3ZZRA

Crystal structure of the cg11501 protein in p21212 spacegroup
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'ECCTSRELVEFKMDRGDCEAVRAIENYPNGCEVTICADGVAQLGAYCGQGPCNIFGCNCDGGCLSGDWSQEFVRRNQQYGIQIIKVTRLPFWRPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG11501
publication title Crystal Structure of Diedel, a Marker of the Immune Response of Drosophila Melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Immune system
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2011-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13164 Diedel Diedel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2800 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zzrA00
3ZZRA 3ZZOA
chains in the Genus database with same CATH superfamily
4X64F 2WTFA 2SXLA 1KTVA 2QJ3A 1X60A 1UVKA 2Z56B 4WIIA 4X4PA 2BA9A 2PFFB 3C66A 1RTJA 5K5MA 1JQGA 4R5PB 2C2RA 2D1CA 2V5HG 3PXGa 3DN9A 5KOWA 4H4MA 1W2IA 2CQCA 4EEYA 4F3QA 4PWDA 4RX6A 1EB0A 3KK3A 2EFPA 4ZP6A 1NNDA 4DR7F 2BQ3A 2R7SA 6FD1A 4M8LA 4DV7J 2MDAA 2GQ2A 2KXHA 3RB6A 4JOUA 4J90A 3IG1A 1FD2A 1WC0A 3AJDA 2GGPA 4YR0A 1RT4B 4PQUA 4MKAA 5A6PA 2HBRB 1F9FA 2JDJA 2KFNA 3FRYA 1YTYA 1AFIA 4ZVFA 3HM9A 1SB6A 3IFEA 5IQQA 2B7CB 4P7VA 3MWBA 4J91A 1SJFA 3RR7A 2M2BA 2E5LF 1WOOA 1LQ9A 1Y5IB 2W2NP 5DZ6A 1NK0A 4V1Ak 5EWGA 3PCOB 2B5JA 1MROB 5E2QA 4Q0BB 3D0HE 3ENAA 4NLSA 3C16B 3CE8A 2DGWA 1XR7A 4RO0A 3MM5A 1Z2ZA 1NDPA 5KFTA 4PWUA 2VBZA 1BD6A 4HH0A 3DI6A 2F65A 4I4BA 2FY8A 4QPTA 2QG9B 5DQIA 5GAGU 2BJDA 3MPYA 4D3GA 5BYSA 3VZHA 2ZITA 5KFGA 3D9BA 1VFJA 4NLTA 5KTQA 1XMOF 3EXCX 1I94J 1RWOB 2ZH2A 3PYDA 3G6ES 2OAUA 2PMHA 1HR0J 1WC3A 2HMIB 1LWCB 1RWWB 1OJ4A 2VU5A 4YN3B 1RHRB 2F4FA 1HW8A 5I42A 1Q78A 1ZPVA 3R6GB 4DV3J 4J37A 4OZ1A 4USKA 1N5TA 2I2YA 2JLFA 5IM0A 4FVMA 3W60A 2EFVA 3SQGB 3OFFA 3D4JA 1RT3A 2XEXA 1TK0A 5CYMA 3D6HB 5BR8J 3GONA 4USTA 2HZAA 2JX2A 2ZOMA 5KFJA 3CWJA 1NSKL 3UVJB 4CM0A 1RISA 3OR2A 1QAXA 1PG5B 5GAGI 3DLKB 3P96A 2NXEA 3OL7A 4ZIVA 2DR8A 2JH3A 5EHHA 3MI7X 1VQ5S 2XZTB 3M8QB 3KLFB 3CCWA 4NXNF 2CDQA 2RU9A 1VDHA 3RAMA 2M0GB 4PEOA 5AE2A 1AT1B 3Q2TC 2DNPA 3L4BC 1U1QA 3EMTA 1Q81T 4IO1A 1HNVB 3HHLB 4MKVA 5IV3A 3BGLA 1W25A 5D0EA 2W2MP 3T6JA 5BJRA 1ZTWA 4JBCA 4ED2A 3K58A 1GXTA 1CJUA 3G4SS 2DEIA 2IBKA 4WIQA 4Y2AA 2KXFA 1FWKA 1DJ0A 4MMOA 3ET6B 3ISND 2MQQA 1T03A 5HMYA 1HBOB 3UNYA 1Q7LB 1N8RT 2RH3A 1EHWA 1HPZA 1RJJA 4K50A 5K20B 3W5YA 4WZMA 3R27A 3KK2A 5HMWA 3MM8B 4HH1A 1WEYA 2N4CA 2J6TA 3ENQA 3PJXA 4MH8A 3I0SA 3QZ7A 1LXJA 1ZM2A 2WOMB 2LA6A 4CYUA 4ZJLA 4KPCA 3HD2A 3TQ1A 5J2QB 1F6TA 1R0BG 1BLUA 1FE0A 2EFOA 4IFVB 1NZ8A 1XIQA 1FDAA 3ZZZA 2Q79A 4I7FA 4KSEB 2GQCA 2C3UA 2F7VA 2KKHA 3ILJA 1HHQA 1JLBB 2IA0A 4F3OA 3NWRA 1JJCB 3T9ZA 3JSMB 2RQCA 3WC2A 5E33A 2DNGA 5HATA 1U6ZA 2CPYA 4HLBA 4R8UA 4DL5A 2HQGA 2GFFA 4IOAQ 4O4GB 5F0WA 2ZEJA 2LECA 3VGVA 4Y3CA 3KJVA 1GEHA 3T1YF 1FXDA 4ER8A 2FIUA 5FLXU 4NPOA 2BOAA 4KO0B 4YQWA 4WU2A 4DN0A 3DU5A 3RBEA 2KT5A 3PRVA 2LCWA 5EX3A 2NR0A 3V2UC 3GG0A 1JLFA 2HHHF 2UXBJ 4FF2A 2XM3A 3IS9A 1WJ9A 2MHNA 1AUDA 2J7WA 4H4KC 3CCQS 1ROFA 1N5SA 2XYPB 4L76A 4OX6A 3VZIA 4UOCA 3MPDA 2HYIB 3MM7A 1XR5A 2IMOA 2CQ0A 4NLPA 4DL6A 1FKPB 3TVZA 1HBNA 1SQGA 2JC0A 5IOLA 3EVWA 4DFJA 4JI8J 3PX0A 4I0WA 3T9NA 1DY3A 1BQNB 2E1MC 1GX6A 3MOZA 3TX0A 3R5BA 1VRUA 5HANA 3L09A 5DQHA 2OKQA 3AQOA 3N6LA 2G0IA 2G0CA 5DZ7A 1EAYC 4CQ1A 3PO4A 1HMVB 2X3DA 1RT7A 1PGZA 4EBCA 2PEHA 3VHQA 5DG7A 2CQ2A 2G2OA 1Q82T 3M6WA 3SCLE 2ASYA 4F4ZA 1AZSB 3R97A 4M5NA 3JYTB 1MN9A 3PYEA 3M9OB 4ATNA 1R8AA 4GC6A 4X4OA 5DO2A 3TAMB 2UVUA 2OEJA 3ISNC 3GCXP 2H4WB 3RBDA 1HNXJ 2UVWA 1KHVA 2VG7B 2VODA 1RLCL 2HNDA 4FKYA 3TZZA 2VBYA 1U49A 4O44A 3F41A 4NMLA 2Q3PA 2ZM6J 4KFBA 2QN6B 4JI6F 2BJEA 1A0OB 4UZBA 1GXLA 2BE9B 4USIA 3FBEA 2RF2B 2HBYB 3BEGB 3AQPA 3BGFA 4W92B 4KC5A 4DR2J 1S97A 3EUNA 4G1IA 1H7XA 4UY85 4K5SA 3MM9A 2XMTA 3GV5B 3D1OA 2XY5A 1JLEB 4DL7A 2DRAA 3C6UA 2HURA 2RU3A 1FKAF 3VAKA 2BJ7A 4MIAA 4NXMJ 3DXBA 4ZHRA 3R6LB 1UWBA 2KN4A 3FEYB 2R8GA 2R9LA 1RZMA 2YX1A 1WKLA 3X3UA 1UJ4A 2VFTA 4ANDA 4YS2A 2B51A 1FRJA 1KC8T 1RTJB 3R7NB 2CQ3A 1TKZA 4GKJJ 2DCUB 4ZPAA 1S9EA 2ZH5A 3A8IA 2P6SA 2UUCF 4EBDA 1OO0B 2WZ1A 2I6WA 2F63A 1WC4A 3PIPQ 5KFMA 4H4MB 2OPPA 4P2SA 4PWDB 2AW0A 3MEGA 1FEEA 5C42A 1REVA 1PBUA 2PE8A 2NPIA 3KK3B 2D74B 3Q22A 3L9ZA 3EXYA 4DLGA 1CEZA 1RI7A 3AY0A 2HAIA 3EDQB 2UUAJ 4HHHA 3S8SA 1XERA 3OFGA 3G2XA 4HEA9 3NGTA 2HLUA 2HNZA 4DSFA 3IG1B 3MCOA 1K9MT 1PJ5A 3KHHA 3GFYA 2FHOB 1SL1A 2GGPB 4B3OA 4PQUB 5LSLA 4B3MJ 4WYWA 4CLYA 1XNQF 2YX4A 1S0NA 1RT1A 2CQIA 3PYFA 5KFRA 2R2UA 1X31C 2XQCA 2KG0A 4GO5X 1ZA2B 1FEHA 2FQQB 4KH0B 5D0RA 5F8MA 3KDNA 3EPGA 2ALYB 2EG2A 5F3TA 1ZETA 4IRKA 2B5JB 4OL8A 2C28A 4HTIA 3M8SA 1V3RA 4A8YA 2DR7A 1ZH5A 3MCSA 1P27B 2D3O1 2EC2A 2JZ5A 2HZVA 3DI6B 5KT4A 4LT6A 4EK2A 3NOGA 4C8KA 2HQDA 2ZBPA 2O01C 4KV8A 1EARA 4B17A 4Y00A 3D2WA 1VBZA 2QMXA 5KT2A 3QMQA 1Y00A 2XI2A 3L95X 2FVPA 3R2DJ 2IRUA 2F1FA 1S6QA 3TZWA 2Y9HA 4ILRA 4YB7A 1GAOA 2CJKA 3BJYA 4N5SA 3OTDA 3ISZA 4ZP8A 1RAIB 3KLIA 2K1RA 2OTJS 1ZAVA 1FRLA 3HK2A 5I42B 3IWLA 3LWMA 2KXNB 1N36F 2C3OA 2C2OB 2XMVA 3NEKA 3MHYA 3C14A 5CQGA 2GIQA 3TR5A 5IM0B 3ZFVA 3PW5A 4CDIA 1DARA 4IQMA 1RKIA 4P2FA 4V19X 3QJLA 5CYMB 2EBEA 4JUZA 2H54B 2XZDB 2ZDOA 5E3CA 1XNRJ 5GVQA 5EWFA 3OHAA 3CCZA 3QWUA 3OR2B 1X9SA 3JTNA 1SKWA 3PJ9A 3H5UA 2BR0A 2UXDF 4XIUA 3M6XA 2XGQA 3T3FA 1SKUB 3IXQA 1JIHA 4UOGA 3BKFA 3CCJS 3LPEA 1ZZNA 4ED1A 2HG4A 2H1YA 3GR1A 3MMAA 5IC4B 4KHPJ 2F9DA 2DH9A 2Z2LA 2W4CA 4RBVA 4TLQA 3NAIA 1KQFB 3CSKA 4HT7A 3RYLA 1ULRA 2RHQB 4K4ZA 3CJSA 1BGXT 1OYEA 1M1GA 4DN9A 1BQXA 4ZCIA 2IFXA 4KPYA 1QSSA 1CJUB 2BUNA 1KTQA 4DPXA 1N56A 2B9EA 5LSRA 1TV6A 4NI2B 4AT1B 2BJ8A 4OZJA 4N41A 2M52A 3QYYA 1H2VZ 1MLAA 1K1SA 4XDDA 1VISA 1HPZB 1WOSA 2WBRA 3RR8A 4UUWA 1U7LA 4X4RA 5KG2A 5MLCV 3KK2B 1SQFA 3BQ2A 3MMJA 4C8LA 3I0SB 4C97A 5DDPC 1HL6A 1K8AT 5L39A 4X65J 2C2KB 2J0XA 1UVLA 3VAHA 1Q4RA 4DWIA 1RXOB 2DHHA 2LA4A 5IZHA 1YK9A 4F04B 1VBXA 1SQEA 1OPZA 1N32F 1FO1A 3E3XA 1FK9A 4P71A 3MUMP 2ZUAA 5LMUF 4MFBB 2KHDA 1HQEB 4I7FB 2QA4S 1WC5A 1KLNA 3DGPA 4MTPA 4CM2A 1Q5YA 1SJQA 4U9RA 2DKOB 4Z7CA 3H2VE 2DCLA 3RAQA 2KH9A 1HD1A 3HLUA 3QIPA 5CD4H 4R8UB 4QYZJ 2C2NA 1WI8A 4J9UE 1S1XA 3KJVB 3HPOA 4DR6J 1N52B 1IBKF 4QCLA 4DV6F 1P1LA 1S1WB 3LP0A 2Y0BB 2QL7B 4CO3A 3N79A 4BWMA 2GMHA 1CQNA 4GC7A 1SIZA 3OJUA 3CJQA 4ZCLA 1J5EF 4K4UA 5KFZA 2N7CA 4LIRA 1JLFB 3IGNA 2LLZA 3IS9B 5KAKA 4DPUA 3BH7B 4YHHF 5KFEA 3NL0A 2NUHA 3B54A 3IRXA 3JQKA 4DR5F 2MZRA 3MM7B 3EYZA 3P5BP 2KFZA 2MQ8A 4OX8A 1WEXA 1R89A 1IWGA 2FYXA 2IAJA 1VJWA 2CIMA 1NJWA 2E1AA 4LBIA 4A8QA 1JX4A 1JNRB 3D7SB 3HMJG 1H38A 4O3QA 1G4CA 4RNHA 3QRPA 4DUZJ 5KFDA 4WTYA 5CXTA 5BYRA 1EZZB 1VRUB 1BQMA 3LANA 2PT0A 2RIJA 4X66F 2C2DA 2GQQA 1HWUA 1EETA 1AROP 3MPWA 5K14A 2FLLA 1TL7A 4Q8FA 2V0NA 2CDRB 3OXLA 3HD1A 1SJ3P 2W24A 4DSIA 2ACMA 2IPOB 2JC1A 2F4VF 3KDOA 1NLKL 1R7IA 3I5CA 4IDKA 2L9WA 4WZQA 4UOFA 4ED6A 3M32A 1F9HA 2O5DA 3IM9A 3OTCA 2W4PA 2AEJA 2HNDB 1S0MA 2IM3A 4O44B 2ASDA 5IWAF 4KFBB 1FX2A 3FVYA 3G8QA 2M8DB 4ECWA 3FFIA 3KTQA 4RL1A 1UL3A 1SIWB 5A8WA 4X64J 2YVSA 1QY7A 2J9EA 1VC0A 2AGPA 3DLGA 2QL9B 3BKUA 1RAFB 1TL5A 2MY8A 2V63A 3WQPA 1JJ4A 1NJZA 3PNIA 1VK8A 2FJAB 4H4OA 1LXNA 1NCLA 3GCWP 2YKQA 4DFMA 2AJ2A 4CCHA 3LGHA 2L3MA 3FBFA 5HROA 1U1MA 4ZPTR 2ILZA 3C6UB 1IJFB 4ZVUB 2RUGA 2D7SA 1QUPA 4B3SF 5L9XA 1UWBB 2JWNA 2A1BA 1CQMA 3U02A 1LW2A 4HI2A 3RG6A 1Q8LA 2PI4A 1NKBA 2F9JA 1TKZB 2R42A 3L3CA 5F8IA 1UMJA 4ZJOA 1TR0A 2XNRA 1U0HA 4OI2A 3LGMA 2OPPB 3CW2C 2DBBA 4A8WA 1H2TZ 1HKAA 3MEGB 4JI2F 4ZPVR 2N4DA 3FSYA 5C42B 1REVB 4LFBF 2DH7A 3Q8UA 2E5LJ 2DGTA 2FVRA 4IG0A 4YUDA 2HBQB 2GHWA 2HNZB 2EWHA 3HI9A 4E0DA 4F50A 2EKYA 3CD0A 4CWBA 3QQCD 3MR5A 1QM9A 2V67A 2YNGA 2DNLA 3N6NA 2E9RX 3D5MA 2BEFA 1TUGB 3GQCA 1PC5A 5C2CA 5T7LA 4KJIA 2GMJA 1LNQA 3UD5A 3NRBA 3CDUA 3CDWA 2YY3A 5M2RA 2BBEA 2V34A 5K8OA 2BJ1A 1XMOJ 2MZSA 3CCVS 1JK9B 1GH8A 2ZJRQ 3DGVA 3N9UC 2XWYA 1DBDA 1G1XA 2DNOA 4JV1A 4ECUA 3GWCA 4FP9A 3BGRA 2AJ0A 3OLAA 3R2CJ 1LEOA 4KV8B 4CO0A 2AT1B 1UP1A 4A8XA 2CQBA 1S99A 5FDLA 4ZS6A 4RPFA 2IVYA 1K1QA 1SKRA 3IRWP 2ZZNA 2NXNA 3CT9A 4LR7A 2FJXA 3EGNA 4RWWA 4F4YA 2B4VA 2EXUA 1S6QB 4LRDA 4M94A 1KONA 1R6YA 2CJYB 3V4MA 4TVAB 3KJNB 3QT5A 1W2BR 5ETRA 3VQTA 3ZTSA 1KSPA 2CJBA 2JEIA 3J81U 3KLIB 2K1RB 1ELOA 2E44A 1CLFA 3DM2A 1CJVA 4A8FA 2A18A 5A0YA 1LFWA 5ETSA 1NM2A 3M4XA 3MFHA 4L75A 1R6VA 1ICEB 2CQ4A 5A6WA 1SI9A 3D28A 4NXNJ 1C0TA 1MMDA 2UXCF 2V94A 3K0JA 4PG4A 4UTGA 1NPKA 3I4PA 3LP1A 1NRKA 1AA1B 3DOMB 1FT8A 4FF1A 1D9AA 1Z1ZA 2DHSA 3NGDA 2DRBA 4MYTA 4NZ0A 3AXKA 4DFKA 1WHXA 4L74A 5L1KA 2IJRA 1R27B 3MMAB 3BSCA 2EK6A 1R8HA 3KXDA 1W26A 4DDFA 5CYQA 3M7VA 5I3PA 3NGKA 2FJBB 1PAEX 1V3ZA 4QIEA 4MIWA 3LP2A 2QFIA 4DZ6A 1HQ2A 2JEGA 1ZM9A 4M5DA 3V6DB 1WKJA 1KD1T 3CD5A 3VAGA 1TV6B 3EZOA 2HVHA 1UPMB 5GAEI 3UPFA 4ED3A 1S7IA 2HWIA 4DI6A 4MK9A 2MGZA 3KLEA 4ZLJA 4EU0A 2Z57B 3UCGA 4IYQA 3HHDA 3FCVA 4Y2CA 1IKXA 3VVTA 3RW6A 4CTAA 4KAIA 3MGJA 4M5KA 1XEZA 4G1QA 2IVMA 3HX9A 2RSQA 1WHWA 3IR6B 3VTIA 2NLWA 4TKTA 2AX1A 1M0SA 3ONQA 1BHNA 2B8QA 4ED8A 3IN5A 5KT6A 5B08A 1FK9B 2HGLA 1UAWA 2CPEA 3T1YJ 1S0OA 2VFSA 5GADI 2MTLA 2OMOA 1GMWA 1DZ5A 3NNHA 3DGPB 4P73A 1EP4A 2HSEB 3MCMA 1X0FA 5IC6B 3HHLD 1P8GA 2MQLA 1FE4A 3QIPB 1KEKA 2R2TA 1URRA 4B08A 2HHHJ 1N88A 2K7JA 4OI6A 1FNXH 1IJEB 4PXDA 4L3KA 1LKZA 4RBUA 2BQRA 2YKMA 3MR6A 2F3JA 4G65A 4J9VA 2ZC3A 2M88A 4KY3A 1YVFA 2KJVA 4OJGA 3ZNUA 3PFOA 4FVCA 3LP0B 1PKUA 3Q8SB 1URNA 2LP4A 1U4BA 3MZIA 4CO4A 1TUWA 1JLQB 4IH6A 3HVRA 4M5LA 4DV1F 4F02A 1VQOS 3J7ZT 1JJHA 1B7FA 2OO4A 5E0OA 3D6TB 2ZH1A 5B09A 4EMDA 4R0EA 4FXWA 2W1BA 5DQGA 2VF3A 3X1LB 5HMZA 4WFNQ 3LW5C 3KHGA 3IRXB 4LBPA 4WTOB 1OIAA 3HHNB 2MQOA 2Y1RI 3POTA 1S7HA 1IQTA 2R7OA 1IQZA 4X4TA 4KHRA 2PGCA 4GO7X 2IAJB 4NLVA 2E5IA 1U45A 1FWPA 4K0KF 1UPPA 3A8JA 4K4YA 3OSPA 4C0HA 1YKWA 2V2QA 9ATCB 4Q8EA 2UV8G 5F3ZA 1A9NB 2EPIA 5AXKA 1BQMB 2MEWA 4EI2A 2DNZA 2AJ1A 2H3EB 4AL5A 2RDIA 3MDFA 1HI8A 1Z4UA 1OWXA 5K14B 3FEXB 4JI6J 5C25A 4F8RA 1RWPB 4KT0C 1O5JA 2HRUA 4IRCA 3MAHA 2D3ZA 1N33F 2QGFB 1NKCA 4OLPA 3UI3A 3SV4A 2AQ4A 4FF3A 5HVHA 4IDKB 1Q8IA 1YSJA 2XSFA 3M32B 3W66A 3JS9A 2HHSA 3NKYA 4LF7F 3PJWA 2R8JA 1RTDA 4QWEA 4LF2A 2PA8D 2E66A 3HHKA 4XK8C 4WU3A 3TEHB 1RA6A 2E5JA 3FFIB 1KQKA 4H4KA 5KFOA 2AKWB 2MPUA 2FC9A 3GIRA 5A8WB 3ITHA 1UA0A 1NBEB 4AYBD 2HK2A 1YJNS 3GIMA 4I6AA 3FMWA 1ZBTA 5IS2A 2FLNA 4C0OC 1NO8A 5T14A 4H4OB 2UUCJ 3GLJA 5K8MA 3W65A 2GJIA 5AJ3F 2QLWA 2YTCA 4RW8B 4DX6A 3G96A 2KYXA 3ELHA 4FPRA 2C2ZB 3IBFB 1OY6A 1R0CB 4ED5A 3W7BA 3HHLC 2PC6A 4CT8A 1CS4A 5L1IA 4ITSA 2IJNA 4FS1A 1F5BA 3M05A 4E2FB 2DO0A 4Q7AA 2ADCA 4FN5A 2CPIA 2E29A 3R1HA 1Y5NB 1Q7YT 3HCXA 3AD7C 1QSLA 1VLOA 1WC1A 4ZPBA 2WONB 5I3QA 2IC3A 2DB1A 2YNHA 4LRAA 1U0HB 4M95A 3MUVP 4HVZA 4P2XA 4C8NA 1IKVA 2GHPA 3PRBA 3GJRB 3OUYA 2NXUA 3AOAA 3CJKA 2B4UA 2JEFA 5HBMB 5DS7A 4TU9A 3K2YA 3M30A 3NCRA 4U7UK 3J80Y 5LXYA 4USWA 3QSYB 2UV8A 2KZZA 2E1CA 3G8TA 2RS2A 5HAOA 4ZVEA 2V69A 3HJVA 3JQMA 4L6V3 4U7UD 3HVWA 1WEZA 4DUTA 4C9DA 2WSFC 2ZFHA 3WHIA 2VG6A 2WVDA 4DOZA 4EGLA 4ZPWR 3B4MA 2ZNZA 3C46A 5T7LB 1YIJS 1FF2A 4QWBA 3DHXA 4NMXA 3K57A 3GG1A 3T1HF 3SCKE 3TARA 2RQKA 3DU6A 3ETOA 2KU7A 5KT5A 3K5MA 4OX7A 4CLFA 2ATLA 4LFCF 1M5PC 2FPHX 4NLGA 1YITS 1HBMA 3I55S 1O8BA 3O5TB 4TN2A 1N36J 3VV2B 3ZZYA 5H9EK 3DRSA 4DS5A 4DF8A 1G3OA 1TAQA 3DLLQ 2RRBA 3LA0A 2DIUA 2RHSB 4G1PA 2OI2A 4FKXA 3HFVA 3LO3A 5HVFA 4B9UA 2RRAA 4JI7F 4YR3A 2DEJA 5D4PA 4C48A 2GVDA 3SZ2A 3H4DA 3DM2B 1CJVB 4CI0B 2UXDJ 2FC8A 2Y1LB 1M5OC 3C3LA 5A0YB 1TP7A 1P9YA 3KLVA 4C3LA 2UUAF 3I87A 3IBCB 1IBMF 5HQLA 1C1CA 4WPAA 2W7AA 3MURP 1S57A 2CNOB 4Y6IA 1C0TB 3FJ2A 4CNYA 1IR0A 3W2WB 4OHYA 4TYAA 4YB6A 3LP1B 2ZVSA 2NYHA 3PTWA 2QA1A 5EX0A 5CABA 3F73A 1QE1A 3CO0P 1P6TA 2V4RA 3EE3A 2IBOA 1NJYA 1KR4A 4FDFA 2OH2A 2XYGB 3LQVA 1KQGB 4NLXA 2N3LA 3HO1A 2IDEA 3DMJA 3BSNA 3T5LA 3LF0A 2MZJA 4WK3A 1L5UA 3J7YU 1RQ0A 2PMWA 2L9DA 5CYQB 2MJUA 3F44A 3LP2B 1DFDA 2G2ZA 2HQCA 2J7KA 2ZNYA 4M5DB 1RAHB 4N8NA 3RJMB 4Q2LA 2J7UA 3OV7A 4C0BA 3TYTA 3BF4A 2MGZB 2Q6CA 2ZBQA 2UVRA 3KLEB 2W4DA 4NRTA 5KFIA 2BZ2A 5LMUJ 1IKXB 3ZTQA 3CJ4A 4I2PA 4NLRA 4CTAB 3A1YG 2HS3A 3TQEA 4OZ2A 4G1QB 2EBGA 2ZD1A 4KGKA 3N5FA 5GMDA 4PXEA 1Q0NA 1WD6A 1NHVA 1RU1A 2QIFA 2AP6A 1HLWA 4LSNB 4OI1A 2IMWP 2ZHBA 2RNEA 3NP5A 5BYQA 1J5OA 4NASA 4DV6J 4B3TF 3FQKA 2ILYA 4IH5A 1XNRF 3WIVA 1HW9A 2AYBA 5C2GA 3LGNA 2V8PA 2Z2MA 5IT0A 1YQHA 4USUA 2XO7A 4WFXA 4Y28C 5CCLA 5KFHA 1RAEB 3V6JA 4ZLLA 4MYUA 4ZN3A 1J5EJ 4NLYA 3BH6B 4LF5J 3CEDA 1PAUB 3QT6A 4YHHJ 1SV5A 2YKMB 3TUZC 1KVIA 1S4FA 2W9BB 2DHGA 2WCXA 4DL2A 3U27A 4CH7A 4DR5J 3FNNA 1IKYA 5L1JA 3FBCA 1DTQA 2XMKA 4QIVA 1Y3JA 3IWXA 1NSQA 3Q8PB 3MEDA 3MF5A 4F7VA 3CD7A 3DXSX 2EFGA 2BW7A 2QX0A 4CRJA 1RGVA 5KG7A 1T9YA 2A3JA 4EO8A 2NUUG 4PKDB 4B9SA 4DSLA 1JNZB 2YKOA 3KYLA 4EYHB 4DQSA 1WSVA 2HPUA 3LAMA 4X66J 3POTB 1TK5A 2CFXA 2ZKUA 2XSJA 2Z4PA 4DS4A 2VJUA 3MM6A 1RDRA 4OYWA 2DY9A 4PQAA 2I8EA 1XBWA 1U48A 3HVTA 3W5ZA 2R8HA 3PRDA 4LRBA 4LQ3A 4J9PA 5J2MA 2XS5A 2X1AA 3DLHA 1GT8A 4J9SA 2HHQA 4RW4A 4DPTA 5D6GA 1NK4A 1XMBA 2F4VJ 1BUXA 2F8MA 1Y11A 1ZTTA 2ERRA 4OI0A 4QIWD 2DR6A 2B9YA 1SL0A 1NPRA 1TAUA 3EX7B 1U09A 3KNAA 3TVYA 4AXIA 1S9GA 3UCUP 3D3BJ 3IA0A 1DHMA 1U2FA 2ZUGA 2LQ5A 5C25B 2OSQA 4KTQA 1JLCA 1B0TA 2MLZA 5AE3A 1K47A 4WFYA 3G8SA 5DG9A 4PR6A 2XZWA 2K2PA 2CG4A 1OY9A 2AYMA 5A2QY 3UNGC 3GIIA 5HVGA 2OD6A 3OBIA 1T9UA 3HULA 4F67A 2H5JB 5B0BA 3FRZA 1VJQA 5HLFA 2ZH7A 1RTDB 3VF0B 2K3KA 2DXEA 1NZAA 1FXRA 1UTAA 2PEBA 2J5AA 3EGVA 3FUYA 1SH0A 4CLSA 2DHXA 5SUHA 4K5RA 3THVA 3R9LA 2XO6A 4B3SJ 4ILLA 1F2GA 3G6YA 2AMCB 1JLGB 2BM1A 1HNWF 4M5IA 3CJ5A 2KHCA 5A76A 3D6FB 1S6OA 3EICA 4FYVB 2VV5A 4NE9C 5C5JA 1FDBA 1QLNA 1DQ8A 2UUTA 1CJTA 3UE2A 2JVRA 3QGHA 2OHDA 3PW4A 4W98A 1ACMB 1OPIA 4ZVPB 2XB2D 4JI2J 2B9WA 4NCGA 4O0NA 4LFBJ 3PHTA 2RKIA 2IY5B 1FFSB 4A8SA 1CS4B 2HHVA 2AJQA 1ZAXA 4TU8A 2GNKA 4YFUA 1X5TA 2YKNA 3UN3A 1YZ6A 2CJQA 5K8PA 3GIJA 3CCUS 2MB0B 4K4VA 3MD1A 1E6YA 5DGBA 1VQ4S 4UW2A 4B3RJ 1C1BA 2IC3B 2YNHB 4JI0F 1XMQF 3T6BA 1IKVB 5I3UA 2YXLA 1LK7A 1LWFA 2VPYB 3BYPA 5DDOC 3OUYB 1N5YA 2VQFJ 2KRBA 4URQU 3CJKB 3VAMA 3M1VB 4KBIA 3AHPA 3M30B 1S59A 1AFJA 5IQ6A 5J2PA 5L1LA 5F8GA 2J6UA 5KFYA 2C22A 2VPWB 3LUYA 1LW0A 4U8VA 1HWJA 5DDRC 2DNHA 2VG6B 5KFLA 4HL9A 2I0XA 4CLWA 1F5AA 1KLMB 2V8HA 4DFPA 4O3RA 1XR6A 3KWMA 4YOEA 1M5SA 4DSKA 2XCPA 2HRYA 2FVSA 4PWWA 4RW6B 1B70B 3PZPA 3MTKA 2CVIA 3KUGA 1K0TA 1SJRA 2NZ4A 4DUYF 2FGCA 4A48A 2KT3A 2VFVA 3M2RA 2D3OR 2D9OA 4USVA 2OJ3A 3ZZTA 1U26A 2DYAA 5JUMA 1U0SA 1L3SA 2X3GA 4WWSA 3QJJA 4M1KA 5KG1A 3ZZRA 2FZGB 1AYEA 3DRSB 4RJVA 5CA5A 3KHLA 4P7TA 1M5VC 2C3MA 2WB4A 3UW1A 2BE7D 5DLFA 2UXCJ 1T05B 1FFGB 2UZAA 3EDRB 1NB7A 4JV5F 1FNMA 1KFDA 1YRTA 3Q8QB 2GVDB 3TZXA 1YDLA 1X8DA 4URSA 1QTMA 4O4RA 4D3HA 4U95A 2VL1A 2WSEC 4YDXA 2H48B 2NS1B 3GTYX 1C1CB 3O2IA 3B4DA 1YJ7A 2R7WA 3I5AA 4O3PA 5EDWA 1TTHB 1OQ6A 1YI2S 5EGYA 4NLWA 3UO0A 1TFWA 1IR2A 2HBZB 2WRMA 2PDAA 5CD4A 4ID8A 3HT0A 3BSAA 5D3GA 1TL1A 1T94A 2MYFA 1YBAA 2CPZA 3MPUB 4NEYA 4ZVSB 3BREA 5ETTA 4DR4F 3D54A 1APSA 1RT2B 4OHVA 4Z37A 1YRUA 3MAAA 3OL8A 1RTZA 1AW0A 4CP5A 1R31A 5B0DA 4XPEA 2CWXA 1T3OA 4I6YA 3ULHA 1MMNA 4KKOA 3AOCA 2AJ4A 4DX5A 5H9FK 2LEBA 3ZZPA 4KYZA 2YWWA 4ZVRB 2P8IA 4PG6A 1WG1A 1RWVB 2V4QA 4UY8T 5KT7A 2HS4A 3BR9A 4FF4A 1RWXB 4CLLA 2B43A 4IOCQ 5KOXA 4Y2KA 2W9CA 2J0WA 2VH7A 3CJ3A 3PR4A 3J7A1 3I6PA 1F60B 2B6AA 2P6TA 4EZ6A 1QUVA 4RNFA 3SYZA 3SV3A 4I2PB 2MKYA 4X4QA 1XJWB 2ZD1B 3IR7B 3H59A 1WF1A 3DLEB 3ZXWA 4ICLB 5SZTA 1BE4A 1X4HA 4TU7A 4K4XA 4DG1A 2J0SD 4OQJA 4PCQA 1HNIB 4EUVA 4ILMA 3H5XA 5LOQA 1A7GE 2LKZA 2EFQA 1J5OB 1S6PB 2XLJA 3RRHA 5E5NA 2MKKA 4OFZA 1RABB 2PD1A 1N5QA 2G9OA 3KLGA 3KG4A 4N8OA 4DV1J 3UN2A 4PG7A 1YRXA 3SSSA 3EZ5A 3MEEA 5HQ8A 5H1SV 2AF6A 2HFUA 5HK4A 3NGUA 4ANEA 4DLEA 3HP6A 1SV5B 3CPWR 1JKHA 1UW4A 2DNNA 1E6VA 3UFCX 1NJXA 1VOMA 1V6HA 1KOOA 1IKYB 1DTQB 3VAIA 1S79A 4TY8A 1FCAA 2JNJA 1R8CA 3MEDB 4YY3F 2EC0A 1PYSB 1UEUA 4DQPA 2MLYA 5EUHA 5AE1A 1QAYA 2VC0A 3ENWA 1NK9A 3FMBA 2V8VA 2QRRA 4N47A 1TU0B 4K0KJ 4IR9A 4ECSA 2CG8A 3A8KA 2QLXA 1OSDA 2IRYA 1TVRA 4CNZA 3UWTA 4ELVA 1RHQB 2B0GA 2Y8YA 3ICLA 3RRGA 4ZN1A 1MN7A 1C0UA 2XSJB 4M5JA 3MM6B 2RJZA 5C7PA 1VIXA 2EI5A 1FA0A 2W2QP 3IC1A 4FZVA 3HVTB 2QTWA 2ZE2B 1S49A 3DRXA 5J2MB 4WK1A 2ZHAA 4BLGA 1N33J 4RW4B 4JV2A 5E3QA 4FBUA 4LF8F 4P10A 2OTLS 2PO4A 2MLXA 2RDDA 3VCDA 2LDIA 5B0GA 4LF7J 3AD8C 2MSTA 5HO4A 3Q24A 3PACA 1WELA 5F8JA 3PKYA 2Q43A 2MZTA 2P9EA 1KWMA 4DX7A 3OVAA 3FKBA 2DNYA 1JLCB 4OHXA 2OGUA 4DXLA 4ED4A 1HWKA 1WORA 1X4BA 1JXLA 5DRKA 3QFHA 4DV0J 1FHTA 2J8SA 2RMLA 4QQBA 5HLFB 3W3SA 3GE9A 5LMNF 5AJ3J 1VQYA 4LIWA 3EVOA 3JQJA 2JEJA 1C2PA 2GA7A 3MEKA 1VHFA 1RAGB 3UN5A 2CVEA 2KTQA 1GK8A 4O0IA 1U6BA 2KG1A 2YKAA 5ETPA 3CNQP 7FD1A 4FXVA 4X62F 4J9MA 3BBBA 3CCES 1RWUA 2CQGA 3S6EA 4C8YA 1D0EA 3GR0A 2GS8A 4Z2XA 2FB0A 1U47A 1H98A 1K73T 1CJTB 1MROA 3E2EA 3VQSA 3P4UB 4ANCA 5F9LA 1YJVA 5HMXA 3CCLS 1SKSA 1U2CA 2ACYA 3SIPB 1Q8BA 3DYAA 4F26A 4DR3F 2RKIB 2AX0A 4ES1A 1FKOA 2DTJA 2XBPA 2PSZA 4DV4F 1U1LA 1RWMB 1FRHA 4BHQA 2RUSA 1N6QA 4FXDA 2V2KA 3NNAA 1KQSR 5G0RB 2MQMA 4HACB 2JFKA 1C1BB 2BX6A 1IR1A 5HJYA 3A4TA 3KKFA 2UUBF 4EYIB 3GYGA 3RB4A 1LWFB 2RRNA 3PKMA 2WB1D 1N5YB 2FY1A 2ZC4A 1EKSA 2JJ4D 5LJ3Y 7FDRA 2AD9A 3VGTA 3T1HJ 3RAXA 4DQIA 3SFUA 1N4LA 4FBTA 1SC4B 4ED0A 3U1LA 4LFCJ 4F0HA 4BWJA 1LW0B 4ZVGA 2XHWA 1RT6A 3FQLA 1VQ6S 1RK8A 5CCMA 2AGQA 3OJSA 3CJ8A 1GMVA 5ETKA 1L3KA 2M70A 3JTOA 5LXRA 4ZVQB 1PIEA 2AHOB 4XO0A 2DNRA 3PDNA 3GJSB 1N34J 2RE1A 5CZVA 2X7IA 3A3PB 2EEYA 2DNKA 4TQRA 4LBHA 1CVJA 4MJKA 2CPDA 1X4FA 2O67A 3CO9A 3M2RB 2CNNB 4JI7J 1RHMB 3K5NA 1F1BB 1I5OB 1D9DA 4A4JA 1WWHA 3K5PA 2VBWA 4DU8A 4BDPA 4OHWA 3OPKA 4QWDA 4YP3A 1RYRA 2B4PA 3PEJA 1F5CA 2QYGA 2CQ1A 2D69A 1YBUA 1IM4A 1WDTA 2C1EB 5D8HB 2DH8A 3H20A 3LTOA 1IBMJ 3CULA 1RTHA 2M8HA 4KHMA 1ZAWA 1HBOA 1YJ9S 1HYSA 1RBLA 2AJFE 5K8NA 3WZ0A 1T9WA 1MWQA 4I67A 3MUTP 3W8PA 5B0EA 3MM8A 1UVNA 3SQOP 3IWNC 5HSPA 3Q83A 1VRTA 3N6MA 2WOMA 3FDSA 4HDHA 1GX5A 4F4KA 4WBFA 3D1QA 4AD6A 1D8YA 4JI1F 4OZ0A 3VGUA 1D09B 1VMBA 5KFPA 3ENVA 2AYGA 3MM5B 3HKZD 5D15A 4RUHA 1U25A 2ZWPA 1D9FA 5DDQC 2ZH9A 1IKWA 4OIXA 4OJ1A 3QO9A 3M8RA 1N0VC 2A2DA 4NYZA 2QT7A 3Q8VA 4ZA1A 4AL6A 1VK3A 1QVFR 1FX4A 1KVKA 1S6UA 3D66A 4P2MA 3DRPA 1ZOTA 4ZP9A 4KKOB 4ZP7A 3I32A 3TJ9A 1FFWB 4CZCA 2PIIA 4QIGA 3W2VA 1FJGF 4XDCA 2W9CB 4G6VB 1RT3B 4ZVOB 4N7TA 3CUNA 2B6AB 3TAQA 5I4MA 4B3TJ 1PJ7A 2YNFA 3R5DA 3CDBA 3MAQA 1LK5A 2R2SA 3Q8YA 2OD4A 3TZYA 5IT4A 4C8MA 4ES2A 1FKPA 5D78A 4N56A 2K8GA 3TJ8A 5GAHU 4EO6A 4XTTA 4NLOA 4PG8A 2I38A 2CYYA 3OXFA 2J8AA 1S77D 2DXFA 5KFAA 1X4AA 1PBAA 3KLGB 1OQ3A 1VQSA 1RBAA 2BOPA 1HMVA 3BKTA 5E41A 8ATCB 2R7TA 3GMGA 4J9NA 1T03B 4DF4A 2AZ3A 2JFDA 2X1BA 1JKHB 1SVDA 3W9IA 1FJEB 2DIVA 2VASA 4NCAA 3U1MA 1E6VB 1WC6A 4LVOP 4DSEA 2VB6A 2FHMA 2ROPA 1KP6A 3GFXA 2DGVA 4MKBA 2W7OA 1WF2A 2GVZA 4DU7A 4TY8B 2XI3A 3PM9A 2J9DA 5FIIA 4PAAA 4CYUB 1LWEA 3SDEA 1VIOA 4JB8B 2DJWA 4KIAA 2QMUB 1RWKB 1SC3B 1VBKA 5KFKA 3M2UA 3QGPA 5L38A 3DOKA 4RNNA 1TVRB 2FLPA 3HJFA 4LJMA 2FHJD 1UETA 2A10A 3ZTOA 3DDKA 1C0UB 4RW7A 2XYHB 3G9CA 2CPFA 4OV1A 2X51A 3BPSP 3U7JA 4ID5A 1T11A 2MHEA 3RUBL 4RU2A 2ZJPQ 2BDPA 2BE2A 3KUHA 3D0IE 4P72A 1NSAA 2HHPA 4C8ZA 1YZ7A 2HVIA 4DMZA 2B7BB 5JXSA 1J2VA 3MR3A 5AXNA 3PV8A 3FZ2A 1U8SA 2G13A 2E7VA 3A3OB 4UOHA 3FZBA 2O1PA 4KQZA 1FI4A 2OPQA 4LF5F 1D3WA 2N7YA 3W62A 1X5SA 5DGAA 1A6LA 3MCNA 3PW7A 2CQHA 3DLBA 2XMJA 1HNWJ 2B3TB 3JSRA 3PYGA 4Q5VA 3DNCA 1SCJB 3B78A 3TUPA 4NLQA 2Z8QA 3CXCR 1S4EA 1NDKA 1B0VA 1HBNB 2CJ9A 1KHWA 4HDGA 3GFZA 2GCFA 4CT9A 5J1PA 5HN0A 2MKJA 1RCOB 1FXLA 3H98A 4F0MA 1RP5A 3VVUA 4RZRA 2NREA 4QWCA 4NOHA 4I56A 3SSQA 2IM1A 1YG0A 1D1UA 2JLEA 5KFUA 4EFAC 2XTJP 4DL4A 2Q66A 3NWGA 2HGMA 3G82A 4LSZB 1RT7B 1IUJA 5HI7A 4JI3J 4K7QA 4CH0S 4JI0J 2LQBA 1XMQJ 2Q1LA 2FLOA 4A46A 2HGNA 5U47A 2K7KA 1KNZA 3UCZP 1REGX 4OJHA 4CLKA 1Y10A 3DYAB 4WP9A 4F36A 2YWHA 5CYJA 5RUBA 4PPZA 1RA7A 3VAJA 4ERDA 2WVEA 4U7CA 1FKOB 2W7PA 2CADA 4K4WA 1VQMS 4MAKA 4CO2A 3TX8A 5L46A 2AIRB 1N6QB 2AU0A 1ZPWX 4TYBA 2P2CB 4K2XA 1HHTP 3M6VA 1HNZF 5DM6Q 2MSSA 1I1GA 2M3DA 2V6AA 1QAJA 2FZCB 2NQPA 1RCXB 3S01A 3GZ7A 3IM8A 3AXMA 2R7XA 3U1NA 3R5JB 2YNIA 3NGSA 3MM9B 1BXNA 3M9MB 4TQSA 1GXUA 5MAOA 3SCIE 4LFAF 2DHAA 4DUYJ 3WX8A 4PPDA 1PCAA 3H42A 1RT6B 2MKCA 2DNMA 1BY9A 5AT1B 4ECQA 5CAAA 1LV5A 5M2UA 3V6KA 4IFYA 3D68A 1RAJA 3GJQB 5LJ5Y 1KN6A 3NLCA 1Q53A 1L3TA 1I6JA 1NDCA 3EZUA 5F0UA 4ZHRB 5ETLA 2M9KA 2G4BA 3OVSA 3TWZA 3A8EA 4CLTA 2MZ1A 3I56S 1S9EB 3UD4P 2KT2A 4OZNA 4LVNP 2VFUA 3GJTB 4RLEA 4OI4A 4LSLA 4AL7A 2Y3YA 4JV5J 2H5EA 2DNQA 4RNMA 2WVCA 1Y9OA 3Q23A 4WXWA 1Q8KA 3HHEA 2E1PA 1HI1A 2YH1A 3JAMY 3OTOF 1S5ZA 2BXJA 4MK8A 4QW9A 4QW8A 3FK4A 1FVQA 4NI2A 2BYCA 4TLRA 1Q95G 2ZZMA 1RTHB 2G0JA 3Q89A 3K8WA 4B3RF 4B3OB 1HYSB 2VJVA 1O51A 3K59A 3LPYA 2OSRA 2EFNA 3G86A 2OMLA 3RTVA 2VOPA 2BQUA 2R2RA 3M8YA 2VQFF 4OV6A 1UEKA 5IT9Y 1AB8A 1RT1B 4USHA 2XLKA 4ZJQA 2HFSA 3NY0A 3AODA 2G2YA 5F8NA 1VRTB 4R25A 3QT7A 3UQSA 4DCOB 2A2CA 2M4MA 3H5YA 4DR4J 2NPFA 3ILOA 1J27A 2KM8B 1WHVA 3CCRS 1VQ9S 3SEOA 4FYWB 4ZK7M 3WIUA 3CMAS 2GHVC 2ZWOA 3FSIA 4MKYA 3WBZA 4MFBA 2BJ9A 2J76E 1HQEA 2XG8A 2YX7A 3NCQA 4DL3A 4B9NA 2ADBA 2NXCA 3PY8A 1IKWB 5KFWA 2RT3A 3QO9B 2F40A 1RYSA 3CGIA 2QLBB 4YEAA 2H4YB 4OZ5A 2PA3A 2VQEF 5IXUA 1RKJA 2KO1A 2GC8A 1DQAA 3T5JA 4NYOA 3R7BB 2ZVIA 1NKEA 3IGVA 3DRPB 3W9JA 3DKDA 1N5VA 3MPVA 2VA3A 1S1WA 3ETMA 4OJ3A 3HSGA 2OLWA 2XWXA 3NOCA 3HSDA 3A13A 2MKSA 2QZ8A 3T5HA 3C14B 3OTBA 1SBRA 2BVZA 4N76A 3W2VB 4WJBA 2QA4G 1U1OA 1ITPA 2NYIA 1YLXA 5D4OA 1NU4A 4J9RA 2BV3A 2OELA 2YNFB 1RLDA 3PX4A 3ZC4A 1O0PA 1VS3A 1ZYQA 1RU2A 2V9KA 4U96A 2RS8A 2LDYA 1KFSA 1S1UA 2Y0SD 5JVHQ 3MOJB 5ETOA 2WBMA 1NDLA 4IOBA 2AEMA 3K5LA 1RHKB 2F5GA 4WP3A 2KYZA 1QVGR 2W01A 2GV1A 1Z2LA 2VDIA 1VLYA 2DY1A 2YWGA 1XWLA 4RKUC 2YQ3A 1FRXA 4AQYF 1S9FA 1H73A 4DCJB 1R0AA 2XNQA 4CLPA 4ZLPA 4CLUA 4YY3J 1VQLS 4OYXA 2KI2A 4HTJA 4F2SA 4JP8A 3AFGA 3PFEA 3NXZA 2XMWA 1SH2A 1M1HA 1TKDA 2GW8A 2COLA 4PUOA 2HNYA 1OY8A 4LREA 3TANA 3OQ2A 3D0GE 4U67Q 1YBTA 4ZPDA 3FSXA 1GTHA 3OLBA 4EWTA 2CKWA 4NCBA 2VD3A 4FS2A 3M8PA 2BACA 3OSNA 1XN9A 2GVZB 1XC9A 1S48A 2VUGA 3TA0A 1B99A 1LWEB 3SDEB 1LOUA 2FJDB 1U1RA 1NH7A 3KJQB 3CCSS 3M2UB 3VWSA 4DSJA 3GYXB 3PEHA 4LF8J 3DOKB 1NSPA 1K0VA 3N28A 1C4AA 4WYLA 2F8HA 3IAM9 3FC9A 5FD1A 2LMIA 2ASLA 4E8UA 4RW7B 4NA3A 2VHGA 6AT1B 2ZH4A 1EQMA 3J80U 3I9V9 3OT9A 3KG0A 1SC6A 3NCPA 4ID5B 1WNEA 2FVQA 2W2OP 5G4DA 3THTA 2W8KA 2BANA 3CJTA 1KS2A 2BE2B 3LAKA 3M8WA 2HIYA 4XPCA 1X7VA 4OYAA 1S1XB 3W64A 2AWZA 4U8YA 1VC6A 2ZOGA 2GAGC 2DK2A 4LR9A 3PG9A 5LMNJ 5A8RA 1NAQA 2OPSA 4ES3A 2NZCA 3MR7A 3SSRA 3C19A 3QLHA 2OPQB 1U02A 2CXEA 2GO9A 1F3FA 3G6XA 4ALZA 4FYDA 2MKIA 3IMQJ 1FNOA 2APOA 5E3RA 3QGGA 3E01A 4X62J 3QATA 3IBWA 5KG0A 2VICA 2R7RA 5DJBA 7AT1B 5E3PA 3QT8A 1VR6A 4PYDA 3TOQA 1CJKA 4FYXB 1T95A 4IG3A 4DR3J 2VC1A 2HKEA 3W8GA 2DGXA 2Z2YB 1XQIA 5FLXY 3P5TL 1T9XA 4DV4J 1B4SA 3HZGA 5H9EJ 2E9TA 4DQQA 2AV5A 4X2BA 3HFZB 2GJ2A 3NNCA 4QR2A 3G82B 2BJ3A 1Y0HA 1XK8A 1EETB 2CUYA 2LVWA 2YWFA 4QZVB 2UUBJ 1TL7B 1CBKA 1Y4ZB 4PXCA 3BDPA 3KUEA 2KFYA 4HYKA 1M5KC 1LWXA 1X0PA 1HWIA 3H8YA 5ETNA 4B9MA 3GPAA 1S10A 3OL9A 2VG5A 4H54A 1KRPA 2DITA 1YGYA 4GVLA 3Q0AA 3GFHA 1FVSA 1UFKA 5T41A 4KH1B 4DPYA 4IUFA 1WSRA 1GTEA 4ZVTB 3ILLA 2XHCA 4OX9J 1HA1A 3NS5A 2JHEA 5JMNA 4LF6F 4DV0F 3H2UB 3NS6A 4R0JA 2ROEA 3DLGB 2YNIB 2QSFA 4Q43A 3OR1A 3AT1B 1MNEA 4WF9Q 3BR8A 1UFLA 2QSWA 3I31A 3QAUA 2L08A 1X4GA 2BKOA 2LEAA 5HROB 2LEPA 3HF5A 4C2MA 4ELUA 1HFEL 4IFYB 3R1LA 2OEKA 2NSBA 3OXGA 3QZ8A 5IV4A 2B4OA 3DCAA 4IQXA 2XCAA 3V81A 1TMJA 3SFGA 3A12A 3DOMA 2HFNA 3GB0A 1LW2B 3TUIC 4NWBA 3TAPA 5K9FA 4IRDA 2W8LA 1QJHA 1F9EB 2LXIA 4NLUA 4WFZA 3EM1A 1P1TA 4USMA 3O1LA 2KL8A 3CVKA 5J2NA 4CO5A 5JVGQ 2D3UA 1S1VA 3E51A 4LSLB 2VOOA 4Y34A 4X4VA 2Z0GA 1ZM3A 2C3YA 4B9TA 3OD2A 4QWAA 1FJCA 1NK7A 2KJWA 3GU0A 3BS9A 3V6DA 4IG0B 2DR5A 3PO5A 4BC7A 4JI1J 5JJBA 1NH8A 2L41A 4YB1P 3PHEA 5CH7B 1NB2A 3BQ0A 4OYOA 5DLGA 4EBEA 1UJ5A 4PYAA 3K17A 2UVVA 1T9TA 1UVJA 2YNGB 2AEFA 1EKRA 1SPBP 1VQ7S 3DHWC 3BZQA 4LF9F 5B7WA 1V9OA 1SH3A 3I9ZA 3PIOQ 5KFCA 3KMQA 1NHKL 2CPHA 5KFBA 2WW4A 3BGOP 2IJFA 3BBFA 3TVKA 3B8HA 1Y5LB 2I1RA 3TA1A 5KG3A 3Q8RB 4IKAA 4GMKA 1WKKA 5HL7Q 1MW7A 1X4DA 3EJMA 1QSYA 2H5IB 2VBXA 3BO2A 4NZ6A 2POKA 3N5BA 2V4JA 2ZBCA 4DHVA 4PRFA 4OYMA 4Q45A 4B9VA 1WF0A 3HFKA 4M5GA 4QYRA 3HSJA 3BGRB 3CMES 4OHZA 5DG8A 1N48A 2QO3A 4DPWA 3OHBA 1TKTA 5FDLB 4DV5F 3ZO7A 1SC1B 4O3NA 4PXBA 1N34F 1FJGJ 5D4NA 3NAHA 5ITHA 3PX6A 1TFYA 5KFNA 5EWEA 4C98A 3WC0A 5J1EA 5KG4A 3HZEA 2QL5B 3HT3A 3LWLA 4A47A 1JLQA 5A8KA 5CZXA 1H2UX 1X5OA 1FRKA 3QNWB 3H4BA 2UU9F 3R5GA 4YR2A 1WACA 3TUJC 4X4SA 2DXDA 3H0PA 3W61A 3KLHA 2J9DE 1WG4A 3M2VA 5AXMA 3O6QA 3NBPA 1FWLA 3I4HX 2V68A 4F4XA 5A2QU 3DLJA 5KFSA 3IAS9 3QJPA 1S1UB 2H9ZA 3KMSA 4NEZA 2U1AA 1U1KA 4UUXA 3AA8A 2IM0A 2BABA 2IIHA 3TJAA 4DR1F 2L9NA 5F9NA 1FRIA 2W2PP 3K5OA 2LFVA 1S76D 1ZM4A 4QR1A 2E7WA 4KB7A 2E5HA 2Z2ZA 3CTRA 3JTPA 1CPZA 2XS2A 1R0AB 4P75A 1TL3A 5GMKa 1WDDA 4P52A 3L7PA 4DV2F 4JI4F 2EVZA 1K44A 1PC4A 3MECA 1H74A 3EGWB 1EX8A 3EPIA 4PUOB 2HNYB 3GP9A 3P3DA 1X9WA 2CQDA 1GMUA 2ZZTA 2I9SA 4P9SA 4ETXA 1RADB 2JL9A 4RR5A 2DGQA 2M7SA 3M8PB 3EWGA 2VDHA 2XGPA 1L3UA 1YJRA 3N01A 3NGRA 1ZZFA 1L3VA 1UJ6A 3RRKA 2EW9A 3UD3P 1T9VA 4JYAJ 2E9ZA 3OVBA 1IBLJ 3OFHA 1MU2A 3M6UA 3J7YI 4AE5A 4RW9A 3SI8A 4NL5A 1RT5A 4ENOA 3BO3A 1C4CA 1O6XA 5KFVA 4KGVB 1EP4B 2DO4A 1HQUA 3CC7S 4RW8A 4F4WA 5KG6A 2BANB 4C6AA 2N82B 4LMZA 2FTRA 5KFXA 2BKNA 3DC2A 2LU1A 4C3KA 2I5JA 2W25A 4I64A 1N54B 4DR7J 3M8ZA 5D4LA 1RE1B 4FPIA 1SJ4P 2X1GA 1YJUA 3J7AN 2YWKA 1WTFA 4BBYA 4PABA 5A8RB 4UQTA 2OPSB 1BWVA 1PILA 1UVIA 3HSZA 2WONA 1M5HA 1WG5A 1MSWD 2RQMA 2MZQA 3CIZA 3QLHB 1U6FA 4TY9A 4HI1A 4B9LA 4QYZK 1VQ8S 3Q86A 4WCEQ 1TQLA 3QIDA 4CLZA 2WK4A 3E01B 4S0MA 5HBMA 1NHUA 3S7RA 1FDNA 3G87A 4LF4F 4HT5A 3QAEA 1GNKA 3PR5B 1CJKB 3BBCA 3IO1A 1NJIT 2ASJA 4GKKF 4IG3B 1IXKA 4RU9A 4LRCA 2P9CA 3RB3A 4NYPA 4HKQA 2WSCC 2ZJQQ 4K8RA 1PSDA 1NMEB 3CC4S 4JI5F 2C3PA 1X4EA 4QIFA 5KFQA 3B82A 3D6MB 2B56A 5E7OB 5HP1A 1HNZJ 1TL4A 2HLTA 1I51B 4ECZA 1JXEA 2HS0A 1WUUA 3C6TA 2JSXA 1H3DA 4ZOSA 1KVJA 1WHYA 3ZZUA 4OI3A 4AFFA 4L72B 3OL6A 5IFMA 3W5XA 1OYDA 2H51B 3AH6A 1SL2A 2HWHA 1FRMA 1S72S 2VG5B 8RUCA 4I68A 3MMBA 1I3OB 4F3MA 2N3OA 2VPXB 3BQ1A 2HFVA 4LFAJ 2YKPA 5M2PA 3D1HA 3O44A 3FCWA 2NCKL 1S1TA 2XLIA 3WDOA 3J81j 1VI7A 2UP1A 2P5VA 3G71S 4BCAA 3RBXA 2KRRA 4UZCA 3QFWA 2LXFA 3ITHB 3I96A 2Y1JA 3SBMA 1UKUA 4J5OA 2RVJA 2QE5A 3OR1B 4Q2MA 1JLAA 4ED7A 1IM6A 1S0VA 4DV7F 3BSOA 3NMRA 5GAEU 3BPDA 1RB0A 4NA1A 4HHUA 4DX8H 3BGUA 3QWPA 3P49B 3P45B 4ZIWA 2YBVA 4DPOA 1JJ2R 1KKHA 3W2WA 2ZDPA 4M5HA 4RUAA 3MFIA 4M63A 5GMEA 2DGOA 4I2QA 3OFEA 5J1NA 3UDEA 3V81B 3MR2A 4WP8A 5H9FJ 4OZ3A 2JVOA 3BO4A 5L8RC 3OTOJ 2OPRA 1B0PA 1HBUA 2GIRA 5L9NA 1FTCA 3BN4A 1W7WA 4MIBA 2HIQA 4JV0A 2XY7A 5J2NB 2HHWA 3JSYA 2OEMA 1S1VB 4JI3F 1NEEA 4C11A 4AXJA 3QRRA 4CIOA 3C8YA 4W4MA 1UW9A 3H90A 1RTIA 4MK7A 1AUSL 5GADU 2P9GA 3B6BA 4LR8A 5ETMA 1PJ6A 3S1TA 2HEKA 4RUCA 2CNLB 2O66A 1V5VA 3DOLA 3BN7A 3C15A 1WI6A 2QYCA 1NPPA 1SJ1A 2FHKA 3K8VA 2D9PA 1I94F 1CG2A 1JB0C 2CJAA 2OUGA 1HR0F 1R3NA 2IYIA 2LXUA 1RWNB 1Q5VA 2EKNA 5D0GA 1X4CA 2R4FA 1UCNA 3HDSA 2IHR1 5LL6d 4NRUA 1TMMA 3THPA 1RHUB 3R8YA 1NXIA 4DV3F 4NX9A 2HK3A 3TNVA 2VQEJ 3V5RA 3D67A 2FHJA 4BS2A 4LSNA 2OFGX 2LQ8A 1R8PA 1UEVA 5DETA 1OS5A 5BR8F 2V4JB 4K4TA 2V8DA 3W63A 4J7CA 4B02A 1B3TA 4WE1A 1HBMB 3DDIA 1HIYA 2HQ3A 3MMCA 1TKTB 3ZZOA 1RAAB 3KOAA 4F0KA 4FYYB 2L48A 4V19J 2FZKB 1DTTA 4YMEA 3V4IA 4OYBA 2HHXA 4K59A 1EJ7L 4LUBA 3PVXA 1RHJB 1OMSA 2W9BA 2QFJA 2PN6A 4LQ9A 5J1EB 3N4WA 3UDLA 2BRLA 4X4NA 1U1PA 3T19A 3T1AA 5KFFA 4IH7A 2VZ9A 5A8KB 4TXSA 4CO1A 2XMMA 3CB4A 5LSOA 2QLJB 2U2FA 1MWYA 2ZH3A 2LQ9A 4L73A 1NUEA 2DGSA 2EG1A 3KLHB 3LALA 1U2RA 3DRRA 3M2VB 1TKXA 4AQYJ 2ZH8A 2GAHC 3NBPB 2PFDA 4C3MA 2LQJA 1CC8A 2YWEA 4QOTA 2R7QA 3GYNA 4ETZA 3HKWA 3HXMA 2C2MB 1QE1B 3MTJA 3FBBA 3BYRA 2IA6A 4GVBA 4F2RA 2GZOA 1H72C 3KK1A 3DMJB 4RUBA 2MQPA 3CIMA 4ECXA 3LH2S 3UDVA 1TUVA 4USJC 2GJFA 3T5KA 3J81Y 1F3VA 1Q16B 2JRSA 4ZVHA 2F8EX 2ZKTA 3RZAA 1WOPA 1U8WA 1CC7A 3QGIA 4C8OA 3O8WA 1TL3B 1GFWB 2RD5C 2GMLA 3MECB 1SUQA 9RUBA 4WFBQ 1NK5A 3TW0A 5KT3A 4IO9Q 4Y0FA 1M1KT 2MY7A 2HAFA 4ECRA 3K7RA 3H25A 3H40A 1F2HA 2ABYA 3ILIA 2OFHX 2V2VA 4RWXA 3P6YC 1T02A 2ZH6A 2ZHOA 2QA2A 1VRQC 2UUWA 2QMWA 2UXBF 4Y2IA 1MU2B 2K06A 3I0RA 3JXOA 2B9XA 3GSIA 3M9NB 4RW9B 3KFWX 4ZMMA 2QV6A 2RQ4A 1RT5B 1JLGA 2IDLA 4ELTA 2MQNA 4PZVA 1UA1A 2XY6A 3CDEA 3MD3A 3CCMS 3CD6S 1YHQS 2R8KA 4G3IA 3RBZA 3P8BB 1HQUB 2AZ1A 2D41A 1NK8A 2YQ1A 4JI8F 2R7VA 3US5A 2A6MA 2I5JB 4IR1A 1VQKS 4O23A 4U6PA 4ECYA 2YPZA 3H5SA 2CAJA 4TNOA 2WVBA 3ZTRA 4DBQA 4F25A 5F41A 2GX8A 4WKYA 2DD8S 5LT5A 3NS7B 2HQIA 2PMZD 1Q79A 3G6VA 1R43A 1D8ZA 3GV8B 1R8BA 1RBOB 4A8MP 4QU6A 4Y2MA 1HWLA 2ZBRA 1QAIA 2OP5A 1XNQJ 3AJ2A 4A8OA 4I1TA 4C7QA 3QRQA 2NXJA 2BMBA 2FJEB 2V8GA 4MT1A 5E3AA 1P9QC 1HI0P 5C24A 3M1VA 1RAOA 1H0HB 3LOUA 2WW8A 4CH1A 1HNXF 2HHUA 2HVEA 3AB2B 4DEZA 2IRXA 4NZ7A 2JOQA 3D3CJ 4N77A 2KM8C 1VGYA 2R7UA 2DVIA 2QEXS 2ZM6F 1VHIA 1TZ0A 2E7XA 4BC9A 1H7WA 4K4SA 3GV7B 3FCHA 1ZS6A 2BKPA 3AD9C 1G2EA 2XC9A 1KLMA 1TK8A 1DLOA 2ROGA 2Q6BA 1CULA 3H2LA 3EVMA 4DR2F 1UZDA 3W1YC 3VR1A 4LF1A 3I82A 4OYIA 4RW6A 3T41A 3AAWB 1T7PA 4NLDA 3W9HA 1YJWS 2Y1IA 2HWTA 5HP1B 5D77A 2FGOA 5D0HA 1S9GB 4R5PA 2G1DA 2VKZG 1N0UA 5HJXA 1DURA 3C6TB 3TO8A 3JB9k 5DM7Q 2HHTA 3CMQA 1SXLA 2DRDA 1IBCB 1S12A 4LF6J 8AT1B 1HARA 4NXMF 1DAXA 4RBTA 2MJNA 2J6SA 2FVCA 3MMBB 3BB5A 2C42A 2V2ZA 4Z7YA 4GKJF 2MKHA 1ZA1B 4ZPCA 1EQ0A 1S1TB 1RT4A 1T05A 2RAQA 1IN0A 1YWXA 1IWAA 2W9AA 2B8PA 5B0CA 1M90T 1UFWA 1T3NA 2KVIA 4ZLNA 4HR2A 4O3OA 2ATCB 1X5PA 1JLAB 2DPJA 4WKRA 3J7Z5 4ECVA 1DQ9A 2R8IA 3N0VA 3PW2A 3QPIA 4Q44A 2BW2A 4YB5A 4Q0BA 3BV8A 3C16A 4B3MF 4J9OA 3NG8A 4DL0C 4I2QB 4NCGB 4GRSA 2FJWA 1PO6A 5BXIA 2ALZA 2IM2A 4DJBA 4HHJA 1MWZA 3L7OA 4A8KA 2OPRB 2YKNB 1HBUB 4FNHA 2QC3A 2C2EA 1VCTA 2MXYA 1QTNB 1E6YB 4Y65A 1HD0A 3F0NA 5ETVA 1RT2A 4C11B 2V9WA 3RW7A 5I3UB 1U24A 3DDNA 1FESA 1TELA 2HMIA 1LWCA 4KE5A 1RTIB 4LF9J 1QDUB 1VC5A 2HVZA 2HZCA 1VQNS 4KGZB 1FTRA 3R5CA 4J9LA 1AXQA 5FJ4A 3AJ1A 2DR9A 3DOLB 5EN1A 2CPJA 2LU2A 2BRKA 4DZDA 4PG5A 3C15B 4P6QA 1GQEA 4M5MA 5J2PB 3CF5Q 3SQGA 1MG7A 1N32J 2G1HA 2JLGA 2A6OA 2YPYA 3VGSA 1VBYA 3AA9A 1LFPA 2CJXB 2KZMA 4OX9F 3O3LA 5ETQA 3WX4A 3BM7A 2KDOA 3UVJA 3KNGA 4ZDNA 1F0XA 1RACB 3DLKA 3Q2SC 3DLEA 2EK1A 4DV5J 2VKRA 4ICLA 4KRWA 2FUG9 3PW0A 3CCTA 4UT4A 2CA9A 2XMUA 4OYPA 1HNIA 3AB4B 3M8QA 4URGA 5B0AA 3KLFA 2HQFA 3TA2A 4QR0A 4ECTA 1S6PA 1IBKJ 2XULA 4K2JA 2E5GA 1HNVA 3HHLA 4WE1B 1HHSA 1Q86T 1VYAA 4QBUA 3KG1A 2DPIA 2QLFB 3MMCB 4QPXA 3IP0A 3FGVA 2GIFA 3CJ0A 4O3SA 1U1NA 1JWWA 2HW3A 1UZHA 3ET6A 1T0TV 2UU9J 1DTTB 1VQPS 3GIKA 3V4IB 3DFEA 2YH0A 4I6WA 3OTEA 4KHPF 3RU0A 4OLOA 4OYZA 2R3VA 3NMAA 2VFRA 4XAKA 3OW2R 3HVAA 3E8OA 2WHOA 4X84A 5CHCB 2MMYA 3QSIA 3SXLA 4DR1J 4AUKA 1QD1A 2IYGA 5J2QA 1FD8A 2RDJA 2RB7A 2CNKB 4L3NA 5LM7E 4IFVA 3DRRB 1TKXB 3FEZA 4KGMA 3UR3C 4I69A 5D3GB 1JLBA 1DRZA 1TL1B 4DV2J 4JI4J 1MMLA 2Z58B 3R3TA 2CZVC 4X65F 3CJRA 3JSMA 3JSBA 2X1FA 4GVBB 4LRFA 3KK1B 2KVQE 2ZE2A 3IR5B 3SCJE 5ADZA 2RILA 5F8HA 3MAAB 2CZ4A 3BDEA 4O4GA 1WTBA 5AXLA 3QBCA 3CC2S 4OMFG 3UR0A 2CPXA 4YDDB 5THWA 1FJ7A 1FERA 4WFAQ 1KBRA 2VPZB 1JMTA 3ZTPA 3K89A 3GSDA 2LYVA 2FD2A 2NSCA 3UDCA 1Q1KA 4WXOA 3I5BA 4KO0A 2Z30B 1B64A 3R5AA 5HQMA 1NK6A 5IWAJ 4DQRA 2AGOA 4DCPB 2ZOFA 1SUQB 4UF4A 3TRGA 5F8LA 4J9KA 3V6HA 2HFOA 4UQGA 4QU7A 3TI0A 1G7CB 2YQ0A 2KB2A 2VONA 2CZ9A 3ZNJ1 1CSJA 1KOHA 2FDNA 4DR6F 3GILA 3VALA 1XTZA 2VA2A 2ZBIA 3RB0A 1UVMA 2WAQD 1X9MA 4DG1B 2O3DA 1YX2A 2BM0A 2HRTA 3I0RB 1V5IB 4FNIA 1H6KX 3TEGA 1BQNA 2DGUA 2AYEA 4W90B 2E1RA 4ZITA 2DISA 3RGIA 2PI5A 1PYTA 1JXVA 2Y8WA 3VAFA 1Y7PA 1G6BA 3ADAC 4EZ9A 1PYOB 1BMQB 4ZCKA 2GO8A 1FDDA 2FJVA 3H7HB 3MEEB 2WVFA 3F56A 1IVZA 2XMAA 4E98A 1RUSA 1AZSA 4RNOA 3AOBA 3A3NB 3MXHP 1BC6A 3JYTA 1B7YB 2CQPA 4DUZF 2CWKA 3L7UA 3TAMA 5B0FA 3DRYA 2OIHA 2DT9A 2V50A 4ZCMA 1EIYB 2XS7A 2VG7A 5G0RA 2J9CA 1T8EA 4LF4J 4HACA 1RSCA 5GAHI 1V3SA 4KGXB 1YJTA 4GKKJ 1UWAA 2HVDA 1OSCA 3TP2A 2RF2A 1KDNA 3SMZA 5C24B 2H65B 4JI5J 2HFZA 4C4WA 1Y3KA 2K3IA 3EGZA 4X4UA 1BWEA 6FDRA 4P74A 3JAMU 2CRLA 3R7SB 3ZZ0A 4J9QA 4OZLA 4F4AA 4ZKAA 3C2PA 3CDAA 2IVFB 2A0FB 3KHRA 4JYAF 1GMWD 1JLEA 5KG5A 3KJFB 1IBLF 4KR0B 2VIHA 1DLOB 3CJ2A 4NA2A 1CULB 2J0QD 2M5YA 4QJVA 5IT9U
chains in the Genus database with same CATH topology
4X64F 3VQSA 5A8KA 2WTFA 3HHDA 5CZXA 2SXLA 1H2UX 1KTVA 5F9LA 4Y2CA 1X5OA 1YJVA 1IKXA 5HMXA 3CCLS 1UVKA 1SKSA 1FRKA 4WIIA 4X4PA 2ACYA 2BA9A 1Q8BA 3DYAA 4F26A 3C66A 3H4BA 4DR3F 3RW6A 2PFFB 2UU9F 1RTJA 4YR2A 5K5MA 4KAIA 4CTAA 3MGJA 1WACA 2RKIB 3TUJC 1XEZA 4X4SA 4G1QA 4R5PB 2C2RA 2AX0A 4ES1A 2D1CA 1FKOA 2IVMA 3HX9A 2DTJA 2RSQA 2V5HG 2XBPA 1WHWA 3IR6B 3VTIA 2NLWA 3KLHA 2PSZA 3PXGa 4DV4F 2J9DE 4TKTA 1WG4A 3DN9A 5KOWA 1U1LA 4H4MA 3M2VA 1FRHA 2AX1A 5AXMA 4BHQA 1W2IA 2CQCA 3O6QA 3NBPA 4F3QA 4EEYA 4PWDA 3I4HX 4RX6A 1N6QA 4FXDA 2V2KA 3NNAA 4F4XA 1M0SA 1KQSR 3ONQA 5G0RB 3DLJA 2MQMA 5KFSA 4ED8A 3IAS9 3IN5A 3QJPA 5KT6A 2JFKA 3KK3A 1C1BB 1S1UB 2EFPA 2H9ZA 3KMSA 5B08A 1FK9B 4ZP6A 2HGLA 1UAWA 2U1AA 1NNDA 4DR7F 3KKFA 2UUBF 4EYIB 2CPEA 1U1KA 2BQ3A 4UUXA 3AA8A 1S0OA 3RB4A 2R7SA 1LWFB 6FD1A 2RRNA 2VFSA 4M8LA 3PKMA 2IM0A 2WB1D 2MDAA 1N5YB 2FY1A 2ZC4A 5GADI 2BABA 2GQ2A 2KXHA 3RB6A 4JOUA 4DR1F 2OMOA 2L9NA 2JJ4D 3IG1A 5LJ3Y 1DZ5A 7FDRA 3NNHA 1FD2A 5F9NA 2AD9A 1FRIA 1EP4A 3K5OA 2GGPA 4YR0A 1S76D 1ZM4A 4QR1A 1RT4B 2E7WA 4PQUA 4MKAA 5A6PA 1X0FA 1F9FA 3HHLD 1P8GA 2JDJA 4KB7A 2MQLA 2KFNA 3FRYA 2E5HA 1FE4A 3CTRA 3QIPB 3JTPA 1KEKA 1YTYA 1AFIA 4ZVFA 3HM9A 2R2TA 1CPZA 1URRA 4B08A 2XS2A 3RAXA 4DQIA 3SFUA 1R0AB 1N88A 1N4LA 4FBTA 1SB6A 2K7JA 3IFEA 4OI6A 1FNXH 1IJEB 1TL3A 5IQQA 4PXDA 2B7CB 3U1LA 4P7VA 5GMKa 3MWBA 1LKZA 4ED0A 1SJFA 4RBUA 2BQRA 3L7PA 4BWJA 3RR7A 2YKMA 1LW0B 4DV2F 4JI4F 2EVZA 4ZVGA 2XHWA 3MR6A 1RT6A 2F3JA 2M2BA 2ZC3A 1PC4A 3MECA 2M88A 3EGWB 3FQLA 1YVFA 2E5LF 2KJVA 1VQ6S 4OJGA 1LQ9A 1Y5IB 1RK8A 3PFOA 5CCMA 4FVCA 3EPIA 2AGQA 3LP0B 3OJSA 4PUOB 3Q8SB 2HNYB 1URNA 3P3DA 1X9WA 1NK0A 2CQDA 1U4BA 3MZIA 1L3KA 4CO4A 5EWGA 1JLQB 4IH6A 3HVRA 2B5JA 2I9SA 1MROB 5E2QA 4Q0BB 3D0HE 4ETXA 4NLSA 4DV1F 4F02A 3CE8A 1VQOS 2M70A 3J7ZT 2DGWA 2JL9A 1JJHA 2DGQA 2M7SA 2OO4A 1B7FA 5E0OA 1XR7A 3JTOA 5LXRA 3MM5A 1Z2ZA 2ZH1A 5KFTA 4PWUA 3M8PB 2DNRA 2VBZA 4XO0A 1BD6A 5B09A 3PDNA 4HH0A 4R0EA 3DI6A 2XGPA 1L3UA 1YJRA 4FXWA 2RE1A 4I4BA 5CZVA 4QPTA 2DNKA 3N01A 4TQRA 1ZZFA 5DQGA 1CVJA 1L3VA 1UJ6A 3RRKA 4MJKA 3X1LB 2EW9A 2CPDA 5DQIA 1X4FA 5GAGU 2O67A 3CO9A 3M2RB 3UD3P 5HMZA 4WFNQ 3LW5C 3K5NA 2BJDA 3MPYA 4D3GA 5BYSA 3KHGA 3VZHA 2E9ZA 3IRXB 2ZITA 3OVBA 1D9DA 1OIAA 4A4JA 3HHNB 1WWHA 3K5PA 5KFGA 2VBWA 2MQOA 3OFHA 2Y1RI 1MU2A 3M6UA 4BDPA 3POTA 4OHWA 3OPKA 1S7HA 1VFJA 4NLTA 5KTQA 2R7OA 3J7YI 4QWDA 1IQTA 1XMOF 3EXCX 1IQZA 4YP3A 4AE5A 4RW9A 4KHRA 2PGCA 4X4TA 2B4PA 1RYRA 3PEJA 1F5CA 3SI8A 4GO7X 2CQ1A 4NL5A 1IM4A 2IAJB 1RT5A 4NLVA 2ZH2A 3G6ES 5D8HB 2E5IA 2OAUA 2PMHA 2DH8A 2HMIB 1LWCB 3H20A 3BO3A 1U45A 3CULA 1C4CA 5KFVA 4K0KF 1RTHA 1EP4B 2M8HA 4KHMA 1ZAWA 1HBOA 1YJ9S 4K4YA 2DO4A 1HW8A 4C0HA 3OSPA 1HYSA 2AJFE 5I42A 5K8NA 1Q78A 1ZPVA 1HQUA 3CC7S 4RW8A 4F4WA 5KG6A 4J37A 2BANB 4OZ1A 3WZ0A 2N82B 4Q8EA 2UV8G 2FTRA 5KFXA 4LMZA 5F3ZA 1N5TA 2I2YA 2JLFA 3DC2A 4I67A 1A9NB 3MUTP 2EPIA 5AXKA 2LU1A 1BQMB 4C3KA 5IM0A 4FVMA 5B0EA 2EFVA 3SQGB 3MM8A 3OFFA 1UVNA 2DNZA 2I5JA 2W25A 4I64A 1RT3A 1N54B 2AJ1A 3IWNC 2XEXA 1TK0A 4AL5A 2RDIA 5CYMA 3MDFA 1HI8A 1Z4UA 1OWXA 5K14B 3FEXB 1VRTA 3N6MA 2WOMA 5C25A 3FDSA 4HDHA 5D4LA 4F8RA 1GX5A 4KT0C 4F4KA 1O5JA 2HRUA 1SJ4P 2JX2A 2X1GA 2ZOMA 3D1QA 5KFJA 3CWJA 1D8YA 4IRCA 1YJUA 3MAHA 4JI1F 1RISA 2D3ZA 2YWKA 1N33F 3OR2A 4OZ0A 1QAXA 1WTFA 4BBYA 1NKCA 5A8RB 4UQTA 2OPSB 1PILA 1VMBA 1UVIA 5GAGI 4OLPA 3DLKB 3P96A 5KFPA 3UI3A 3OL7A 2WONA 3ENVA 2AYGA 1M5HA 1WG5A 3MM5B 3SV4A 1MSWD 2AQ4A 4FF3A 3HKZD 2RQMA 4IDKB 2MZQA 1Q8IA 3CIZA 1YSJA 2XSFA 3QLHB 2DR8A 2JH3A 1U6FA 3M32B 5EHHA 4RUHA 3MI7X 1U25A 4TY9A 4HI1A 4B9LA 2HHSA 1VQ5S 3NKYA 1D9FA 1VQ8S 4LF7F 3M8QB 5DDQC 3KLFB 3CCWA 2ZH9A 3PJWA 4NXNF 2CDQA 2RU9A 1IKWA 2R8JA 4OIXA 1RTDA 4QWEA 4WCEQ 3RAMA 4OJ1A 1TQLA 2M0GB 5AE2A 3QIDA 3QO9A 2PA8D 2WK4A 3M8RA 3E01B 1N0VC 5HBMA 3Q2TC 2A2DA 2E66A 4NYZA 2DNPA 3HHKA 1U1QA 4XK8C 4WU3A 1Q81T 1NHUA 4IO1A 1HNVB 3HHLB 1RA6A 2E5JA 2QT7A 3FFIB 4ZA1A 1KQKA 4AL6A 3BGLA 4H4KA 5KFOA 1VK3A 3S7RA 1W25A 2MPUA 1FDNA 2FC9A 1QVFR 1S6UA 5A8WB 4LF4F 3ITHA 3T6JA 1UA0A 5BJRA 1ZTWA 4HT5A 3QAEA 4JBCA 4AYBD 4ED2A 3K58A 1GNKA 1GXTA 3PR5B 1YJNS 3G4SS 3IO1A 3GIMA 4I6AA 3DRPA 2IBKA 4Y2AA 1ZOTA 1NJIT 2ASJA 4GKKF 2KXFA 1DJ0A 4ZP9A 4MMOA 4IG3B 1IXKA 4RU9A 4KKOB 3FMWA 1ZBTA 5IS2A 2FLNA 2P9CA 4C0OC 1NO8A 5T14A 3ISND 4H4OB 4ZP7A 5HMYA 2MQQA 3RB3A 4NYPA 1T03A 1HBOB 3I32A 4HKQA 5K8MA 4CZCA 2GJIA 2WSCC 2ZJQQ 1Q7LB 5AJ3F 1N8RT 2QLWA 2RH3A 1HPZA 1PSDA 1RJJA 2YTCA 4RW8B 3CC4S 4K50A 3G96A 2KYXA 2PIIA 4JI5F 2C3PA 4FPRA 1X4EA 4QIFA 4WZMA 3R27A 3KK2A 4QIGA 5HMWA 3W2VA 1FJGF 5KFQA 3MM8B 3B82A 4HH1A 4XDCA 2W9CB 2B56A 1WEYA 2N4CA 4G6VB 3ENQA 1RT3B 3PJXA 5E7OB 5HP1A 2J6TA 4ED5A 3W7BA 3HHLC 1TL4A 2PC6A 4MH8A 3I0SA 2HLTA 3QZ7A 3CUNA 4CT8A 2B6AB 3TAQA 1LXJA 5L1IA 4ECZA 1ZM2A 1JXEA 2HS0A 2IJNA 4ITSA 1F5BA 2WOMB 3M05A 2DO0A 5I4MA 4FS1A 4Q7AA 3C6TA 2ADCA 2JSXA 1H3DA 2LA6A 4FN5A 4ZOSA 2YNFA 1KVJA 2CPIA 2E29A 1WHYA 3R5DA 3R1HA 3ZZUA 1Y5NB 4OI3A 3CDBA 4AFFA 3TQ1A 1Q7YT 4L72B 3MAQA 3OL6A 5J2QB 1LK5A 2R2SA 5IFMA 2OD4A 1QSLA 1BLUA 2WONB 3AH6A 4ZPBA 5I3QA 2IC3A 2DB1A 1FE0A 2YNHA 5IT4A 1SL2A 2EFOA 4IFVB 4M95A 4C8MA 3MUVP 2HWHA 1FRMA 1FKPA 4HVZA 4ES2A 5D78A 1FDAA 4N56A 4C8NA 1S72S 2VG5B 1IKVA 2K8GA 5GAHU 2GHPA 4I68A 4EO6A 3MMBA 3PRBA 4NLOA 4F3MA 2N3OA 2VPXB 3ZZZA 3OUYA 2Q79A 4I7FA 4PG8A 2NXUA 3BQ1A 2I38A 4KSEB 2GQCA 2C3UA 2CYYA 2F7VA 2KKHA 2YKPA 3OXFA 5M2PA 3D1HA 1JLBB 2IA0A 3CJKA 3O44A 4F3OA 2B4UA 2J8AA 2JEFA 5HBMB 1S1TA 3T9ZA 5DS7A 2XLIA 3WDOA 3JSMB 2RQCA 3WC2A 4TU9A 3K2YA 3M30A 3NCRA 4U7UK 3J80Y 5E33A 5LXYA 1VI7A 2DNGA 5KFAA 1U6ZA 2CPYA 4HLBA 1X4AA 2UV8A 4R8UA 4DL5A 2UP1A 2GFFA 2KZZA 2P5VA 4IOAQ 3KLGB 1OQ3A 3G8TA 2E1CA 4O4GB 3G71S 4BCAA 2RS2A 2KRRA 1VQSA 2LXFA 5F0WA 3ITHB 4ZVEA 2BOPA 1HMVA 3I96A 2LECA 2Y1JA 4L6V3 4Y3CA 1UKUA 3HVWA 4J5OA 3KJVA 1WEZA 2RVJA 3T1YF 2QE5A 3OR1B 4C9DA 4Q2MA 2WSFC 2ZFHA 1FXDA 1JLAA 4ED7A 1S0VA 2FIUA 4DV7F 2VG6A 5E41A 4NPOA 3BSOA 2R7TA 4DOZA 3GMGA 4EGLA 4J9NA 4KO0B 4YQWA 1T03B 3NMRA 4ZPWR 5GAEU 4DF4A 2JFDA 3B4MA 2X1BA 2ZNZA 5T7LB 3C46A 1JKHB 4WU2A 1FF2A 1YIJS 4NA1A 4QWBA 1FJEB 3DHXA 2DIVA 3BGUA 4DX8H 3K57A 3GG1A 3QWPA 4DN0A 3DU5A 2VASA 3T1HF 3RBEA 4NCAA 3P49B 3U1MA 2KT5A 1E6VB 2LCWA 5EX3A 3SCKE 4DPOA 4LVOP 3TARA 4DSEA 2VB6A 1JJ2R 2FHMA 3W2WA 2NR0A 2ZDPA 2RQKA 3GG0A 3V2UC 4RUAA 3DU6A 3MFIA 1JLFA 4M63A 3ETOA 2ROPA 3GFXA 2DGOA 4I2QA 2HHHF 2DGVA 4MKBA 3OFEA 2W7OA 4FF2A 1WF2A 5J1NA 3V81B 2KU7A 3T3FA 3IS9A 5KT5A 3MR2A 5H9FJ 3K5MA 4OX7A 4TY8B 2XI3A 3PM9A 2MHNA 2ATLA 4LFCF 1M5PC 2JVOA 2J9DA 1AUDA 2J7WA 3BO4A 5L8RC 2FPHX 4H4KC 3CCQS 5FIIA 1ROFA 2OPRA 1LWEA 3SDEA 4NLGA 1B0PA 1HBUA 1N5SA 2GIRA 1VIOA 5L9NA 1FTCA 1YITS 2DJWA 3BN4A 4KIAA 4MIBA 2HIQA 4OX6A 3VZIA 4UOCA 4JV0A 5KFKA 2HYIB 3M2UA 3MM7A 1HBMA 1XR5A 2XY7A 5J2NB 3QGPA 3I55S 2HHWA 3JSYA 1O8BA 2IMOA 5L38A 1S1VB 2CQ0A 3DOKA 4JI3F 4RNNA 1NEEA 4NLPA 4DL6A 1TVRB 3O5TB 4TN2A 2FLPA 3HJFA 4C11A 1FKPB 3TVZA 3ZZYA 1HBNA 4AXJA 2JC0A 4LJMA 4CIOA 2FHJD 1UETA 3C8YA 3DRSA 2A10A 4DS5A 4DF8A 4DFJA 1G3OA 1TAQA 3DLLQ 1RTIA 3PX0A 4MK7A 3DDKA 2RRBA 5GADU 2DIUA 2P9GA 1C0UB 4G1PA 4RW7A 4I0WA 3T9NA 3G9CA 2CPFA 1BQNB 2E1MC 1GX6A 3LO3A 3MOZA 4OV1A 2X51A 3S1TA 3U7JA 4ID5A 4B9UA 4RUCA 2RRAA 2MHEA 4JI7F 3R5BA 2O66A 4YR3A 4RU2A 1VRUA 3DOLA 3L09A 5DQHA 2ZJPQ 2OKQA 3BN7A 3AQOA 3N6LA 5D4PA 2BDPA 2G0CA 2BE2A 3D0IE 3SZ2A 2HHPA 4C8ZA 1WI6A 3H4DA 3DM2B 4CQ1A 2QYCA 1SJ1A 2FHKA 3K8VA 3PO4A 2HVIA 4DMZA 2B7BB 5JXSA 4CI0B 1HMVB 1RT7A 1PGZA 1J2VA 2D9PA 2FC8A 1M5OC 3C3LA 5A0YB 1I94F 1TP7A 1CG2A 1JB0C 3KLVA 3MR3A 4C3LA 5AXNA 2UUAF 4EBCA 2PEHA 3I87A 2CJAA 3PV8A 5DG7A 2CQ2A 3FZ2A 1HR0F 1Q82T 1U8SA 3M6WA 3SCLE 1R3NA 2IYIA 2LXUA 1IBMF 2ASYA 4F4ZA 1C1CA 2W7AA 3MURP 1X4CA 4Y6IA 2G13A 2R4FA 1C0TB 3JYTB 3FZBA 3M9OB 3FJ2A 4ATNA 1R8AA 4GC6A 2O1PA 3HDSA 2IHR1 5LL6d 4CNYA 4NRUA 5DO2A 4X4OA 1IR0A 3TAMB 3THPA 4DV3F 3W2WB 4KQZA 2UVUA 4NX9A 3ISNC 4OHYA 3TNVA 3RBDA 4TYAA 2OPQA 2UVWA 4YB6A 3LP1B 3V5RA 2ZVSA 4LF5F 1D3WA 1KHVA 2VG7B 2VODA 2FHJA 2N7YA 1X5SA 2HNDA 5DGAA 1A6LA 4BS2A 4LSNA 2OFGX 2QA1A 5EX0A 2VBYA 1U49A 3F73A 4O44A 1R8PA 3F41A 1QE1A 3PW7A 1P6TA 4NMLA 2V4RA 1UEVA 2CQHA 2Q3PA 5DETA 3DLBA 4KFBA 2XMJA 2IBOA 1OS5A 1NJYA 4JI6F 1KR4A 5BR8F 2V4JB 2OH2A 2B3TB 3JSRA 3LQVA 4K4TA 1KQGB 2BJEA 4NLXA 2V8DA 4Q5VA 2N3LA 3HO1A 1GXLA 3DNCA 4B02A 3B78A 4WE1A 3DMJA 4USIA 3BSNA 1HBMB 3T5LA 2RF2B 3BEGB 4NLQA 2Z8QA 3CXCR 2HQ3A 3AQPA 3BGFA 3LF0A 4W92B 2MZJA 4WK3A 1B0VA 1L5UA 3MMCA 4KC5A 3J7YU 1RQ0A 1S97A 1HBNB 1TKTB 3ZZOA 3EUNA 2CJ9A 2L9DA 1KHWA 4HDGA 3GFZA 5CYQB 2GCFA 3KOAA 4G1IA 1H7XA 2MJUA 4UY85 4CT9A 4K5SA 3F44A 5J1PA 2L48A 3MM9A 4V19J 5HN0A 3LP2B 1DTTA 4YMEA 1DFDA 2MKJA 3V4IA 2XMTA 1FXLA 3GV5B 2HHXA 3H98A 4RZRA 1RP5A 2NREA 2J7KA 2ZNYA 4K59A 4NOHA