3ZZSA

Engineered 12-subunit bacillus stearothermophilus trp rna-binding attenuation protein (trap)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
64
Chain Sequence
b'SDFVVIKALEDGVNVIGTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ATTENUATION PROTEIN MTRB
molecule tags Transcription
source organism Geobacillus stearothermophilus
publication title How to Change the Oligomeric State of a Circular Protein Assembly: Switch from 11-Subunit to 12-Subunit Trap Suggests a General Mechanism
pubmed doi rcsb
total genus 15
structure length 64
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 3zzsA00
5EF2A 2EXSA 2ZP8A 5EEYA 1QAWA 1GTFA 4B27A 5EEVA 2ZP9A 3AQDA 3ZTEA 3ZZLA 5EF1A 5EF0A 2ZCZA 1GTNA 2EXTA 3ZZSA 1WAPA 2ZD0A 1UTDA 5EEWA 5EF3A 1C9SA 5EEZA 5EEUA 3ZZQA 5EEXA
chains in the Genus database with same CATH superfamily
3WS6A 1HTYA 1AY1H 3ZL2A 4XTRC 2XPYA 3PQYE 3PABA 4NQXB 5E94B 4BA0A 3CK0H 2V2WA 2WD0A 4GP4B 1F6LL 3S2AA 3MLSL 4M7ZC 4L8CA 1NINA 2P8MB 5C09B 1VGKA 1XZWA 2YC1B 3IMRA 4WY7L 1NICA 1AC0A 3P3SA 4BUHA 1Z2KA 1PZUB 5HYEA 1KCWA 3BKYL 1ZV9A 4J3SA 4GAJH 3CMOH 1RMFH 2X4PA 4PRAA 4AYMC 4GQPH 5KG9A 4QTIH 4F2EA 2AVGA 2CIIA 1IUZA 5HGDA 1UJ3B 4G9FA 2UZPA 2VE6B 2C7UB 3MNVB 4R8WH 1T1XB 4BSVA 2B4CH 2EXWC 3N41F 1F2XK 1CLVA 5KTEH 2XWCA 3OG6B 1AO7D 2DQTH 1A9BA 4XN7A 1KYOK 3P69A 5HPOA 1UG9A 1QX1A 2CDEA 2GABA 3FAXA 3MKKA 2ZG1A 3H9SE 1MCSA 1DQQA 1K5NA 2V9UA 4PLKD 5E5UB 2PABA 3DV4A 2WINA 2WP3T 2AQSA 2BINA 3ILEA 5G5DB 3ARGA 2WTPA 5CBAA 5C70A 2A74C 3HUJB 3QS3A 1BZ7B 4FQPA 5AOIA 1FFOB 1N8OE 2ZYSA 2UX7A 3IFLH 1S9WB 4F5CA 2ZWNA 1HYSC 4LLDA 5J6GB 1OCCB 3ARUA 3C75A 3EGXB 4G1MB 3PFQA 4GT0A 4QCIA 2ZQKA 4O4YL 2QPFA 4NDMA 5DHVH 4HOZA 4B9FA 1OWRM 1PZ2A 1P53A 2BVQA 2D0GA 4IRSD 3BVWA 2C9XA 1PW3A 5A2KH 2WW8A 3ETTA 4NP9A 4WNSA 2HVBA 2DI8A 2Q9OA 2XZCH 4NB7A 4KO7A 3RDTA 5JOEA 4PCKA 3GMNA 3Q1SL 4JUSA 4P9HH 3R7QA 4ZOCA 2VDQL 2I5YL 4HK3N 4N2GA 3MV8D 3I85A 4GEJA 4PBVC 1KIPA 1KCKA 2EEAA 3QHFH 5KBNC 2OL3L 5FYLE 3U2SB 1CGYA 1A7QH 3VD2A 4ZXBB 2LLGA 1U9KA 4R5TA 1L5GA 2VGLM 3VXNB 4G72B 5IFAH 2VXSL 5SWZE 4CW1B 5KJRH 3HHRB 4LRNH 2OM5A 4G7YH 2H32H 4PJGB 2VR7A 4PJ9B 1DVFC 1E2ZA 1S4IA 4IEFA 4OFVA 4P05A 1K5NB 2QLYA 1OGAB 2FB4H 1SJEB 4R96A 3VFMA 4QO1A 1XF2A 4P2QE 3GSQA 3KS0J 2CKBA 4QJ4B 5E5MB 5BO0D 1UB6B 4NZJA 3WEMA 3WIFB 3DX8A 5I24A 4CGTA 2VLJB 2ZJSL 3X2QB 5FECA 3MUZ1 4DP9X 4PI2A 4XBGB 1GRWA 3GUTB 3KVDD 5ID1A 1PDKB 4AL8H 1EVTC 3GYRA 4JK0D 4LQFH 1DUYB 1FZOB 1ZPLA 3VFNB 3CSYB 4KK8D 4DVRL 4G8FB 2FUTA 3BYTA 4JFSA 4U1IB 2Y7LA 4BXVA 2H4EA 2WBJC 4EF3A 5IFAL 2DF3A 4JJ5B 2O6DA 3E8UL 4L3EE 3IFOA 1O0VA 4AV4A 5KVGL 1X4YA 4G7YL 3MU3A 3BT2L 3G6JA 2ZKYA 4JGUA 4AKQA 5FGRA 5A7EA 4IRSB 2FWUA 1OGPA 3CSBA 4X6FA 4GI9A 4F8NA 4L9LC 5GSRB 2N7AA 2DD8H 4YOKA 2P5WE 5B3NA 4XNMA 3G9AB 4I0CC 1L5GB 4P4KA 5L2KB 4OZ4B 4CC0A 1S7RA 2Z92B 4PB9L 3HE7B 1A7OH 2RTTA 3C60A 3OKKA 3TBYA 4WO4A 3VXUE 1KB5B 5AAMA 4BUQA 2Z4TA 5HYJB 3ZTNH 5L7XH 4RESB 5GIRB 4HG4K 4NM8L 2BOCB 2LAAA 4XXDB 2LLNA 3TH2T 4YNYB 1C16B 3K46A 4KMTH 4OZGA 4WDIB 1PZ5A 4G6FB 3QUHA 1UUNA 1XMWA 4ZTPL 4XBGA 2X3AA 5GZND 4MA7H 4J28A 3T4YA 1ROCA 4Y4HB 4JUTA 3GMLA 4HD9A 2AK4E 3TBSB 3MLRL 4R5VA 3TASA 1KLUA 4OM0H 2Z35B 3T3MB 1FRGL 2UUDK 4PTUA 5AAWC 1U8JB 3P4OB 3L13A 1P7KA 3M6DA 2OJ1A 2FTAA 4BHUI 2VDML 3H4FA 1U58A 9CGTA 4YDLB 5E00A 1NLBH 1FIGL 1DCEA 4GMTH 2WQSA 4JJ5A 4KUCD 3X3FH 2BP8B 2WAQA 2VDOB 4Y2DB 5F1OB 1KY6A 3AU1B 3Q43A 1S78D 2IV8A 3V9EA 3X3GH 1R5VB 2XG4A 5E6UB 1XB3A 4JE0A 1O7SA 2BZDA 5DC0A 4TSAH 3MNWA 4KO6A 1HE8A 2N56A 4Q74A 5EEZA 5JHDE 4X8JA 1UM5L 3LNIA 1JS4A 5T3XD 1I9RH 5TDOA 2N7BA 5D7HA 1ADWA 2PXYA 4HF5H 3M7FB 4PGZA 4PTTB 3GS0A 5I6LA 4CSZA 4OLVL 2K0RA 3KLLA 4HUCA 1E9OA 4P2OC 1GYUA 2WYTA 1INEH 2HTKC 5IBUB 1EIBA 1FNSL 4PH8A 3T0BA 1R34A 3D0VB 3GSNB 4HWNA 4XCCL 2IJ0C 1A4JA 5C9JA 3BEVA 1E5BA 3LEXA 5IFJA 1I3GH 4IJ3B 4W6YB 3WIHL 2DICA 1UXMA 1XGYL 1U8LB 3OPUA 4L8SB 1ZA6B 3VFPA 2ENYA 1N26A 3TP4A 5BQ7B 5HVWA 4IBWA 2EDBA 4QRRE 2MNJB 5CJOL 1IT9L 2P8MA 2XQYA 4YHMH 2G9KA 2P3YA 2XPGB 4D7BA 1EGJA 4IOSD 2ZCHL 3OSVA 1MPAL 1A2YA 1FGVL 5C0DB 3CTTA 1CL7L 43C9A 2ZUSA 3B2XA 1PG7H 4Y8AA 2BNQA 3LH9A 4HIXH 1E50A 3NPSB 3ABMB 4N3UA 1NGWA 2PCFB 2XUWA 2AQNA 2AS5M 1GZQB 4OLWH 5B22A 4HGMA 2R51A 4HKZB 2ODHA 3L1EA 5D96C 4Z7QB 1DJHA 3O3DB 4DAGH 4I48A 3GPSA 1YC8A 2FX7H 1DL7L 1Z66A 4ZUTA 5D8JH 3VSTA 1G7QA 1YPZF 1BG9A 3D2UB 5K1VA 4Y19D 2DLTA 4WW1A 4HJEA 1I3GL 3WIHH 5EO9A 3MLVH 5DJCA 3HR6A 1RVFL 4DH2A 3APFA 1EJ6A 2DQGL 2XKSA 5TDPA 1TNMA 2X9XA 2RFXB 4N25A 2X53A 4NUJB 2D31A 4X4YB 1B0RB 5DJZB 1LHZA 4X8CA 1CFVH 1Z32X 3LB6C 3FT4A 2A9CA 5KS9B 1QBLH 3QIBA 1MCOH 2JCCA 5E8PA 3U9UB 3SQBA 1FYTA 1BMWA 5HHOE 1R3HB 4OFYD 4HG4J 2DTMH 3LH8A 1KV3A 4HSQA 4XBEL 1NCCH 1AOZA 1ML0A 2X1QA 3MGOA 1AYRA 3ZE0F 1MRCL 3RX5A 2N4IA 4KXBA 4LL4A 1AS6A 1JWUA 5SV4A 3OPZH 1NCOA 1T2QL 3DJSA 1XD1A 5KOMC 5HHOA 1WFTA 5MENE 3VTMA 3BWUC 1Z9OA 3MBEA 3OX8B 2WN3A 4IRJC 4OAWA 2F1AA 2YKLL 4ZAKC 1OARL 4CRPA 2Z7ZA 3HBZA 4ZO7A 3APMA 2Z7UA 4QJ5B 1ET7A 1OQXA 4AM0Q 1R3IL 2OQJB 4Y5YC 1KTBA 4AWJC 3WFDL 5I8CB 4JFYA 1W8EA 3P02A 4LPXA 2ZWKA 3FT3A 4YLCA 4JPSA 2DYRB 3FO1A 3CBRA 4B53A 2XTJC 3EDFA 4MDRA 1JZEA 1KV7A 3PP4H 4MS8C 3U4BL 5ADPH 1JRHH 2QT6A 3P0YH 4QXUH 3AG2B 4NKOA 3ARTA 3W9DA 5C6WH 3QPQC 2GEEA 5IQ9A 4XBEH 4JG0L 5FYLL 4EPSA 5DEGA 3TYGH 4KMTL 1BJ8A 4XH2B 5BW7C 1T83A 3QT2A 3SD5A 3QVAA 1PZAA 1T22A 4GKNA 2R15A 3OPZL 1SGKA 2E9GA 3QQ4B 2COQA 1LE9A 2HKFH 1SJHB 3DXAA 4F7MB 5DRXB 3RNKB 3ERXA 3NP4A 2CGZA 4HUUB 3HCVB 1IC4L 4N1HB 4JRXB 5T1KB 2DZEA 4KK9C 2DQ6A 2X70B 3O41A 5DGQA 3ZL1A 4F7CB 4TXVB 1MUJA 1ZHBA 3O2WH 1ZVSA 4N5ED 3WNJA 4ZI8A 5ETUB 2Z1KA 1T66D 1I8LC 1S5HB 2ROYA 2VUOA 3O3BA 4LEXL 5IK3B 1M53A 1PZCA 4LSUH 4XNDA 5J0BA 2EADA 3IDNB 1U8NB 3EZ8A 4OV5A 4LSSH 1X5KA 3LHPH 2OYLA 3ZE1E 1TZOA 1IJNA 2R2EB 4TQEL 1AGFA 4P23B 3VWJD 2DIAA 4A6YL 1NMCB 2XWBB 1YNTA 1G94A 4OZGB 3S4SA 5KSAC 1LEGA 2YLKA 3ATFA 2Z1PA 2ZCLL 2V17L 1PZ5B 1JUFA 4JPVH 2DKSA 4G8GA 4WKZA 3E6HB 3F7KA 4G9FB 1XIWD 4YN3A 4GKNB 5HDBF 1UB5B 1W6WA 3C5XA 4D9QE 2OULB 4OR1A 1TFPA 1YLBB 3S36H 3KLHD 3HUJA 3O2WL 3QO1A 2K3TA 2FAUA 3TESA 2AZAA 1MCPH 1AD0A 4JPWL 5GGRY 1RZFH 2Z9TA 3H9YA 1B9KA 3L6FA 3FUHA 2R0KL 4LEXH 4M5YL 2VR8A 4JM2D 3UPRB 1IT9H 5T1JA 5HTSA 5T1KA 4HALA 4UV4L 5FO8B 1C8PA 4OCYL 2VMEA 3RUGF 4W70A 3L4YA 5FKAB 1FPTH 1OAUH 2MNWA 5GISH 1JF5A 5JIHA 5T5NF 3KBHE 3V10A 4QOKD 3RBGA 2W65A 4YHZH 3MDJA 4L29B 4RA3A 2YD6A 4WFGD 5GRVK 3NJNA 1ZLSL 2C3GA 4I85A 5BS0A 2HTLD 4PTTA 4XWGL 4LLMA 1UWGL 2MPAL 3MQIA 5AAMC 4OB5H 3CHPA 4DGWC 4ODXB 3WTSA 5CFAA 3A3YB 1M57B 5LXGH 3B43A 3M8OH 1M7XA 1XZ0B 4QRBA 4X6DA 4NGHL 4FE9A 4XNZB 1GKOA 1BECA 4LOUC 4XRCB 1OGAA 4MWFA 1IAIH 4LCVA 4QHNB 1NA8A 3CZNA 4ZJ9A 1RVFH 3F7QA 2QKSA 2ITEA 3QZPA 1AQMA 2ADJB 2LVCA 3RG1C 1AXIB 1NJ9A 2YAPA 4LIQH 4NRXA 1UYWL 4UMGA 1GXEA 3VXNA 3MCG1 2YWYA 7FABL 5GISL 5DJ8B 2Y69B 3SD2A 2QSCH 1DVXA 1CIDA 1XDTT 1RZJH 1AHMA 1CFVL 3L7FB 3PE9A 5KSBE 4FJYA 3CLFH 4KHTH 1X44A 3COOA 5ICZB 5FFGA 3HI1B 3NIFF 3VI4E 1ICTA 1TCMA 2VDOH 2H2SD 4Y1SA 1U92A 3U7WH 3V0FA 5CS7A 3U0WL 2JLLA 3ZMRA 4J3OD 2CLVB 3G08B 3GSXA 3GZKA 3CQQA 3HLAB 4NDMB 3FSAA 3GI8L 2X4UB 1A6TA 2K9UA 4OCXH 5DZVA 4JGMA 3WU1A 4FYSA 1ZVYA 5INCB 3C60B 4XXWA 2XCMC 4HW6A 3SPVB 1E6JL 4X5XA 5A2AA 1SN2A 3OKLA 4NP4L 3TA4D 3QR2A 1B90A 4N2EA 3RU8L 4JPKL 2QGDA 3U2SA 1A47A 3BVNA 4Q6IA 1DR9A 5I8EB 4Z7VA 4K23L 2F74A 2D31B 4BH8A 5I15H 4R4FH 4JG1H 4L4VA 5D7JC 5EFIA 3MACL 3EOAA 5ALBL 1T1XA 4CU8A 1KCRH 3DJZA 4YDKL 3IN2A 3UBXI 5GHWH 4FXTA 5HJ3B 1GY2A 5C86A 4MXWL 1AKPA 2AK4A 2GTZB 3K8MA 5I1CH 4Y4KB 1OE2A 1U8JA 4WEUD 2XT1B 3SDDD 2O5YH 1A3LH 2MOGA 3MGOB 1MCEA 5BW7A 3H9HB 2VISB 2JKJA 1L9MA 3EDJA 3D05A 1Z7JA 3RDJA 1AR1B 4UIKH 4BQ8A 5B38G 1UT1A 2EABA 4WV1B 5EU5B 4KDWA 4NQEB 3L3OA 4BQ9A 5IBTL 4WGKA 3RU8H 3B9KB 4GINA 4I5BB 2WN2A 3VFSB 2XWXA 4U1LA 2VAAB 1UOVA 1YUKB 5IMMA 2J8UF 2XIIA 2YA2A 2ZCKL 3MRKB 4HS6A 3NFPA 2XJKA 3HMWH 4PV9A 4Y2DA 2IBGA 1NOFA 3MACH 3VSUA 2PKDA 2UV3A 3MYJB 4LMQE 5I18L 4NZDA 1VERA 1FAIH 5KOVC 4LXFA 3L4VA 4U1JA 3OAUL 1SOKA 1ILSA 1E9OB 4Z3EA 1BFOA 3KPRA 2YD1A 1XGRB 1TEGA 3IJEB 4RNRB 2YPVL 1SEBB 3MNMA 1F4AA 1TOXA 2YAHA 4EMZA 3VDAA 3RZCA 1DSFL 2XZQH 2BC4B 4AOFA 5I71C 4PP1D 3UBFA 1JHKH 2O6FA 2WXKA 1T0OA 4OIBA 4WO4C 5CSZA 3TT3L 2EXTA 4Y4KA 5D4HA 4F2MB 2OMUB 3L3JB 3DI3B 1I8KA 1FH5L 4ZMXA 4JPWH 4JAMB 2I69A 3VG0H 1VFAA 3E80A 4BKLA 4DNLA 1W72L 3UJIH 2XNAB 4F33A 2CMRL 1NBCA 4OFQA 2OMTB 4N26A 3OAUH 3BO8B 4UQIM 3NCYP 1RAMA 4F15B 2V2XB 1A1OB 2EO1A 3OAZH 4ERSH 3QFGA 3O3DA 3NFSL 4K71B 5E56A 4YSAA 2PWHA 5CHNA 1MCRA 2GTWA 4L1HA 3BAEL 1WZAA 4FQCL 3RFRA 3WE1A 4XWGH 4Y89A 4DO4A 4KO9A 1FVCA 3L7EB 1FFRA 2LR4A 2ROXA 1CFNB 1QPXA 1I7ZA 3JZ7A 2HKHH 1JN6B 4UV7H 1HKLL 2P4AB 4X8JB 3GMPB 3WFHB 1BJ1H 1T4KA 1OLZA 3WEOA 4UOZA 1NM9A 4MVBD 3B8SA 3WLBB 5D2NB 2WJ7A 1KUMA 3TO4B 3UH8A 4JO4L 4P99A 4QUOA 1MF2H 2PW2A 2FX8H 2Z31C 5TE4L 3RPBA 3GXFA 4ZMPA 3NZUA 3Q8EA 1D9KB 3N9GL 1BQHA 4PS4L 1WBYB 1N2RB 4KY1H 1XF1A 2HFEB 2BWIA 3LN9A 3C12A 3EFDL 1OAYL 1FF5A 1FG9C 1SHWA 2L3BA 3ARBA 2OR7A 3GFUA 5LDUA 1TKWB 1CGVA 5LVEA 3BT0A 5K9KA 4PIBA 4Y4HA 5C6TH 1P7QD 4U6VH 3C2AH 4JBSA 1HE7A 2IMMA 3N0AA 1FVDB 2M26A 1NL0H 4GIOA 3UTTE 3DBXA 4CVZA 5BS0B 4FG6C 3WBDA 3QPKA 1ZSDA 4LGSB 4XCFH 5CFHA 3ARQA 4A7SA 4ODXA 4RVBA 5FYJD 3RIFK 3SBWC 4R2GD 4E41E 3PUUA 2DV6A 4LLWA 1KLFB 2FO4B 1TJIH 3AU1A 2GPZA 4FFZH 2EDTA 2V9RA 1TZIB 3N9GH 4FXGA 5C0RL 2NR6C 3CZGA 2J8OA 3IXTB 1FDLL 4NRXB 4UIMA 3QUKA 4PJ6A 2J8UB 4LVNC 4MZRA 2YGOA 2EXSA 2J56A 2VDNL 3IDJB 4EUPA 4OJFL 4S2SB 1OGAD 3VWJC 4JZOB 5LAXA 4PJGE 3QEUA 2ESVB 2W59A 5EF1A 3MO1B 2WLZA 1XMEB 3B7TA 1TQCB 3TJPA 4K5PA 3RILA 5I2IA 4DUXA 1MDAA 3OJDB 2FD6L 3KJ4B 2WWMC 1ZOXA 4CMMB 4FTVB 1OSYA 2WBJB 2AQRA 3F65A 2BIQA 3RGVB 3B56A 3RWFB 2L7JA 1CGXA 2HLAB 3UACA 3M1CA 4RBPK 5D1QB 3L3KB 4IBTA 4NKMB 5C08D 1AZRA 2G60H 4N2HA 3DX3A 3MLXH 4LASL 1BZ7A 2LT9A 5C0RH 2P7TB 1Q0YL 5TTRA 2WLHA 1NOAA 1XVSA 2J25A 1XX9C 4AJ0A 5KJ7E 5CLTA 2H1PL 1A7BA 1NMBL 4AC2A 3L4CA 5T8IA 2BNRE 4Y1AB 4C4KT 1TZIA 1WFJA 3FQWB 2N3JA 2WXLA 3IXTA 3O2DL 1S7UA 2HN7B 4XOEA 5DURD 3EFOA 1QFHA 4RA0C 4LAQL 5I8KL 3GC3A 4C4UA 4Z1PA 5M95B 4BFIB 3ECVA 4ZSOA 3IS0X 4TNEA 2CK0L 5J7CC 2HJFA 2R2HB 4MAUL 5KYYB 2VN5A 2J88L 4PJAB 4HETA 3MO1A 1E4JA 1NKRA 3S88L 1AGFB 2EVFA 3MRJA 5DD5L 3H9HA 4PG9B 4FRWA 4D0DA 4KK5C 3UAAA 3ULUD 4DGUA 4N6RB 2EH8H 1SJEA 5L8KB 2EIMB 4K5NA 2RH0A 2F2HA 4AENA 4PI0A 4U33A 4L5FE 3EYOA 4P2QD 4YIQB 1CFQB 1G7LA 3DX1A 2YD5A 3OF6D 4ZZFA 3F04A 1SUHA 1Q9LA 2AXFB 4E5XA 2GBVA 4JPQA 1EO8L 4E68A 2VAAA 2Y6SD 4GFTB 3HMXA 1B88A 3R4DA 3UPRA 1R19A 2DQIH 1AO7A 1UD2A 3MPCA 1IC0A 5JHLH 3DHMA 1M1XA 1Z0MA 1DVFA 1PJWA 4U6XB 3UZVB 3B6SB 1G7HB 1GR7A 4XNXH 3LB6D 4YWGL 2VAJA 1ZK9A 4HGWA 2BSED 1UXLA 1OV8A 3HKZA 1OAKH 1A22B 4JDEB 4L29A 2R0LL 4UV7L 2XZZA 2HB0A 2X9ZA 2FNBA 4G42B 1NFKA 1BF5A 5CD5D 2DKMA 1KCSH 4IBZA 3CVHB 4XT1C 3PWJB 1YEEH 5EF2A 4EUPG 3MUGB 1MWOA 2P5WD 4P23A 5I6OA 1KT2A 2AEQH 2PR4H 4FNTA 3B5HA 4LARL 3PP4L 1I53A 3RGHA 1LD9A 2CRMA 4N3TA 4ZDHB 4LK4A 4U1KB 3GM8A 1I7UA 4HCRA 5E9DE 3HI1A 4RRPG 1OB1B 4R7NA 2ZOUA 3KGUA 4JG0H 5FYLH 1J1PH 1LVEA 4WUKH 1U8CA 1PZSA 5ERWB 4BYHA 4GBXA 1E7UA 3QO1B 1TSHA 1ZCRA 4XCNA 1FSKB 4QHPA 1JXDA 1LK2B 4K0OA 4YBQD 5GGQH 4OIIL 3VGAB 3HLAA 5K9JL 3SYOA 2QVIA 4HMDA 3TVMC 1T5XA 2PMZA 1OSPL 5C0JB 1LEKA 1P4UA 4I7ZC 3EBGA 5L2KE 5IB1A 1P4LB 3BPOC 4YBLB 1D7DA 2VN4A 3UYRH 3GGWB 3WAKA 2V7NB 1IQWH 2XFGB 4NPKA 3S37H 5I73C 1ZY9A 3QGVA 1L9OA 2UWEE 2WXIA 3W38A 1SXSA 4HA1A 4W9CC 4FKHA 3GSWA 5A16B 3MRBA 4AYFA 3QA3B 4YFDB 2YSSB 2JKTM 3HBPA 1T04A 1BFTA 3FZUD 1A6PA 4JDVB 1BQHB 4NQDD 4AITA 5IQMA 4YFLI 4GQRA 5JLZA 2BOBB 5GGQL 3NOIA 5E4IA 1OB1A 4R7NB 2ITDA 1JGDB 2O61B 3NIGB 2VUKA 4JM0A 3CLWA 1BXUA 2IPTL 2VRKA 1J7VR 3QI9B 3BE1H 3O9WB 5HHXH 2OSXA 5F1SA 1MCBA 4UQ2B 2UZIH 4ANUA 1DUYA 5HJ3A 1Q4NX 1RZFL 3MLXL 3LS5L 5IV2B 2CJUL 3AABA 1LO4L 2QTEA 1MFAL 1TYEB 3DV6A 1J10A 3FQUA 4Z7OE 9PCYA 1E28B 4RMUA 3RGBA 5E0QA 3QUYC 3WTWA 2DH2A 1U91A 3DBSA 4G70B 5C0DA 5MEQB 1WWWX 3D7PA 4RX4D 1DQDH 3N40F 1S9KC 5I1EH 4KHXH 4TVPL 4PUBL 1BBJA 5CD3B 2JI3A 4RSVA 3D5OF 4LCIL 4ZX5A 1QHPA 4PY8I 4HQQL 3D0AA 4HFWB 5JPNA 3QA3A 4U4BA 3LRSA 4X98B 5AAWA 4PS3A 4LKCA 4X5XB 4AGPA 4IOSA 1KB5A 3OC8A 4WHTA 5HYJA 1XXDC 4UTBH 1QKZL 3HZYA 4PJ8A 3VQ1C 3GRGA 5MEOB 4Z76A 2K4AA 2VXUH 2Y9RT 2PP9A 3SDAB 3WXVL 3SE8L 1P1VA 4X6DB 2F8OA 4JKMA 4P4RB 3WNLA 3GMRA 2NNCA 5DD5H 1A3RH 5DEZA 2J6EH 1CDGA 2HX7A 3IJYA 4DFIA 1A4KB 1UYWH 4P2RA 3KCWA 3NIGF 5F8QC 3DSFH 4RFOL 2LE9A 1I1YB 2P26A 2BIMA 3S6CA 4E9SA 1FV1B 4KK6C 5C07A 1MG3C 2ZF8A 3NSYA 4P46D 1BCIA 5PAZA 4JO8A 2BP8A 3E0GA 3WHE0 3P3UA 4XPHL 1TTCA 2VLME 1NBQA 1HXYA 2P1YA 5FUCC 1A6UH 4FGMA 3WFBH 4X5LA 5IKCA 3ARFB 3NRFA 4JFEA 2VXVH 4O9HL 5D4JA 3U7WL 1SUJA 3UO1H 5K9OB 1K6QL 2XTSA 3QI9C 4BFGA 5KVEL 4B9GA 1EEZA 4OZIE 2XWJB 4X80L 3JVGC 3CXHK 4PLJD 4XMXA 3TV3L 1O9WA 3AAZA 2FWOB 2O5ZH 5E8EA 3MXWL 3MOBL 3U7YH 3MXVL 3U1QA 3TH3T 3MGTB 2R0LH 1KCVL 2H6OA 5LQBL 1ASPA 1KCSL 2IALB 4OSUL 5CLYA 3OC5A 3VB8A 3BZFB 1RK1B 3JXAA 5IQNA 1IKNC 5DVOA 1JWMA 3ZE1F 1QSFD 3W9DB 1U4EA 2H47C 3WELA 4X4ME 2NW2B 1N5AA 3TIDB 1F02I 4UQ3A 4BH8B 4CC4C 3ZLQC 4A2EA 3MREB 4UUJA 4AMKH 3MRQA 1QACA 3MCLL 4OZGF 3LIZH 5D7LE 1YEFL 3ZKMD 1VENA 4TPRH 4PG2A 5ACZB 3DLQR 2ZT9C 4TKWA 1AZUA 2K8QA 4LPWA 3MXWH 5FS5A 3SGEI 5L4FA 2R2BB 4GRWB 1HHIA 2ICWA 5EUOB 4PLNC 4JQVA 1EVUA 2FYVA 5K9QG 3VMOA 2DM7A 2BNUB 4LLWB 1L9TA 5JMOC 4FNLL 4L4VD 3FJTA 3F64A 1UKQA 2CHNA 3MRPA 3D09A 2BHUA 3RAJL 4P5MB 5SWQA 1B2YA 1MFEL 2J57A 1RH8A 3O4LE 15C8H 1ZXKA 3IWVA 3OMIB 1O7DC 4YXKH 5E2WH 1PU0A 5K9QI 4NLAA 3LZOA 1NGYB 4APQD 5DD0H 1FAIL 2I26N 2WNKA 3ZKXB 1E40A 4FXGB 4X5RA 1T5WA 4Z95L 2J1WA 3MLUH 1FUNA 2B5IC 4DQAA 2ZX7A 4AZ8B 1AQ8A 4CJ0A 1WE5A 3W11C 4OZIB 5D55A 5DJZA 2IPUG 1D5ZB 2FHCA 1L7IL 2ESVD 4TSBL 4NSKA 2E59A 4K8RH 3BE1L 1P2CB 5EU7C 2R23B 3NMEA 4MNQA 4NKIL 3DX9A 1YYLL 5DUPL 1NPNA 4IYKA 4ABUA 5ITFA 3VD0A 5J4MA 3UTQB 4JAMA 5B38B 5D7EA 2XA3A 4KGJA 3WS3A 1PZDA 3A24A 4NC1E 4GW4B 1M9WA 4PBDA 1PNDA 3Q05A 3VQLA 1ETJA 1BZQK 1DQDL 3VFWB 1E27B 2FECI 1IC5L 3TPUA 3BD3A 4GKOA 3TNNB 5FLVA 1EAJA 4RZCA 3QYCA 5ISZA 3HHMA 3QXVA 1OF2A 5B39G 1A1OA 4FXKB 3T77B 4FEMA 4Y4FA 1Y0LB 3W0WB 2QADD 5JTWA 1U8PA 3ECUA 2G75A 3FT3B 5T1KD 4MA8H 2HX9A 2JB6B 4NWTH 3UGUA 2R69A 1FZKA 3N04A 5B8CC 3DURA 3I2CH 4NKIH 1ZS8B 2PUQT 4N0UA 2WHVA 2VN3A 2WYIA 1NFDE 3A4AA 1MAKA 1I8LA 4AIZB 2Y7QB 3NCYS 4ENZA 4WWID 3GJFA 3U46B 3SJVD 5DHYA 3S3BB 4HCGA 4R7DA 5HBBA 2JE8A 3MUHL 3ESMA 1BX2B 1TJXA 4PRPE 2YS4A 3RWJB 2ZAHA 2UY7B 2W5PA 2H9GB 3QXUA 4PLJC 5CEYA 3GSUB 4YXHL 5HHPA 3MJ6A 5JUEH 4FP8H 3V7AG 1O9VA 5CZXD 4P2QB 2KLRA 1TVHB 1EZLA 2P52A 1KEGH 1DFXA 3MLSH 5CP7A 2CO7B 6PAZA 2V2WB 2IBBA 2I24N 5DF0A 4FCAA 4FFVD 3RJOA 4DZBA 2E74C 4ZD3H 3LMJL 5T1DH 3DVNA 2WZ0A 1XB6A 5IW1A 2CGRH 5EPMB 4ES8A 3HZ3A 4GPVA 4NO0D 2H0EA 1YMMD 2J8HA 4GAJL 4F7KA 5HHNB 2V5TA 2GJ6A 5FAAA 5J11B 4CAGA 1ZANL 5JQ6L 4HJ0D 1JZHA 2FJHB 1S7WB 1CDYA 1LO2L 1TITA 4LU5L 2MJWA 1PX8A 2CG9X 2ZZUT 3GJEB 4HLZH 3T1FA 4G42A 3BGFC 4B27A 2Q7NA 3D2TA 3HLKA 5KANG 5BNXD 3NGBB 4PJBA 1KPRB 2DRUA 1PAMA 1Z3GH 3EOAB 5BZZA 3BUBA 4GKSB 5TDPB 3VG9B 1ZIAA 1MLCA 4KZ0A 2MSPA 3MCLH 5D7SL 1HEZB 3DV4B 1LL1A 3QNZA 1H3PL 2BNRA 2R59A 3RWDA 3VXTA 3VGFA 5KUKA 3GSOB 2BSRB 3VXMD 1UOKA 3L3GB 2G3MA 5I17B 1EZSA 1WD9A 2X88A 2CO7A 3L45A 1H6EA 2QSVA 3LCYA 4U3SB 4L3ED 4PWFA 4Y2NA 2AXFA 1E0OB 4PHZA 1INQB 5EIIG 3QIWA 3QQ9D 1AANA 1I9EA 1D6EB 3ZR5A 3B3BA 4ZUVA 3S8WA 5E95B 2NR6A 4KI5C 3QWRA 1WT5A 4Q58C 1UADC 1MFEH 4RETB 1O6SA 15C8L 2QKIB 1OM3H 4E9TA 4PB0L 2G5RA 5DS8B 4Y5YB 3QEQD 3N1FC 1Y18A 2WYHA 2PPDA 4ISVA 1X9UA 2CHZA 4NUMA 3O2DH 5I8KH 3QJHB 2KL6A 1EXUA 5IJVB 4NBZB 3VXRA 4P3WA 1KPRA 4Y19E 4TSCH 5D4IA 3F7RA 2G2NA 1HHHB 4R4ND 2A4CA 2VLKA 2WJ5A 3O3AA 1WT5C 5JPMB 1VADB 4CA4A 3ZUNC 1NEUA 2NW3A 4X0KB 4ABQA 1PBYA 2Z35A 4UTBA 1Q8MA 2X10A 1HCYA 4R96B 3VFMB 2XWDA 3P40A 3P4OA 1DVQA 2VW6A 4PG9A 1KY7A 2HWZL 2O72A 5TQ0L 3MBWA 4I18A 4HFUL 2CU9A 1E6OH 3HKFA 4MB3A 1CN4A 1U3YA 3RJDA 2I60H 4CVXA 2BW5A 1JYNA 2H26B 5SWSE 1FZOA 3VFNA 3QG7H 3ZRCC 1SY6A 3OZKA 1AJ7L 4Y4KD 2NY1D 2BPBA 5LBGA 3GIVB 3SKJH 1KYAA 5TGBA 1OTTD 3QXWA 4TTDC 3VYPA 5GSVB 3BH9A 4JFPA 4NNYA 1G43A 2BX5A 5F96H 3FOMB 3QRGL 3FQ1A 2WLLA 2TAAA 4POZC 4JQXA 1SM3H 3SDAA 4LESA 2X6CA 2JMRA 1ITBB 1DJSA 1UZ8A 3STZB 3LKSB 4JQVC 2VR6A 3LKNB 1QTSA 5FA4A 5LNGA 5TDNB 4R0LA 1U8QB 4EZKA 3ULVC 3ARYA 3DVIA 1B0WA 5T3ZH 5B1BB 1X5FA 4BSJA 1ZS2A 1G0YR 4RMTA 3GT6A 4JHAL 4PG2C 5ITBH 2FWLB 4HAKA 1F4HA 3F8UB 3L9BA 3I3BA 5E1HB 3NCFB 5DI8B 5T33L 1RUAL 2FT8A 2NQ3A 3TA3B 5B38A 4P49A 3FYIB 2VRAA 3PQYA 2E8ZA 1DSYA 4PGEA 3IJYB 3L2NA 3IJSA 2LQRA 1FP5A 2CKBB 3JZYA 4OCRL 4QRTB 4WNQA 2ORBL 2HRGA 4ODVH 4IMKC 1BVNP 1KN2L 1LP9F 1WAAF 1KEGL 5IV2A 5CJBA 1NLBL 3X3FL 4KKLD 2ZYHA 3HE7D 1IFHH 3PGFH 2P28B 5HPMA 1QO3A 1TFHA 4J7RA 3BW9A 5F8RC 5FHAH 4UAOB 3OHXB 4OV6F 3R0MA 2X89D 1AC6A 2IALA 2V6HA 4K3HA 5E2UH 4C56B 3U6XS 3KYKH 2J6WA 2PYED 3SO3B 5K9OA 1MXGA 1PY0A 4HT1L 5D7JB 4OVVA 3EDDA 4XNQB 2EP6A 3ECWA 3PXLA 3V0VB 3AAZB 5D2NC 5KYXA 2F7IA 1NCNA 3CZFB 5DK0B 1MY5A 3L1FA 1C5DB 4ZUSA 1W91A 3MRNB 2CLRA 2HFFA 2ORBH 2NQDA 4QNPF 3CSPA 5H4YA 4DOHE 4MJIA 5BV7H 5GIRA 4FNUA 4V11A 5DQJB 3HVNA 1U42A 5D70H 1TZAA 5CJQL 5HDQL 2BS71 4YGVB 4YDNA 2YD7A 5GRYA 2EDJA 1I1YA 1CU4H 2OMTA 2FBOJ 3VSQA 4S1RL 4OLXL 4BIKA 4Z3IA 4QRPE 5FM5O 4Q9QH 3VUAA 4HT1H 1T0PB 4J1UA 5BOJA 2PPAA 2DLFH 3QHZL 4RGOL 4XPBH 4TQEH 5D1XA 2P46B 4MAZA 4I3RH 1IKFH 4MNHA 3S5LA 3DV6B 4AKPA 4X8GA 3L95A 2FZ3A 2H2PD 4X4KA 2VM4A 2K3HA 4KRPC 3H6AA 4BD4A 5IWLC 1OM3L 4DAGL 2EZ0D 3BJLA 1S7WA 1K8DA 3ETBJ 3HE6C 3P9MA 1VIWA 5KSBB 1CDCA 1V3KA 2FWOA 5E8EB 2XFXB 3OGOE 4WJ5A 5EZJB 1AQDB 4I48B 1AE6H 1NFIB 4KKCD 2PO6A 5HI5D 2G0KA 3LH2L 5GGVL 4FS0A 1OO2A 3VH8A 5AD0A 5I1HH 4BZ1H 2WNWA 1CFTA 35C8H 5CZVL 3RB5A 3O0RH 5L0QC 4YR6B 2WIIA 3APCA 3CFUA 4HXAH 4OLXH 4WHTB 4Q9QL 1WFMA 3BUQA 3AG1B 3FB7B 1VPOL 2NQCA 2R1WB 2VR3A 3UG5A 5G4OA 1Z9SA 2GFBA 1FVEA 2DLFL 3BESR 3LPFA 3DJ9A 3QHZH 1UD5A 2E76C 4M3HA 3VGAC 2OMZB 5T3ZE 1YDPA 2DS4A 2I9LA 5DSCA 5I17A 3WV0A 1E8ZA 1FZJB 3AUWB 4M02A 3S98A 2X4QB 3VFTB 3L5XH 2P44B 5D6CB 2DQMA 4Y0GA 4ONGL 3FW6A 1KCUH 4W9IC 5BJTA 3DTXB 2JKXA 2IANA 5CINL 4Z7QF 3G5YA 1VFMA 5J1AB 4NM4H 3WY1A 3LIZA 3OXRA 4QHMB 2FZ3B 3OB8A 2AW2A 1IAKA 3BIKB 3WLWC 4YZFE 4HH9A 4AGOA 2LW3A 2F1EA 4FYQA 4OGQC 5F96L 1LEIB 1FGVH 2LU7A 4WGWB 1LWHA 1C9SA 1BVLB 1YEJH 2QDWA 1YQVL 5KBLA 3MLWL 4GAAA 4APXA 2NX5A 4NFBA 4FQQA 1OF2B 4L1SA 4OVUA 3VWKD 3ABLB 2CUAA 4LPTA 4TRPH 3BPNB 1EH9A 4KV5F 1G7QB 2IQ9H 4KKQA 4R8WL 3GB7A 3MUGA 4GXUN 3HRZB 3TYGL 3RNQB 3II2A 4JHBA 1EJ8A 3KPPA 5BOPA 2OZNA 4DW2H 3QCTL 1JZ4A 1H3WM 4JRXE 5IJKA 4XH2A 4R26H 4NNXA 4C54A 3CXFA 5J11C 5TFSH 1SXNA 3MJGX 2I07B 3RVUC 2I9TA 3HPLB 4MNQD 1UZGA 4NNPH 4OLZH 4GBXB 5GGTL 4KTEL 4NC1C 1PY9A 4NZUL 2WGXA 1YEJL 5GRZA 1BM3H 4G6AD 3U4EB 4CU7A 1J88A 4QRUB 4NBXB 2NNFA 2ZKHL 3IFLL 4H7VA 4KXDA 3NVQA 3ULUE 3QXAB 2ZUQC 3DNKA 1Y6KR 1KFAH 5E2VL 5EU7E 2XG5A 2YMTA 1L9NA 3H7BA 3V2AR 3EIFA 3PNRB 4ODHH 3ZKMC 4ATWA 4J3OC 2Z7YA 2HAZA 4GBXD 4ZFFA 1BVLA 5BMFH 1ASOA 4JQIA 3LKSA 5CEZE 5JW3L 4G7QB 1G7PB 4MWFB 2B5IB 4QHNA 3OGCA 1Z9LA 4PMFA 1WZ1L 1L0QA 3EYFA 2I5YH 4A6YH 3HPJA 3UTSB 2BSTA 4PP1C 1XF4B 3GTVA 2DJMA 3QZLA 3KGTA 5E99L 5DJ2A 4OJDH 3RTQC 4GUPB 4ZMWA 3SODB 5F70A 3MRJB 1JZDC 3TA3A 2VXSH 4AQEB 1ES0B 3QG6B 3PQYB 4KRNA 2MWCA 1R47A 4AIZA 3UROR 3JQOB 2D3VA 4HUXA 5IM7B 4HS3B 3IU3B 2B59A 1AXTL 4MD0B 1REIA 4MKMA 1CLZH 5HDQH 2J4WH 5A3ID 2Y7SA 4OI8A 1RK0B 4ICWA 4TQPA 2IWFA 1BFVH 3BEWA 1W8NA 3STLB 1P1ZB 4OZFA 1S6NA 5I1LA 3GHBH 3U4AA 4Z3FA 3IM1A 1HEHC 2IFFL 1ORSB 4LIQE 4J3XA 4NSKB 4JFXA 4ZFGL 2KQNA 1OAUL 2EO9A 4JFDA 1L6PA 4DKEL 2CR3A 1I7RB 4P46C 2HKFL 2DQHL 5D5MF 4Q8BA 1CFBA 5IOPA 3SPVA 5JIQA 3QZOA 4G6MH 1OTUC 1PTZA 4HWEL 1SN5A 3RL2B 4BH7A 4M03A 1RUKH 4OD2B 1IX2A 1K3ZA 2BDNL 4GSQA 5KBKA 5L6YH 3TT3H 5AQ0A 1A4BA 2AV1B 1OSZA 1XT5A 1PEWA 2WNXA 4OBRA 3A4DA 1NBZB 3H85A 4HU2A 2H0JA 4GUCA 4Y9EA 2N7SA 4Z78A 2V33A 4AT6B 1FL3B 1BZEA 3IDNA 4LSRL 3KPNA 2WOBA 3VWKB 3ENEA 3H54A 5C6PB 2KYIA 3FCTA 4QO1B 3ZDZF 1VPOH 3II1A 3KXFA 2GI0A 3P3TA 4JQIL 2XI9A 3CFJA 3U2IA 2B3RA 1KBVA 3QDMA 2EE3A 1TTAA 3MI6A 1CYWA 3O8XD 1FFOA 5DJ8A 1S9WA 1X7QB 1QZNA 4HWEH 2QSTA 3UTPD 2OCCB 3BWUF 2C9SA 4OCLC 4LVOC 3ZKSD 1FV1A 4UOW1 1XH2A 3D9AL 4OM0L 1HH9B 2IFGA 2OJZH 4YO0B 3QDGB 5ILTH 2CDGA 1EFXB 3CN3A 4M7LH 1OE1A 5KZCB 1BIIA 4NCC1 5T1LA 1ITCA 4YC2C 4DWHA 5K93A 1I3VA 4ZUVB 2EUXA 5JDJA 4NN5B 1P5VB 3QWRD 4A7GA 4EKXA 4Y9FA 5ANME 5KVFH 4MYWB 1W16A 1MELA 2WVUA 1MH5B 1GZHC 4QXVA 5A2BA 1QQDA 3MYZA 2Z92A 4NQDE 4M48L 1EHLL 2WO2B 1QVOA 3FTUA 2BFVL 3KG5A 4MB5A 3CFIC 4DQOH 2WLLB 1SNRA 2GYSA 4E9XA 1M56B 1QABA 4XPAL 5IJVA 3Q3GB 4OKDA 5D2LA 2CCWA 3SBWA 4HMCA 1FZJA 3BJ91 3GBNL 3IAPA 2VLKD 4MASA 1OHZA 2NZ1A 1IGTA 3IFNL 5FV2A 4X6EB 4M62L 1ORQA 3A4FA 1B0GA 1IAIL 3ARZA 4KNUA 2EE0A 3MSPA 4UDTB 5KS9F 3S5LG 4LOVA 4CGUB 3QYMA 5DJAB 4LVNB 3NRQA 4JGNA 1BM3L 1VFBA 2VABB 3BKYH 1RZ8B 4RQQB 3CMOL 2BNRB 3UBXG 4JMXA 3DVFA 1YMHB 1JYWA 5FOBA 4WHCA 3VI4B 1T4WA 3BQUA 4IRSA 1E65A 3HE6A 3WGUB 2WBXA 3H2WA 5BXFB 1SY6L 4NIKB 3AXLA 2CQVA 3GRWL 5TGBB 1Y1DA 5EZLA 4LCWE 4FQJL 5CEZL 4W93A 5J12B 2D9QB 4PV9B 3TF7C 3LEYL 3VD7A 3UERA 4ZXBA 1WZ1H 3QDJD 1G7IA 3EYUL 2BNRD 4D8PA 4OT1H 4DKFH 4HLJA 4Z7OB 1SMDA 3MA7A 1JGEB 3GSRB 5D8JL 1JFHA 2EXYD 1XH0A 3B4NA 4WJKB 1FLTX 2AXJA 4YK4C 4UILH 5I76B 2KDGA 3ME0A 1L6XA 3U6XA 1J8HD 1CF1A 4JFTA 3T4YB 2YXMA 3GHEH 3VCLA 5GGVY 1L0YA 1KB9J 2ZCZA 3QZWG 4L0PB 1UVQB 1U4FA 3PNWB 4MZ2A 3BIBX 2VLKB 2ZSWA 3S48A 5MEPA 3HC0A 1NMBH 2CHDA 1IL1A 4H8UA 3CBJB 4X0KA 5IW3A 1FO0L 4Y4KC 4LLVA 4N2KA 4XB3A 3LKRB 2KZWA 1N59B 1AGBA 1KXHA 2XG5B 3HA0A 1OP5H 1MCQA 2NX5E 3Q13A 4P59H 3SKOB 2ENQA 5ENWB 4ZBJA 3X1EA 3M1BA 2VR5A 3RQ3A 5TK4A 1QLRA 2J5WA 3KAAA 2F6AA 3L5HA 3EH5B 3OVUB 4CC4A 1I1RA 3V8OA 4PJCF 3VFWA 4FLSA 3TPUB 3VB9A 3W81A 4ZUTB 3SKJL 2IG2L 4N2NA 5CN3A 2BWDA 1EANA 3BDYL 4ABWA 3BXNB 4TUOA 4XMKH 4HUNB 4X5QA 1RZJC 3GBLA 1HKLH 3CC5A 5GRJL 2MQ3A 2ZX5A 2XLLA 1CPUA 1J0KA 1I7TA 4HWZA 3K6SB 2NY4C 3CZUB 3ME0B 5JYLA 3LRLA 1Z9SB 2Y2TA 2GFBB 2NY7H 3MJ8A 3L3DB 4WWOA 5BO1L 3ZQWA 2QPUA 3KPTA 4XOCA 3B3IB 1ZS8A 2F5AH 2YD2A 5F1IA 5D7IE 3GBMH 1TVDA 5D2NA 5TE4H 3CH8A 1ZA6A 4G8AC 1NCBL 1HS6A 5IHZB 3IGLA 5GZNA 4PJGA 4W4OC 4EXKA 1UC6A 1RP9A 1HILB 2DM4A 3LKRA 3I3EA 3P3RA 3GMMB 5T3XH 4N0UE 3CZJA 4J8RB 4DP7X 2O6CA 4OFPA 3ML8A 4N0YL 4YBLC 3MR9B 5EBLA 3DMMB 5E00B 3GSUA 1IMHC 1IGCL 2WP3O 2X6AA 2YPLA 4KJYA 2O26U 3LSOB 2ERJC 2APVA 1K3IA 4NQCE 5IESL 1FA4A 2NY6B 1S78C 4PJEA 3EJYC 5BJTB 3ILDA 2E75C 4Y4HC 2NRDA 2ZNXA 4W81A 1EDQA 5AB1A 3QUZB 3D25A 1VRSA 1S2EA 4LSUL 3TBWA 4S1QL 3OKMB 1KJ3H 3HNSH 4NJ9H 5CD5C 3OQRA 1ZLUH 3UAFA 1KN4H 3TVMA 1OPOA 2ZNWA 3NIGE 5GSRA 1KWKA 1KB5H 4YDVA 5HYSG 2ENJA 4OJFH 4FQCH 3I6LD 2CA3A 4YHKH 4OY9A 1CK0H 1WAAA 3JTBA 1WS8A 4LLUB 2GB2A 3D3VA 4MA3A 5K9JH 3X1NA 3F85A 3FFCD 4S0SD 2QLVB 5CWSB 4MD5B 5E7BA 5IESH 3ZXAC 3WIIL 5IGXL 4FD0A 4UWQB 1YY8A 4FNQA 4KQ4L 3U25A 3UTOA 1DO5A 1PNCA 3S36L 4K3JH 3PAUA 5C0BE 2UVFA 4XC3H 2MQGA 1E4KA 3KGRA 3UO8B 2QV2A 1NDTA 2UXTA 4KAQL 1V54B 3N1PC 1HKFA 3WG7B 1JPEA 4PVNA 4D8OA 1QSEE 1I1AD 2BSDA 3D4ZA 3I6GB 2BMKB 2BNQD 4NRYA 4QWWD 1G7HA 3WCYA 3G7TA 3O4LA 1OTSD 4HKXB 3WMPA 4URKA 3UJJL 4G43B 4DK6A 3C5ZB 4XCEB 4WWNA 1A6WL 2VL5A 1QVOB 3RIAK 1U8PB 2KI6A 3GJFH 3CHQA 1OT1A 5D7IB 1EMTH 2WXPA 2DMBA 4HUWB 3TBVA 1DVSA 2Q3AA 2P24A 3JTTB 3QUMB 5CMAA 4G5AA 2XV3A 4S1SH 2V2TA 4MCYA 1U6AH 3P30L 2D8KA 5AW5B 4G8GB 4MQXC 5JHBA 2P42B 1GL4B 5JZ7C 1KXQA 4NT6A 2YXWA 2AMGA 4UM9D 5AW2B 3QIWC 3W2DL 1J0IA 3ESVF 1Y6NR 4LHUG 2J1YA 1DQLH 3FQ4A 4MBOA 3Q6FA 1XH3A 3GS7A 3GKWH 3HFFA 3A6BH 3UIYA 1DJIA 2PXYC 2VJXA 3IPFA 3REWB 4M1GH 1EXHA 2AFNA 3GWJA 5DZPA 4CMMA 3L5IA 3MNZA 3U7AA 5CBAB 1J87A 2A6IB 2YEQA 4WU7B 1GJIA 3S35H 3T1WA 1JGLL 1SYSA 5HYIA 3MA9H 3OXSA 4S1SL 1ORSA 4FL4C 3C6SA 1TO5A 2QDVA 4YGAB 4FXGC 5JHLL 3SGKC 1MJ8H 2VLMD 3GDBA 1SLVA 3DGGB 1KGXA 1KGUA 2IIJA 2XIDA 4PJEF 2R2EA 5AVWB 4E9QA 3KEHA 5GGTA 2XN2A 2V3FA 3DGCR 3F7YA 1D5BB 4ZMOA 1PIFA 1IAOA 4XVJH 3W56A 5EO0B 2VR4A 3KJ4C 3VFGL 4KVPA 5HYJD 3QRLA 4LCCC 4WKZB 5E8DH 4EXPX 4O2FA 4EQ2A 3BUIA 3FU7B 2NY7L 3HI5H 4IU2B 1Z9MA 5HGDB 1GCYA 3PWVB 4IMLA 3GXMA 1A8ZA 1DN0A 4KPHH 5HGGS 1J8HA 3NTCL 1CLOH 2YPVA 1T0MA 1IEAB 1A7PH 1PIGA 1LP9E 2GITB 5C08E 3FCTB 1DJWA 1AQKL 3FSWA 2J88H 4JKPL 4PR5B 3THMH 2X89A 5T1MA 4LCCA 4NFCA 1P5UC 4XMWA 1HX0A 4KROC 3EJRA 5I1LB 2X70A 3O41B 1IM3A 2OSLB 3KLAA 3HPLA 1YN7B 1BBJB 5CD3A 5I8OL 4NZUH 3SE4A 4KK8C 3UAJA 4OSUH 3UC2A 1S7XB 3MV7D 3WEXB 2CH8A 4YHLH 5IEKA 4ZTOH 5E70A 3N43F 2G4GA 1LEKB 1DVUA 2YMXH 4MYPA 4B3VA 2TSAA 4L4TA 4AYEC 3PQYD 3LPWA 3ZN6A 2ZXWB 5FYJH 1I7TB 2RR3A 3DIVA 4WLCA 2VZVA 1UCTA 3T2OA 1J5DA 2CPCA 1WPCA 3EXJA 4KTDL 2DMKA 4ZFFB 4XVSH 4JJHA 2KS0A 2NT0A 3IRPX 4A37A 5EORL 1KJVB 5CGYD 3CXHJ 3FUJA 3EJJX 4O2EB 1UB5A 2Y0SA 3MJ9A 3SEPA 5DR5L 2R56L 3N3EA 1KXVC 2H8PA 2CLZA 2VDLH 1K4DA 4LHUA 1AZNA 5JLZB 4L8SA 4YJZL 2CCLA 5BQ7A 2WIMA 4PR5A 4GXVL 4A1RA 1JPTL 3IN0A 5MERB 2XXMB 3ZKND 5G2NA 1F4WH 1EEYA 1RPUA 3IU4L 3LVTA 4MLIA 5GQBA 1VFBB 2VABA 3QIBD 3LSOA 1KJ2H 1GKEA 3I9AA 4E0RA 4G5ZH 3D0LA 3NRPA 1GGTA 2CALA 4YHPA 2DIEA 4Z0XA 4ZTEA 5I30H 3P54A 3V4VA 4A67A 2VCOA 4FQIL 3WEXA 1BBDL 4WQOA 1FCCA 2Y36H 3CDFA 4ODWB 4LLDB 3REVB 1E4KC 3J27A 1J18A 3LOWA 2CUHA 2WNGA 3QDGA 3Q5YA 4NHCH 1QBML 1SJMA 1Q1JH 1AZVA 2Y06H 2VR9A 2QHRL 3G04B 4OQTA 3BZEB 2O5XL 1XR9A 3MA7B 1SOQA 5TF1H 3DX4A 4FZEL 1OE3A 3HG3A 4GXVH 2B14A 1PFCA 1F8TH 5E4AA 1VESA 2ZXGA 1IJ9A 2A6DA 3OKNB 4PJIF 3VVVA 2VH5L 3IVKB 4OIAA 1YYLH 4NN7C 4XNMB 2Y3NA 3VH8B 5JO5A 2DM3A 5CSZB 4KX7A 3QO0A 2PCXA 3B7RL 5E6ZA 3RY5A 3CFEB 4YR6A 5I30L 1QRKA 2GSGA 3HC0B 3N1GC 1ZXQA 3HG1A 2L04A 1MW0A 2CO3A 1FGNH 4NQCD 3OTTA 4UT9A 4WSGA 5F7EH 4YMPA 1QBAA 1WYJA 3A6BL 2PP8A 3OAYK 1AKJA 2A4ZA 2F18A 1D2OA 4JFOB 3DXAD 4ONFL 2Y06L 2AVFA 5EUOA 1A02N 5E9AA 1T7YA 5EU4B 4XZ4A 4IRJD 4WWKC 1FH2A 4ZAKD 1PLGL 3VM7A 3BAKA 3HS8A 1KWGA 3V0JA 1NKGA 1HHKB 1VAHA 1XCQA 2JNZA 3KL3A 4G9FD 4FMFA 5FWQA 3ARDC 3NFPB 4K5LA 5DWUH 1N59A 3KYOA 5B1KA 5AG8A 4Q2ZA 2L0DA 3SYCA 2OJZL 3SPGA 5L4JA 4ECNA 2A38A 4JN1H 4M7LL 5DUBB 2ZD0A 1RK7A 3MJ9L 8FABB 3H9SB 5HYSA 3BZ5A 3IDIA 2D7TL 1QW9A 4IGBC 5LXVA 3TJEH 3GHPA 3UC0L 1JNHB 5F7EL 7FABH 1E3FA 2GIYA 3T3PB 3K71A 3QCVH 5I16A 4FFTA 1F90L 4F2ME 2HFFB 4NOFA 2Z93B 2DQJH 5T5FA 1DFBH 3P11H 4WFED 3UP6A 5MHSD 3QR0A 2XBTA 4XC1H 1CR9L 4K9EC 3KZ8A 4NO3A 5AUMB 2LHAA 4P2RD 4K8RD 5T1LD 4QRQA 4XMPH 4UOW0 2A3TA 1BOGA 2FGWH 1FNEB 2YOAA 2F15A 2NY0B 5IMKB 1AQKH 4JKPH 3U9PH 3MRCA 4TNFA 4DN3H 4Y2OB 3CN4A 1TKWA 4M62H 2Y1AA 4K55A 2HFGH 4YSTA 2FD6H 4GUOA 1T66C 3GO1L 3ZL4L 3BH8A 1IGYB 3IBOA 2D7TH 2XQBH 3BEVB 4N6QA 2Z8VC 4M6OL 3LS4H 2HYMA 3DX0A 4PJIB 1U3HD 1X5AA 4WK0B 3RI5F 3FUKA 1ZLVH 2FSDA 3K6NA 2WK2A 3T2PA 2W91A 4XNAA 1A2YB 3UTPE 1IE4A 3B7SA 3CHOA 2F53A 3BP6A 4Y2DD 5D2LF 1TNNA 4JW3A 4PM1A 4NO0A 1EHXA 3FO0L 1JHTA 4YVUA 4PJIE 3UAJC 3VXOA 4R4FL 4EAEA 3VH8G 4P5MA 5AW6B 2NY5C 3FTXA 3HR5A 3VFVB 4TV3A 5AB9A 5FDWA 3AXIA 2VYRE 1U3HB 3ECQA 5FYKU 2GBUA 3OZ9H 2D0HA 2ISDA 3RWGA 2O5ZL 4HCIA 3QW9A 4N20A 3N50A 1MJ7L 2WZPD 1B6UA 4S11A 2CO4A 1N2RA 3KLQA 4AZUA 5HJGA 4HGKC 3P4NB 1RK1A 4QXWA 1FFNB 3WFCL 3FFCB 1JK8B 5AALA 2VC2B 4JM2B 1AHWB 4U1NA 2BZCA 3EH4B 2ZTBA 3QISA 4PVMA 5H37H 3VX0A 2D7OA 2BIIA 2ZX9A 1P2CA 4NRZA 5SWSD 4RRPA 1QI5A 1P1ZA 4OZFB 1VSCA 4FADA 4ZS7L 1ZSDB 1FFQA 1OP9A 1RJZB 4MHHG 4ZNEE 3KWXA 1RURH 4QOKB 1WD8A 3HEIB 5BZDA 3IDMA 1T6WA 2BIPA 5CZKA 4Z7AA 1U41A 3WDIA 3WNPA 2HT2D 2VQ4A 2R2BA 3NA9H 3QZBA 4K3EL 2OK0H 4XHQA 1HAUA 3LNFA 4PEEA 2DQIL 3FK3A 4HJGB 2YPVH 4M1CC 3ARFD 4PRBB 2IOOA 3X13A 4TVUA 1WJ3A 4MHHI 4QTFA 3MV01 1HSAB 3MRIB 1HZHH 4QHUA 3CXDH 2HT3D 2FT7A 3NFNA 2UWEA 4PD4J 3F6IA 2KDYA 2CNYA 3IWUA 2EEBA 5SWQB 1J12A 3BFOA 2C1PA 1OD7A 1W9XA 4K15A 5DMJB 1FH5H 2PYFB 1MNNA 4Y7OC 2J6EA 4LLQB 2DQUH 1T6VN 5DMIH 3A4EA 5E51A 1KGJA 2AABH 2XVLA 1BQLL 2VN7A 3E9UA 1E6OL 4Z78B 4XN8A 1N12A 1ROWA 1XSKA 1AGDA 1X3DA 4F9LC 4Z0BH 1DLFL 2CMRH 3E6HA 2G30A 3TT1L 2N59A 5AVYB 2XX0A 2Y5QA 2GW5A 5KBMA 4XP5L 1OW0A 3O6FC 1QNIA 5FM5M 4FYRA 1YY8B 3SIKA 1HNGA 2LFEA 1XTLA 3FT4B 1YNLH 4GSRA 4DTGH 1OTUD 3OKYA 1I3RB 1XV8A 1KBPA 1MLBA 4FP8L 3GBDA 3AITA 5C0CB 3T09A 1F1GA 1BM7A 2C9AA 4Z77B 1NUGA 4WFFD 2XNAA 3EO1A 4JM2F 4OGAD 4K7PH 4LGPB 4OIIH 5EBLB 2ZKMX 5DMGC 1SZNA 4OLYH 4DPRA 1NAKH 4AL8L 4FG0A 3VO0A 2P43B 2P47B 3WKNA 4AL8C 3D3VE 4TYUA 2NLJA 4U6TA 2UWEB 3FQRA 4PGBA 1U21A 4JZJC 3CVHA 2HP4A 3WXWH 2W9DL 5H35A 1CXEA 1XGQA 3MOAL 3T5WA 3T77A 5HVFB 2BERA 4S1QH 4L2LA 1LO2H 4LU5H 5EZOH 2X0UA 3CVHH 5JW5B 2DL2A 3DX2A 1PYWA 2XX1A 5FUZL 1FFPA 1I8AA 1I8UA 1TZGH 4GQ9L 4X4MA 4A66A 1CR9H 4O2FB 2Q8BL 1QHQA 5F44A 1OPGH 1HDMB 4AK2A 3UTZA 1D3CA 1S9VB 2H3NB 3EO0B 1EZVY 4Z7UF 4KRPB 3WE6B 1W15A 4N22A 5IF0B 1GVIA 4KITB 4K3DH 3DHUA 4LVEA 4PJ7E 2VLRB 3PAZA 4L5FH 4WI4A 2NYZA 3BWZA 4FG6D 4ZFOL 1NOLA 3VFSA 2WCPA 4K3JL 2P5WA 4M56A 5JXED 4FFZL 4H0LC 2CDFA 3V0WL 2H2PC 3V9FA 4WU7A 4RMSA 3FTSA 1MFAH 4G8GD 2OMVA 2XZAL 3VXUA 4YXHH 2X87A 5F3HA 5GGUA 4CC1A 4YXLL 3RWHA 1TZGL 4KDTC 4OKVB 1JL8A 5ACLA 5F1NB 4JZNB 1A6WH 4GS7C 3Q7JA 3ZQXA 1DANT 3KGSA 3VU1A 3JWNG 3HUJF 5DVLA 3V5HA 5CGTA 1XCWA 1CFSB 3Q2CA 3QC5X 4AT6A 4ZMYA 2FH6A 4ALAH 5DJDA 3DO7B 3R1GL 3V6OE 1YPZE 5JIDA 5JZ7D 4LHUB 2Y1ZA 3BX7C 2AMUA 2FDBP 3QPXL 2BOBA 1UA6H 4JRYB 1IGFL 4JR9H 1JGEA 3GSRA 5FW7A 4Q6IB 1SLUA 1CI5A 4HOWA 1JPSL 4PMEA 2O61A 3F2LA 5CMAB 1A9EA 5AW9B 2EKSB 1I9RL 5GRWA 3WE6A 5IW6B 3HNVH 4LCWB 3EYSL 1FN4B 4O5LL 1J8HE 1YHPA 2W60A 3EJZD 1CGSL 2NXZD 5E6IC 5E9NA 1MHPL 4XNUH 5IQ7H 1T03H 2VDQB 1IEAA 3UCRA 4Q97A 5DVKA 1DQLL 4ZW3A 3KPMA 3TZVD 2BK8A 1N0XL 4K71C 2F58H 2VDPL 3ARVA 2MFNA 4YK4B 1TZ8A 4X42A 3RGVA 3UX9B 1WFUA 4U1GC 4KZEL 3ZDYF 3ZE0E 1IAIM 1YN7A 4DF9A 1MZYA 3M1BB 5JIKA 2VT0A 1S7XA 2XTLA 4L8DB 4XTRD 3SPJA 3NQIA 3PDOA 1MWAB 4YHML 5IEKB 1QYGL 4XHJC 2W65B 4FQHB 3S3CB 4P4KB 5L2KA 5IMMB 5C07E 3NESA 4HAGA 2BSEA 2EIJB 4IBLT 4WO4B 1U3NA 2IWEA 3ALWA 5E4EB 1E9QB 1TQVA 3A21A 4M7KH 5AKTA 1A1MB 1CXLA 1ZT1B 1NC2A 4XNYH 4XVJL 3QJRB 5JW4M 3BCDA 3VFGH 5FO9A 1IFRA 4AQ1B 4IKNA 3EFOB 1DHKA 1QFWH 2KLSA 2XWZA 1XTMA 4X6BA 4WZ9A 3SDAC 2FIKB 3MGAA 4M93B 2QSQA 5ITBL 1HXMB 1N7ML 2A73B 3UMNA 5KYYA 1W80A 2WYZA 1UH4A 2IOIA 2XV0A 4C47A 3MLVL 5EUOE 5GS2H 2DQDL 1M7UA 4G6FD 5BZDB 1F3JA 1QYGH 4BK8A 3KM2A 4YHNA 1A21A 2WXRA 1GCFA 4XX1E 3SCMB 7TAAA 1UOLA 5KAQF 1M05A 3QARA 3MLWH 1RJYA 1WH0A 5DZOA 3ULUH 3TBCA 2J1XA 3JWOC 5C0FB 4QXGH 3X13B 1EEZB 3IJ7A 2EDNA 5HVGB 4MRCA 2HWZH 2R7EB 4MD4A 1RJLB 3SDYL 1A6AA 4PJ9D 3ZHNA 1QFWL 4JGJA 4BFJA 5LGJA 3JV6B 3UZQB 5I1KH 3AGVA 5I0WA 3BVUA 5C3TA 3SY6A 4GP8B 3R8BB 3HS0C 1I9JH 25C8H 2DEWX 2ZE0A 4W4OA 2K7QA 2H6UA 1UFGA 1WFNA 1AI1H 4AY0A 3K4DA 4P2OB 1QFUL 3E2HC 1A66A 3WUZA 1IIIA 3L4XA 3NGBC 3NZ8A 4CSTA 3LZNA 3TS8A 3KBEA 1YG9A 1JNHA 1T4KB 1KGCE 3NJFA 2HTLC 4B6ZA 1U2CA 3VWKC 4KVNL 2BCKB 2VLJE 3MV7A 1UCBL 1BFSA 1ZE3H 5H2BB 5E1GA 2QPSA 2VIRB 3NJVA 2QQNL 1JMXA 2V3DA 4MNGE 4N9OB 1A4AA 4H40A 3U4BH 4XAWL 4Q4IA 4ZUUA 4ODHL 4TSBH 1R3LA 1DVYA 1P7KB 4IDJL 2Y07L 3K6DA 3L81A 5EC2B 5BPPA 4M4PA 1UB6A 5JW3H 1I1FA 3PGCA 3RTQA 3GEFA 4GG6A 3CQFA 1ZDQA 2L8AA 4BKLB 3V0WH 3T2LA 3IJSB 1G4RA 4RGOH 3TEWA 2VERA 3UG4A 4NRYB 3ZUCA 5F88B 3RVXD 3TGXA 2WQRA 4APXB 3I3DA 1PKQB 4TUUA 2E7BA 2YGPA 3FU0A 2J2ZA 5EC1B 2IF7A 4U1IA 3GK8H 1E3ZA 4FNPA 3VG9C 1DJYA 3QJFA 4YHOH 4HPYH 4NUGL 5JYMA 2PW1B 3O11A 3SGDH 4GSDH 4G8EB 1AE6L 1XSIA 3AS0A 1BZDA 1RIVL 1BFOB 2ZOWA 3F58L 3TBVB 1UA6L 2E7LC 35C8L 5JPMC 3T0ED 4M4RB 1FSKC 3GMRB 4GO8A 3A22A 1B0RA 2DMCA 3NIDB 3IDJA 1LK3H 3MRQB 4RAUA 2JCCB 4J3TA 4X6CE 5LAXB 1NCIA 2YAQA 2J7LA 1NCDL 1QRNE 3EJYD 2M1KA 1CGSH 1NCJA 5D4QA 3M45A 3U4EA 2FE0A 2BW4A 4HS8H 1NCUA 4HLZG 2VW7A 4HHAA 4PBXA 2OZ4L 5LBSL 2E7LA 2NY1C 2ZOLB 2FJGA 4BFKA 1E4HA 1MAJA 2ZPKH 4FFYH 4M7LT 4PJEB 4XAKE 1QNZH 4NJAH 1YEHH 3BMWA 3DI2B 1ACYL 2CKBL 2ZP9A 5IB5B 3F58H 4A04A 2Q2LA 1BEYH 4FHJA 2GIXA 3GZQA 4PJ5D 4EN3A 4X9FA 1LK3L 2X2JA 3LXAA 3TBTA 3QORD 1VEPA 3KYOB 5JIMA 5DYOA 2E9JA 3FB8A 4JN1L 3DTUB 3NACL 2IQAB 3VW3L 2NY0D 4ODBD 2X4PB 4PRAB 5KG9B 3N85H 4KKPA 2FL5B 1MZZA 4GRMA 3NN8B 1A9EB 2AQPA 4MXQD 1SPDA 1MFBL 4G59C 2YFNA 3ZOAA 4ZXBC 3AU0A 4RAVB 2JK5B 2W07A 1WBXB 1P0SE 1QA9A 2WOYA 3MUUA 1OK0A 1LE9B 1M2OA 4XCCH 3WMSA 5LXGL 3AMLA 4GKLA 3LY6A 3P11L 1I1CA 1WA2X 3M8OL 5F7DB 5SWZB 3TO4A 1CDBA 4HISA 1ZRUA 3EJPA 4ODSL 4MS6A 4ORGB 4E2OA 5I1HL 4AGNA 3BLBA 2ZG2A 3TCLB 3QRBA 3P9LA 2OL3A 1ASQA 4N6RA 3O0RL 1BJ1J 5AG9A 5BVPL 1DZBA 3DPBA 3ESUF 4Y88A 5DHVA 3BVTA 2GC4C 3HI6H 4OZHE 2AEOA 3EO1B 2WXJA 4AENB 1JYXA 4EDWL 2IAND 4P0DA 3EJTA 4F7PA 3GMOB 3NCJH 5DQDH 1LO3H 3SBQA 4XNZC 2Z31B 2NUTA 4BGDA 3TWYA 3OWEA 1NGQH 2QBWA 3B34A 5DCCA 4HKJB 2D0FA 1NC4B 4L3CB 4UDUB 5E9DB 4FZ8L 5GGRB 3S8GB 1DTUA 2R4SH 5EOCH 4NZRH 2UZXB 3EGDA 3LJ3A 3GSWB 5A16A 4FMVA 2BVOB 3M17B 3MCKB 1G7MA 3U0WH 1AVAA 4HDIB 4X9HA 1TZHB 3DPDA 1O7DE 3JTTA 3O4OC 5LCVL 3I50H 1URZA 4KKCC 5F3BB 2D73A 2QTVA 3HVDA 5E99H 3HI6L 5HDLA 3S96A 3QXTA 4P23D 1N4XL 1YEKH 3VWJB 4K94L 3TTYA 2CO6B 4CBZA 1URLA 1TEYA 1LO3L 3FU9A 3LQAH 4ZNEA 1DE4A 4QRRB 4PJFE 4MTMA 5CF3A 4OLEA 4JFHE 3HHSA 2P8PB 1K4DB 1DQML 3QUXB 5A2JH 1WWAX 5FV1L 2F8VA 2XXFA 3AWFA 3KNBA 2C3XA 4YH6A 4J3BA 3OJDA 1B4JH 4GY4A 1Y6MR 1VJSA 1U8CB 5ERWA 1YAIA 5F7WC 2E27H 2NZ9C 3PAVA 3INUL 3NP3A 3LEYH 2IH3B 1RJLA 4MCNA 5MI0C 3SBRA 1SN0A 1A5FL 3U6RA 5GGRA 2FEDC 3RL1B 1G4MA 2B7DT 2OL3H 1CDHA 1FZMA 4LGRB 5EBMB 4FA7B 1A7QL 5KEZA 1T21A 2NNAB 5JQIB 4KTEH 3CDCA 3V5HB 4MJID 4K94H 5DQ9B 5CKGA 4JKWA 3Q8CA 1AGCB 4OTXL 2MKWA 5J13B 1PY4A 3GMQB 1MCDA 3OD3A 2GHWB 1PFOA 1H3TA 1DUZB 3F01A 3FXIC 4PJ7F 3OF6A 5KUMA 3MX0A 3QBTB 3MTXA 2BCKA 3MV7B 3WIHA 4OD3L 4HGWB 3WNIA 3IGKA 4OZ4A 1MIEH 1D7BA 2D7QA 4Y5XC 2B4CL 3D34A 4WTZG 1P84J 1EAPB 3INUH 1HK6A 3C9NB 4WHYG 4PCTA 4AC4A 1T0MB 1MIMH 1ONQA 1BWMA 4H26B 1DCLA 2G0LA 3RTLA 1BYOA 3HAEH 2Q10A 2HCZX 1PG7W 3HZKA 4GS7B 5DEGB 1N9PA 1SRDA 4XP1H 2CCVA 4RQQA 4J3UA 3Q2LA 2ITCA 3VRIB 2VZOA 5D1QE 4P5SA 3ZYJA 4D3CL 3EYOB 2XOTA 2DBLH 1FC2D 1Z5LB 4IRZH 4YDJA 5E2TH 3AREA 5EU4A 3PV6B 4BBWA 1OGTB 3PWPB 4D2NA 1A25A 4EZJA 4NUQA 3RNKA 1BF8A 3F83A 5F71A 5I1DB 2I7SA 4XHJD 4P5TC 2FH8A 3QUYB 5D7LA 5LB1A 4FFWD 2WZAA 1HH9A 4JM4H 4PW3A 2G2PA 3UTQA 4YEFA 1JJUA 2AQQA 1GTNA 1JAEA 1G6VK 4MA1B 1QSEB 2BVQB 1YNKL 3MRDA 2OA9A 3CIQA 5EUOF 3P2BA 1CLYH 4EO5A 1U2HA 3O9WC 4OKVA 3WN5B 4BH7B 1DSWA 5AKRA 3F7LA 3C60D 3CDZA 1SDAB 2I25N 4M8VA 3LRSB 2UXGA 2NYYC 3EFFA 4X98A 2VW4A 4BINA 5E6ID 5F9WC 5T3XL 3DX7A 3SB3A 2BDNH 5L6YL 1MREH 3EO9H 4B7LA 4LF3A 4OGZA 2BY1A 4HYTB 3GBNH 4KTYA 3BISA 1P6WA 3IFNH 3QR1A 2IH1A 5CEXB 5C0BD 2LU3A 1HEZA 1BW8A 1I82A 5I0YA 2W88A 1AGBB 1BYPA 1HQRB 1ZHKB 2RCSL 5K1JA 1Y07A 3CDGA 3T0XA 2BRRL 1AGEA 1ZGLP 3F62A 3FHEA 3ULAB 1BGXL 1OGTA 3PWPA 3V4VL 4KXAA 2NXYB 5ID1B 1AMXA 2EIZB 2EDEA 4UZGA 1WIOA 4HP5A 1WGOA 2HUEA 2NSQA 4PJIA 4ONHB 3SJVB 2X3CA 4FZ8H 2C34A 2VRQA 1GPOL 1CURA 2R4SL 4KVCH 4MXVE 2GSIA 2EYSA 4OB5L 3EXLA 4FQJH 3D9AH 5DRWB 5CEZH 5EEWA 3GI9L 2OMNA 3UBXA 2HMID 3IDXL 3WDHA 1UWFA 4LNRB 1WZMA 4HIIB 4XCFL 1UA3A 1IM9B 2LLLA 1IGMH 4ETQA 2RMNA 4PRIE 1JI2A 3TFBA 3O3UN 5JMRA 1UGNA 5L7XL 3UYOD 5I19L 2OMUA 3BZFA 4GH7B 5B1JA 2A7BA 1SDDB 5GJTL 3DO7A 3BP5B 2BS8A 5FFOA 3FBQA 5CJOH 2DY2A 1EA9C 1F41A 3VCLB 4AJYV 2ZWSA 1ZVNA 4P3CL 2JJWA 2OI9C 1R0AL 1BD2B 2PYEA 4PRHD 4F7PB 2EYRA 2YPLB 3BC9A 32C2A 1JZ5A 1HYSD 1JXKA 1KYUA 3S34H 3MLRH 1N0LA 1FN4A 4IDLA 1MLCB 3FKUS 3QI9D 3IDXH 3ASOB 4X5WB 2MNUA 5K5YA 3SPHA 2BVOA 4Y4FB 1TG8A 2DLGA 5IHUH 5GS2D 4HJUA 2Y24A 2D9CA 4HKBB 3U4KA 2CRZA 2R1YA 3PHOB 3CHRA 5B8CB 5C0EA 2EC8A 5DD3L 4EDXA 5BS0D 3VI4A 5FOBB 5ID0A 2XFXA 1Q0YH 4Z7NB 1DEDA 1G87A 3FU5A 4JFEE 3LRHA 3QUZD 5GRJH 1GY1A 1LGVA 4I4WB 1TEFA 3BXNA 2OCJA 2EDWA 3MN8A 2Z93A 4O4YH 4QOKE 4TUOB 2Y7QA 1GGCL 3WUWG 3X14A 5MENA 3D51A 3LNEA 2GSMB 3OB0H 1NWOA 4EIGB 2J20A 4GYBA 5MEOA 4ZX3A 2VDKH 5AOKA 4K3GA 4YSRA 1OHQA 2GJ6E 2BLFA 4JVUA 3EJUA 4OT1L 1WG3A 1KTDA 2X4SB 1L9QA 4Y2OA 5JHLA 1TR7A 4F33B 2ZOLA 4DIXA 3RDTC 1NAMH 2IH3A 4QMEA 5PCYA 4Z7WE 1A1NB 1SVZA 4R26L 3OKOB 5B7EA 5DD3H 4PGDB 3H55A 1U8MA 2W38A 2AQ3A 3BUTA 4U1MA 3WNKA 1H6UA 3QUML 1KIUA 1RUMH 2WBJD 5MEPB 2G5UA 3L16A 5DRZB 4YEEA 3IB4A 1IBFA 5C0CA 1PG7L 4JHWH 1E42A 1AGCA 5JDSB 3QNXB 3Q2WA 3V52L 5GGSA 1CT8A 1FO0H 2ZOTA 3BAYA 3P4MB 2ZKHH 3APDA 4MAYA 2W0LA 1H3XA 1FFTB 4QTHA 5EZJA 4P5RA 1F1AA 4PJHB 5A43C 5FDWB 3MV7E 1IBDA 2ZF9A 2XSKA 2WKOF 4P59L 4XNQA 1TETH 1QATA 1RZIB 1URIA 3N43B 5JHDB 3MRPB 3HFMH 1OP3K 2XKNB 2H5UA 2HT4C 3HG0A 5LGHL 2A0LD 3A0OA 3O2DA 4A2GA 1RUAH 3VI3B 3D08A 3X1GA 2MOQA 1FZKB 1CK0L 1Q72L 3DURB 3ZMNA 5ESQA 3NA4A 4ZT1A 1M7DA 3QC6X 3RLSA 1Z0NA 3QUMH 4KRPD 4H8PA 1YA5A 4G1EA 1DQKA 1ZT4A 2AAVA 1JK8A 5E5LA 1MRDH 4JHWL 3VG0L 3BPCB 4LBEB 2Y7OA 1KYOJ 4F37K 2VDRL 1C12A 3WFZA 3MMEB 4NLHA 2YMXL 2FYYA 2V0AA 1RUQL 1QSZA 2YPLD 3X11B 4ZPTA 1HN1A 4AE0A 1QSFE 1S3RA 2OL3B 1GGBL 2OZ4A 1S3KL 1PSKL 3GLEA 4UQCA 1Z5YD 4G6JH 5ITFB 2BVEA 2COVD 1NKOA 2ICWB 1G7MB 4ADGA 3BAEH 4NN6C 2DWYA 3ZHKA 3BAXA 1KYFA 3ETSA 1MHHA 3KPOA 4QHUB 2Z7WA 3FT2B 4Y1AD 3DX7B 1TF4A 4UIMB 5GPRA 4A39A 1N3NB 4HX1B 3O6LL 4DCQB 1DN0B 3QQXA 1N68A 5D93C 4HUMB 2V9TA 5DA0B 1CDIA 3O11B 3TBWB 1JDAA 2NY2B 2NSMA 2CRYA 1CU4L 5F9WB 1ADQA 2LAGB 2F7OA 5DK0A 1JZ8A 1II4E 4S1RH 4WW2A 4N0UB 2Y36L 4JRLA 2ZYIA 4Z5RB 3W5NA 2CLRB 3OBAA 5IFHL 4XCYA 1UXWA 1XF5A 2B39A 1IVLA 5B1JC 3UPAA 1RU9L 4R2GB 1JSYA 5EH1A 4MMZA 5FCSH 2QHRH 4OI9A 2AJXH 3LHAA 2MCMA 4B50A 1NL0L 3VD4A 2VLJD 1H8OA 5DFVD 2BP0A 2AJUH 1JGLH 5IB4B 2X2YA 2IPTH 4U3SA 2AJSL 2WVTA 1ED3A 4W9FC 4B9IA 4BKTC 4HJIA 3Q9PA 2AQ2A 3DRQA 2A1WL 2EIKB 3P0VL 3PHAA 4G9FE 1XD0A 4KAQH 5ILTL 4AJVA 1BMGA 1XGYH 2CKBH 4IW4C 1LQBC 4EEEA 4DEPC 5FYLD 3OLEA 3AFLA 5DD1L 3IAGC 1UZ8B 3STZA 3MUY1 1A14H 3FCSB 4M3KB 3C5ZA 5TK2A 4JE4B 2EDFA 2GBAA 1EAPA 2C4FT 3QAZB 5AL8A 5AYTA 1HCVA 3BP5A 1MCWW 4A7UA 3LKPA 4ZK8A 1EV2E 1JNNH 4QHKI 5I1JL 3KWTA 3KWVA 3R06B 2GEQA 3S4SB 1F11B 3L1OL 3ETBF 1HHJB 4M1DH 1R3JB 2QVKA 3RGVC 3L5XL 1G1CA 3Q5TA 4RGNB 2LVEA 2VDOL 4XCYB 5EIVA 1NLDL 2FIKA 3GUTA 3CX5J 1D5IH 1WQVT 3RZWA 4MS8D 2LTQB 1NAML 1OWWA 2FQEA 5EIQA 1FLRL 1YEIL 4IGBB 1QZ1A 4GKSA 2DOCA 5E24E 3FRUA 4A38A 2AGJH 4YHNB 4B5ZA 1R5WA 5AZUA 3FF8A 1A6VL 2C9QA 2IGLA 3ZTJG 1XIWA 4BE5A 4EE2A 5I8OH 4PJFF 3HG2A 3BOVA 2QVFB 3FAWA 3H7BB 4HD5A 4JFDE 5F6IC 2K9FB 4JY5L 3NCMA 4JKKA 4M1GL 1NGQL 4X5PA 1DFBL 2MHAA 3FBKA 4YHZL 4JO3L 2NY3B 3UG3A 4ELDA 2F68X 1T21B 2VZ3A 1S7RB 4K23H 1SEQL 2YFOA 3DARA 4N1CA 4XMUA 3NYKA 3GRWH 5C0IB 5I75B 2BS9A 3HPJB 3UMTA 3UTSA 4XAKD 4K5MA 4LPUA 5C3LD 2A4EA 3ARDB 1O6SB 2NY5H 3HG4A 3VDBA 2ITDB 2B08A 1YECL 3FSVA 4FYTA 1L3WA 3FH7A 1W0WA 1YN6A 5TFSL 1N8ZB 1JGIA 4NENB 1OARH 3UJTH 1CD0A 1D9KD 4O2EA 4LCWA 4PWHA 4N0FB 3AM8C 4HUXB 1H19A 5IM7A 3AWEA 3FYEB 3IU3A 5GJSH 3OKOA 4UQEA 3VXRB 2QL1A 1KBBA 1BWWA 2WQAA 3TC9A 3UIZA 1JWSA 1S5IH 5DT1L 2J72A 3F7PC 1E28A 4TLKA 2EVGA 3T8XB 3DHJA 3FF7A 2XVGA 5BUPA 4F93B 1CGUA 1CT8B 3P4MA 4N5EC 1BBDH 2WUBL 2D4FA 3I6KA 3WNMA 1RZ7L 4PJHA 1CFQA 1G7LB 3VXRD 4PSPA 5FGBC 3V4VB 3IS1X 5CIPB 2Q76A 3C2SA 3LQZB 4N9GB 1ZTXE 5HXMA 1NPUA 3FL7A 1CCZA 3QORB 2V7NA 3EYQC 1D6EA 4FXLA 4YHIA 1FJ1B 3EGXA 3CVDA 3EJQA 2J73A 3NUKA 3F05A 4A7QA 2IANE 4V33A 3HZMA 2PXYB 1IBHA 3ZYIA 4AYDC 4EOWL 1YPZA 4KXZH 1IC4H 1FG2A 2P5PA 1KDIA 4AQAA 1R1CA 4YE4H 4DEWA 4IOIA 3DDGA 5TH2A 1D6VL 3E3QE 2NCEA 3OKLB 3ULUL 1Y18B 4WSJA 1AXTH 5FX3A 1FVEB 5D5MA 5H94B 4N0FA 3PY9A 4LKXB 1U8OA 2NPLX 3BKJL 2YK1L 2OBGA 4FI6A 2HPTA 3BSZH 3TIEA 3C6LB 5C1MB 2ZSWB 4EKJA 3BDXA 1ETB1 1GYWA 2IANB 3G5YB 1UWXH 4QLRA 43C9B 4Z7NE 2PTVA 4C4KO 3EYQD 4D0CB 4C56D 3ALXA 4IGBD 2XA8H 3NJGA 4DUVA 4QHKJ 4D3CH 1OSPH 4G6AC 4TNWF 5DUMH 3QH3A 3RX9A 1AS7A 5B8CA 1RZGA 1WZKA 3IU4H 4JLRA 1D6VH 1IGCH 1OANA 3E9TA 1LEIA 2GK2A 1M6UA 3L4ZA 2BCMA 3B37A 3NPZB 4J3OH 5TE7L 3WKYA 3PWNA 2Q7YB 4X5WA 4P48A 5JORB 4RRPM 4M7JH 1E4XH 1A14L 3IDYB 5EO9B 4IOIB 3OZLA 5B7FA 1NUNB 4NQVA 3ZSSA 4XGZA 4ADJA 4H4NA 4ZQTA 2PXYD 3FUIA 1RUPH 3MJ8B 1AQDA 4OGYL 1A7RL 1OP3H 2HVJA 4H5SB 4F1ZA 4ACTA 4PRIA 4UU9A 3RTQD 2UVEA 1T3FA 4HZLB 4PN6A 4I4WA 1OIOA 1ZEAL 3QIWD 4MJJA 2YOCA 2GUOA 3EOYG 4PGCB 1MFVA 3ZT6A 3MRFB 1B0GB 4DPBX 5IUSA 1JNJA 2WZ5A 3B2VH 4MVBC 1JF6A 3PP3K 2HXAA 5TF0A 1KIUB 4DN3L 2YA0A 4NGHH 1LO4H 1PCSA 1XHHA 1MFCL 3H9SD 5IJCC 2FECL 1BQKA 1M4KA 3RTQB 1NBVH 1EHNA 1WISA 1UASA 3EYVB 1TYRA 5C0CE 4XC3L 1M6OA 2E8YA 1YMHA 3LKOA 3P3YA 4QRTA 4MAYB 3RBSA 1WTGT 1TTFA 4PJ8C 4RDQG 1XSOA 4XPTL 5HI3D 4PTUB 3VYOA 4GW1A 2E9IA 4HBCL 1EHLH 1SQMA 1DBAL 3PHQB 4UOQA 3IMBA 3H0TA 3S3PA 5IIEB 1IGIL 3MGTA 4XPAH 5T1LB 2V37A 4U7SA 5ID0B 3F7VB 4NZ8A 3RVTC 3WL9B 1RERA 4HWBA 3HBQA 2HKHL 5DRWA 4RGNE 4LSTH 5DZAA 3JTSB 2YO3A 3UEQA 4LLUA 5K69A 1S7QB 1UM6L 4EN3C 1AG0A 1ZANH 4MX7B 4ELMB 4N2AA 4BDVA 4DP0X 3UZEA 2XN1A 3ULSA 3QDMD 1M3JA 4NXKA 3WSQH 2DQJL 1F1DA 1IGIH 2VDPB 5CXPA 3MLZL 2ADFH 5KYWA 2PWEA 5D1ZB 1H8SA 3VTTA 1V7MH 4UB0H 5I23A 1ODUA 2FGWL 2WXHA 3OX8A 3DWTA 3D3VD 3TM6A 1MEXH 3ZZLA 3D25B 4N85A 3ZJAA 3BWAA 1INDL 1A3LL 5F6HI 5ADOL 12E8H 1N3NA 4HX1A 1BMZA 2FBRA 1AIZA 1CG9A 1KDJA 1W2KT 3QUMA 3O81A 3EYSH 2Q87A 5C8JA 3FO1B 3KD4A 1ZSHA 4XVOA 5HHVL 3D3VB 4FI8A 5GXBB 1W0YT 3JWDH 2KT6A 5CLWA 1N0XH 1CZ8H 2WXQA 1RULL 5KVMC 1OAXL 2AABL