3ZZQA

Engineered 12-subunit bacillus subtilis trp rna-binding attenuation protein (trap)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
SDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGEALIQTAYGEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ATTENUATION PROTEIN MTRB
publication title How to Change the Oligomeric State of a Circular Protein Assembly: Switch from 11-Subunit to 12-Subunit Trap Suggests a General Mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 3zzqA00
5EF0A 2ZCZA 2EXTA 5EEXA 5EEVA 3ZZQA 5EF1A 2ZD0A 5EEWA 3ZZSA 5EEYA 4B27A 1C9SA 3ZTEA 1WAPA 2ZP8A 1UTDA 3ZZLA 1GTNA 5EF2A 5EF3A 5EEUA 1QAWA 2ZP9A 2EXSA 5EEZA 3AQDA 1GTFA
chains in the Genus database with same CATH superfamily
1SOQA 1RZ8B 4L05A 2YZ8A 3GGWA 1D9KD 1RUAL 2CPCA 2CHNA 5E5LA 3LN5B 2AERT 1HZHH 2DQEH 3DK2A 4OCSH 2IDCA 2CAKA 2CO2A 3NJXA 2RAMA 3ZKXB 2ATKA 2KDYA 4BFIA 3OPZL 4N6RB 5EU7C 1EFXD 1TTAA 4KI1A 2VSCA 1ZLDA 3LIUA 3SDDC 4DETA 2IDTA 3QRLA 2E9GA 3EDKA 4MJIA 5C09D 2A77H 4R7XA 5IROD 1GZPA 4HU2A 3S8GB 5IJKA 3QEGH 2CBMA 4G8EB 4QRRA 5HGAB 1UACL 5ETUB 3US1A 1Q0XL 1INQB 3RY6A 2OMUA 4U1MA 4X99A 1HWGB 3X11A 5CM1A 3BPOC 5ICXB 5FHBL 1WA0X 3SN6N 2B1OA 5ALBL 2AXGA 1T0NB 2PCPA 4D0BA 5DUPL 2VDPL 2Z7ZA 3T2NL 4X9GA 2G2PA 1TVHA 3SJVA 3BCFA 1VFBB 5FDWA 2VT0A 3MBED 4RGOH 3U83A 3UBFA 3K71A 2CDGA 1KELH 3DGCR 1T0MB 2CE6A 3QUZC 4Y9EA 3M45A 3FSAA 4C83B 2MPAH 1VEMA 3VFVB 4BDVA 4H8QA 4MNGE 4GH7B 4KKQA 4KKAD 4YX2L 4TULH 2VMJA 4XH2A 2H2PC 2MQ0A 2MTAA 1MVFA 2BOCA 4OGQC 4NNYA 5CP7A 2VABA 2L7UA 3OPZH 4YHIB 1JNLL 3FHQA 3SDDB 2ARJQ 5B22A 4KZCA 4AJVA 4KNUA 4PRPB 2OZ4L 5LDUA 2AFNA 2WWKO 4PJFB 4RFEB 4CJ1A 4LVEA 5DD3L 3WY2A 1WWAX 4LKCB 3C5JB 1BZDA 1UACH 3F64A 3CFBA 3FU6A 1CR9L 2CKBH 3UTTA 3BPOB 2Q86A 2QZQA 3B2XA 3QEUB 3QJRB 3T6ZA 5INDB 4KK6C 1VA9A 2I26N 3TWYA 1YPZE 5FHBH 3WEBA 4ELMF 2I25N 2R2EA 3SKMB 3F01A 2J6EA 5ALBH 3RGVD 3ZLQC 4BXSV 1UCTA 4GUQA 5DUPH 5CZVL 2VDPH 4KO7A 2EXWD 3T2NH 2HRPL 4YDLB 2YQGA 4K71B 1V8HA 3BZDA 1AXSA 2BPBA 3FFOA 2P8MB 2Q7YA 2FR4A 5D1XA 2XETA 3F5WB 1FHNA 5D2LF 4HWBL 3QUZB 4UQ3A 4X6FB 3GD1C 5BO1L 1VACA 3NN8B 4TNGA 4BKLB 3QQ9C 3NZHH 4HLEA 2X87A 3CDYA 2J8HA 4ELME 2H0FA 2C3XA 4O2FA 3UG4A 1CXLA 4NGHL 4YX2H 1BG9A 3QDME 3VRLF 3IPEA 1USQA 4LHUB 4PJ5A 1WQVT 4XPFL 6PAZA 4CN6A 1N5YL 3Q8FA 4IMKC 5TE6L 1JZ3A 1LMKA 1VADA 3PLYA 5I8KH 5SX4H 1OF2A 4AQAB 1F56A 2NTFA 5GSRA 2XQ0A 3AAZB 3NABL 5D2LE 3RNKA 1FZJB 3VFOB 4ODVL 3BPNB 3OX8A 4WW2A 1JHTB 5DD5L 3ZKSD 2XX0A 4Q9BA 2OZ4H 3DUSB 2E5EA 3L3GA 4U2ZA 3DK0A 5DD3H 1JPSL 4Q89A 3IF1A 1N8OE 3AC0A 4N1CA 1UGNA 3QZBA 4WU5B 1G7LB 4IU3A 1TCRA 3P69A 1CR9H 2XDHA 5DVKA 5LGHL 5MEND 3EJTA 4UT6A 3RB7A 1O7SA 3OM3B 1RH8A 4K7PX 4LPWA 5F7WC 4QYOA 3BIKA 3IPFA 2P9RA 3EYQC 3LY6A 3O0RL 4ODXA 4WFED 5DZAA 3BDBA 4AQ1A 5CZVH 4OF7A 2R1WA 4N0UE 3BVXA 3X13B 4Z7WF 1P4IL 1JFQL 1ZHLA 5AENA 5BVJB 4HV8A 5IBTL 3GSVB 4F5CE 2PNDA 1ODAA 5DS1A 4HWBH 2YEQA 5BO1H 4U7SA 5BOJA 4M3JA 4XXCC 3VW3L 1MHPL 5DS2A 4GRLA 3GB7B 1NWPA 3VJ6B 2G75A 2LU7A 1YMME 3G3LA 1AO7B 4NGHH 1NAML 3TWCL 5EA0L 3VI4F 1INEL 1KY7A 4XPFH 4LSPL 4Z7WE 1N5YH 5TE6H 5HYJB 1YEEH 3QW9A 4BELD 4Z3EA 1OCRB 3JQOB 3OZLA 1QRND 3QJXA 4ODVH 2EEFA 3BO8A 3QH3A 1PEZA 5DD5H 3IFOB 4QNPF 1QPXA 3SEPA 4I2XE 3GNML 2VDRL 1XXDC 2Y1ZA 2M2DA 4ORGB 1T83A 3B1UA 3IN0A 3SZ6A 3LB6C 1WZLA 5C0AD 1BVKB 3W11C 3QUXC 1JPSH 3VI4E 4OZIF 4P5KB 2YBGA 1QO3A 3VXSB 2HT4C 3ZDZF 3DV4A 4W4OA 4CMHC 5LGHH 2V5RA 5AKRA 2IDFA 2ITDA 5GS0C 5DRXB 2Y5TA 4KKNA 3ZE0F 4BYHA 2JJTA 4QNPE 4NSKB 3D0LA 2OYMA 3OQRA 1HL5A 3NK3A 3BW9B 4AV5A 1Q1JL 3HG1E 2NX5B 5HYQA 3CDGA 5KSUA 4OZIE 5FW7A 3GWJA 1TZAA 1P4IH 5IBTH 2WTRB 3QXWA 3CLFL 3ZDZE 1EAQA 3LOWA 2UVEA 5F7DB 2CIKA 3GIVA 1YNKH 3PQYA 3VW3H 3ZE0E 5KBPA 2K8QA 3Q9PA 3AXLB 3QZOA 5IVZA 4LBAA 3HB3D 3ZQXA 3HN3A 3OGOE 1FGVL 3W2DL 1A9BB 3TWCH 5BW7C 1DHKA 1Q8MA 1FZOB 1SM3L 2NR6C 2ZZUT 4MCZA 4LSPH 4TS6A 4GAYB 4ZW8A 2X09A 2Q5BA 3MCKB 4U49A 2E27L 5CWSB 2ZXGA 3TCTA 4ODUB 4LOFA 1C08A 3GNMH 5I1GL 2VDRH 2WXGA 3TEUA 4A7GA 4PV9A 4FFVC 1FVEA 5AUMB 2ZOTA 4OM0L 2I7SA 4DOHE 2VDOL 2DKUA 4OB5L 1FRGL 3G6DH 5B3SB 2CMRL 3NCCB 4R4BB 2GJRA 1R3KA 4FQJL 3VXNA 3D5OF 2WBJD 4WTZG 3FOLB 4PWIA 1CE6A 4I3RL 1KBBA 2YAEA 2AJ3B 3A21A 1Q1JH 3QIBC 1KPRB 3PRZA 2FHFA 4AVJA 4HUWB 2YLHA 5LCVL 3STZB 3RVVC 1DVFC 5IK3B 3NSJA 4QI3A 1XGRB 1KIQA 5E4OA 3I3DA 3PXLA 3CPLA 3CLFH 1S7VA 1HCFX 1MCHA 2DYPD 3WE6A 4EAEA 2PMZA 1UFGA 3HCVA 4FTVA 2ZUQC 4YFLF 1AH1A 4IQHA 2OMXA 2UWEA 4HS6B 3ES6A 1A7PH 4MKTA 4U1GB 5E56A 3WUWG 5IB1B 5GS1A 4OUOA 1SM3H 5CR8A 4LK4A 2CUHA 3BH8B 1ET5A 3OBAA 2D4DA 2MEJB 3CBKB 5DJ6B 5LNDA 4PEEA 1WGVA 4HP5A 2ZG3A 4FG0A 2E27H 1F3JA 1IAIL 5SWZA 1UWXH 4J3OC 4YSOA 3BP4B 5I1GH 1KGJA 1IQDB 1E4KA 1GMIA 2HJKB 4MB1A 2NNRA 3HUJB 1HE7A 3LN9A 3MRHB 4GUPB 4J27A 4OM0H 5IQ7L 2VDOH 3NCWA 5IQLA 2BIOA 4MZRA 1MCIA 1N6VA 5E5MB 3DX6A 5J6GA 2YK1L 4OB5H 1FRGH 2X53A 4OIIH 1RAMA 1B6UA 2CMRH 4L3AA 4WO4B 3JWNG 1HHHA 2O5ZL 3BLBA 4GSQA 3AS0A 1OW0C 4B9PA 1RZPA 4FQJH 4DP5X 1IM3B 2VITA 2UZYB 4NLHA 4PCTA 3IXAB 3KW8A 3OR6A 4JL2A 4I3RH 1Y6KR 4OF6A 3D2UA 2WB7A 1ODUA 1DVFB 4M61B 1WD9A 5LCVH 1A4CA 1QFWL 3DROB 3FB6B 4AK2A 1YNTB 3A24A 3KWVA 1Z5YD 5H2BA 4NQCE 5T3XD 5IHZA 3U46B 2AJZA 3NSXA 2EYRA 3VE0A 4JFOB 5B3JF 5LDSA 3MLXL 4LP5A 2AAVA 1L9QA 3KJ4C 1UB5A 4JFWA 1TO5A 3KH4A 3ZE1F 3LEYL 4WI6A 3V5KA 2AKRA 1DO5A 4S2SA 2IXQB 2YPVH 4YSDA 4EQ2A 3WY1A 2R23B 3IU4L 4ABWA 1GHFL 1MF2L 3BZFA 1A64A 4S1DC 3QIUA 5HYIA 4RGND 4AIOA 3VDBA 3F12B 1HL8A 1ZPUA 5B3JE 5A6MA 1IAIH 3L7FB 2WV3A 5J56B 2IH9A 4FHKA 4LRNL 5G5DB 3RTQC 4LCYA 2VDQL 5I1DB 2VWEC 3V0JA 5C0RH 3D1MC 2E8ZA 4HAGA 4NQDD 3ZE1E 3WNPA 3K6OA 4HSAC 1AIFA 4IBTA 4Y5YC 4OCLC 1XCTA 2CO7B 3C6SB 1B4LA 5BRZD 4DKAA 4XP6H 4XBEL 2XWZA 3L4ZA 1H6UA 2YK1H 5A7BA 1E4XI 2WWOA 4F91B 1SDYA 4P3DB 2ED8A 1FUNA 4GKOA 2O5ZH 3OSVA 4GW4B 4HPYL 4NOFA 1E9OA 3V5HB 2P46B 3E8UH 2V7NB 5GGUB 5T1KB 4YPJA 2QSCL 2VQ4A 1XGPA 1DCEA 1KFAL 3NRQA 2DW5A 2X1WL 1QFWH 3FUKA 4KAQL 1BFVL 5DRNA 2OCFD 2N59A 4ADIA 3MLXH 1QFHA 1MJUL 1J10A 1K72A 1W8EA 2C3VA 2C4XA 3HZMB 2AVFA 3SPHA 5KW9L 2X9YA 4OI7A 1FNGA 2V5TA 5ABZA 2HT3D 3O6FB 3LEYH 1C5DB 1DBJL 3PWLB 2IAMD 3B5HA 5FUZL 1VKXB 2P5PA 3GXFA 5EOCL 3FU8A 5F21B 3TVMC 1UURA 3IU4H 5FECA 1GHFH 1MF2H 3IYLW 4V33A 4XXDB 4BZ2L 4LHUG 1LO5B 1SZNA 4OGZA 1TVBB 3S48A 4QCIA 1MCOL 3RTQB 5IMMB 4MAZA 4CGUB 4PRAB 2HPOA 2VDQH 1WBYB 1G4RA 1RJLA 2FWOB 2FH6A 2XKSA 3MXWL 1UOWA 3C8DA 3QARA 3H8NA 4XBEH 4A63A 1A7RL 2BSSA 2HJLB 3MCYA 3BUQA 1QZNA 3NUKA 2WGXA 1G5AA 4QR7A 4BFKA 1VAHA 4P4KC 3QNZB 2Z31D 5D1QD 1SQMA 4CSTA 1MNUL 1KWGA 3LVTA 3GJEA 5IVOA 3UZEC 5L4JA 4HPYH 2CO4A 3V0GA 2RFXB 2CHDA 4JDZA 3IFNH 3IMWA 1RLWA 2M1KA 2OMTB 5AZEL 2QSCH 4FYQA 2R29L 1OSPL 3CCHB 1KFAH 1EZUA 3JTTB 4QHLA 4KAQH 1BFVH 2OYPA 2APFA 3J7HA 4P2OB 2F7RA 4JFQB 4M8VA 5CCKL 3LKRA 5MP6L 3DI2B 2XN2A 4RZKA 3QRFM 1A3ZA 1MJUH 3BJLA 1I1AB 3Q5TA 1AZZC 1U93A 3FT3B 4ZFOB 2WIIA 4ZMZA 2GBTA 3QT2A 3MI6A 5FC9A 4MDJA 2FLBT 5FW8A 2DIAA 3KVQA 1CYXA 1W8OA 2BHUA 5EOCH 1M7UA 2CALA 5ID0A 2CH8A 4I9WD 4RMQA 4BZ2H 3ZPDA 1BIIB 4NRZB 1AQHA 3UO1L 5IQ9A 5JW5B 1ZSHA 1MCOH 4C4KT 3BSZA 3VRIA 4U7KA 5D7LE 1RERA 3VXPA 2O5YL 5CP3A 3B8YA 2AXHA 2CO6A 3MXWH 3V0EA 5LG6A 1JZIA 1MHCA 1JVLA 1IAMA 3Q44A 5E00B 1KB9K 3K8MA 1A7RH 4NC1E 3BQUA 5JDJA 5CIPA 1DDTA 3K8LA 4LP8A 3WEXB 1T66D 1MNUH 4D0DA 1JVOA 4IS6A 3PAUA 2NT0A 3GUTB 2EECA 5A16A 1OAZL 5IMOA 5IWLC 4APXA 4C54A 4B9ZA 4I1RA 5FGCB 3ULVF 4BHUI 2R29H 1XXFC 1OSPH 4WTZA 4APQA 2VMCA 3VMNA 5LNEA 1ZV9A 4YDZA 4WI7A 4AKOA 4YDMA 1ZV5A 4AJYV 1HILB 5CCKH 5MP6H 2FHBA 1DQQB 3HZVA 1G9NC 2A73B 1AZVA 3EO1A 1TDQA 2VLLA 2DS4A 1WAAA 3BVDB 2AV1B 4A2FA 3V8OA 4QPEA 5DEFA 4B97A 3PXJA 3GO1L 2R0LL 2HLAA 3ULVE 2P52A 1NC4D 2GW5A 5D96C 5C92A 2P3YA 1N9PA 2EEAA 4MA3B 4G6ML 1R1CA 5JHLL 1W0WB 4LCCA 3RWHA 1UD5A 2YD6A 4TSBL 3UO1H 2RQ8A 4JFYB 3PV6B 5GPRA 4YVNA 1IC1A 1COBA 3H1ZA 1G9ML 5AOLA 3PS6A 5D4IA 2C5DC 1RZ8A 3FQ2A 4JREC 2O5YH 2ED7A 2ZWLT 3S3DB 3HR5B 3LN5A 3WFHB 1HK6A 3AT0A 1IJNA 1BFTA 5GZND 2Q0ZX 4HKXB 1L9MA 1T03H 3T0DA 1TU2B 5TJWK 5LGKA 3VCLA 5FA4A 1UB6B 1QNIA 4Z7IA 3ZO9A 3LRHA 4YR6A 4UQAA 3L1OH 5EBWA 1LP9B 2GK0B 3SOBH 4A2MA 3D06A 1JK8B 5I82A 2NNAB 3I75B 4MJ5B 5TF0A 2J5LC 3CN1A 4PJGA 1OARL 5E5RB 1K8IB 4K7PY 3FRPA 1OAZH 2CD0A 2FGZA 2I9TA 2B0SL 5ETUA 1ONQA 4DP6X 1INQA 1WWCA 1S5HA 3I6KB 3ZMNA 3MBXL 3QHTC 4MDRA 2EUZA 1SJHB 1E9PB 4KC3B 1D5IL 3FZUC 1QA9B 1HL9A 2KKQA 3C6LA 4RRPM 1FG9C 5CGYD 3QQNA 3T4AC 4AYFB 5F93C 1EHAA 3NEOA 4ZAKC 5EC1B 2WSKA 1QW9A 1T0NA 2X9XA 4HZ1A 4YHPB 5J5EA 4QYAA 1V3JA 3QJSB 5GRJL 3GLZA 3OQ3B 3L2MA 2DQTL 2XVKA 1VFBA 3GO1H 4G71B 2R0LH 1XCQB 2Z1PA 3GMOA 3U2SB 4MJ2A 5LWYL 1X5HA 2F68X 1OGAB 2BNQB 1NC2D 4PVNA 4G6MH 5JHLH 4M5TA 4RH4A 2D7OA 4C83A 1L7TH 2DM2A 2Y2WA 4L4TE 4NKDB 5FHAL 3VFVA 1ZHKB 3VD4A 2WZ6A 2QPUA 2XPZA 1OTUC 3O2DA 5F8QC 2JKRM 1SYVB 3FT1A 4JREB 1G9MH 4GY4A 4WHTB 4BHUA 1W91A 2ZOKA 4WU7B 4WFHE 5J12C 1E0OB 1YUHA 2DBLL 2X1XR 1NEZB 3CZSA 1MI5D 4JRWA 1CGVA 5A2LH 4GAGL 2APWA 3ZHDA 4YHIA 2RD0A 3SDDA 4ZO8A 4MD0A 4L8CB 2EZ0D 4CDGC 5BZDA 1CT8A 4GS7C 4NPJA 4XMPL 4EDWH 3VFSB 5IB3B 2Z7WA 3HW7A 2J5LB 1ZLSH 4NQEE 1PSKL 4RFEA 4OM1L 2NNCA 4M3KB 1OARH 5LHDA 3EBHA 5I17B 5KVEE 1AG0A 3DV6B 4OUUB 2B0SH 5B7EA 3QO0A 1UYWL 3MBXH 6TAAA 3GJFH 4PREA 4FNUA 3ECUA 1D5IH 5HHOB 4YHYB 3UTPD 3FULA 2ZUYA 3NP4A 2EEDA 2AZUA 2BOBB 4NKOB 3HS8A 4JL1A 3CHXA 4RQQB 1YN6B 4A6YL 4YHZL 2WO2B 5E9DD 1BXAA 5GRJH 5I6XB 4FOMA 4HK3N 2DQTH 4RLDA 1IVTA 4PRIE 4KK8C 5E0QA 3F5WA 4A38A 5LWYH 4X6FA 3QUZA 3NN8A 4BKLA 2Y36L 1C16B 2ZPKL 1E4WL 4XMLL 4MB3A 4Y1AB 3SDCB 4XE5B 1IAIM 3FB7B 5DXWA 2EEXA 3VXOB 4BSWB 3Q6GL 5L2KB 1NWOA 2D3JA 4RAUB 2P44B 4WWID 3SDAC 3TONA 4MYPA 1MG3C 5TDOB 1CLCA 5ACLA 2LAGB 4P9ML 5J12B 4XNQA 3BQVA 1N6QH 4OR1A 1XZ0A 1KF9B 2DBLH 4AQAA 1KGCE 2ENJA 4JO8A 1FZJA 3VFOA 1JGIA 1U3JA 2IPTL 1JXJA 3V4VL 2YXMA 3E6HB 1JHTA 4L3EA 5F3HA 2P5EE 1WDAA 3OKDB 3UFIA 1JXDA 1PS3A 3JXAA 5F0JB 1S2EA 5F0MB 4ZMYA 3DUSA 1EGJH 1T1WB 1I3VA 4QJ3B 1PSKH 4JM2C 1XF2B 5A2FA 5T5NF 4ZNEE 1G7LA 4LARL 5I8EA 2EE0A 2Y25A 1UYWH 1QFWM 2H41A 4B5EA 1S78D 1IEHA 1WS8A 3EH4B 1BZ8A 2WLZA 4CU7A 2B8OT 4MJ4A 1JZ8A 3FTXA 3RY5A 3WTWA 2ZCHL 2LQRA 4WGKA 5MHSE 2RMNA 5E2UL 1I9IL 1YYLL 1NIAA 3PG2A 3MV7E 5CMAB 4EZKA 2CDFB 1E7VA 1U9KA 4A6YH 4YHZH 3X13A 1A14L 4FE9A 4N0FB 4NLAA 5BVJA 5EF2A 3GSVA 5EOQL 3ZZ1A 4P59L 2EDOA 3RIAF 1LHZA 2Y36H 2ZPKH 2WNGA 1E4WH 1XF4B 4XMLH 5FYJU 5J0BA 5DVOA 2W8CA 4GP8B 5JDSB 3GB7A 3VJ6A 3Q6GH 4ODSH 1VFAB 2YKLL 5EU6E 3ZR5A 5CAYB 4IMKA 3V8CA 1LO3H 2OR8A 2NYKA 3QIWD 4P9MH 4PVMA 4FG2A 1XDTT 3F2LA 3FTGB 4LEXL 2IPTH 3V4VH 5KYUB 3PFQA 3IFOA 1HCZA 5DTFA 3FOMB 1JPFA 1RHFA 3B2PA 2R8SL 4ORGA 1JPTL 1A1NB 1YMHB 3MJ8A 1DQIA 5AW2B 3LNGA 4P5KA 1IAOB 3CC5A 2VXQL 1IKNC 4LARH 2WZPA 4GO6B 5D70L 1WK0A 2PYEE 1O9VA 4GQQA 5FV1L 1QBAA 3R06A 3ARED 3VQLA 1T04A 2ZCHH 2NUTA 1NBCA 3H7LA 2KLSA 4HIHA 2C1PB 4NCDA 5E2UH 3ROLA 1I9IH 3FQ1A 2K1MA 2NX5A 3VQ1C 4K8RL 4IRZL 2IPKB 1I8MA 1A14H 2ITCA 2VN4A 4HZAA 1YEIL 1EZLA 1UD8A 3CLWA 2WTRA 3FQNB 1AGFB 3QG7L 4Z7UF 4XXCA 3WELA 4N2GA 3CHSA 1F02I 3COOA 1FAKT 3SKNB 3EH5B 3BGFC 3AXLA 3HKFA 4O02B 4ANUA 1HKLL 4WI9A 5I0DA 1ZA6B 3MQIA 4MJID 2YKLH 1HHJA 3NZ8A 3G04B 5CZRA 4DEPB 5HYSB 4I87A 2P80A 2DQUL 3V55A 4QRRD 2ADFH 4X5WA 2R7EB 4F37K 3S98A 3RX7A 1AI1L 1BVNP 4Z7UE 4I0PC 4LEXH 5CWSA 2EIZB 5CCJA 4E68A 3NJVA 2X05A 1FVDB 3RZWA 1HH6B 5FOBB 1ID5I 4N8UA 5HDBB 3MRRA 2R8SH 1AHWC 4BM7A 1I4FB 1MAKA 5AUMA 1JPTH 1IV8A 3SJVD 2WWMD 4YSRA 1FPTL 5AOMA 5CFAA 2VXQH 2GT9B 2BNUA 2BFVL 2VE6B 3GMQB 1CICC 5D70H 3TJPA 1UTDA 2F53B 2JKTM 3BYYA 3FUJA 1AR1D 2FJGB 2V9TA 4QTIH 1F97A 3LH8A 4NDMB 4PY8J 2QLVB 4K8RH 5B38B 1KPRA 1PBYA 2IWGA 4UF7C 1S9YA 2F54E 5CLTA 2GUOB 5IK3A 4L18A 1YEIH 2V9UA 4GG6F 3BMWA 3SPGA 3EDEA 3QG7H 1Z0MA 4D9QE 2ED9A 4IKLA 2NQDA 4X4MA 3MU3A 4YHOL 5C0ND 1ZS2A 4YSTA 4JZOB 3K2KA 4UWQB 4QRUB 4QLWA 4L4VA 5H4YA 4RA0C 1B3JA 4GPVA 1E28B 2VZSA 3N44B 2NR6A 4HS6A 3QULB 4YHNB 1A7QL 5F9WB 4O2CB 3QZWB 2DQUH 1JTPA 2Y7MA 4NO2B 5E51A 1AS8A 4AUUA 4K3DL 5DJ6A 3CFUA 4LMQE 5HI4D 4WJ5A 2Y72A 3UTTD 2OL3L 4OCXL 4G9FE 4X7EC 2JQZA 3FH7A 4QHKJ 3QE5A 1G0DA 1SDAB 4JDEB 3BP4A 1AHWB 3BVNA 2HJKA 2XVLA 3DIVA 5DA0B 1L0PA 4M48L 2XIBA 1XVSA 3BUIA 2DMKA 1SBBA 1B0IA 2XXGA 1FPTH 1HXYB 2NY0B 2PLTA 3QC5X 3RG1C 5D1XD 1JGEB 2IANA 3SZKC 3MLTA 5K59F 3QFJE 1G0YR 4W68A 2BFVH 5J11C 2X7LB 2XX1A 3KLLA 2VGLM 3GM8A 2VNCA 1KXHA 3BP7A 4P3CL 4MQXD 1IM3A 1NCBL 3IXAA 4M5YL 4IJ3C 2FQFA 4FXGC 2OXGB 2ZUWA 4PU2A 4PJCF 4PJ5D 1DVFA 1SJMA 4M61A 4PWGA 4YS4A 2Z92B 1CPUA 5EB9A 4J4PC 5BUAA 3GSOA 5I0XA 5J13C 3F00A 4L9LC 5K59E 1HIML 1EVTC 3U46A 2B3RA 2BOLA 4JFOA 2O72A 2WUBH 4JZJC 1QFUL 1UEMA 2DZEA 3O2WL 4FXKB 3IS1X 4YHOH 3L13A 1JZ6A 4OFVA 2FJFB 5DFWH 3AQYA 2JCWA 5F6HJ 4PRHB 5F7FA 5I73B 2IALB 5KAQF 2IXQA 7FABL 1A7QH 4PJCE 3WD5L 5CN1A 4IMLA 3UZVA 3F7PC 4K3DH 1MFDL 5KSAB 1GJIA 1RPKA 3D3VE 1OP5K 4JMNA 3GUFA 3F12A 1UD3A 1DN0B 5G5DA 3VXMB 4A55A 5B4MD 4ZZKA 5E2WL 1KIPA 1NEZG 2PR9A 2PPAA 3JYCA 3L4UA 3C5XA 1RZKH 4ZUTB 4G43B 4M48H 4Y4HC 3ZDXF 4HKJB 5E7FA 3MRFB 1OAXL 3C6SA 3LPFA 3Q06A 2X4TB 2ZWSA 5EMYA 4LCUB 5J11B 1GS6X 3GSRB 4QMEA 4P3DA 1OW0A 2X1PA 4P5MA 2RCSL 3AW5A 1FO0B 4GW4A 3RL1B 2ERJC 3N91A 3V5HA 1QLFA 5CEZD 2N1KA 4GRLD 5C97A 1NCBH 4M5YH 4KV5F 5T1KA 3TN0B 2COVD 1DVSA 3P3SA 1HINL 1KACB 2WKLA 3IAPA 4I89A 3ZDXE 3OF6A 1M2VB 4YZFF 4D7PA 1Y1DA 4HCIA 1N8ZB 3GK8L 2W38A 4PTTA 4L9LB 3PFUA 2JTDA 4MA1C 4J5VA 1CZ8L 2BIHA 1G6RB 2RA1A 4F1SA 1HIMH 4E2OA 4WEEA 1IIIA 3SO5A 5AW8B 4CW1B 5CSZA 3O2WH 4MA8L 3HZMA 5IMLB 2XFXB 1KYDA 1I7RB 1HI6A 2OQJA 4KV5E 2CZNA 2OULB 1MOEA 3GM0A 4R7NA 4ZS6C 1NTDA 2XHNA 3S2CA 4OGXL 3ULVC 7FABH 1VGKB 4YZFE 2NT1A 2QGDA 3BLPX 3QR1A 5IKCB 3DBXA 5EC2A 3CXHJ 1VKXA 1OP3H 2FX8L 2QTEA 1MVUA 1PX3A 1XBRA 1E40A 1MFDH 1ZMYA 4P46C 4XXDA 4XNXL 3U7WL 2GABA 4HXBL 1B0GB 1LO5A 1A6TB 1TVBA 1YEKL 4XR8C 3RTQA 1Z3GL 3NFPB 2ZXEB 4KQ4L 1O6VA 3O6KL 5E4EC 4XODA 2WXRA 3QJUB 1C12B 5E2WH 1WBYA 4NXKA 4OJFL 2FWOA 4Y4HB 4ANWA 2WSPA 1WEJL 2FSEB 2WXFA 5IUCA 1OAXH 2ZIDA 3ZIMA 3IETB 2N4IA 2FGWL 4XNAA 1HHKB 2XI9A 3MTXA 1QRKA 2BVUA 4JW3A 4OQ1A 4WHYH 3QNZA 5D6DC 3C87A 3DUUA 5D5MA 4Z95L 2RCSH 2ERJB 5HYEA 2YPLB 2EYSB 3PQYD 2G5BB 1U8MB 1BQHA 4L5FL 3WIHA 1HINH 2A74C 1BQRA 2JKWA 4JFEB 4YL4A 5BS0A 5E08L 2YD0A 3CCHA 4MA1B 3RHWK 1MW3A 1KBPA 3JTTA 1G9EA 5C08E 2X6CA 1CZ8H 1NPNA 2J1YA 3L1GA 2WLHA 1L9PA 3EJSA 3HI5L 3LEVL 4XPTL 5E9NA 4MA8H 3GKWL 1I1AA 2H0PA 2Q87A 4PMEA 3N04A 3FT3A 1LNUB 4ZFOA 3C6EA 3M1BA 5CLYA 3EHBB 2CO3A 4OGXH 5HHMB 4I1NB 3RWJA 3IN2A 1Y0LA 4E9VA 1BIIA 3QCUL 4NRZA 4XNXH 4HXBH 3U7WH 4G9DB 1YEKH 4KQ4H 3O6KH 2VR3A 1YEJL 1AJ7L 1P84K 4AIEA 1P53A 3ARBC 5DF0A 2VL4A 5F1IB 3SD5A 5J6HA 3ME0B 2XWBB 4OJFH 2YARA 3TT1L 3DRTB 1SY6A 1WEJH 1FYTB 5DRWB 1XGQB 3C08L 1ES0B 1T1XB 1TZHA 2HFGL 5E00A 3QQ3B 1HWWA 4P4KA 2FGWH 4ALAC 2XZAL 4G2AA 1R3JB 2JXMA 3UZEA 1I8UA 4YSAA 2X4SA 1OAQL 4Z95H 4S11A 5A3ID 1AC6A 1HOEA 2R2HA 5L4MA 1HQ4B 5HPMB 3CZLA 3GUTA 1H6TA 3BVTA 4G80A 4L5FH 4FTVD 4WI4A 3OJ2C 2YAPA 4PJIB 3BPCB 2NPLX 5E08H 4MNHB 4H40A 5CLZA 2F2HA 4KO9A 3V9EA 1QSEE 2KBGA 3WLBA 5CINL 5I1LB 3DOSB 1JGDA 1FNFA 1JAEA 2J1XA 3MV01 3UL4A 4TQHA 3WFCL 1GW0A 3LEVH 3HJEA 3HI5H 2A73A 4HKZB 1M6OB 4XPTH 5DJAA 5FYLD 3GKWH 5SWZD 3UJIL 3MFFA 3HMXL 3B8SA 5B1BB 3VGEA 5I1EL 3OJVC 2AXJA 2DEXX 3RJOA 4ZFZB 3MLYH 2VL5B 4WSKA 2Z35B 4Y19B 5GIRB 4QRTA 1OSZA 4PJXB 1SHXA 1UHVA 4KH9A 4MA3A 4FFYH 2ZF9A 1W15A 4LFHG 5HYSG 1MLCB 4GKSB 3QCUH 2Z0UA 4MNGA 4GIAA 4JFYA 3PV6A 1BLNA 3ARBB 3MV8B 5F2FA 1YEJH 1AJ7H 1W6LA 4NJAH 1XGTB 1CG9B 4QT5B 3D2UD 3QJHB 3TT1H 3HR5A 3WFHA 3PDGA 3O3EB 4C8XA 4HKXA 4YHKL 3C08H 5FA3A 3K7UA 1NGYA 1TU2A 3VD9A 3HPLB 1Q4NX 2HFGH 4POYA 1UB6A 2XZAH 3WBDA 5BXFB 3B9VA 3MJ7B 1U3NA 5DLML 3L4YA 4K9EH 1A7BA 3IJSA 3RVWC 4NX0A 1KSRA 4C4UA 1NCAL 3I75A 4MJ5A 1KCRL 5IWLA 1X9LA 3MR9B 1JERA 2DWSA 3V6BR 4A68A 1YDPA 2ZOWA 2P1YA 3KEHA 3MJWA 2YLKA 2CQVA 2EDNA 4PJBF 2YD4A 3FQ4A 5F7AA 1QVOB 1SJHA 1YPZA 2B2XL 1E9PA 5F89B 1QA9A 2FECL 4PMFA 3CVDA 2ARJB 1PZ5B 5B38G 3QIUD 5LAPA 5CINH 2ADGB 5EC1A 3WFCH 1F4HA 3HS0C 2MOGA 1F11B 3WN6A 4YHPA 2ZF8A 1PLCA 1GCYA 1E5ZA 3UJIH 3HMXH 2WWKT 1J5DA 4JKNA 2YXVA 4GO8A 4ACPA 3P2TA 1NOFA 3KMDA 1MCWW 2EVJA 2EDJA 1XCQA 3U2SA 5DHYB 3OZ9L 4PJBE 1OGAA 2FT6A 2F6AA 2BNQA 1N7MH 3RNQB 4ELMA 1P5VB 1KNOB 3SY6A 3QZWG 4NKDA 1CQYA 4N0YL 1ZHKA 3FB5B 4TNVF 1PVHA 2VZUA 1OAJA 1QR4A 4NQXB 4DPAX 7TAAA 4NJ9L 1DVTA 4PGBA 2PO6C 3JTSB 4WHTA 4BWTA 4FCAA 4PM1A 4P49A 1DJXA 3MJ9A 3NESA 4M5SA 5D2LA 5AVUB 4YHKH 3MTRA 2N0KA 2Y1AA 2Q20A 3P30L 5E8PB 5T3XL 3LYRA 5JLZA 2XXCB 5I0VA 2K6YA 1KDJA 2KDGA 4FF9A 5DLMH 1TTUA 1NFIB 1Z0NA 4FZ8L 3VFSA 5IB3A 1F18A 3ISRA 3VAEA 2X4PA 2EKJA 1NCAH 2FB4H 3WKYA 3KLHD 1U8QB 1QWHA 3FUDA 2WGNB 1JPST 4TNWF 1KCRH 1QBBA 3CXDH 1B3IA 2L8AA 5IOKA 4LDOB 2WXHA 2MPVA 3IJEB 4HIPA 2XRAL 5I75C 2B2XH 4JPWL 1F58L 4JRYB 4FLQA 4JRFA 4ZAKA 4NQTA 4N9GA 1JZHA 3KE0A 1CBVL 3MX0A 1J1XH 4EIUA 2V3DA 1KTRL 4RQQA 4N0UA 1YN6A 1V27A 3B9DA 4M8UA 5E1GA 2WLMA 2Q7NA 1W0VB 4MQ7B 2H5UA 1FCGA 4FS0A 3V4PH 5JPMC 1MHHB 1H3GA 4OZHF 3W39A 3G5XB 3OZ9H 2W07B 4AT6A 5D2NE 2FBJL 4Y1AA 1T1YA 4QY8B 5HYFA 3ZVVA 4U6HB 3FB7A 3VXOA 2ZCKL 1YMMA 4WDIB 5L2KA 4N0YH 2OR9L 4PGJA 4WFEE 2GIMA 4CC0A 1UWGL 2QVIA 4MS8D 4Z7WA 4YDKH 4NJ9H 4S0HA 4JPVL 2NXYB 5TK2A 3U4EB 4OCWL 4OZHE 1TFPA 1TMCB 3KL0A 3LZLA 2NXZB 4QD2E 4XNYL 4F8OA 3JWOL 3E6HA 4I2XA 1X3DA 4TUUA 5T3XH 5E1QA 4YLCA 4WQOA 3GSXB 4NNXB 1S4IA 3MCLL 2N3JA 2R27A 3MRMA 4FZ8H 1T1WA 4W9CC 3IMRA 3VI4A 4XI5C 2ZNWA 5SX4I 1XF2A 3DSFL 1HXMA 2PP8A 3GMPB 4LP4A 2V6HA 2PCXA 3KNBB 4WAFA 5I75B 4MCMA 5EBMA 2XRAH 4JPWH 1F58H 1QRNE 4GAAA 3NQKA 2PW1A 2XYBA 2CNZA 4J28A 5FAAA 5ILTL 1U0QA 3K81A 4XN1A 5TE4H 4BFGA 1CBVH 2YAHA 1T80A 3HG1A 1XF5B 4JLRB 1MVYA 1QASA 3OB0H 4GEIA 4PWJA 5C0AE 4N0FA 3T2PA 5JPMB 1ZTMA 2WKGA 4EZMA 2VLRE 4KVNL 1UWXK 2MQGA 1CLVA 3ML9A 1G7QA 5LXGL 1AOZA 1TTBA 1ADQH 3L3OC 3CMGA 4QHMB 2FBJH 5IY5B 3GHBL 2FWUA 3BQUD 4XMZA 3PIQA 1WAPA 4IK6A 4M1GH 3SDAA 1D6VL 1U8JB 4XVUC 3S4SB 5L0QC 3RGBA 3AFLA 2OR9H 1XR8B 1VFAA 4LPTA 1JXGA 4MJJA 2Q6WA 5I15L 5IFHL 3BKJL 1UWGH 3HI1B 3Q6FA 1EXHA 4WUKL 5TQ2L 1KGYE 3KPTA 3M07A 4EN3D 4GJTB 4OCWH 3ZYOA 3EOBB 3B7TA 4APQD 5E8EB 1ZLEA 1OANA 3FTGA 4XNYH 2VDNB 3OG4B 1RVFH 4XGZB 1AD9B 3JWOH 3ZTJH 5KYUA 4TUKL 4CN4A 4HGWA 3RX5A 1DUZA 5B39B 2GEEA 3UDWC 4JM2A 1CFTA 3HBGA 3CSBA 3OMNB 3I6SA 1C7SA 2BINA 3KPQB 1EJ8A 3DSFH 4WIQA 2IG2L 1XSKA 2OV0A 5TDNB 3MUGB 1AAJA 4IOSA 1RIVL 4U4BA 3A4DA 2VXVL 1MAML 2D2OA 2XA3A 4BUQA 2QHRL 5LN4A 2C1PA 2K3TA 3T3MB 5ILTH 1I9RL 4U4IA 2WY3B 1U58B 4G1MB 1JE6A 2DQGL 2BIMA 2IPKA 1U8HA 2CJTA 3NJFA 2EE2A 4DK5A 4KVNH 1UKTA 1AGFA 5LXGH 4P07A 3OAYH 1Z9OA 2UXTA 4PW3A 3NACL 1SPDA 1F5WA 4IKNA 3GHBH 2X3AA 1ACXA 4U6VL 1GYVA 1D6VH 3QS3A 5KTEL 2EDTA 3HZKA 5LJYH 5HYSA 5I15H 3G04A 4K3JL 3KPLB 5IFHH 4L0YA 1UD2A 3LHPL 1YEFH 1E5CA 4WUKH 5TQ2H 2PKDA 4A2DA 4B60A 1JZDC 2P7TB 2QV2A 3V6OA 2EIZA 1S7XA 3C6LD 3QXAB 3VXUB 5KYYA 1UH2A 3LNHA 4TUKH 3RUGB 2UUDH 3SBQA 1FVDA 5FOBA 1HH6A 5ITBL 1T7ZA 4PWFA 1Q9LB 1F42A 5KS9B 3KLQA 4G1EB 4WRLA 4RDBA 2VSMB 3RQ3A 1IKNA 2OMYA 2IG2H 5I1AB 1E4HA 2VE6A 4HZLA 2EILB 4KOBA 4YSQA 3O9WB 3BGAA 4ZOCA 3KVPA 1WCBB 2F53A 1P0SE 2E47A 3U0WL 1RIVH 3CVBA 4ZI8A 2VXVH 1MAMH 2DWDB 2QHRH 1Y1UA 3ZSTA 1NDGB 1I9RH 3A47A 1AS7A 4X8JB 2CXGA 2OFQA 1H3UA 2D3VA 1A7NL 1XGUB 4L1HA 3RX9A 2DQGH 4LSRL 3ZXAC 4UNVA 4JNXA 5HI3C 2GUOA 1PFOA 4NQCA 4I18C 2WP3O 4NM8L 4FZEH 3DO7B 5AAPA 3HE7C 3H9SE 3NACH 3SDDD 1VLXA 1RL1A 4U6VH 4J3BA 4JZOA 4TM9A 2GC4C 3W38A 1S7SB 5KTEH 1U8CB 1E28A 3CFJA 4K3JH 4YHNA 3BYTA 3LZPA 4O2CA 3QZWA 2XBZA 3LHPH 4NO2A 3HAEA 1SJXA 4NO0A 4NAQA 5A6LA 4MASA 3N41B 2DMGA 3HC4L 3SBWC 4QOKD 4WV1C 4Q2ZB 2ENSA 1N26A 2AJXL 2A83B 2VN6A 1VGEL 1SYSA 3TO2B 1WBZA 2FEEL 1AHWA 2SEBB 5EG6C 5ITBH 5LBSA 4Y5VC 4DGIL 3O41B 3FQWB 4G7YH 4B9KC 2WNKA 4JKMA 1HXYA 3OMAB 4JFXB 1JGEA 3WNKA 1CICA 2X7LA 5FCUH 2QKIC 2BLFA 3QUZD 1UUNA 4LKXA 3RIFF 4MBOA 3VXRE 1M3IA 1KCKA 2DY2A 5CGBA 3LJ3A 4JANA 4UNTA 3BT2L 3GTTA 2OXGA 3FBQA 1A7NH 1F4XL 4L1LA 4LSRH 2EDMA 3FH5A 4AMXA 4E42A 5BRZE 1J5OL 4D9RD 1OWWA 2H2PD 4JFPB 5DYOA 4MLIA 1OT4A 4PV8B 5C0FB 5EPMB 2XN9D 4NM8H 1OIOA 1JGLL 3BWAB 1CDGA 4FXKA 4L3ED 2HH0L 1QTSA 4LLVB 1ZXKA 3OWEA 4ZO6A 2FJFA 2G0KA 4PRHA 4U1NB 1NGPL 2IALA 3EFDL 1WHOA 1XMWA 3VD0A 3VGAB 3QAQA 1ZV2A 4HD9A 5TF1L 4BUGA 2VDLL 1K85A 4F3FB 3HC4H 4KK6D 1MCRA 2AJXH 4RA3A 1DN0A 3VXMA 1VGEH 5ADOL 1GIGH 3O3UN 2VLKE 2QSQA 4ZUTA 4DGIH 3NJMA 2WUCL 3QUML 5J9PB 3VI3B 3MRFA 3T2LA 2CGRL 4KXZI 2YD5A 2X4TA 3PJLA 4LCUA 4N2DA 3UPAA 5ICZB 5L4IA 3QISA 5IP4A 2G9HA 3GSRA 2QVKA 4WUUE 4J3XA 3MLRH 3QQ9D 5CR1A 5JQHC 1FO0A 3VXQA 1TF4A 2LVEA 4R8WL 5EO1A 3PDOA 4JVUA 4JG1L 4FXGA 2X6VA 1AOHA 3BT2H 1Z9SB 4PI2A 3WL9B 3C60C 3LKQB 1ZLWH 1F4XH 2JCCB 1X5IA 4RRPA 4WFGD 5BV7C 1FFRA 2Q8AL 4CSPA 5KWYC 2PWDA 4J4PA 1W72A 4U1LB 2VN5A 2JLPA 4L9LA 1PG7W 4JB9L 4H5SB 4K3HA 4JZJA 5ANMB 4V1DB 4DN4L 1JGLH 2ZKXA 4UZUA 4CW1A 5E9AA 4ELKA 2HH0H 2OSYA 5KSBF 2XFXA 1DQDL 1ZGLM 1I7RA 3SGEH 3Q0HA 1NGPH 2E46A 2A6JB 5HD8C 1YYML 3OLGA 5IHBA 1QFWI 1NMBL 1VGKA 5IKCA 5EBGA 4PRBB 5EV7A 3G7TA 4UMGA 3WGUB 3VSVA 2VDLH 4J12A 2WZPD 1B0GA 4L1SA 2WINA 3NFPA 4D8PA 1YY9C 3WTSA 1NA8A 4FFWD 2O61B 1ZTXL 3WIFA 1Z5HA 3EYQD 5ADOH 1F3RB 1FC1A 4MNQB 3VFNB 2CIIB 4OVVA 2CRZA 5L9DL 4Y4HA 1PZBA 1MCPL 4ZUUB 2JI1A 2NX5D 3QDJB 2WUCH 5HHNA 1WZAA 3QUMH 3MBEC 1QHQA 4PFEA 2CGRH 5FYKD 3P9LA 3IETA 1NM4A 3GSUB 2W81C 1QYGL 1HHKA 2QHLA 1O9ZA 3VTMA 4N1EA 1DQLH 1NH6A 4EIBA 1JVKA 1TLKA 2YN3A 3LKOB 3P4NB 1NEUA 2COQA 2YPLA 1UKSA 5FM4A 3CX2A 4JRXB 3B6SB 3RWFB 2G5BA 4R8WH 4E9XA 1MCKA 3SE4A 4JG1H 3CZJA 2YMOA 3MRIB 2XIIA 5BV7B 4H25B 1X5GA 2ZOUA 2VKXA 2P80D 2Q8AH 2F8XC 5GRZA 4S10A 4Z18A 3NPZB 1IEBA 5LO7A 5EZLB 2E56A 4JB9H 2QSTA 3HC2A 4TUOA 3MDJA 3R4RA 1TOXA 4AL8C 3V0WL 5ANHA 2P45B 1X7SA 4FULA 4M5ZL 1LE9B 1ROWA 1DQDH 1LNUA 4ZG1A 4IRJB 3O2VL 3MYZA 1OAUL 3LB6D 3W11D 3QUXD 2APVA 4CL7A 5KG9A 1UJ3C 1NMBH 3S7GA 2XQYK 3S4SG 5F96H 3LPPA 2HT4D 4IJTA 4DUVA 2D7QA 1HYRC 4FNPA 5ERWB 4R7DA 1MUJB 4PY8I 4EI0A 5DUBB 5GS0D 4O2EB 4WFFE 1J87A 2J57A 5CEYB 2AJYL 2OTWB 3JSSA 1KIUB 1OK8A 2ALAA 5F1IA 1ZTXH 3ME0A 2XWBA 5L9DH 1NCUA 1B88A 3P4OA 1MCPH 1U8PA 4PJEB 1FCCA 4Q14A 3I84A 1XGQA 1T1XA 4NHCL 5AQ0A 5B39G 3QQ3A 2ZOLB 5FYJD 1QYGH 1P2CB 1R3JA 4NHUB 5D6DA 5GGRY 4HOWA 4GXVL 3IGUA 5DI8B 4U1KB 4GRWH 4C59B 3V79C 2ZXCA 2DQHL 1NGXB 3FQUB 1HQ4A 5HPMA 1BQLL 1AMYA 4LEOA 3T6VA 3KXFB 3BIAX 4Z7OF 1I8IB 3QZPA 4L4VD 2A74A 3B9KC 2NR6D 2R83A 3S37L 4QHKI 1YQVL 4XPBL 5TD4A 1OSYA 3PPEA 5I1LA 2HFFA 1KLGB 2ZSVB 4JS7A 3V0WH 3B3BA 4CVXB 4FXTA 2AMUA 4Z7OE 4M5ZH 1MWAH 1NIFA 4FFVD 2CM6A 2AEQH 3O2VH 2A5UA 2PUQT 4TNEA 1OAUH 1JRHI 1L9TA 4OLYL 4ZFZA 2ICWJ 2I7OA 1IGTB 4W9EC 4HCGA 2OA9A 4PJXA 4Z7AA 5D2NC 1ASQA 2IAND 1MLCA 2HFEB 4LLWB 4U3HA 3AT8A 3ARBA 1DVYA 2AJYH 1LEGA 4JG5A 3VH8B 5DEGA 2IBZY 3W9DA 1IM3D 3V0DA 4PJ7F 2BP8A 2A6DB 2GFBA 1XGTA 3GXMA 3SIKA 3QIBD 2HVJA 4PJ9B 3O3EA 3RVVD 1DVFD 1XMEB 2E9WA 2EYTA 3HPLA 4NHCH 4KUZL 2B15A 2P4AB 3KYMB 3APMA 5BXFA 1LVEA 5F6HI 4G7VL 4GXVH 1ZANL 4R26L 2VMFA 3ZQWA 3IDJB 3QHFL 5IQMA 4XE0A 1PY9A 5AWNL 2YA1A 4EN2A 3MR9A 4WF7A 3KAAA 4PJ7E 3CH1A 4PH8A 3B9KB 3N1GC 1MRFL 5G4OA 3BAEL 2QDVA 5CJXC 1I8KB 3S37H 5AB2A 1QVOA 1YQVH 4XPBH 1XF3A 3JZYA 3L08A 3MV9B 4EI5C 2XA8L 2ARJA 3BAKA 3K6NA 2MTPA 2ADGA 2CBQA 2NCEA 1P7KB 2VR7A 3RKPA 3Q8CA 2H8PA 1A5FL 4J3OD 4XRCB 2HJFA 5CO1A 4NC0B 4N1HB 1ZCRA 2AQTA 4LASL 5JIMA 1QW8A 5J3HC 1M7DA 2J6EL 1GPOL 4YO0B 4R84A 5K9QG 3EIFA 1AE6L 3MACL 3T0AA 4OLYH 5DHYA 2D4FA 2OMZA 1L0XA 2VLJB 5FFGA 2LGNA 2YOCA 4RCAA 3RNQA 3HNVL 3NP3A 4PGZA 3SPVB 2Z6FA 2AGJL 2DYRB 1MQ8A 3U48A 1PMYA 1ERNA 3UTPE 2VW7A 3DJSA 3TIEB 2FL5A 2WPGA 3FB5A 4UT9H 4NQXA 4OQTH 5JHBA 4OD1L 4Z3TA 4XCYA 3JTSA 4UIKH 5T1KD 1ZHBB 4GKNB 3REVA 1LM8V 1XX9C 3AGWA 2CGYA 2XTJC 4K4KA 2DRUA 4KUZH 2P5EA 3WS3B 3CFNA 5E8PA 4Z77B 3BC9A 4G7VH 3QHZL 4I3SL 4R26H 2C9SA 1YO4A 1KYOK 4ZFQA 1NFIA 1D5XA 3G6AB 2L3BA 3QHFH 2XIDA 2EEBA 4Q74A 3U6RB 2APTA 1IX2A 3FCGA 4OF0A 4ZNEA 1MRFH 1KXVC 2DWEA 3BAEH 3F7QA 3O45B 3WN5B 4H2CA 2IBGA 1LO0L 2P24A 4EI5B 1E27B 4JRYA 4ZFGL 4S1DD 4EJ1C 3N6YA 4AUJA 4HVBA 2XA8H 1CGWA 1F3DJ 2YSTA 3LNDA 3HS0A 3HNTL 3RTQD 1A5FH 1BX2B 1OKEA 4UT6L 1CXKA 1QQDB 4LASH 3SCMC 1ILUA 2J6EH 1W0VA 3GLEA 1GPOH 1X5XA 4MQ7A 1CMOA 1MCNA 3K1KC 4P2RE 1MHHA 3MACH 4W9DC 1X5YA 2XPGA 2AGJH 1BLIA 2MNJB 4QXTB 1A1OB 3A0OA 4QY8A 5DMIH 3UADA 3MLUH 3ILEA 1KYAA 4JPQA 1Z66A 2PO6A 4JJ5A 4OD1H 4WKZA 1JPEA 1RJYA 2V7HA 5BS0D 2XTJB 4PBXA 3BVWA 1SVCP 2J73A 4X0KA 5BRQA 2I27N 1RY7B 1M7IA 1H9DA 3DETC 1KZYA 4I3SH 3F7YA 3T2QA 3GSXA 4NNXA 5L7XL 2M8XA 4ODHL 1ECYA 2WXLA 5FR3A 3GMPA 4FN0A 2XJKA 3FO9B 4LMQI 2PYEA 3TVMD 3LSOB 4K0OA 4UQ2B 4Y2OB 3HNTH 2EKSB 3PXHA 1XF5A 1YEDB 3W81A 2EUXA 3KLKA 4UT6H 1SGKA 2R4SL 2QEJA 4EPSA 1XB8A 3BKML 1N0LB 1PL3A 4NUQA 5IF0B 3TEXA 5JPMA 5IFJB 1KWKA 5MI0C 1VRSA 3ARDB 1MCBA 1II4E 1T6VN 1D2PA 5FPIA 3TBWB 4OFIA 3J07A 4P4KD 1JD9A 1IC4L 3VFGL 2OXHB 1AMXA 2MSPA 5AOIA 3S4SA 1K5WA 3PWUB 1PX8A 2EDFA 3ZUCA 1U33A 5CEZH 3T0EE 3BZ4A 4HJSA 2XSKA 5D55A 5D6CA 5DWPA 5I19H 4POZC 4M9OA 3OXRB 5D1ZC 3RJQB 3JT2A 2K8MA 1GGIL 3EOBA 4RDQF 3O3AB 4JFTA 3DYOA 3A6CL 2Y9RT 5E8EA 1FV1B 1GGUA 4NN5C 4RSYA 2OYKA 3ERXA 1LO2L 4XGZA 1AD9A 4QRPE 4QRSB 4X9FA 1HEZB 2X28A 2H6OA 2JB5L 4ODHH 5BMFL 4MJIE 2D2CC 1RJZA 2IVFC 2X2HA 3NJJA 2UZXA 1BECA 4K7FB 3KPQA 1FF5A 4ZYKA 4N0CC 1NFKA 4HULB 3A6OA 2ZXBA 4Z7NF 4AITA 4G6AC 3T0BA 2ZOOA 4DVBA 1CDCA 3MGTA 4PIBA 5JO5A 3WDHA 1GOGA 3P9WB 2VIRB 4N3UA 4H8WC 2G4GA 3LS5L 1IBHA 4TSCH 2ICEC 3BRDA 1KYUA 1U58A 4G1MA 5DHVA 5F8RC 3BKMH 2F54A 3SJVE 2BZCA 3CC1A 4R0LB 4Y4KB 2NY3B 5H37A 2DWXA 3W3BA 3ZDYF 4Z7NE 3BEVA 4P2CG 2CKBB 1MNNA 3AWEA 3O6LL 3SODB 2YC1B 2OS7A 2DL2A 1IC4H 1RUML 3VFGH 5CEXB 2CHWA 1EEQA 4K3GA 1HQRA 3BWUF 3WFZA 3FQRB 4KMTL 2TRHA 5IIEB 2YSSB 1V3KA 2VR5A 5FFOA 3KPLA 4BK4A 3NMEA 2NY2C 5D1ZB 5D9SA 2WTPA 5EO9B 3ZKMC 4URTB 2ZUUA 1A6AA 3BFQG 3MBWB 4XMXA 1J1OL 1GGIH 3HE6C 3JWDL 4G9FA 3ZDYE 5AB0A 3A6CH 2HPTA 1LO2H 1XAKA 5GRUL 1TQCC 4DKFL 3UDWA 2JB5H 5EZJB 3R4DA 1URIA 1HNFA 5FYLL 5KS9A 2OMWB 3GMLA 5BMFH 2M26A 3Q2NA 4XXWA 3VYPA 1P6FA 4D3CL 3DVNA 2J25A 3DMMC 4FKKA 4L1TA 3QFJA 5KOMC 4NP9A 5I1AA 4YSEA 5AD0B 5HGDB 3UTTE 1B4TA 1OGAD 3R1GL 1WCBA 2NQ3A 4PJHB 2Y1VA 4WSGA 1JI1A 2O5XL 2ICEB 3VWKB 4KKLC 3LS5H 2Y22A 3G5VB 1NDGA 3L81A 5C2BL 4KXDA 2A4CA 4U3SA 1WA1X 1XGUA 5KBLA 4FAAB 3VFPA 1UVQA 4IHOB 2EDDA 3UXFA 4BIKA 1BOGA 3AY4A 2BWQA 5ESQA 5HSFA 5F9DC 3UCRA 5JNYB 3DO7A 3ISYA 2FH8A 4WW2F 4NO5A 4CU8A 3ZIYA 4Q58C 1PKQE 4OFQA 1WWBX 2G60L 2WJ7A 4PQXA 1S7SA 5AYTA 4DO6A 4KMTH 3GDBA 1U8CA 2WJ5A 2GIXA 3NRFA 5IHWA 3SY0B 3VB9A 1U4FA 3HE6B 3D3VA 5D4HA 1SXNA 3TBYB 4IBZA 1H5BC 1J1OH 3JWDH 3FZUD 4X7TB 3GDCA 4FMVA 4IOIB 3TO2A 4ZAKD 3VWJB 5D7SL 3MRCB 4KUCF 4KY2A 5C0IB 4DKFH 3C5ZC 1AG6A 5FYLH 1PFCA 3C8KB 2A4ZA 4GQRA 1F1AA 3OHXC 2ZWYA 3DMMB 3FQWA 5DEJA 1KV7A 2BWIA 1FN4B 4D3CH 3K72A 3L3HB 5AKTA 1HS6A 2GJ6B 1F6FB 2C9RA 3FDWA 3D07A 3P2DA 3TA3B 2Z91B 3EGDA 1CIDA 5TGBA 3WI9A 2Z65C 3VDAA 3BE1L 1Y18A 3R1GH 3GHPA 4Y1AD 3PP4L 5IHUL 1D7BA 4FD0A 3F6IA 2EDBA 1YMMD 1A3RL 1OTUD 4AXWB 1GTFA 1AC0A 2JVUA 4FQXB 3VFUB 4QHNB 1XL4A 2PYFA 2H0JA 2AANA 4JFPA 1OV8A 4N2CA 3V7AE 3UGEA 4FNQA 3ABGA 2I07B 5C0FA 3BD3A 3KYOB 5EPMA 3RI5F 3NCYP 4KH2A 3GEFA 4MMXB 2NY5L 3L1FA 3MA9L 4KXCA 4XMUA 1KIRB 4LLVA 5EN2A 2JK5B 4KMQA 1B0RB 2CGZA 4OLZL 2G60H 2ZXDA 1ZS8A 2ZWZA 4MZIA 2A9ML 2CG9X 3VRJB 4XNMB 3SBWA 4WV1A 4JQVC 3EGSB 4XP5H 2XV0A 3X3GL 1SEQL 1R3IL 3U1QA 4HSCX 1A9EA 4AKQA 3UTSE 5DJ2A 2W9LA 3POHA 3CXFA 4NUPA 3X2QB 3X12B 4H13C 3I9GL 5D7SH 3HG1D 2YPKB 4M7LL 2BH0A 5HGBA 1HHIA 5J9PA 3VI3A 1I7TB 1Q9OB 3U4KA 1TSHA 5ICZA 2QKIA 2PR4H 5LAXB 1XR9B 4Z78B 5MEOA 4YBHA 1M71A 3IT8D 3GBEA 3HEIB 3BE1H 1KTBA 5IQNA 3B2UC 3NSFA 3PP4H 4KDWA 3IDMB 5GGVL 5IHUH 4TRPH 3T3PB 1KPUB 3SDAD 1VERA 3IJYB 3FONB 3ESMA 5CS7A 3LKQA 3VFWB 2BP3A 4JCMA 4ZQTA 1CFNB 2JCCA 2AK4B 4ODWB 5T8IA 1MCJA 3LQAL 4H8UA 4FQLL 2XKNB 4H5SA 1WIPA 1N68A 5J1AB 1NUDA 3QDHA 5TH2B 3BDYH 2NY5H 5F6IC 3MA9H 5DD6B 1S7TB 4OLZH 3NDYE 3ZBMA 5EF0A 4ZFFB 4JM2D 4AVHA 3PWNB 5SWSB 5FO8B 1NFDB 2XPYA 2A9MH 2IDSA 4PW4A 3ILQC 3L95A 2I9LB 2VC2L 2OPCA 3X3GH 1E4XL 1SEQH 1R3IH 1MFCL 3NYKA 2MCMA 4IOSD 5EHFA 1U2YA 2O61A 3NIFE 4RGMB 1TG8A 5EUOA 4MNQA 2CIIA 2XUWA 3I9GH 4MD4B 5FF6B 3U6XA 2WQAA 4M7LH 3BSZL 4ZUUA 3EFOB 3QDJA 1BZQK 3LKPB 2CLVB 3MRBB 1W2KT 3Q8BA 4Z3GA 4X9YA 1NGQL 3KS0J 4GT7A 3LKOA 1PIFA 3P4NA 1TQVA 2R1XA 3M1OA 4DKEH 5GGVH 3VU1A 4FI6A 1MY7A 2X40A 5A2AA 1JNNL 1OP4A 3PUCA 4NP4L 4H25A 2PCFA 1R3LA 4FCHA 2YD9A 4Q7DA 4UNIA 5AOZA 5DVMA 4Y1TA 4ZS7H 2VDOB 5DVLA 4IIQC 5CN2A 1QSEA 1XWVA 3LQAH 4I8DA 4YOKA 1L9NA 1TTRA 4ILDA 5EIIB 3MN8A 4FQLH 2NZIA 5IVNA 4LGPB 3RL2A 2HN7B 2X12A 2FSDA 1KENL 4B7LA 4ZW5A 1KMGA 1BBDL 1MFNA 4R7VA 2WYTA 3WHE1 4NQSB 5IBLC 1QATA 5DQDL 3A6BL 1MCQA 4HUNB 1XEUA 2IMNA 2JJVA 3QEQB 4FTVE 4G6JL 1T2QL 3MNVB 1N2RA 2HSIA 2KZWA 1R19A 1CGTA 3FU9A 1Z9NA 3QAZC 4KWUA 5DYFA 4N28A 5CILL 1XFPA 2VC2H 5JPNB 5ERWA 1RIHL 2ZAGA 4BQCA 2GUYA 5DUBA 1E4XH 1WISA 1TJGL 4O2EA 5FIEA 4XPGL 1Y6MR 2F53D 2VKWA 2OTWA 5FYLE 4MMYB 2B4CC 3WDIA 4F33B 3BSZH 3V0HA 3IS0X 2WCSA 5SV3A 1WUNT 5CP3H 4EKXA 1F45A 2MKWA 2QDWA 3Q1EA 2ZOLA 4OSUL 4NQCD 1P2CA 1NGQH 3A22A 4K5OA 4NHUA 5I9QC 1U2HA 2QPFA 3E6FB 4ZD3H 4FJYA 1HH9A 3AADB 5DI8A 4HS3B 1NLDL 3FQUA 2VLME 3KXFA 5DZNA 4ZW7A 2DPKA 4PP1C 3AT9A 5HJ3A 2H45A 1FL6B 1R24A 3N85L 1JNNH 4NP4H 1R5IB 2F19L 3K6FA 4DAGL 4LBEB 4XCFL 5GQBA 4N2MA 1BCIA 4EIZC 4NO0D 3CFCL 4H44C 4I0PD 1I82A 5G55A 3UEQA 2J2ZB 2P8PB 4BWUA 1KENH 4ODBD 2ZE0A 1BBDH 1BBJB 3PV7A 4B27A 1KXTB 5DQDH 3A6BH 1UJ3A 4M00A 1T2QH 2CRIA 3ETSA 4PJBA 1BV8A 1IGTA 5DR5L 1MCDA 1Q94A 3RWIA 2ALWA 4NI3A 4OJYA 4ZO9A 4LIQE 5CILH 1CICD 3FSVA 1RIHH 3QA3B 2HFEA 2O26U 4K94H 1TJGH 4XPGH 3VH8A 2DTSA 15C8L 4XBPB 2A6DA 2DKMA 3M1CA 3O2DL 4XO4A 5CBAB 3HVNA 4PJ9A 4QIRA 2V8LA 2WYIA 1A8JH 1TJXA 3KYMA 2QR0B 4OSUH 5GGSY 1O7VA 1E65A 3OB0K 4XN5A 3ZTCC 4A2GA 3TCLA 5J1TC 1BAWA 3IDJA 4LLYA 1NLDH 1NQBA 3P9MA 4AGNA 3CX5K 1QAWA 2A9DA 4K2UL 2VDQB 1D5BB 2FIRT 3B9KA 3N85H 1D6EA 1WE5A 4XOAA 2F19H 2R56L 1YY8A 3IDIB 4L0ZA 4QJ4B 4KZEH 4XCFH 2DQ6A 4POUB 3KL3A 5JIHA 5K9OA 4NNPH 2Y3AA 3MV9A 3RZCC 5C6WH 3CFCH 3QWRA 1P7KA 1HDMB 2NW2A 4XRCA 3VXMD 2GG1A 1IM9B 2IQAB 5DZ9A 1U4EA 4OI8A 2ZX6A 4Y8DC 4EQ3A 4YO0A 1E4JA 3IDGA 1FH2A 5BNXD 4M4PA 3NIDB 5CN3A 4XMKL 1I7ZA 4IIZA 1J5IA 3LZFL 2P48B 4KKBC 5DR5H 1L3NA 3K2MC 4OLXL 1S7RB 4NZJA 2BNRB 4XBMA 1S5IH 4FG6C 2Z9TA 2C4FT 3D05A 1WIUA 3N1PC 4UM9A 1PJ9A 2ENYA 3BUYB 5JHDE 15C8H 3T0EC 5IB5B 2BC4B 3DJTA 4M8RA 1EIBA 3Q1SL 1ZHBA 4GKNA 2YZ1A 5HHQB 1BWMA 4A66A 2YD1A 4J4PD 4DN3H 1OGSA 4DTGH 3FS9A 3WS3A 5HGBB 1T4WA 2HT2C 3BUDA 2APBA 2G3XA 3U6RA 4K2UH 3AU0A 2G2RB 3HZYB 3OAYK 4AG4H 1R3HB 2IMMA 2OP4H 4YSCA 4H0GA 4KJYB 2R56H 3IE9A 4EI5A 1E27A 4PR5B 4LSSL 2J8UB 1U3HC 1JF6A 1PKOA 4HFUH 1DBBL 1BX2A 2X2JA 3LAFA 1BAFL 4K07A 2O93L 3KPMB 4WNQB 1XSIA 1AGDB 3MXVL 2A38A 2C3HA 4Y4HD 2VLRA 3AQDA 1JWSB 1RZQA 4R6UA 4XMKH 5DK0A 2UUDK 5IGXL 4GI8A 4OLXH 4TVSa 2R1YB 5GISL 4RX4A 2GJJA 1JF1B 1A1OA 3DX8A 5GSVB 4A04A 3KPOB 4LXFA 1GRWA 2NYZA 1QEWB 1BVLA 4WZ9A 4U7MA 5TFSL 3A23A 3CFEB 3Q1SH 3ZHNA 3JZ7A 5AB9A 2NW3B 5EF3A 1N5AB 3KPPB 1CFBA 3L5WB 1U92A 4P2YA 1IO4C 2NNFA 3I02A 5T5FA 3S0PA 3VTAA 4P5SA 3ZN6A 4AZUA 4NB7A 3BZEB 3UYPB 2WTOA 3QQ4A 3GBLA 3P2BA 4YBQC 1JV2A 2D7MA 4I5BB 4MMZC 3W0WB 3BWUC 3QXUA 3HLAB 5IHLB 1QSFB 4LO9A 4NS0A 1WAAF 3MROB 4C57C 1KXVA 4ZS6D 2X10A 2XCMC 3A67H 3PPSA 4TNFA 3ULVD 4IGBC 2ATPB 3FO9A 4U1HB 4ZO7A 5HHMD 3LSOA 1U3HB 4P46D 2PWEA 4LSSH 3SDXB 5E6IC 5DJCB 1QABA 1EXGA 2EKSA 3D12B 5AVWB 1DBBH 1YEDA 3VG0L 2CBPA 1QFOA 4NIYE 3SCMA 4Z1PA 1U8LA 2D3LA 5IFJA 4NWTL 5IF0A 5B7MA 4GUCA 1XV8A 2FQEA 3CUPB 1GGBH 2FT7A 3ARDA 1AYRA 3GLAA 3O3BB 4KNTA 5FYKL 3U4BL 3TBWA 5LGYA 3B7SA 5DEZA 4GNKB 1MKFA 1LXMA 2OXHA 5AL8A 1OD9A 4BQ6A 1T2JA 2NY1C 5ITFB 3O4OB 4PRNA 3PWUA 2C4FU 4HLZH 4UQCA 2VQTA 2ZXAA 3NTCL 5TFSH 1IRAY 4WEBL 5FB8B 1NCIA 2Z8WC 4RMSA 4L3CB 4LF3B 3RPKA 3INUL 3LHAA 4U1SB 4XOEA 5D7IB 3AZUA 4X4YB 4ZPVA 4EMZA 4PJDB 4QF1B 4FA8A 1QUNA 4QRSA 2NY4B 2ZT9C 4WW2C 4MMZB 1J9TA 2ICWI 4Q9CA 1UXWB 2A4EA 1UQSB 4UAHA 4KRPC 2I24N 2DEYX 2VM9A 3NK4A 4ONGL 4X6BB 5CUSH 3JWNE 5AYUL 3ZE2F 1JNJA 2XFGB 3MA7B 5E6SB 5GGRB 1ORSA 3O11B 1CS6A 1P69B 4Y4FB 4G8AC 2GTZA 1Y6NR 4JPKL 5I16B 3QPXL 3WG7B 3NJGA 1NBZB 3F05A 43CAA 2CBOA 4L4TD 3SBRA 2ZCLL 5I71B 5GS0L 5C7XL 4DKDC 4Z7UB 3VG0H 1E8ZA 3ARBD 1IFRA 2XG4B 5EIIG 5BJTA 2ZSWA 1Z9LA 1TETL 4LL9A 4ZBJA 3ZE2E 2Y6SC 4NWTH 2C26A 4Y4KA 1SN0A 1BFSA 3QG6B 3SPJA 3S36L 2CKBA 3H9SA 3U4BH 1ZGLA 2VM3A 4WNJA 2YC1A 5CSBA 1G7IB 5JUEL 3MAWA 1HL4A 1E50A 1PGRB 4ZMPA 1REIA 1CB4A 2EH7H 4GOSA 2N01B 4NQED 4TTGA 5IIEA 4PJFF 3ABLB 4Y2LA 4PGCB 3NTCH 4GI9A 3BH4A 5D1ZA 5F1NB 2BXZA 4OF3A 4WEBH 5EO9A 4UOQA 1DJSA 3INUH 3MBWA 1BZ9B 5KSVA 2GJZB 4K5NA 4A2HA 4X8CA 3ZL1A 2WP3T 3V6ZA 4WVRA 4JHVA 3K0WA 1ZLWK 1TEFA 1X5JA 2K78A 1RSFA 2R2CA 4PRPE 5EZJA 1GW6A 2OMWA 1H6EA 2XY1A 4UDTB 4PJFE 5FWQA 5C71A 3M88A 1A1MB 4ONGH 5AYUH 1HJCA 2DICA 2UY6B 4TN9A 4YSUA 2E6JA 3P73B 4JPKH 4WI2A 2XJLA 2BMKA 3QPXH 3MLVL 2E86A 1GR7A 4PJHA 4RISL 3VXRA 3O4LB 5JW4R 1ZA3B 1CFQB 3VWKA 2ICEA 3IDYC 2ZCLH 1UG9A 4Z3HA 3O3DB 5GS0H 3F83A 4GG6B 1T5XA 2F1EA 2FO4A 5EIQA 3DX2A 3ULSB 5I1HL 1TETH 5AKVA 3HMWL 1NCWL 3MUZ1 1BQSA 5EO0B 1KGCD 4S1QL 5IHHA 1MCSA 3L5HA 2UXGA 3S36H 2C7UB 3CVHH 2F0CA 4HOMA 5FYJH 2P5ED 4EBQL 4EUPA 4MXVF 2ICWA 3RVWD 5DVNA 5DZVA 3TO4C 3FNKA 4DHLA 4GKZB 3FQTB 1DFBH 1UZ6F 3SO3C 2BVEA 2JIXB 1M1SA 1ZEAL 3HE6A 2PW2A 4HGMA 3TBYA 2Q10A 3MRLB 4X7TA 3PGFL 3Q05A 3FCTB 1FNEB 4J8RA 2ROXA 3S96B 4IOIA 3UTQA 1HTYA 4Y16B 3V2AR 4GLRI 1H3WM 2EO1A 3CFTA 4MXVE 5DURB 5MHSD 4A7VA 1A3QA 5TDPB 4WWNA 5AZUA 5C0IA 3MV7D 5BQ7B 1HVXA 1RZFL 1T6WA 4MCYB 5DLLA 3C8KA 2Q9OA 5MERB 3DMMA 3IWUA 32C2B 1UZ6E 2VQ1B 4IU2A 3TA3A 1PAZA 3DC0A 3FQXB 1C1EL 2Z91A 3V0FA 1A22B 4KMLB 1EHLL 3BXNB 3EF4A 1DEDA 4ADJA 1E2ZA 1IU1A 2QT6A 2Y24A 1PW3A 1AXTL 4U1IB 1QPPA 5C8JB 4DZ8B 1WAEA 4AXWA 4XZUA 4FQXA 4QXUL 4QHNA 2PO6D 4DJMA 4E41B 3GS7A 5I1HH 1KBVA 3KPSB 4Y0GA 3HMWH 4N25A 1NCWH 2I07A 5IV2B 4S1QH 2VH5L 5T3ZL 2GQHA 3AB0C 1L5GA 3MO1B 3HKZA 4MMXA 1N10A 4UUJB 4AM0A 1KTLB 3B5TA 5C3TA 3DURB 4Z76B 1MQKL 5KVGL 2GEQA 4UAOB 4LCWB 1AO7E 4JO2L 5L8LB 4WFGE 3EYOB 4LEEA 2KC0A 3UX9B 5GS1C 5JOFA 1TZGL 2Q3ZA 4XNMA 1ZEAH 1NMCC 1H5BA 1CU4L 1KG0B 3FN0L 5HYJE 1GC1C 2PYED 1NGZB 3PGFH 4OBSA 3MRNA 1AZBA 4ETQB 1SDDA 2EIEA 1EJ6A 3C5ZA 2VXUL 4J3OH 2YPKA 4BK8A 3OHXA 1JSYA 1RZFH 2C9AA 1F6AB 2ZCZA 2Q1EA 1AANA 4PPTA 5ISZB 5IW1A 1Q9OA 4TYUA 3F7KA 2B1AL 4JE0A 3UAEA 5DHDA 3VXSE 1C1EH 1ZLVH 1XR9A 3BLKA 3O8XC 1D2OA 1EHLH 4F58L 1MJ8L 1G84A 1AXTH 1N19A 2YUWA 1EH9A 3OD3A 3IJYA 2VRQA 3FONA 1WBXA 2NX5E 3VFWA 2NDGA 2AK4A 4ODWA 1BD2B 1CGUA 3H7BB 1BOYA 5FYKE 3WIHL 4JFFB 2XKNA 2VH5H 1XAUA 5J1AA 4TQIA 2O6EA 4JX0A 1UM6L 4P5TC 4FMKA 5DD6A 1HHGB 3MJ6A 1EEYB 1MQKH 2BWDA 2LU5A 1R5VB 3L1EA 4E5XB 3CDCA 1MY5A 4JO2H 3CU7A 4XI5D 3PWNA 5SWSA 5FO8A 4P2QB 4ZFOL 1NFDA 3SPCA 4M1CC 4X98A 4NQVB 4H26A 2WXIA 3WJMB 1A65A 3FN0H 1DVUA 1P9MC 4UBDC 4LLQA 1YEWA 3QXDA 4R5TA 3P0GB 3SGEI 3W9EB 1CD9B 4MD4A 2VXUH 5DUJA 5FF6A 3FO2B 4GIOA 1BA9A 2BVPB 3EFOA 2E4TA 3FO0L 3LKPA 3MRBA 2F54D 4U0QB 3MREB 1QI4A 3OAZK 3QUYC 3T04D 3RWCA 4CC4C 2WXPA 1I1RA 1SY6L 2QQQA 3FCSB 3L9EA 3BKCL 3O8XB 3SYPA 1PAMA 1TZ8A 2D7TL 4GFTB 3DNKA 4MDIA 5DJ8B 5H35B 4F58H 5JORB 1ND0B 5BCAA 1MJ8H 3KPNA 4HHAB 3CHRA 3RIKA 3ESPA 5FGSA 3V0IA 4XVUD 4MX7B 1DL7L 3ARUA 5HDQL 2Z8RA 1ETZA 1H3TA 4PIRF 3UBXB 4TXVB 1AD0B 5E4IA 4GSDL 3PGDB 2H2SC 3LXBA 3WIHH 4RIRB 2VR9A 5JIQA 4KY1L 3PL6C 2BIIA 1D5ZB 4HW6A 4LHJB 5E2TL 1U8NB 4G9FD 2X38A 1J1PL 3Q7JA 2YAQA 1UM6H 2RIKA 2VZ3A 4X4ME 2BERA 3Q5YA 3D4CA 3QEQA 4ABVA 3HUJF 1BJ8A 1ZE3C 3BVVA 3MNVA 2DJMA 5A40E 4ISVB 5LXVA 5HGGS 1G1OA 1S7WA 5CHNB 4XHJC 1D9KB 3QFJD 4S1SL 3MJGX 3RDJA 2E7MA 3HN8A 4ZMQA 1BF5A 3KR3L 4N2OA 4KHXL 3PWPB 5EU3B 1OCCB 4GSUA 5HDLA 3IFPB 1ZHNB 1XF1A 1MJ7L 5FKPB 3T0XA 4F33A 2PTTA 2H9GB 2J55A 3KBHE 5ESVB 3FO0H 3HUJE 4NBYB 3AU1B 5C09B 2OJZL 3VGGA 5JW4M 4FLRA 1ZXQA 4M8QB 2YPVA 1CD0A 2FWLB 3EO0A 1SY6H 3B2DC 4MD5B 3BKCH 1PQZB 3E6FA 4N87A 2AW2A 3PGCB 2D7TH 1QMUA 5I8CB 3LN4B 2QMJA 3V95A 4HSQA 2D31B 5CJOL 5AVXB 5KANG 1DL7H 4MB5A 5LN8A 1EQWA 3BAXA 2CLRA 2HTKC 3HC0A 5HDQH 2XU9A 1F4WH 1FL6A 1IFGA 4KROC 4GSDH 1R5IA 1M6UA 2G9KA 1NEPA 3FHEA 1U6AL 2XQYG 2GIYA 4HFWB 4IIQA 3E0GA 2EH8H 3PL6B 5EN3A 5BOZG 3NGBC 4KY1H 3D3VD 4FLSA 4MHHG 4QTHB 4LAJH 2F7QA 4D7BA 1KTDA 4YBLB 4P8QA 4I77L 1J1PH 4LGSB 2P8PA 3OKLB 3QP3A 4N26A 3S5YA 5AOJA 4JDTL 5E1AB 3BFWA 1BBJA 25C8L 4G6KH 1G9NL 4ABUA 1KXTA 5E8OB 2F1BA 3TBTB 4LAQL 1AP2A 1N4XL 2H0EA 3VMPA 1VSCA 1RZJC 1BDYA 1AGEB 4LPYA 2ZD0A 2KT6A 3WENA 4Y2DC 3DVGB 1FL5A 2QL1A 3WUZA 5C0BB 3TPKA 2RTTA 4MCNA 1VCBC 2IOIA 5DC0A 3Q8EA 4XBPA 1I53A 3TOPA 1U8KB 4AV0A 1RK1A 1VEPA 3CX5J 4GMTL 1MJ7H 2LT9A 4XNBA 5E23A 3TIDA 3UOAB 5CCGE 4UTBA 4XWOC 5CBAA 3QORC 2R0ZL 3DARA 4OF5A 1Q9KA 4OCNC 2OJZH 3QYNA 5HI3D 3DWTA 4F7EB 3RY4A 3MJ9L 3BQUC 1VHPA 3HE7D 1RUQL 2FWSA 3ENEA 1FA4A 5F70A 3DX3A 1EJOL 1ESOA 2Q8BL 4XNZC 4KTEH 2MNWA 2YA0A 4LCVA 4B95C 4DCQB 5C6PB 4PUBL 4G6FD 3RGVB 4WLCA 3IDIA 3UMTA 2WLKA 3DECA 2JKNA 5E4AA 5T3ZE 5D4JA 5DQJB 1WVZA 2YRPA 3H2PA 4YDVB 1H15A 2W91A 3QI9C 3RE0A 1JZFA 5EORL 4M02A 3WXVL 3TP4A 3GSQB 5KVGE 1HOCA 4AENA 5CF3A 1IM9A 4JDTH 1R46A 4M6MH 5EU4A 4UTCA 1G9NH 3RAJL 1JCVA 1N6UA 2HKAA 4H0HB 2BP5M 4NKQB 1N4XH 5GJSL 5I6MA 1SF5A 3GXPA 4AGPA 2VW6A 1S7QB 4UNUA 2BNRA 2J71A 2QADC 1JMXA 4ZMLA 1EWHA 4LCCC 4HH8A 1HSAB 1IGML 3NCBB 2VWEE 3K6SA 3BUTA 5IB5A 2BS8A 1GSMA 1SXZA 4GMTH 4PCSA 3QORB 1TUPA 1AVAA 1J11A 2DF3A 4JZNB 4AIXA 2YEZB 5K9KB 2F7PA 3ZKXC 1YAIA 2F8IA 5FGRA 5C08D 2VJ0A 3KG5A 1RUQH 1OY3B 2N56A 5MENB 1EJOH 2Q8BH 1ZVNA 3TJEL 4JO4L 2G2RA 1HSBB 3HZYA 3JWNC 1N67A 3MRQB 4NBXB 5BS0E 4KJYA 3F6LA 3QI9B 4JDVA 1J05A 3RZCA 5C6TH 4PR5A 3NSYA 1FL3A 2X89A 1QBLL 5EORH 2JWYA 3ELAT 3C09B 5L88L 1KT2A 1X4XA 4DGYL 1F00I 2HXAA 3MRDA 1ZVHA 1AGDA 3IGAA 4MNQD 4XHQA 5JIDA 1T0PB 3E38A 3RAJH 3QDJD 4BA8A 5JHMA 4DP8X 3EFFA 5TQ0L 1DE4B 1NIDA 1QPKA 5GJSH 3TNNB 3T71A 3WUWB 4XMVA 2XC8A 3FFDB 4BGLA 5GSVA 4I85A 2X2YA 1UA6H 2WXJA 1IGMH 3KPOA 2I32A 3MRGB 5ABAA 1QRNB 4RWHA 1ET8A 4D94A 5L6YL 3T0EA 4HBCL 4I9XA 3CFEA 4OAWB 1HC1A 3C60D 4PYGA 3PHOB 4ZDHB 3T65A 2WD0A 5GGTA 1N5AA 3L5WA 2YAMA 1YEGL 4YDIL 4NT6B 2ZX7A 3FT2A 2W65B 1WH0A 3CG8A 4XX1G 4IBVA 1PLGL 4QRPA 3VYNA 1QSED 1L0QA 3UYPA 4CADA 4YEFA 1IEAB 3BZEA 4Z7VB 5CFHA 1TQBB 1QSZA 3ILDA 1SFHA 1FNLA 4I5BA 2XWJB 2WCPA 3HLAA 2K4AA 2L04A 2IDUA 2DQIH 1QSFA 4BSJA 3OGCB 3GSNL 3TJEH 4JO4H 3CQFA 1XSJA 4HIQA 5HD8D 1QTYT 3K4ZA 4U6TA 3BWZA 5JMOC 2ATPA 2PPCA 5FGCE 3ZYZA 5C0CB 3IU3A 3QJFA 1FLRL 1U3HA 1G1YA 4IBUA 3GMMA 1RU9L 5EEXA 3OKEB 3SDXA 4ZRGA 4M93B 1QBLH 1UD6A 3LQZB 1YY9D 4AYMC 5L88H 5HHXH 1F1DA 4DGYH 1Q72L 1NBYB 3GINA 3KDMB 5K5YA 4PI0A 3G6JB 2A0LC 1YVLA 4HWUA 4YDLC 3TFKC 3B56A 4K71C 4OZFA 4YUEL 3CUPA 3HB3B 3FH8A 4O51B 1IKOP 1OCOB 3GRGA 5TQ0H 4XMTA 1IGIL 3ULUF 2GAZB 3EYSL 4E5XG 1H0DA 1Z2KA 2OW6A 1DDHB 3LDBB 4PS3A 4WTWA 2BJML 2HWZH 1WV7T 4UILL 2LOEA 1WRFA 1E2VA 5ITFA 2O6FA 4A2LA 4ZQKB 1IBYA 4UM8B 5L6YH 4HBCH 3KXFD 4NENB 1RUAH 1IKFL 1EAJA 4HKBA 1R9FA 1C5BL 4XCNB 5D72L 4U1SA 2ZTBA 5D7IA 2ZAIA 2FZ3A 1YEGH 1IARB 4X4YA 4YDIH 3WU1A 5EWIL 4P57A 1YPZF 4QF1A 1PLGH 4UOJA 3BRFA 3ULUE 3BPNC 4KI5C 3ALPA 5T1MB 5AVZB 5F9JB 4MMZA 1OM9A 3QUHA 4UOW1 3X1GA 3V6FA 4PTUB 4HOZA 2WMPA 1KTJA 4NN7C 5KYWA 5ADPL 3OC8A 1A6PA 1UXWA 2Z1KA 1UQSA 3IBOA 4A7UA 4AW7A 5I76B 7PCYA 3GSNH 4YE4L 4UQEA 4X6BA 5EUKB 5IMKB 3EJYC 1FSKB 2XY2A 1Q0XH 4IGBA 4K9JA 4AW4A 4ODTL 3IAGC 4JFHD 3TTSA 3UBXG 4BGDA 5I16A 1FLRH 5E6IA 2HFTA 1NBZA 1RU9H 3VFMB 4X6DB 2YGPA 1WHPA 4KKZA 1T5KA 2XQYA 3ZTNL 4ZNCD 1Q72H 2XG4A 2DI7A 2CJ3A 1EO8L 2DYPB 5IJVA 1TNNA 4Y5XB 1OALA 2Q3XA 1XZWA 4YUEH 1YSOA 2A3TA 1X5AA 4MA7L 1ITCA 1OGAE 1PKQA 1IGIH 2BNQE 3EYSH 4YEEA 1O6SB 3F3HA 3ATEA 4D0CA 2GC7C 4ECNA 2BJMH 2ESVB 3IFLL 3OAWA 4JY5L 1FG2A 4ZZFA 1QZ1A 4KKPA 2MCG1 4Q6YA 5F1NA 4AGOA 1IKFH 3B9KD 1C5BH 1M7XA 4LE8A 3MUUA 5D72H 3S5LB 3CZUB 3OJMB 1BZ9A 3V4PB 2WIMA 2GJZA 5EWIH 1JNLH 5F3BB 1B2YA 3E3QC 1EAPB 3MV9D 3QPKA 4AX3A 1KULA 3QWRD 4JFDB 1XSOA 4NN7B 4UQBA 4AVIA 3UTZB 3GLDA 3LZQA 1E8XA 5AEAA 4ADGA 2E8YA 4DZBA 5ADPH 4IKJA 2XZQL 4EI6B 4X7CC 4YE4H 5LBSL 5GGSB 3NDZE 4ODTH 5IT2L 1F4AA 2DLIA 2AQSA 3BAYA 2L7JA 3NCYS 2Y23A 1WF5A 4HEPG 5C9JB 3O4LA 3Q8AA 5HHOE 3ZKQD 1ZA3A 4FFWC 1CFQA 3N5AA 2YD2A 1OT1A 2EDWA 3O3DA 1Y7VA 4A1RA 3RPIB 2FUTA 3ZTNH 4UM9D 2XBTA 2HRPH 1EGJA 1GS8A 1OGTA 4OGYL 1EO8H 5FO9B 1J8KA 5LVEA 2EINB 4QKTA 3WLWC 5EO0A 3ZZQA 4MA7H 2GITB 4K5MA 3U9UB 2E76C 2ADJB 4Y1AE 4YVUA 3OVUB 3WNMA 1O5PA 3DRQA 4RGNB 3F7RA 5L2KE 5MEQB 1SMOA 2DQDL 4GKZA 3BSHA 3BGMA 1EEZA 4NQDB 2JIXA 1GYCA 1UM4L 3WKML 3HZ3A 3NABH 2DLTA 2N0MA 1E42A 2ROYA 2OK0L 3FCTA 4EI5D 3HAEH 3S35X 3I3BA 3CDZA 3UTSA 3NRPA 3ESOA 3T9WA 4M7LT 4XAWL 5K69A 2GSGB 5BQ7A 5J3HD 3IGKA 4MCYA 2ENQA 1YNLL 4OTXL 2XZQH 1H19A 3B7RL 1OQXA 3QDGB 5CD3B 5LBSH 3L4XA 2VQ1A 2VLRD 4HWZA 1JZGA 1P5UB 2B59B 4MJ6B 2DI8A 5IT2H 5DU7A 3MNDA 4G70B 1U2CA 1AKJA 3BXNA 4DT2A 2C7FA 4JCLA 2Y7NA 4MSWB 4BCXA 1L6PA 4RX4D 4Q0XL 2DIJ