3ZZRA

Crystal structure of the cg11501 protein in p21212 spacegroup
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
ECCTSRELVEFKMDRGDCEAVRAIENYPNGCEVTICADGVAQLGAYCGQGPCNIFGCNCDGGCLSGDWSQEFVRRNQQYGIQIIKVTRLPFWRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG11501
publication title Crystal Structure of Diedel, a Marker of the Immune Response of Drosophila Melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Immune system
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2011-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13164 Diedel Diedel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2800 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zzrA00
3ZZOA 3ZZRA
chains in the Genus database with same CATH superfamily
4FYVB 4TXSA 2GHPA 3PVXA 1Q8IA 4F2RA 4TY9A 5F0UA 3PIPQ 4F4AA 2C42A 1BQMB 1WG1A 4CYUA 4XK8C 4IOCQ 1NRKA 5I42B 2XG8A 5HBMB 3VQTA 4USVA 4W92B 4N77A 4LMZA 2HHHJ 2LYVA 5ETSA 4L73A 2V2ZA 2ATLA 5KFFA 1V9OA 2KHDA 4NOHA 2NZCA 3S7RA 2NPIA 4OLPA 4JYAJ 2ZH5A 5CCMA 3V4IA 3J7A1 2Z4PA 1MSWD 1FFSB 2FVPA 2ILZA 2MHEA 1EHWA 3J81Y 4PG4A 1IUJA 1RK8A 3DM2A 2BX6A 2MLZA 5DQGA 2XI3A 3MM8A 1T3NA 5KT7A 3O2IA 2P8IA 2J8AA 1N33J 3D5MA 1JJCB 3NS6A 3BH6B 5DZ6A 1TMJA 5DQHA 1JWWA 2AIRB 1BD6A 4NYZA 4CO1A 1HBNB 4NA2A 1GMWD 1EKRA 3SIPB 3HX9A 1KLNA 5ADZA 3AQPA 2ZJPQ 2BQ3A 4C0BA 4C8NA 4I7FA 1VGYA 1T3OA 3EGWB 3BEGB 1KRPA 2NYIA 3I5CA 1FWPA 2DIUA 2CJQA 1QD1A 1RE1B 1D0EA 2J0XA 1N34J 1HYSA 3MMBA 2OFHX 1SCJB 2PEHA 1VHIA 2FGCA 4BC9A 3M1VB 2W9BA 3IP0A 2IM0A 3HF5A 3UN2A 1R0AB 1VQLS 4B3SJ 3HD2A 5E3CA 2KZMA 2MPUA 3LOUA 4LF8F 3ZZYA 4A46A 2LXFA 1Q8LA 2KXHA 3NGDA 2GIRA 4O3QA 1NZ8A 1UW9A 4PUOA 2XNRA 4DR2J 2HQFA 3SDEA 1RACB 2GO9A 4YY3F 4YP3A 4DV5F 4JOUA 2MQQA 3TAQA 4ED8A 2A3JA 2KJWA 1S7IA 2MKKA 3RR7A 3HKZD 3QT5A 4CLFA 1TVRA 2UUAF 2E5JA 1N32F 2J7WA 2VH7A 3OTOF 2BJEA 1XQIA 3JQMA 2BJ8A 3HFZB 4K4SA 4LIRA 1XWLA 2VFVA 3DOKA 2N3OA 2BJ3A 3QGGA 3G8QA 4CLYA 1VR6A 4LRDA 1RHQB 2UUBF 2CG4A 2M0GB 2M8HA 1O8BA 2HHTA 2CPHA 3OFFA 4Y2MA 2QIFA 3NGSA 3DI6B 4PQAA 6AT1B 1PJ5A 1IBKF 4URQU 1E6VB 5J1NA 1S9EA 1JLQB 3PJXA 4ILMA 4OX9F 1NPKA 1U1RA 3R2DJ 3VVTA 2CIMA 1LWEA 1OY9A 4N76A 2FD2A 4GC7A 4DR1F 2C3PA 3SI8A 3SQGB 1YVFA 3CD6S 3B4MA 2R7WA 1RTJB 2DY1A 4J7CA 2ALZA 2MGZB 4M5LA 2B6AA 3DDNA 2PMHA 2X1BA 2OPPB 4YB6A 1UWAA 2HFVA 5DM6Q 4IDKA 1FXRA 2RH3A 1VLYA 3A3NB 3MFHA 3QYYA 2W9CA 5ITHA 2KZZA 1OO0B 3H98A 4WWSA 4I6YA 3IMQJ 1FRIA 3B54A 4P73A 3RJMB 3F41A 2H48B 3QO9A 1YTYA 3GG0A 3NKYA 2V9KA 2V4JB 2VFSA 2E1RA 4KY3A 4BCAA 2HQDA 3CCQS 2B5JA 4N47A 4PWWA 1DJ0A 4BLGA 4FYDA 4ZVSB 4FF2A 3MM7B 2AWZA 1J5OB 3WX4A 1H38A 3W64A 2CPJA 3HT0A 4C7QA 4QIGA 1I1GA 5AE3A 5KG1A 3NXZA 1UFKA 3W65A 2DB1A 3UPFA 4EZ6A 5KFQA 3DXBA 3UNGC 3GMGA 4A48A 1QY7A 4ZVRB 2C2RA 2K8GA 1NO8A 4ZVGA 3IG1A 4A8OA 4BBYA 4ZP9A 3QT7A 1B70B 1FXLA 1VRTB 4MK8A 2Z2MA 4I2QB 5KFWA 2VFUA 4WFBQ 2VPYB 5I3UB 1NJYA 2QL5B 2QLXA 4LVOP 2YNHB 4JV2A 5J2MB 5RUBA 5DS7A 1BLUA 2ZC4A 2QT7A 3OSNA 2N7YA 1TL1B 3Q89A 2K1RA 3HHLD 1N36F 3JB9k 4ID8A 3W60A 1QJHA 4JI7F 2ZH9A 3CCSS 3T9ZA 2OUGA 5CYJA 1FEHA 3PYGA 1JLFB 4RU2A 2FZGB 2JNJA 4PPZA 3G71S 2YBVA 4LF9F 2WVBA 3H2UB 1F5CA 2NR0A 1DURA 2F5GA 4JI3J 1EZZB 3MOJB 3R1HA 3F44A 1N0UA 1U1LA 1CS4B 1Y5LB 3T5LA 3DDIA 4C3LA 1CEZA 5KFMA 3DOMB 3L4BC 1RWVB 1HWUA 4KH0B 2UXDF 4HHJA 3AJDA 8ATCB 1CJVB 3TAMA 1S5ZA 2ZBQA 1KP6A 4X84A 1HIYA 2WB1D 3CGIA 4NLSA 2Z2ZA 2BM1A 3OLAA 1QSSA 3MEGB 2ZM6F 5EX3A 1RTDB 4ZKAA 4B3TJ 1HA1A 3QAEA 1WI6A 2HBZB 4ZPWR 4ED6A 1MWZA 5IOLA 5JJBA 3LUYA 3C46A 4NX9A 3V2UC 4J9LA 3GCXP 3GQCA 4N7TA 1VQ6S 3Q8VA 2GV1A 1ZM4A 1PYSB 2VDIA 5KOXA 1VQYA 3PHEA 1Q81T 2DR8A 1U1MA 4PYAA 3DMJB 3KHLA 2M3DA 2DHXA 2ZBPA 2XHWA 2CPXA 2ZNYA 4FBUA 4M94A 1LK5A 2ZWOA 2LKZA 1QE1B 1Q86T 1RWWB 3FSYA 1F5BA 2AMCB 2E5HA 1TAQA 4DR3J 1SKWA 1BQMA 2DRDA 3GJRB 1HBMB 5KFZA 4DSLA 1SV5B 5FJ4A 4NA3A 2MLYA 5I42A 4O4GB 1S6QB 3WC2A 5HBMA 4KSEB 4S0MA 3DRRB 3CJSA 1T9VA 2YWEA 3PR5B 1RHKB 1XK8A 2JEFA 1BQNB 4U7UK 1FVSA 1KVJA 1S77D 2Q6CA 1NXIA 4DZ6A 2MXYA 5DG8A 1VMBA 3IN5A 3N5FA 2U1AA 3BGOP 5ETQA 4DV2F 4D3HA 1TKTB 2DEIA 3D3CJ 4G3IA 4IRCA 3KNGA 4HKQA 2EEYA 4DV4F 3TYTA 2CDQA 4AUKA 5KFLA 3RB0A 2V0NA 1CJKB 5KG7A 2R2TA 3PTWA 5HAOA 2QL7B 2L41A 3BQ0A 3BR8A 1MWQA 1HI0P 3PR4A 1OS5A 1C4AA 3FGVA 2AHOB 1WORA 1JXEA 1HBNA 1T03B 2HIQA 3BR9A 1KOHA 1AT1B 4X4RA 2YKOA 1VHFA 1TTHB 3QWPA 4LFBF 4GMKA 4PPDA 1FRJA 4EBCA 3TZZA 2YQ1A 2HK2A 4IFVB 4IH6A 4IQMA 4RW4B 5L46A 3CJRA 1GNKA 3LF0A 4TKTA 5KOWA 4LFAJ 5F8MA 4MTPA 3WQPA 1EX8A 3M1VA 4Y65A 1UVIA 4KBIA 4WFYA 1HNXJ 2CXEA 3GP9A 3K5PA 1HI8A 4LIWA 3CNQP 4LSNB 1I94F 3QPIA 4R0EA 3PX6A 1R0AA 3GIJA 2XMKA 4C8YA 2GVDB 3P3DA 5LSRA 1QUPA 1D3WA 2GIQA 1Q8KA 1U4BA 2KFZA 4X4PA 1RT3B 1MMNA 4FNIA 1EP4B 1MU2B 2V69A 3M6UA 4RNNA 2OD4A 1UEKA 3BS9A 1Q5VA 2IJNA 3A8JA 4FVCA 1CLFA 1F3VA 4X64F 1N0VC 4O3PA 1GMVA 4L75A 2HHSA 3QIDA 3EM1A 4ALZA 2XMAA 3SFUA 1RWKB 4NEYA 2E7VA 3K0JA 2R2RA 3A8KA 1R8HA 3CVKA 1SKSA 3PZPA 1Q95G 2ADCA 2V2QA 4YN3B 2OKQA 1F3FA 2P9GA 2XYGB 2NZ4A 2EFGA 3D54A 4H4OB 1UA0A 2AGPA 3FSIA 1GH8A 3DI6A 3LGNA 2DGSA 5F41A 3G87A 3KTQA 4DR6J 2LECA 1E6VA 1WC3A 2MQNA 1FDAA 2NYHA 1JLQA 4ZS6A 2AQ4A 3CC7S 4LR7A 2BE9B 4YR3A 3MI7X 4BWMA 2X1GA 2KI2A 2UUWA 3ONQA 3UO0A 3G8SA 2ZZMA 3MEKA 4LF7J 1FKOB 2KYXA 4WP3A 1V5IB 3SQGA 1OQ6A 2B4PA 2VPXB 3HFVA 3RB4A 3M30B 2PO4A 1GAOA 1KOOA 1JLAB 4GO7X 5F8HA 1RTJA 2IRUA 2MGZA 2XLIA 2OPPA 2AYGA 1HFEL 5L1KA 3SEOA 3Q23A 4HT5A 2YNIB 4J91A 4OL8A 1SJ4P 2PE8A 3FEXB 2HWTA 5DG9A 2LLZA 2OGUA 2RRBA 1HW8A 1TR0A 4DZDA 2J8SA 3B78A 2D74B 3NMAA 1T95A 1U8WA 2E7WA 1S1UB 4K5SA 1VJQA 1WC0A 4NLRA 5GMDA 4NLGA 5D15A 5HQLA 5BR8F 3FBEA 1BQXA 1OJ4A 1WHYA 2OH2A 1ZM3A 4DV3J 5D78A 4ECQA 1SBRA 3KHGA 1S76D 2V4JA 3PKYA 1KFSA 2MZJA 1VFJA 2FJWA 2QRRA 2DXDA 4GVLA 2OELA 4ZPBA 1KQKA 4LBIA 3LP1B 2ATCB 4TN2A 1JB0C 1X5SA 4ZN1A 3S6EA 2DNNA 5DJBA 1UEVA 1ZZNA 3MM7A 1J5OA 2E66A 1B4SA 1H72C 1WF1A 2ZH7A 1HI1A 5A8WB 3BYRA 3AOCA 3PY8A 2QO3A 2DHAA 2RIJA 1RA7A 3KK2B 2LCWA 3FDSA 5KFIA 1OIAA 2VFRA 4LFCJ 5D4OA 2GJFA 2QGFB 1V5VA 1U2FA 5D6GA 3CJ2A 2W8LA 2LU2A 3K89A 3LP0B 4CWBA 3ETMA 3I9ZA 2DCLA 5JXSA 1VRTA 4I2QA 2B8QA 5I3UA 4P52A 4ILLA 5HMWA 3M6VA 1KR4A 2P6TA 2YNHA 5J2MA 3MTJA 4EGLA 2XWXA 3TOQA 1RT2B 4DWIA 1WHXA 5EUHA 1RTIB 3PG9A 3DHXA 1F60B 4RZRA 1TL1A 1H3DA 1NDLA 1T9TA 3EYZA 3R5AA 4IYQA 1Y3KA 4UQGA 4JI1F 2MQ8A 4H4KA 1D1UA 3VGSA 1JLFA 1UPMB 1YRTA 3AD8C 2ZHOA 3GJTB 5MAOA 1Q82T 1WSRA 3ITHB 2QMUB 3HHNB 2L48A 1CS4A 1SQFA 3O3LA 2CNLB 1QM9A 3DOMA 3CCES 2ROEA 3H25A 4LF4F 3KHRA 4KT0C 4MFBB 4M63A 1CJVA 1HHTP 1U09A 2M2BA 3TAPA 1UCNA 2C2DA 2CNOB 2VQEF 4ES3A 3MEGA 2G1DA 1RTDA 4F3MA 5CZVA 4M5DB 5GADU 1JQGA 3CCZA 3MM9B 1X4AA 3D3BJ 2G0CA 3K7RA 2ZH6A 1VQNS 3I0RB 3A4TA 3BSCA 2C2KB 3PO4A 3KYLA 1NSQA 1XR6A 3UCZP 4DL7A 3CCVS 2EKYA 4LT6A 1K9MT 3GYNA 9ATCB 2DHSA 1S4EA 8AT1B 4RWXA 3DMJA 4I68A 2GQQA 4QOTA 4ED5A 1QE1A 1LEOA 5F0WA 2OSRA 2MSTA 5SZTA 1WC1A 3HVWA 2CPYA 1IJEB 1HBMA 2WVCA 1SV5A 1U6FA 2M88A 3EPIA 4TYAA 4O4GA 5AXNA 1S6QA 2WSFC 3J7AN 2ASJA 2GO8A 4FPRA 2CKWA 2UVVA 4JI0F 3KG1A 3DRRA 4I69A 3ISZA 2PT0A 3DLEB 2GFFA 5JMNA 3CCWA 2XMTA 1NKCA 3KLVA 3GJQB 1BQNA 3C6TB 2V94A 3HI9A 2V2KA 3R6GB 1VJWA 5HANA 3FUYA 2NSBA 4DSIA 1M5OC 4DPWA 1DTTB 1NK0A 1TKTA 4MAKA 2UU9F 2HFNA 4RKUC 3DGVA 2RUGA 3GR0A 3DFEA 3I0SB 3QZ7A 2UVUA 2VJUA 2PA3A 1CJKA 5CCLA 5GAGU 4OV1A 1BXNA 3B82A 4JI6F 2KFNA 1RYSA 1PYTA 2E1AA 2B9YA 4O23A 1JIHA 5ETOA 5K8PA 1T03A 1O51A 2VASA 3T41A 3QWUA 3OBIA 3ZZUA 3BZQA 4C8ZA 3EDQB 3P96A 2J76E 2W2MP 1FNOA 3H2VE 3AY0A 2B56A 4IFVA 5L1IA 2O1PA 2AD9A 4RW4A 2B51A 4LF8J 1BMQB 2G2YA 3I6PA 3CDBA 2CUYA 2QEXS 3QJLA 1UVKA 4RO0A 3TUZC 4DF8A 4JUZA 2NUUG 2BJDA 2JVRA 1PBUA 1V3RA 2QLWA 4YY3J 4NI2B 4OLOA 1QTNB 4F04B 4ZVFA 3T1YF 1MW7A 2E44A 3E2EA 4LSNA 4EFAC 2H5JB 4CLUA 3HVTB 3W1YC 2GW8A 2DTJA 4K4VA 1TU0B 1YG0A 2GVDA 1S1TB 3ENAA 2MMYA 4FNHA 1NDPA 5AE2A 3AJ1A 3ZNJ1 2B43A 2X7IA 2OHDA 1N32J 2EFQA 2VPWB 1RT3A 1S0MA 2AV5A 2EKNA 3DCAA 1EP4A 3PFEA 1MU2A 1VRUB 2Y8WA 2UUBJ 3TZYA 2HW3A 2ZWPA 1X9WA 1W2IA 1WC5A 2XCAA 3P8BB 1YRUA 4DV1J 5B0GA 3NGRA 5IV3A 1KNZA 2YQ3A 3J7YI 2FC8A 2LFVA 4DSKA 3QGHA 1D9FA 2ZITA 4OX9J 4CLPA 4G1QB 3MMJA 3N6MA 3M6XA 5D77A 2HEKA 3MR5A 2DY9A 5HI7A 1HW9A 4DR1J 2D69A 4DJBA 3CDAA 2YH1A 2NXNA 4H4OA 1YJRA 2FVCA 2R7OA 3T3FA 3CSKA 2OD6A 1MROB 2B9WA 3LW5C 1K0VA 2LQ9A 3M9MB 4JYAF 3Q2SC 2DGVA 2AJQA 4OV6A 5E3RA 3EZ5A 1GFWB 4CNYA 3U7JA 4TNOA 2IC3B 4ZLJA 3N9UC 2FHJD 2JEJA 2B9EA 3JAMY 3MD1A 3T9NA 4DX7A 1FKOA 1N33F 4QIFA 5E33A 2LEBA 4R0JA 2HGLA 3UD3P 3K5NA 1DY3A 3LAMA 1VISA 3M30A 4DSFA 1JLAA 4A8FA 5AT1B 3CMAS 3A12A 3E51A 3AXKA 3EZOA 2QLFB 1NK4A 1ZPWX 1PC5A 2ROGA 1EJ7L 2YNIA 2WHOA 1I3OB 1UPPA 2XGQA 1H7XA 2KL8A 4PAAA 1UWBB 2BVZA 1JJHA 2JVOA 2CZVC 1SVDA 3QT6A 1S1UA 1WUUA 5H1SV 1N34F 2DVIA 3HHLC 1FI4A 2R7TA 1QAIA 1PO6A 2A2CA 4C8KA 3IWNC 1S6OA 4ERDA 3MPVA 4MT1A 3CCRS 2CQCA 4O0IA 3KJFB 3F0NA 1FTCA 3ILOA 2Y0BB 3LP1A 4WIIA 1RQ0A 1GEHA 5CA5A 2IFXA 2AZ1A 2V5HG 4QR1A 3TJAA 4J9QA 4K50A 5A8WA 1X9MA 4CCHA 4A8XA 4M5HA 5JVGQ 4HLBA 2BUNA 3KK2A 3KXDA 1N36J 1RJJA 3M8PB 3R97A 3W5YA 2KH9A 2BMBA 2E7XA 1R8CA 2DH7A 1SKUB 3GV8B 3LP0A 3HSGA 2DXFA 1K47A 4JBCA 4LF9J 1HQUB 4QYZJ 3W5ZA 2FJAB 4ANDA 1WI8A 4ID5B 3BGRB 3I87A 3OJSA 4C3KA 5HVGA 1RT2A 4DQIA 1GMUA 2DO4A 3N01A 1RTIA 3THVA 1KD1T 2HVHA 1VIXA 2MKSA 5K5MA 2HMIB 2FPHX 2UXDJ 5KFNA 1LXJA 1CC8A 1UJ4A 2WAQD 2VHGA 2WVFA 3SFGA 3VAHA 1Y4ZB 3CUNA 2LA4A 4BC7A 1WEZA 1DQ9A 2ZM6J 1RKJA 5DETA 1NUEA 2RB7A 1Y7PA 5IT9U 1PILA 4K8RA 2YWGA 4DDFA 3MAHA 4OYOA 3JS9A 4PXDA 4IO1A 3U1MA 2MKCA 2QL9B 3ENQA 3ITHA 5JVHQ 2EBGA 4QW9A 1G3OA 1VQ8S 1Z4UA 2G1HA 4KGXB 1FWLA 3CJ3A 2CPEA 3R5BA 2MJUA 4MFBA 5H9EJ 1NMEB 1WOSA 3QJJA 4RW7B 4YMEA 3OR1B 3FKBA 2GJIA 4C6AA 1S9FA 3IC1A 3KUEA 4ED3A 2X3GA 3Q8UA 4DPXA 2HVDA 4CT9A 4M5DA 3CCUS 3MM9A 3IXQA 3UN3A 1K73T 4LQ3A 2QMXA 1LQ9A 3I0RA 3CEDA 1VQ7S 4EI2A 5CHCB 1G2EA 1RCOB 1UZDA 4Q5VA 1BC6A 3CJQA 1T8EA 1JJ4A 4UOFA 4WYLA 2D7SA 3H5SA 3H4BA 5A76A 2IMWP 1GQEA 3FRYA 2C3OA 1EB0A 1JKHB 3LWLA 1DZ5A 3H7HB 2EPIA 4ZPVR 2W4PA 2DIVA 2Q1LA 2HQGA 2AX0A 1L5UA 2GIFA 2YPZA 1R27B 3LGHA 1RTHB 2JC0A 2XYHB 4K0KF 2IVYA 3OPKA 2GC8A 4FVMA 4P6QA 3FCVA 3DLEA 3Q22A 4MH8A 3C6TA 3NBPB 3ET6B 5HATA 1TL7B 1P27B 2NXUA 5DZ7A 1YJVA 4DQQA 4AXJA 1IM4A 3U1NA 1NK5A 4WFZA 3GONA 3OR2B 5A2QU 1DTTA 3I4HX 4HDGA 1NSKL 5D8HB 4LFBJ 1DAXA 1NH7A 2RJZA 2GMLA 4UOGA 1QAJA 3I0SA 5L1LA 1FK9A 3KJNB 2RD5C 2ZOFA 5KFEA 1TP7A 3RB3A 4CLSA 3AHPA 2OAUA 2YWHA 3ELHA 4NXNF 2EI5A 5GAEI 3BV8A 4GRSA 1JMTA 2YKAA 5KT2A 5D3GB 4RUHA 5C7PA 1RHJB 3R5DA 3ZZZA 2FJEB 5EWFA 3IRXB 3TARA 2K3KA 4N56A 3DU6A 1I94J 4CRJA 2N4DA 4F26A 3GIRA 3V4MA 1ZM9A 2C2EA 1CVJA 4CH7A 1OYEA 2JZ5A 1HD0A 3HMJG 2GAGC 4CO5A 2V4QA 3CJTA 4YHHF 4MJKA 2ZEJA 2FDNA 1NKBA 3NLCA 2C2MB 1V3ZA 3QRQA 2HWHA 2KFYA 1S1WB 3GE9A 2W2PP 3M2RB 4XIUA 4NI2A 3FEYB 1TELA 3MUVP 1QSYA 4URGA 5HP1B 3HVTA 3JTNA 3FC9A 1LWXA 5J1EB 3NRBA 1S1TA 2DNKA 2ZDPA 3FQLA 2HIYA 1T9YA 4B3TF 1PC4A 1Q5YA 3GFXA 4F4XA 2HAIA 4X64J 3P45B 2YWFA 3KG4A 3KMSA 3V5RA 5GMKa 2RQCA 2IBOA 2B7BB 3OHAA 3TANA 3W66A 1TK0A 1VRUA 1FCAA 1RT1B 4HT7A 3VAMA 3PRDA 3NOCA 4C97A 2LXUA 3CDUA 1VBXA 3KLEB 2IBKA 3G2XA 1MLAA 3FEZA 4UOCA 1WEYA 1IKWB 4OYIA 1KEKA 1L3UA 4NCBA 2D1CA 1UMJA 3QFWA 2NQPA 1B0VA 3QGIA 2HRUA 2D9OA 3OL9A 2R8HA 3GCWP 3VAGA 1NNDA 5EWGA 2CA9A 4G1QA 1FXDA 5E0OA 5LOQA 3VAIA 2L08A 1Y5IB 4F36A 2HFOA 4RW9B 3CCTA 2E9TA 2IA6A 4DX6A 3EPGA 1SJQA 2L3MA 2FLLA 2YKQA 2HKEA 1TKXB 3UI3A 5L9XA 2Z2YB 2W24A 4X4SA 2RAQA 4OYPA 5LT5A 1AFJA 3Q8PB 2XS2A 1MROA 2QE5A 2IVMA 3PW0A 2ZE2B 2B4UA 2HS3A 2BW7A 2CJ9A 4UW2A 5E3QA 1KFDA 2E5GA 2FGOA 1BWEA 1N54B 4CLTA 2N82B 4F0MA 2IC3A 4HACB 4P2MA 4QWDA 4W4MA 3QSIA 4ETXA 1KLMB 4Y2IA 3MECB 4ZP6A 3X3UA 1FJ7A 3UW1A 4DPOA 4MKAA 1PAEX 4OHZA 2Y1IA 4MYUA 5BR8J 1TFWA 3NCRA 4WKRA 4N41A 2HYIB 3JSMB 1RHRB 1WELA 4L3NA 3BO3A 3ISND 2BV3A 5DDRC 5AJ3F 1NKEA 1PYOB 1HNZF 1U1OA 2ZHAA 1RAGB 4C0OC 5A6PA 2RT3A 3RW7A 3MWBA 5ETVA 2RQ4A 5HMXA 1PAUB 2XS5A 3MCNA 2G4BA 4C3MA 3M8ZA 2HAFA 1UWBA 1RDRA 2JEIA 2BABA 2W2QP 1N88A 3V6HA 4OHWA 5JUMA 4P9SA 2OPSB 3I32A 3BJYA 3TVKA 4H4MB 2YKMB 2VPZB 1HNXF 4PQUB 2XMWA 3O1LA 1MMLA 2BBEA 1N5TA 5GMEA 4EWTA 5IQQA 2WTFA 1KQGB 2UV8G 2DT9A 1B64A 4P72A 2EG1A 2NXCA 2H51B 4PCQA 2XLJA 5M2RA 2AP6A 1R0BG 3ETOA 2KM8B 3M8PA 4NZ6A 2GJ2A 2PI4A 4UTGA 3GV5B 5HJYA 3RRKA 4JI1J 1CULB 2XZWA 3EX7B 1HQUA 4NLQA 2HPUA 4ZPTR 1GXLA 4ZIVA 4TU9A 3HO1A 2DNZA 3VR1A 4ID5A 3BGRA 1K1SA 2BKOA 3HD1A 4KIAA 2VF3A 2ZD1B 4NLVA 4ANCA 4LF4J 2HNZB 2ILYA 2BACA 2HMIA 4WJBA 3IWLA 4H54A 4O3NA 2Y1RI 1FVQA 4RR5A 4K2JA 2BJ7A 1S57A 3A1YG 4ES2A 1MN9A 3J80Y 2ZH2A 2VQEJ 2Z57B 4DUTA 3THPA 3TQEA 2RU9A 4OYMA 1YKWA 4F3OA 4U7CA 4LF2A 1VK3A 1X5PA 1SUQB 2QV6A 3MPWA 4M5KA 1C0UB 1AB8A 1OY8A 2N3LA 4NE9C 1TQLA 2I8EA 5KFXA 3VTIA 5KFVA 4OMFG 1U8SA 4AL7A 2VKZG 2MHNA 2WVDA 3PW7A 4XAKA 4RW7A 1IQZA 3HJVA 3OR1A 3GYGA 3SSRA 3W2WB 2LQ8A 2YQ0A 3HZEA 4LBPA 4PXCA 1RCXB 2RSQA 2ERRA 3SV4A 2HSEB 2V8VA 3O8WA 1B7YB 2IRXA 4FF4A 4QCLA 1DQAA 3MM5B 4Y3CA 3SCJE 4ZVHA 2QN6B 2MQOA 2VBYA 3TNVA 4CQ1A 2LEPA 3HZGA 4NCAA 1RLDA 2WW8A 2KYZA 1PJ6A 1EIYB 4RNOA 4JI0J 2QX0A 4KC5A 5EX0A 4B08A 3CCMS 2DGTA 3UN5A 3J81U 5KG2A 1RWOB 3NCQA 5ETMA 3OHBA 3DLBA 2DO0A 1NB7A 2BA9A 1JKHA 5J1PA 2HK3A 2VL1A 3D68A 4UY8T 1UJ5A 2KRRA 4OHYA 3Q24A 3MF5A 2KG0A 2BXJA 4WXWA 3QAUA 2MKYA 1RTHA 1D9AA 5IXUA 3DC2A 3ULHA 4FP9A 2J9CA 4CNZA 2MKJA 1Q8BA 2NXEA 1XNQJ 4C8LA 1LWCB 4OZ3A 1ZA2B 1REVB 4JI6J 3NBPA 3ET6A 1QLNA 1TL7A 2MZ1A 3HPOA 3E01B 3UDCA 4CDIA 2JX2A 4F8RA 1FJCA 4X4VA 3OR2A 2YWKA 4ZVTB 3MGJA 4AYBD 2CQDA 1PG5B 2IAJB 1F9HA 4WBFA 1G7CB 4DLGA 1VBYA 4TU7A 3BH7B 2R8KA 3PJ9A 1T0TV 2XBPA 2DH8A 3LALA 4DCJB 5D3GA 2XTJP 2W1BA 3C2PA 5HVHA 1VDHA 2LQJA 4KV8B 3TR5A 1SB6A 3IRXA 3NP5A 1SJ3P 3G6XA 2K3IA 2CWXA 5LXYA 3DGPB 3FQKA 1JLBB 2D3UA 4URSA 3CJKB 1WHVA 2HWIA 3R5CA 2APOA 1BUXA 3DRSB 3HSJA 2F63A 3CD0A 1FFWB 3IS9B 4X65F 4L76A 4F7VA 5ETPA 2YKNB 1IBMF 1DTQB 1WC4A 2LP4A 3NWRA 1H2VZ 3IAS9 5KFCA 1S1WA 3M2RA 3K2YA 4DL6A 3BYPA 4IOAQ 1LV5A 2W9AA 3D28A 1L3SA 3H8YA 1ELOA 5HP1A 3B6BA 3AOBA 2OTJS 5J1EA 3PYEA 1Y00A 2YY3A 4WFAQ 4B9VA 5A8KB 2GMJA 2O3DA 2XB2D 1URRA 5D0EA 4EU0A 2RQKA 2BE7D 2OO4A 4J5OA 3NGUA 4DEZA 1NCLA 2VKRA 1U26A 8RUCA 1PKUA 1XTZA 1WF0A 1YJNS 2W7AA 4ECRA 1RT1A 1FD8A 4OX6A 5KFTA 3M8WA 3BM7A 2IM1A 2OEJA 1X4GA 4NCGB 3SSQA 1U6ZA 3KLEA 2RDDA 1EQMA 4JV0A 2F3JA 5E2QA 5KG0A 2UVRA 4U8YA 2NS1B 4J9KA 1IKWA 3Q86A 2GQ2A 4YEAA 5I4MA 2W2OP 4ANEA 3BB5A 2Y1LB 3N0VA 5L38A 3SZ2A 2R7UA 3RAMA 2QZ8A 1G1XA 1NJWA 5C24B 2Q79A 4LQ9A 4RW9A 4L72B 1HMVB 1S59A 4WK1A 2R2SA 1RBAA 2XEXA 1ZS6A 3ZZTA 4LRAA 2V34A 1TKXA 2CQ1A 2RS8A 1Y9OA 4ETZA 4AQYF 1HBOB 1YDLA 1X4EA 3FZBA 3MEEB 1UFLA 2DITA 2DISA 4IO9Q 2KVIA 2YPYA 2ZE2A 2DR7A 1ZA1B 3P5BP 3QSYB 1SJRA 4A8YA 3T19A 1XIQA 3KNAA 4HACA 2QYGA 3DN9A 3OTBA 5HQMA 2ASLA 3NL0A 2HQ3A 5H9FJ 1KLMA 3MECA 4PXBA 5CQGA 1C1BB 1EARA 4K2XA 1L3VA 2CQ2A 2AEMA 2ZNZA 5F3ZA 1TMMA 2GHWA 3JSMA 4RUBA 4LR9A 1P1LA 2BKPA 4WPAA 3SSSA 3R1LA 1WOOA 4ZIWA 3NOGA 4DX8H 5KFHA 1IJFB 2MQMA 2RUSA 2R8IA 3VQSA 1TKZB 5HK4A 1Q78A 1UZHA 1YJTA 3NAIA 1FESA 5ETNA 3KG0A 2GQCA 2QC3A 3AQOA 1JLEB 2YNGB 4OZNA 2MTLA 3PO5A 4WTOB 3HULA 3CJ5A 3M6WA 4KTQA 2HFUA 2OPSA 4Q0BB 4X4TA 1U47A 4DQPA 4CP5A 5HROB 4H4MA 2YKMA 4QW8A 2YKPA 4PQUA 2VONA 2V68A 3V6KA 3OD2A 3FK4A 1APSA 4OI4A 2Y9HA 2KU7A 1FDDA 1HWLA 2C28A 5DDOC 4OFZA 2I38A 3GPAA 4CM2A 3Q0AA 4OHVA 3LO3A 1HR0F 1CULA 2IJRA 2I6WA 4UUXA 2XI2A 4ZVQB 2ASYA 3K5OA 4A47A 2MQPA 3DOLB 1SPBP 1IN0A 4Q2MA 1YBAA 3ZC4A 3KK3B 1X31C 3CT9A 4DV1F 5KG6A 5ETKA 2VQFJ 3SQOP 1RSCA 4BS2A 2HHXA 4EYIB 2ZD1A 2EWHA 4L6V3 3GFZA 1R0CB 2HNZA 1KSPA 3RBZA 1FNMA 3M8RA 3PIOQ 1RABB 1YJ9S 1S10A 3K5LA 3ZZ0A 5DDQC 3WIVA 3FMWA 5IT0A 1P8GA 2AGQA 2EFPA 3NS5A 3F56A 4KFBB 2B3TB 5DGBA 2F7VA 1SUQA 2OMLA 5D0GA 1C0UA 2OSQA 2RRAA 2ZBIA 4C0HA 2CJBA 2EFVA 4CH0S 4JV5J 1FWKA 4DI6A 3BKUA 3M7VA 1YK9A 2XZTB 3V6DB 1XERA 4ECWA 3IA0A 4AE5A 3N28A 4KE5A 4K7QA 4OZ1A 1R6VA 3DRYA 3W2WA 2CDRB 2JDJA 3CD7A 1A9NB 1T7PA 5HVFA 4HHUA 4TY8B 3IBFB 2DGOA 3MM5A 2YH0A 3FJ2A 2ZBCA 3KWMA 1F9FA 4ZCLA 1ZH5A 2YX7A 2QA1A 3FCHA 4KGMA 3ZZRA 1NM2A 2EW9A 4OJHA 4XTTA 5A0YB 1UAWA 3M05A 3JSYA 4K0KJ 2LEAA 4WXOA 4V19J 1WDTA 3EXYA 3IGNA 4G1PA 1RT4B 4X4QA 2PFDA 1KVKA 2HVZA 3T1HJ 2QYCA 4QBUA 1Q53A 4MK9A 7AT1B 1HNWJ 1LXNA 2CNNB 1M1GA 1FRMA 3SCLE 3OV7A 4DPUA 2BOPA 5I3PA 2B4OA 4Q44A 3FZ2A 3HVRA 3D1HA 3BN7A 1EKSA 2MY7A 3EGVA 5F8LA 3BSNA 2CG8A 1QAXA 5B0BA 4GKJJ 4WE1B 4OI3A 4QIVA 3WZ0A 1LWCA 3MDFA 4MIBA 4NXNJ 1SC4B 1REVA 1VC5A 1JX4A 1H73A 2HQIA 3CC2S 1RHMB 3AA8A 3E01A 3R7BB 1F6TA 4QR2A 1WTBA 5KG5A 1UVJA 3OTDA 2CPFA 2HGMA 3PX0A 4UZBA 3SCIE 3CD5A 1FF2A 3HJFA 2F8HA 2PDAA 2Q66A 4FXWA 3PRVA 3D1QA 2IAJA 1F9EB 2LDIA 3G6ES 4FKXA 5D4PA 3M2UB 2K06A 2VG7B 3A3PB 2F1FA 2HFSA 4CO0A 4FS2A 1HARA 3PKMA 3CTRA 4EBDA 2FHKA 4F0KA 4WCEQ 4YHHJ 3WHIA 3LA0A 2XO6A 4KHPJ 1W26A 4KV8A 3THTA 2G0JA 2DNGA 2UZAA 4C4WA 3L7UA 4CZCA 4ZJQA 1KKHA 4IH5A 1FO1A 3J7ZT 3DGPA 2DPIA 4W98A 4EO8A 4YR0A 1JLBA 1VRQC 2VD3A 3CJKA 4O0NA 3D6FB 3ZXWA 3CMQA 2U2FA 3K5MA 1N5YB 1YITS 3DRSA 2V4RA 3IS9A 1D09B 1UJ6A 4YDDB 4CLWA 1ZBTA 4DXLA 1TK5A 1H6KX 1X4FA 2YKNA 3OXFA 1DTQA 3U1LA 5L1JA 2CZ4A 1NU4A 1MWYA 5DGAA 2IJFA 1P9QC 3QRRA 2KG1A 2WZ1A 1FTRA 4PWUA 1AA1B 2BE2B 3GZ7A 1RWXB 2OEKA 5KFAA 5THWA 3V6JA 2WBMA 3PW5A 1GT8A 1KTQA 2RQMA 2VBWA 5A8KA 2A18A 2KB2A 5ETTA 3RU0A 4MMOA 2MKHA 2IVFB 2P9CA 2ZHBA 3RG6A 4HDHA 2CQ4A 2WRMA 2IM2A 2GCFA 1VQKS 4ZPDA 4F3QA 5CAAA 4NCGA 2L9WA 3KOAA 1R8PA 1SH0A 1R8BA 2XMUA 3D67A 2DNHA 2O5DA 3PW2A 5KT4A 3F73A 4QYRA 1HQEB 1N8RT 1HWKA 4P74A 1S48A 4NXMF 4AL5A 5C24A 4KO0B 4DFPA 4ED4A 3P6YC 2EVZA 4CO2A 4WTYA 4LRCA 1HMVA 5E3AA 2JC1A 3EICA 1SC1B 3W7BA 4K4ZA 2D41A 1S9GB 3FVYA 3DU5A 1HBOA 3MEEA 4USWA 3ILLA 2AJ2A 4NL5A 2CPZA 3LANA 5AJ3J 1HNZJ 3MM6B 1XJWB 4ZLNA 1C1CB 2GZOA 2YNFB 1S97A 5K8MA 1U24A 5BYRA 3KUHA 4F4KA 2AGOA 3PHTA 2XZDB 4IUFA 1SL0A 3MR3A 4GVBB 1C1BA 4DU8A 4CO4A 5C25B 4ZA1A 4DCPB 3JTPA 5FDLB 1GX5A 2VBXA 2H4WB 4NYPA 1YWXA 5GADI 5CH7B 5J2QB 3HHEA 2GGPB 1RB0A 3LGMA 1RA6A 1FFGB 3LWMA 4QIWD 1A0OB 3FNNA 2CQPA 3R6LB 1QDUB 5KFRA 1TKZA 1RT7B 5EN1A 3CB4A 1RKIA 5F9LA 5DRKA 1TL3B 4GKKF 4GC6A 1REGX 3C6UB 5AXMA 4ECZA 5DM7Q 1S99A 2R8JA 1JLEA 2YNGA 4DBQA 2M4MA 3NNCA 1RAHB 3V81B 1P9YA 3MAAB 4Q0BA 1W25A 3PFOA 5BXIA 5HROA 2FVSA 1NDCA 3VGUA 1HL6A 3NMRA 2XQCA 2HHVA 3Q8QB 5J2PB 4P2SA 3H42A 3K8WA 2ALYB 4IR9A 4TLRA 3SV3A 4ZLLA 4ED7A 2HS0A 5EHHA 1T05B 3MURP 3TO8A 1OSDA 3WDOA 4K4XA 4Q8FA 1MN7A 5DO2A 5LM7E 5LMNF 1S0VA 2CYYA 3NGTA 1R89A 1SJFA 4ZPCA 1M90T 3DLGB 4PKDB 3VZHA 1NJXA 1VQOS 2AJFE 2PA8D 3DOLA 3KK3A 2E9RX 4YDXA 1X5OA 4R5PA 2DNQA 1YZ7A 1VC0A 5GAGI 2BOAA 3RUBL 3MHYA 1FX2A 3CE8A 3I5BA 4UT4A 2QA4G 4OZJA 1NPRA 4NLYA 4RLEA 2DHHA 1RI7A 2DRBA 2DCUB 5H9FK 4NLUA 1S6PB 4Y0FA 1TK8A 1IBCB 3TW0A 2C2NA 2R8GA 1JLGB 1WDDA 1KS2A 1RU1A 2V8PA 2OP5A 2AJ1A 2COLA 4Z37A 1RWNB 2HLUA 1RAFB 4KFBA 2JWNA 1LKZA 2HZCA 4DN0A 4K4UA 5K8OA 1V3SA 2MY8A 2N7CA 2C3MA 4KGVB 5KFJA 1AZSB 1RWPB 3BQ1A 1RHUB 4DN9A 4WIQA 3R7SB 2VICA 4ZHRB 2M70A 1FA0A 3V6DA 4KGKA 1FRHA 3BQ2A 1HLWA 2WVEA 5LL6d 2XYPB 2FHMA 2VC1A 1NK6A 2WW4A 2KXNB 3KLHB 4M5IA 1DLOB 4NLTA 1YGYA 4TY8A 4O4RA 2IA0A 3A13A 2UXBF 2Q3PA 1AXQA 2W7PA 4C8MA 2QLJB 4G6VB 2C22A 2VFTA 2HGNA 2PMZD 3N6NA 4PYDA 1VIOA 2HRYA 2V9WA 2IPOB 5A0YA 2DNYA 4B3RF 1FJEB 3QRPA 2O66A 4WK3A 4USTA 3G6VA 1T9UA 2X3DA 3A3OB 2ZVIA 2GAHC 1RADB 4W90B 5AE1A 1RT4A 3VAJA 4LRFA 4ZP7A 3TUJC 1FD2A 2JSXA 5HO4A 3H5XA 3MR7A 4E8UA 1FRLA 2HHPA 5AXKA 1RGVA 1PCAA 3VAKA 1XNRF 3IAM9 3PDNA 4Y34A 2CFXA 2HZVA 3W8GA 3T5KA 2ZH4A 2E5LJ 2WCXA 3OJUA 4WE1A 1M5KC 3B8HA 4IG3B 3PEHA 4KPYA 1R31A 3CJ4A 4IFYB 1X8DA 2QA2A 5HJXA 3CCLS 1Y0HA 2V8DA 2P2CB 1HBUB 1Y5NB 1XN9A 5IZHA 1R3NA 1RYRA 4X66F 2L9NA 4DMZA 4DR7F 2OJ3A 2CQ3A 2E5IA 2YXLA 3FBCA 4QWEA 1LFWA 3TA2A 4XPEA 3GYXB 4O3OA 3TUPA 1SH3A 1VQ4S 3M2UA 2VG7A 4DHVA 1U1KA 1X4CA 4X65J 3POTB 4Y00A 3KJVB 2NUHA 1IBMJ 4LVNP 4NPOA 4ILRA 1VLOA 5HL7Q 5K9FA 1FEEA 1SL2A 3QATA 4RU9A 3QMQA 5IS2A 1QAYA 3MPDA 4DL0C 4P7VA 2Z56B 4ECXA 1N5YA 4DFJA 3I56S 1DQ8A 2XMVA 4RWWA 1H2UX 4USMA 4WFXA 2IYIA 2Z0GA 4OI6A 2RNEA 4I67A 3BKFA 1QSLA 3NAHA 2KT3A 4DG1B 2AYEA 4ED2A 2OI2A 1O5JA 3KMQA 2DNOA 2CQBA 3PCOB 1YLXA 1X4HA 2MEWA 4NLPA 2G2ZA 2XS7A 5DLGA 5CABA 2BE2A 5KFYA 2DXEA 5A8RB 3CO9A 2ROPA 3BSAA 1RXOB 1PGZA 2DK2A 1HNVB 4ZPAA 1H0HB 3BDEA 3WX8A 2E9ZA 1RAOA 3KUGA 3GILA 3CW2C 3ICLA 2JH3A 4PG5A 3BGUA 2PFFB 3EGNA 5K20B 1LW2B 3G86A 4DL2A 5DQIA 1VBKA 2HHUA 5D0HA 2UUCF 3JAMU 5F8NA 3CPWR 4NLXA 4ZN3A 4AQYJ 4OI2A 3MD3A 4TLQA 4RBUA 1XMOF 1HQEA 3M32B 1W2BR 3I96A 1ULRA 4HTJA 4M5JA 1ZZFA 2HLTA 3AB4B 3S1TA 3N6LA 4ECSA 1GXTA 4IRDA 3H40A 4KO0A 3NCPA 2H54B 1LW0B 2OPQB 3WIUA 1FRKA 2P6SA 5DLFA 1VYAA 2IHR1 3PX4A 1FK9B 1XNQF 3HSDA 3LPEA 4DL5A 2RHQB 3UD5A 4B9SA 5E41A 1S9GA 1DARA 1WKKA 1HNIB 1RU2A 2O01C 1HKAA 2QFJA 4DUZJ 2DNMA 5IM0B 3MM6A 4ZCIA 1R7IA 1CG2A 2PIIA 1C1CA 2DGXA 2YNFA 3LH2S 2FLPA 2KKHA 3W61A 2MDAA 4TQRA 1VQ5S 1YRXA 3HHLB 4GVBA 3U27A 4ECVA 3L95X 5C25A 5HMYA 5DG7A 3D6HB 1N5QA 5FDLA 1S7HA 3US5A 3OLBA 4ECUA 4DSJA 4DR4F 1BE4A 5J2QA 1IM6A 2GGPA 2NREA 1RWMB 1WJ9A 1T11A 3ZTSA 3IRWP 2E1PA 2F40A 3DHWC 1C4CA 3SXLA 4CM0A 1TFYA 1H7WA 3SMZA 5IC6B 1RT7A 2PSZA 1UFWA 4CLZA 1TL3A 1WACA 3MXHP 4HEA9 4HH0A 3HP6A 3C6UA 3OTEA 4J9RA 5GAHU 2B4VA 3GSIA 1Q7YT 1OQ3A 2ADBA 1S1VB 4YR2A 2DHGA 3V81A 1XMQF 5L9NA 2AF6A 3NGKA 3MAAA 3ZO7A 2FY1A 3EJMA 4CTAB 3JQKA 3QFHA 3D9BA 1FHTA 4NMLA 3PJWA 4ZVEA 3LAKA 3BBBA 1HWIA 1H2TZ 1HR0J 1FKAF 1X5TA 5J2PA 4B3MF 1J27A 3HCXA 4EZ9A 1OSCA 4Y2CA 4UY85 1U2RA 3QQCD 1B7FA 1AROP 1Z2ZA 1JLCB 1T05A 1QVGR 3CO0P 2HHWA 4DPTA 2XCPA 1N6QB 1TAUA 3DLJA 4OZ0A 3RRHA 4M1KA 1CBKA 3DLGA 2VA3A 1H98A 2V8HA 3OUYB 2XSFA 1U48A 2ZC3A 2EC2A 3BPSP 1NAQA 2ZVSA 5M2PA 4WZQA 2H65B 4CH1A 2XNQA 4Y2KA 3VGTA 3KJQB 2RF2B 2JOQA 1PJ7A 2I2YA 1YI2S 4OHXA 1WKLA 1Y11A 2ZBRA 1FJGF 4MIWA 4NRUA 1S6PA 4O3RA 4F0HA 1QUVA 4J9UE 4JI5F 2BEFA 1JLGA 2A6MA 3QGPA 5C2GA 1M1KT 4RL1A 2CADA 2F8EX 1UVNA 1MNEA 3H5YA 2PI5A 2FJVA 2E29A 3MEDB 1NBEB 2QMWA 5F8JA 3U02A 4Q8EA 3GU0A 2OMOA 1LFPA 5E3PA 2VOPA 4Y2AA 3H5UA 2F8MA 3D4JA 4P75A 1AZSA 2ZOMA 3TEHB 5IV4A 2MJNA 3ZZOA 1Z1ZA 4ZHRA 4ELVA 4KKOB 3RW6A 2FJDB 1SL1A 3TJ8A 3C8YA 1J5EJ 2XHCA 2JEGA 4PWDB 4F67A 3JXOA 3VALA 1JK9B 1VQ9S 3KLHA 2FTRA 1DLOA 2D3OR 1GMWA 3TA1A 3TUIC 1KHWA 5L8RC 2BANB 4DQSA 4JI4J 4YS2A 2W01A 4DV0F 4IG0B 1OMSA 2FVRA 5B0FA 4OI1A 5D0RA 4DUYF 3OVSA 2EG2A 1GTHA 3KLGB 2UUTA 3NNHA 1VC6A 4ER8A 4B17A 1JNRB 3C19A 2CJYB 2E1CA 2J9EA 4JP8A 4WFNQ 3TZWA 3QT8A 1GX6A 2UXCF 2DPJA 3CULA 4EMDA 3EMTA 4KAIA 4YB1P 1ZAWA 1N5SA 3A8IA 5I3QA 1Z2LA 3KLIB 4MKVA 4PR6A 2OPRB 4IG3A 1S6UA 3AA9A 4IFYA 4OIXA 5B0CA 2SXLA 3CIZA 3M8SA 4RNFA 2MZTA 1FKPB 1HBUA 4ITSA 3ZTRA 1HPZB 1ZM2A 1R6YA 1AW0A 2EFNA 3DRPB 3K17A 3MUMP 3GFYA 1WSVA 4ED0A 2EC0A 3QLHB 2DJWA 1LNQA 3PV8A 1KVIA 2AZ3A 2RHSB 3POTA 1NK9A 1JNZB 4FN5A 5B0EA 4V1Ak 2WB4A 3KJVA 2VQFF 2ZH8A 2G0IA 3NY0A 1NDKA 1UW4A 4HI1A 3LP2B 4ZOSA 3AD9C 4DX5A 4R8UB 4NMXA 2D3O1 3IBWA 1RLCL 4WU2A 1YJUA 2XMMA 2KDOA 4A8MP 3TEGA 3MCSA 2PN6A 4LF5F 2AJ4A 5HSPA 4QU6A 3PYDA 4H4KC 4M5MA 2HVEA 4DS4A 4DG1A 4DS5A 2F4FA 2FZKB 5ETLA 2FLNA 2C3YA 4J9NA 1IR2A 4JV5F 2C2OB 4P7TA 2RVJA 3IM9A 2ACYA 2FVQA 2FC9A 4AFFA 1FDNA 1ZAVA 1IXKA 2LVWA 4TQSA 2JRSA 5KFPA 4LRBA 2H3EB 5A8RA 3MCOA 3OL7A 3EVWA 5BYSA 1U1NA 3DKDA 1HNVA 3IR5B 3AH6A 4RW6B 4F4ZA 4ED1A 1S4FA 2E1MC 3UCGA 4NA1A 1VQPS 1B0TA 2IMOA 4ECYA 1FE4A 3UE2A 1ZYQA 4M95A 4NXMJ 4LF6J 3E3XA 2DRAA 3UDEA 1VBZA 2H9ZA 5FLXU 3UDVA 1LW2A 1U6BA 3EGZA 1WOPA 3BGFA 1FX4A 3M9OB 2XY6A 1ZAXA 3KDNA 4CLLA 4B02A 5A6WA 3EWGA 3A8EA 3N4WA 1UEUA 2XC9A 5T14A 4QQBA 3R3TA 5IQ6A 3D0IE 4IOBA 2XSJB 1BWVA 3JTOA 3T1HF 2Y0SD 4HHHA 2J0QD 3M32A 1HNWF 3MMCB 1CJUB 4DLEA 2AX1A 3G8TA 1OPIA 1D8ZA 4FBTA 2R7XA 1MG7A 4IH7A 4FZVA 3W8PA 1LW0A 2OPQA 4LR8A 4Z7CA 3T5HA 2BDPA 2VIHA 2I5JB 3OVBA 3PACA 3TX8A 1KWMA 2EFOA 3DDKA 2GS8A 1N5VA 4GKJF 2F4VF 1F2HA 3RBDA 2CVIA 4P2FA 2AEJA 3UWTA 1S1XB 3GTYX 4L74A 4NLWA 5KG3A 5KAKA 3W2VB 3I9V9 1HNIA 3TJ9A 4ZVPB 2B8PA 5IM0A 5D4NA 4FDFA 2ZJRQ 2M7SA 4M8LA 4DFKA 2H5EA 4GKKJ 4I56A 2HNDB 2G13A 1SI9A 1CPZA 3HHLA 4J9MA 5FD1A 2J9DE 2RILA 2Y1JA 3DRXA 1RTZA 4OYAA 3RTVA 1IKVB 4C9DA 2QFIA 2GMHA 5D4LA 5GVQA 1YJWS 1U1QA 4KHPF 3TQ1A 2CQHA 2CJKA 1D8YA 1WEXA 5IC4B 2FB0A 2X1AA 3R2CJ 3HLUA 1IKXB 2ABYA 5F8GA 3AFGA 2W4CA 3W5XA 5T41A 1G6BA 1T9WA 2QSFA 2RU3A 3G9CA 3M4XA 1X0FA 1L3KA 1S1VA 2C2ZB 3HDSA 3CDWA 5LMNJ 2NLWA 4MK7A 1T94A 1JJ2R 4IQXA 4CTAA 2DD8S 4NLOA 2I9SA 4U6PA 2MKIA 4NZ7A 1X9SA 4C48A 2JJ4D 4M5GA 5CYQB 3FFIB 2KT5A 3JSBA 3OXGA 4KH1B 4BWJA 3J80U 1R8AA 4YUDA 1XBWA 3CJ8A 4OYXA 1RWUA 4Y28C 3UQSA 1JLCA 1YBTA 4USHA 3ILJA 1UETA 1NSPA 4E98A 4CI0B 1FERA 3CXCR 4NEZA 4ZJLA 1N52B 1N6QA 4C8OA 2R7SA 3KLFB 2HZAA 1SC6A 1DHMA 4YOEA 1EETB 5E7OB 5K14B 5T7LB 3UNYA 5ETRA 3K58A 5KFBA 2WOMB 6FD1A 1S0NA 3OUYA 1HD1A 4UF4A 4QIEA 2FUG9 4EO6A 1ROFA 1FNXH 4P71A 1UTAA 4HL9A 5IWAJ 2MZRA 5KT5A 2NPFA 3OL8A 4DSEA 4WZMA 2HBRB 1SQGA 3P49B 3C14B 2LQBA 2RF2A 3D6TB 2ZH3A 4DQRA 3OQ2A 3RZAA 4NLDA 1XC9A 4BHQA 2VA2A 4WYWA 3TZXA 4F4WA 2R7QA 4OI0A 2QSWA 1XR5A 2WSCC 5HN0A 5IT4A 2VG6B 3AAWB 3IWXA 1DRZA 3MEDA 5SUHA 2UXBJ 2B9XA 2Q43A 2KXFA 1U7LA 3J7Z5 4AL6A 1R43A 3GG1A 1O6XA 2IYGA 4C11B 4P10A 2BYCA 5CXTA 2FLOA 4LF1A 4YB5A 4KKOA 1D9DA 4B3RJ 1IWAA 4OZ2A 4B3OB 3CDEA 4KGZB 1KTVA 2AYBA 4M5NA 3CIMA 4PWDA 2BRKA 2CQIA 1TKDA 3H59A 1RBOB 4FYYB 3E8OA 4RNMA 4HYKA 4AXIA 4B9MA 1KQFB 2BANA 2K7KA 2DEJA 3C15B 4Q45A 4J37A 1U49A 4IG0A 4U7UD 1GXUA 4USKA 5KT3A 3QIPB 1XNRJ 2MB0B 2KTQA 1HHQA 3IBCB 4DV7F 3KLGA 2VBZA 1IBLF 3C66A 2OTLS 4QJVA 4E2FB 1T9XA 1N4LA 4Q43A 4RUAA 1OPZA 1ZTTA 1ACMB 4FXVA 4RX6A 3MTKA 3SBMA 3GB0A 3O6QA 2J0WA 4EYHB 3OFGA 1WF2A 2QG9B 1YHQS 2O67A 4X66J 3MPUB 3BO4A 3H20A 3IR6B 1XEZA 4DR7J 3KHHA 4QWCA 2BJ1A 3L3CA 2POKA 2PGCA 2AKWB 2D9PA 4LBHA 5B0AA 5KFUA 4ZDNA 3KLIA 2OPRA 3UFCX 3TP2A 4OJ1A 3WBZA 4DV6F 2C3UA 2YX4A 2RS2A 4FYXB 5C5JA 1FKPA 4FPIA 1S79A 1HPZA 2XY5A 2NCKL 5LSLA 2PC6A 4X62F 3DRPA 4U96A 4I2PB 3L09A 3CJ0A 2FYXA 2Z30B 4OQJA 3GLJA 4PZVA 4DPYA 4JI2F 2V6AA 3QLHA 4DF4A 5LMUF 1SQEA 5B09A 1TL4A 5B7WA 4QR0A 1BHNA 1RT6B 3G4SS 3KFWX 4WKYA 2VC0A 4KHMA 1L3TA 3Q8YA 1OYDA 2DR9A 2FJBB 3LP2A 2B7CB 2DGWA 1W7WA 4R8UA 2HQCA 3I82A 4R25A 1F2GA 2ZDOA 2HHQA 3L7OA 4RW8B 3GIIA 3K8VA 1Q0NA 4J9OA 3I5AA 3C16B 4QWBA 5HLFB 1WKJA 3I31A 1G4CA 4CIOA 4JI8F 1FRXA 1TV6B 4I6WA 4ZMMA 2ZOGA 1CQNA 2YX1A 3NG8A 3BO2A 4DV5J 4U95A 1ZOTA 3CMES 3RBXA 4ES1A 1OY6A 2DKOB 1BGXT 1NJIT 4ZK7M 2K2PA 4DOZA 2DBBA 1UA1A 2UUCJ 2VJVA 3VAFA 3NS7B 1VI7A 3JQJA 1XMOJ 4RNHA 5FIIA 4RW6A 2UUAJ 4OYWA 2ZUGA 3NWGA 3OTOJ 4HTIA 1EAYC 2UV8A 4YB7A 4F2SA 4DR5F 3QBCA 2V67A 1K44A 4NWBA 2QA4S 4A8SA 3L9ZA 4PG7A 4QPTA 3HXMA 1UVLA 1TUVA 3BPDA 2XSJA 4U8VA 3MAQA 1RT5B 4ZVUB 3R5JB 2UP1A 1IBKJ 3MMCA 1HHSA 1CJUA 2XMJA 1NHVA 3JSRA 3OFEA 5B08A 2DNLA 1UVMA 2CJXB 2GNKA 4ECTA 3ZTQA 1SJ1A 3FCWA 1RZMA 2I5JA 3IR7B 4EUVA 4PEOA 2E5LF 1ZETA 3BSOA 3DLKB 2HHHF 1TUGB 2F65A 3FSXA 2VG5B 1S1XA 3P5TL 3S01A 3W2VA 1CJTB 2R42A 4DCOB 3PEJA 4DR4J 1WWHA 5CZXA 3DYAB 4LSZB 4RBTA 3CCJS 1C0TB 5LXRA 2BR0A 1U1PA 2JLFA 2CJAA 2IM3A 4PG8A 4XPCA 1KONA 2QTWA 2HNDA 1NJZA 2RRNA 3KKFA 4KYZA 4FXDA 1Q16B 1RAIB 1YX2A 3X1LB 4LUBA 4TU8A 5LSOA 7FD1A 1IKVA 3B4DA 1XMQJ 4K59A 1M5PC 2J0SD 4XDCA 5KG4A 4WF9Q 1ZTWA 1VCTA 3R27A 2DNPA 3D7SB 4ZP8A 1CSJA 2AT1B 4Q2LA 1IKXA 2F9JA 1NPPA 4BDPA 3R9LA 4B3MJ 3UVJB 2HBYB 5CD4H 4J9PA 4OJ3A 5LJ3Y 3TX0A 2EK1A 3NEKA 4XO0A 4F4YA 2FIUA 4KB7A 3HM9A 2EBEA 1B99A 3AXMA 2J7UA 4A8WA 3M2VB 3G82B 2A0FB 2QLBB 1K8AT 2Y8YA 4DL3A 4I6AA 1U0HB 2JFDA 2V63A 3H0PA 3VF0B 2HRTA 2EK6A 1FE0A 6FDRA 2WONB 3Q2TC 4N8NA 5CYQA 1E6YB 3FFIA 3RBEA 1J2VA 3Q8SB 4B3SF 1SC3B 4USJC 2M9KA 2ZKTA 4A4JA 1F5AA 1P1TA 1PBAA 2J6UA 1N48A 2K7JA 2PMWA 3TVYA 1Q1KA 3KLFA 1FJGJ 4Z2XA 4DR2F 4JI7J 3HHKA 1EETA 3ZTPA 4JI5J 3TA0A 5K14A 1NB2A 1NEEA 5T7LA 2P9EA 5M2UA 1KHVA 2WOMA 3T5JA 4RUCA 4F02A 3D0HE 1AUDA 1UP1A 2NSCA 5BYQA 2PEBA 4EEYA 1NHKL 3LQVA 2V8GA 3H4DA 2J5AA 5G0RB 2GVZB 2A10A 4DFMA 3C14A 2M8DB 2I0XA 3M8QB 4GO5X 2RDJA 2WK4A 2CPIA 3T6JA 3BKTA 3AOAA 5KFOA 4O44B 2I1RA 1NK7A 2WSEC 4I4BA 4PG6A 5C42B 1IKYB 1X4DA 4ZITA 1O0PA 1U45A 2XGPA 1RISA 2VG6A 2CWKA 2W25A 3AJ2A 1KDNA 3KK1B 5U47A 4DUZF 4DV0J 3S8SA 4C11A 4USIA 1UL3A 4DUYJ 4G1IA 4O3SA 4I0WA 1IR0A 4LSLB 4B3OA 4A8KA 1IWGA 1Q4RA 2N4CA 1KQSR 3T1AA 4Y6IA 3T6BA 4KJIA 1XMBA 4LREA 1URNA 3OW2R 1DBDA 2OLWA 3MMAB 4RBVA 4B9TA 4IRKA 1VQSA 4X4NA 5F9NA 3C15A 2UXCJ 1F1BB 2VDHA 1VK8A 2V2VA 3FBBA 2BQUA 2X51A 4ZCKA 1I5OB 3FBFA 2WBRA 4JV1A 2CPDA 3QIPA 1P6TA 3OXLA 3GV7B 3RAQA 4ENOA 2GHVC 2Q6BA 1LWFB 2J6TA 2BZ2A 3VWSA 2R9LA 2HG4A 3BF4A 3ZFVA 2ZZNA 3MUTP 1TZ0A 5KTQA 3TWZA 4OX7A 1S72S 3VHQA 2LXIA 2CZ9A 2JHEA 4DV2J 4OZ5A 5E5NA 3AD7C 2ZZTA 4ZJOA 1OWXA 3H2LA 1VS3A 4DV4J 2HNYB 2AW0A 2QJ3A 2OFGX 2CNKB 3DXSX 3W3SA 3VV2B 2V50A 3HSZA 3J7YU 3J81j 4WP8A 4R5PB 1A6LA 1C2PA 4QWAA 3R5GA 1Y10A 2GA7A 5L39A 2DR6A 4RPFA 4I1TA 3HFKA 4ATNA 4MKYA 2AU0A 1WD6A 3N5BA 1RAEB 3EVOA 3JYTB 2MYFA 4I2PA 1FDBA 2B0GA 1JXVA 4RJVA 3M8YA 2A2DA 3EDRB 3MPYA 1SKRA 3VGVA 2H5IB 5KT6A 4ICLB 3GSDA 2XULA 2W7OA 1RT6A 1B0PA 4LF5J 3L7PA 4B9UA 2R4FA 2IDLA 2MQLA 3RB6A 3I55S 1F0XA 4YQWA 5J2NB 1X4BA 2MZQA 1NHUA 2KVQE 1UKUA 4ELTA 2RMLA 1YQHA 4A8QA 3BBCA 2AYMA 3D6MB 3ZTOA 3W9IA 2XM3A 2KJVA 2RKIB 3G96A 4RW8A 3BREA 2KN4A 2G2OA 4OZLA 4C98A 3BDPA 4X4OA 3HVAA 4JI3F 1VOMA 3C16A 3GIKA 5HLFA 3RYLA 1WC6A 9RUBA 4UZCA 2OIHA 2FHJA 1TV6A 2XWYA 5CYMB 3O5TB 3AT1B 1IR1A 3RAXA 4D3GA 3SYZA 2C1EB 4CT8A 3OSPA 4AT1B 1J5EF 5KFGA 5IT9Y 1M0SA 3SCKE 4EBEA 2HFZA 4TVAB 1X0PA 2Z8QA 4UOHA 4L3KA 2CVEA 3HKWA 3W63A 2VOOA 2LMIA 2BQRA 2DYAA 1YJ7A 2HS4A 4JI4F 1X60A 4KQZA 4U67Q 2Y3YA 3MR6A 2VODA 4CYUB 2H1YA 1IQTA 2ACMA 3Q8RB 2IDEA 1N56A 3MR2A 2A6OA 2F4VJ 3LTOA 3QZ8A 2W2NP 4NASA 1M1HA 4K4YA 4MYTA 3Q83A 3DNCA 1RT5A 5K8NA 1SXLA 2ZFHA 1DFDA 4DR3F 1SIWB 4N8OA 3V4IB 5KFKA 4KRWA 3PXGa 2ZH1A 3BGLA 3DLLQ 3DM2B 3ILIA 4E0DA 3ENWA 3MM8B 3DLKA 3GWCA 2EXUA 4K5RA 3RGIA 1M5VC 1BY9A 2VG5A 1NZAA 3IO1A 1CJTA 2J7KA 3EZUA 3DYAA 2MSSA 3WC0A 1Q79A 4YFUA 2ZUAA 5FLXY 1C0TA 1WHWA 2LA6A 1QTMA 4LJMA 1I51B 2XY7A 7FDRA 4I7FB 3EUNA 2ZKUA 3OT9A 1T02A 4PXEA 2JLEA 4ELUA 1KC8T 2F9DA 4ZCMA 3K59A 2Z2LA 3FMBA 4DU7A 1CQMA 2R7VA 1HYSB 3MMBB 1QVFR 3H90A 4HVZA 3VVUA 4OJGA 5A2QY 3R8YA 1S49A 2HURA 1JXLA 1RP5A 3R7NB 2W9BB 1WG5A 2DH9A 3BBFA 3BN4A 4I64A 2AEFA 3UD4P 3UVJA 3QNWB 3MCMA 4KR0B 4NYOA 4OYZA 4V19X 1SH2A 2YTCA 1TUWA 2A1BA 4FYWB 2ASDA 4LFAF 2OEMA 3M2VA 3G82A 3MZIA 3VCDA 4QPXA 2W4DA 5MLCV 4PUOB 2CRLA 1S12A 3SDEB 4FF1A 2CQGA 1U0HA 3TI0A 4X4UA 3C3LA 2VZ9A 1Q7LB 2IIHA 4OX8A 3D66A 4AD6A 5KFSA 2WONA 3IFEA 4MIAA 1E6YA 3GFHA 3NNAA 1WTFA 2D3ZA 2M52A 4FKYA 4Z7YA 4P2XA 2KRBA 3ISNC 2W8KA 1TVRB 2DGQA 3OFHA 3OVAA 3PNIA 4LF6F 1IVZA 3LPYA 2JFKA 3W9JA 1M5SA 5KFDA 3DOKB 3OL6A 3UDLA 2KO1A 4X2BA 2M5YA 3IGVA 3IM8A 3AB2B 1AFIA 1K1QA 3QJPA 3TVZA 5DDPC 2Z58B 4JB8B 4DL4A 4J90A 4NZ0A 4HH1A 5LJ5Y 4IKAA 1NK8A 1WNEA 3MFIA 4B9NA 5G0RA 2GVZA 1YBUA 1S9EB 1K0TA 3UR3C 3ZNUA 4B9LA 1GTEA 4QU7A 4WP9A 3AODA 3M8QA 3K57A 2CQ0A 3D0GE 2XLKA 3CWJA 2X1FA 1LWEB 5GAEU 1EQ0A 2NXJA 1Y3JA 3N79A 1U0SA 3OTCA 4O44A 5C42A 1IKYA 3PYFA 1KN6A 1ITPA 1HQ2A 4N5SA 2P5VA 4FS1A 4C2MA 4DR6F 1U25A 3KK1A 2B6AB 3PW4A 2YWWA 1B3TA 1MMDA 4IDKB 4F25A 2J6SA 2KT2A 4DV7J 1X7VA 4LSLA 1IBLJ 4TYBA 2W9CB 4UUWA 1YZ6A 1NH8A 4U9RA 4LF7F 2VV5A 2MZSA 1FT8A 4USUA 3ENVA 3MMAA 3P4UB 3EXCX 4QZVB 2BW2A 3UCUP 2AJ0A 4PABA 1AUSL 3QO9B 3HHDA 2PD1A 4EK2A 2BJ9A 1V6HA 2LDYA 1VQMS 1ZPVA 4CO3A 1YSJA 2B5JB 3W9HA 2GX8A 3D1OA 4K4WA 1RAAB 3EE3A 5AXLA 2G9OA 5BJRA 1LWFA 1LK7A 5B0DA 4DV6J 1CC7A 1S0OA 1U02A 2VUGA 4PRFA 4DV3F 2BKNA 2DGUA 1ICEB 5F3TA 4ZLPA 3CF5Q 4KHRA 3GIMA 2IY5B 5HMZA 2VB6A 5F8IA 1NSAA 4X62J 1RUSA 4J9VA 1HWJA 2UU9J 4QYZK 4HR2A 5HQ8A 4K4TA 3UR0A 3IG1B 2R3VA 2HNYA 4IR1A 4JI2J 3MOZA 5LMUJ 3G6YA 3GJSB 4HI2A 5EGYA 5G4DA 3TRGA 1U2CA 4G65A 5EDWA 2L9DA 3HK2A 4J9SA 3PM9A 5EWEA 2XO7A 4WU3A 2FHOB 3DLHA 2RE1A 1AYEA 2K1RB 2VU5A 1RBLA 1KBRA 4F50A 3HT3A 5CD4A 4LFCF 3JYTA 4XDDA 2R2UA 2H4YB 2RDIA 2IRYA 1PIEA 2ZJQQ 2KM8C 1TL5A 4ICLA 3KDOA 3O44A 4MKBA 1XR7A 4ZVOB 2DNRA 5IWAF 3RR8A 1H74A 2HBQB 4JI8J 3FRZA 5J2NA 5H9EK 1M5HA 2LQ5A 4UQTA 1RAJA 3ADAC 2UVWA 3PRBA 2R7RA 3T1YJ 2HVIA 3RRGA 3VZIA 3TAMB 3ZZPA 3I4PA 2CAJA 2RKIA 2DR5A 1YIJS 1SIZA 2BM0A 4KPCA 5IFMA 4CLKA 1A7GE 2LU1A 2MLXA 2J9DA 5GAHI 4NRTA 3M9NB 4OYBA 4FF3A 5CYMA 3EVMA 2JL9A 2BRLA 2FZCB 2FJXA 1PSDA 4DR5J 3W62A 2FQQB 2JLGA 1NLKL 5C2CA 1LOUA 3GR1A 1WG4A 2KHCA 1I6JA 3D2WA 1GK8A 2YVSA 4Q7AA 2FY8A 3CC4S
chains in the Genus database with same CATH topology
4CO0A 1PC5A 2ROGA 1DHMA 4FS2A 1HARA 4TXSA 2GHPA 2YNIA 3PVXA 2WHOA 3PKMA 4YOEA 3CTRA 4EBDA 1Q8IA 2FHKA 1EETB 4WCEQ 4F2RA 5E7OB 5K14B 4TY9A 5F0UA 2XGQA 5T7LB 3K58A 5KFBA 3PIPQ 2C42A 1BQMB 2WOMB 6FD1A 1H7XA 1S0NA 3OUYA 1UWBB 1WG1A 4KV8A 2BVZA 1JJHA 2JVOA 3THTA 1HD1A 4QIEA 2DNGA 4XK8C 4IOCQ 1NRKA 2CZVC 2UZAA 2FUG9 4EO6A 4C4WA 1ROFA 1FNXH 5I42B 4CZCA 1S1UA 4HL9A 2XG8A 4IH5A 1FO1A 2MZRA 5HBMB 5KT5A 3J7ZT 2NPFA 3DGPA 2DPIA 5H1SV 3VQTA 4EO8A 4YR0A 1N34F 2DVIA 1JLBA 3HHLC 3OL8A 4W92B 4DSEA 2VD3A 3CJKA 4N77A 2R7TA 1QAIA 4LMZA 1PO6A 2A2CA 4C8KA 4WZMA 3IWNC 1S6OA 1N5YB 2U2FA 3K5MA 1YITS 2LYVA 3DRSA 3P49B 4ERDA 3MPVA 2LQBA 2RF2A 2ATLA 2V4RA 5KFFA 2ZH3A 3CCRS 4DQRA 1V9OA 3IS9A 2CQCA 4O0IA 1UJ6A 4YDDB 3OQ2A 2KHDA 1FTCA 3RZAA 4NOHA 1ZBTA 1TK5A 3S7RA 1H6KX 1X4FA 2NPIA 2YKNA 3LP1A 3OXFA 4OLPA 1DTQA 4NLDA 3U1LA 5L1JA 1XC9A 2CZ4A 1NU4A 4BHQA 2ZH5A 4WIIA 2VA2A 1RQ0A 5CCMA 3V4IA 3J7A1 1MWYA 2Z4PA 4WYWA 2IJFA 5DGAA 1MSWD 5CA5A 4F4WA 2R7QA 2FVPA 4OI0A 2QSWA 1P9QC 2ILZA 2MHEA 2IFXA 1XR5A 2WSCC 5HN0A 2KG1A 2V5HG 4QR1A 5IT4A 4J9QA 2VG6B 3AAWB 3IWXA 1DRZA 3MEDA 4K50A 3J81Y 4PG4A 1IUJA 5SUHA 1RK8A 3DM2A 5A8WA 1X9MA 4PWUA 1FTRA 5DQGA 4CCHA 4A8XA 2B9XA 2BE2B 2Q43A 2XI3A 3MM8A 5JVGQ 2KXFA 2BUNA 3GZ7A 4HLBA 1U7LA 3KK2A 1T3NA 5KT7A 3J7Z5 5KFAA 3O2IA 5THWA 3V6JA 4AL6A 1R43A 2J8AA 3GG1A 2IYGA 1RJJA 2WBMA 4C11B 3PW5A 3M8PB 1GT8A 1KTQA 3D5MA 2BYCA 5CXTA 2FLOA 2RQMA 2VBWA 5A8KA 2KH9A 4YB5A 2A18A 2E7XA 1R8CA 4KKOA 1D9DA 2DH7A 2KB2A 3NS6A 3GV8B 3LP0A 3RU0A 4B3OB 3CDEA 4MMOA 1KTVA 4JBCA 2AYBA 3CIMA 5DQHA 1JWWA 4PWDA 2BRKA 2MKHA 1BD6A 1HQUB 2CQIA 2P9CA 2IVFB 1TKDA 4NYZA 2ZHBA 4CO1A 4QYZJ 1HBNB 4HDHA 3H59A 2FJAB 4NA2A 1WI8A 4ID5B 3BGRB 3I87A 3OJSA 2CQ4A 3E8OA 2WRMA 4RNMA 4HYKA 4AXIA 2IM2A 4C3KA 4B9MA 2GCFA 3HX9A 1KLNA 1VQKS 1KQFB 5ADZA 3AQPA 1RT2A 2ZJPQ 4DQIA 2BANA 4ZPDA 2K7KA 3N01A 2DO4A 2BQ3A 4C0BA 4F3QA 4C8NA 4I7FA 1VGYA 4NCGA 2L9WA 1T3OA 3EGWB 3KOAA 1RTIA 3BEGB 1R8PA 1KRPA 3THVA 4Q45A 2NYIA 1SH0A 1VIXA 1R8BA 2MKSA 4J37A 3I5CA 2XMUA 5K5MA 2HVHA 1U49A 2DIUA 2CJQA 2FPHX 4IG0A 5KFNA 2DNHA 2O5DA 2HMIB 1GXUA 1LXJA 1D0EA 5KT3A 1CC8A 3QIPB 3PW2A 5KT4A 2MB0B 2KTQA 1UJ4A 2WAQD 4DV7F 2J0XA 3F73A 4QYRA 1HQEB 1HYSA 3MMBA 3KLGA 3SFGA 1N8RT 3VAHA 1HWKA 2OFHX 2VBZA 1Y4ZB 3CUNA 1IBLF 3C66A 2LA4A 4BC7A 2OTLS 1WEZA 4QJVA 1DQ9A 2PEHA 1S48A 1RKJA 5DETA 1N4LA 4Q43A 2FGCA 4NXMF 4BC9A 4AL5A 3M1VB 5C24A 4KO0B 4RUAA 1OPZA 1ZTTA 4DFPA 2RB7A 1Y7PA 1PILA 2YWGA 3P6YC 4FXVA 4RX6A 4DDFA 3MAHA 4PXDA 2EVZA 4CO2A 4IO1A 2W9BA 3U1MA 2MKCA 2IM0A 3ENQA 3ITHA 3MTKA 4WTYA 1HMVA 3GB0A 5E3AA 5JVHQ 2JC1A 2EBGA 2J0WA 3O6QA 4EYHB 4QW9A 3HF5A 3OFGA 1G3OA 1VQ8S 1R0AB 1WF2A 1Z4UA 1YHQS 1VQLS 3W7BA 2O67A 5E3CA 3CJ3A 2KZMA 2CPEA 3BO4A 4K4ZA 3R5BA 2MJUA 3H20A 3IR6B 1XEZA 2D41A 2MPUA 1S9GB 3KHHA 3FVYA 4MFBA 3DU5A 3LOUA 4LF8F 3ZZYA 5H9EJ 1HBOA 4A46A 4QWCA 2LXFA 3L3CA 2POKA 2PGCA 3QJJA 3MEEA 1Q8LA 2KXHA 2D9PA 5B0AA 3NGDA 4RW7B 4YMEA 4NL5A 2CPZA 5KFUA 3OR1B 4ZDNA 3KLIA 2GIRA 3LANA 4O3QA 2GJIA 1S9FA 2OPRA 3IC1A 4ED3A 2X3GA 3MM6B 4PUOA 3UFCX 2XNRA 3TP2A 4OJ1A 3SDEA 3WBZA 4CT9A 4DV6F 2GO9A 4YY3F 4M5DA 3CCUS 4YP3A 4DV5F 3MM9A 3IXQA 1C1CB 4JOUA 2C3UA 2YX4A 2YNFB 2MQQA 1K73T 3TAQA 4LQ3A 2RS2A 1S97A 2QMXA 1LQ9A 1U24A 5K8MA 5C5JA 3I0RA 3CEDA 5BYRA 1FKPA 1VQ7S 4ED8A 4F4KA 2A3JA 1S79A 2AGOA 2KJWA 1HPZA 2MKKA 2XY5A 4IUFA 1SL0A 3MR3A 1C1BA 3RR7A 3HKZD 4CO4A 5LSLA 2PC6A 4X62F 3DRPA 5CHCB 1G2EA 4I2PB 4ZA1A 5C25B 3L09A 3CJ0A 3JTPA 5FDLB 4Q5VA 1BC6A 1T8EA 1TVRA 1GX5A 4OQJA 2UUAF 2VBXA 1JJ4A 2E5JA 4WYLA 4NYPA 1YWXA 2D7SA 3H5SA 5GADI 3H4BA 4JI2F 1N32F 3QLHA 5CH7B 2J7WA 2VH7A 3HHEA 5J2QB 4DF4A 3OTOF 2GGPB 5LMUF 1SQEA 2BJEA 5B09A 1TL4A 3LGMA 2IMWP 5B7WA 4QR0A 1RT6B 1RA6A 3LWMA 4QIWD 3G4SS 1GQEA 3FRYA 3KFWX 4WKYA 2C3OA 3FNNA 4K4SA 4LIRA 1JKHB 1XWLA 2CQPA 2VC0A 2VFVA 3DOKA 2N3OA 4KHMA 3LWLA 1DZ5A 1L3TA 3QGGA 3G8QA 5KFRA 2EPIA 2DR9A 1TKZA 4ZPVR 2UUBF 1RT7B 2W4PA 2CG4A 2M0GB 3CB4A 1RKIA 5F9LA 5DRKA 5EN1A 1TL3B 2M8HA 4GC6A 4GKKF 2DIVA 1O8BA 3C6UB 5AXMA 4ECZA 2FJBB 2Q1LA 3LP2A 2B7CB 2HHTA 5DM7Q 1S99A 2AX0A 1L5UA 2CPHA 2DGWA 3OFFA 1R27B 4R8UA 2R8JA 3I82A 1JLEA 2YNGA 4R25A 4Y2MA 2QIFA 2M4MA 4DBQA 3NNCA 1RTHB 3DI6B 1F2GA 2ZDOA 4PQAA 3V81B 1IBKF 2JC0A 2HHQA 3L7OA 4URQU 4K0KF 4Q0BA 4RW8B 1E6VB 5J1NA 1W25A 2IVYA 3OPKA 3GIIA 2GC8A 4FVMA 4P6QA 1S9EA 3DLEA 1JLQB 3PFOA 5HROA 3Q22A 4MH8A 2FVSA 3K8VA 3PJXA 4ILMA 4OX9F 1U1RA 3C6TA 3NBPB 4J9OA 1HL6A 3I5AA 3NMRA 4QWBA 5HLFB 1P27B 2NXUA 2HHVA 2CIMA 3I31A 3Q8QB 5J2PB 4P2SA 4CIOA 1LWEA 4JI8F 1YJVA 3K8WA 1FRXA 1TV6B 4DQQA 2FD2A 4I6WA 4AXJA 1IM4A 3U1NA 4DR1F 4GC7A 1NK5A 4ZMMA 4WFZA 2ZOGA 4IR9A 4TLRA 2C3PA 3SV3A 1CQNA 3SI8A 4ED7A 2HS0A 2YX1A 3SQGB 3OR2B 5EHHA 3NG8A 1DTTA 1YVFA 3BO2A 3CD6S 3I4HX 4HDGA 3B4MA 1ZOTA 2R7WA 3CMES 1T05B 5D8HB 1DAXA 1NH7A 4ES1A 3MURP 2RJZA 3TO8A 1BGXT 1OSDA 3WDOA 4K4XA 4Q8FA 2GMLA 5DO2A 1NJIT 1RTJB 1QAJA 2ALZA 5LMNF 4ZK7M 3I0SA 2K2PA 2MGZB 5L1LA 4DOZA 1FK9A 2DBBA 1S0VA 2RD5C 2ZOFA 2B6AA 5KFEA 3DDNA 1TP7A 2PMHA 3RB3A 1UA1A 2X1BA 2CYYA 2OPPB 3AHPA 2OAUA 4YB6A 1R89A 2YWHA 4NXNF 2EI5A 3VAFA 5GAEI 1VI7A 5DM6Q 4IDKA 1FXRA 1JMTA 2YKAA 1SJFA 4ZPCA 1M90T 5KT2A 3DLGB 5D3GB 4RNHA 5FIIA 4PKDB 4RW6A 3VZHA 4RUHA 2RH3A 1NJXA 1VLYA 1VQOS 2AJFE 2PA8D 3MFHA 3QYYA 3R5DA 2W9CA 2ZUGA 3NWGA 5ITHA 2KZZA 3DOLA 3ZZZA 1OO0B 3H98A 4HTIA 2FJEB 2UV8A 5EWFA 3IRXB 3TARA 4I6YA 3KK3A 4YB7A 2E9RX 4YDXA 4F2SA 1FRIA 1X5OA 2K3KA 4DR5F 4N56A 3DU6A 4R5PA 2DNQA 1VC0A 4NWBA 3F41A 5GAGI 2QA4S 3MHYA 2N4DA 3QO9A 4A8SA 4F26A 3CE8A 3V4MA 1YTYA 3I5BA 3GG0A 4PG7A 4QPTA 3NKYA 2V9KA 4OZJA 2QA4G 4RLEA 4NLYA 1ZM9A 2C2EA 1CVJA 4CH7A 2V4JB 3HXMA 2VFSA 1RI7A 2JZ5A 2DRBA 1UVLA 1TUVA 2DCUB 1HD0A 2E1RA 2XSJA 4BCAA 3HMJG 3MAQA 4CO5A 4NLUA 1RT5B 2V4QA 1S6PB 4Y0FA 3CCQS 1TK8A 3TW0A 2UP1A 2B5JA 4N47A 3MMCA 4YHHF 2R8GA 1JLGB 4MJKA 2FDNA 1HHSA 1KS2A 2XMJA 1NKBA 1DJ0A 3NLCA 1NHVA 1V3ZA 3JSRA 4FYDA 3OFEA 2HWHA 2KFYA 2OP5A 1S1WB 2AJ1A 3GE9A 2COLA 3M2RB 4Z37A 4XIUA 5B08A 4FF2A 3MM7B 2AWZA 2DNLA 1J5OB 2HLUA 1UVMA 3FEYB 2GNKA 4ECTA 3WX4A 1H38A 4KFBA 3MUVP 1QSYA 4URGA 2CPJA 2JWNA 1LKZA 1SJ1A 2I5JA 2HZCA 3IR7B 5HP1B 3HVTA 3JTNA 4C7QA 4EUVA 4QIGA 1I1GA 2E5LF 4DN0A 5AE3A 5KG1A 1ZETA 4K4UA 5K8OA 3BSOA 1V3SA 2MY8A 2DB1A 3DLKB 3UPFA 2N7CA 2C3MA 5KFQA 4EZ6A 2HHHF 5J1EB 3DXBA 3UNGC 3NRBA 5KFJA 3GMGA 1S1TA 2DNKA 2ZDPA 3FQLA 3BQ1A 4DN9A 3FSXA 4B3TF 2VG5B 4A48A 1PC4A 1QY7A 1S1XA 3P5TL 2C2RA 4ZHRB 2M70A 1FA0A 2K8GA 3S01A 3GFXA 1NO8A 4ZVGA 4F4XA 3W2VA 4KGKA 2HAIA 3V6DA 1FRHA 3IG1A 4A8OA 4BBYA 3BQ2A 4ZP9A 2YWFA 3PEJA 1WWHA 5CZXA 1FXLA 1VRTB 3KG4A 4MK8A 3KMSA 3DYAB 5LL6d 2Z2MA 4I2QB 5KFWA 3V5RA 2FHMA 2VC1A 2VFUA 4RBTA 2VPYB 5I3UB 4WFBQ 1NK6A 2KXNB 1NJYA 5GMKa 2RQCA 3CCJS 1C0TB 2IBOA 5LXRA 2QLXA 2BR0A 4LVOP 3KLHB 2B7BB 3OHAA 3TANA 1U1PA 2JLFA 1DLOB 1TK0A 2CJAA 4NLTA 1YGYA 1VRUA 2IM3A 4PG8A 2YNHB 1FCAA 4JV2A 4XPCA 4TY8A 1RT1B 5J2MB 5DS7A 4HT7A 4O4RA 3VAMA 1BLUA 2ZC4A 1KONA 2QT7A 3PRDA 3OSNA 2IA0A 2UXBF 2Q3PA 2HNDA 2N7YA 1AXQA 4C97A 2LXUA 1NJZA 3CDUA 1VBXA 3KLEB 2IBKA 2RRNA 2W7PA 3KKFA 4C8MA 1TL1B 2K1RA 3HHLD 1N36F 3JB9k 4FXDA 1Q16B 4ID8A 3FEZA 4G6VB 4UOCA 2C22A 1WEYA 2HGNA 1IKWB 1QJHA 2VFTA 2PMZD 3N6NA 4JI7F 3X1LB 4LUBA 1KEKA 4TU8A 2ZH9A 3CCSS 1L3UA 4NCBA 1VIOA 5LSOA 3T9ZA 2HRYA 2V9WA 7FD1A 5A0YA 1IKVA 3B4DA 2D1CA 2DNYA 5CYJA 4B3RF 4K59A 1FJEB 1UMJA 1M5PC 2O66A 4WK3A 2J0SD 3G6VA 2NQPA 4XDCA 1FEHA 5KG4A 1JLFB 4RU2A 1B0VA 3QGIA 2HRUA 4PPZA 3G71S 4WF9Q 2D9OA 1ZTWA 3OL9A 4LF9F 3H2UB 2R8HA 1F5CA 3VAGA 3R27A 2NR0A 4W90B 1NNDA 2DNPA 5EWGA 5AE1A 1DURA 1RT4A 3VAJA 4ZP8A 4G1QA 1CSJA 4ZP7A 3TUJC 1FXDA 5E0OA 3VAIA 3MOJB 2L08A 1Y5IB 4Q2LA 2HFOA 1IKXA 2F9JA 1FD2A 4RW9B 2JSXA 5HO4A 3R1HA 4BDPA 3F44A 1N0UA 3H5XA 1U1LA 3CCTA 4E8UA 1FRLA 1Y5LB 2E9TA 2IA6A 2HHPA 3T5LA 3EPGA 4C3LA 5CD4H 1CEZA 4J9PA 5KFMA 5AXKA 1SJQA 4OJ3A 5LJ3Y 2L3MA 2FLLA 2YKQA 1RGVA 2EK1A 4XO0A 1HWUA 1TKXB 3UI3A 2UXDF 4HHJA 5L9XA 2W24A 4X4SA 4F4YA 2FIUA 3VAKA 5LT5A 1XNRF 4KB7A 3HM9A 2EBEA 3IAM9 3PDNA 4Y34A 3TAMA 1AFJA 3Q8PB 2CFXA 2XS2A 1MROA 4X84A 2QE5A 2WB1D 2J7UA 4A8WA 3M2VB 3CGIA 3T5KA 2ZH4A 2IVMA 4NLSA 2BM1A 2WCXA 3PW0A 3OJUA 4WE1A 2ZE2B 2B4UA 2HS3A 3OLAA 1QSSA 3B8HA 4IG3B 1M5KC 3PEHA 3MEGB 2CJ9A 2ZM6F 1K8AT 5EX3A 1RTDB 4KPYA 1R31A 3CJ4A 4DL3A 4IFYB 4UW2A 4I6AA 1X8DA 4ZKAA 5E3QA 2JFDA 1KFDA 2E5GA 2FGOA 2QA2A 1HA1A 1BWEA 1N54B 2N82B 3VF0B 2EK6A 2IC3A 3CCLS 3QAEA 1WI6A 4ZPWR 4ED6A 1MWZA 1Y0HA 2V8DA 1FE0A 6FDRA 2WONB 5JJBA 4N8NA 4QWDA 3Q2TC 5CYQA 3LUYA 1E6YB 3FFIA 1HBUB 4NX9A 3C46A 3V2UC 3RBEA 1Y5NB 4J9LA 4ETXA 1J2VA 1KLMB 1XN9A 3MECB 4Y2IA 4ZP6A 3X3UA 5IZHA 3GQCA 1R3NA 1FJ7A 1RYRA 3Q8SB 3UW1A 4X66F 2L9NA 4B3SF 4DPOA 4MKAA 4OHZA 2Y1IA 4USJC 4MYUA 4DMZA 2M9KA 2ZKTA 4DR7F 2OJ3A 4A4JA 1P1TA 1F5AA