 3FTXA 3G5ZB 2FJHA 4LLAA