3ZZSA

Engineered 12-subunit bacillus stearothermophilus trp rna-binding attenuation protein (trap)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
64
Chain Sequence
SDFVVIKALEDGVNVIGTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ATTENUATION PROTEIN MTRB
publication title How to Change the Oligomeric State of a Circular Protein Assembly: Switch from 11-Subunit to 12-Subunit Trap Suggests a General Mechanism
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 15
structure length 64
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 3zzsA00
5EEXA 5EF0A 3ZTEA 2ZD0A 5EF3A 1GTNA 5EF2A 3AQDA 1WAPA 3ZZQA 4B27A 2EXTA 2ZP8A 5EEVA 1QAWA 5EEUA 5EF1A 5EEWA 1GTFA 1C9SA 5EEYA 3ZZLA 1UTDA 2ZCZA 2ZP9A 2EXSA 5EEZA 3ZZSA
chains in the Genus database with same CATH superfamily
5EA0H 2EE2A 1HCVA 5KS9F 4DP8X 3OM3B 3D0LB 4EE2A 3NCJL 1TZOA 3O9WB 5D70L 4LSQH 1F18A 1RZJH 2WLYA 2AJZA 3CQFA 4KFMA 1ECYA 2DL2A 3BQUD 2VL5A 5K9OB 2OR7A 3ZL4L 3A67H 4OZHF 3OV6A 4FE9A 4AE0A 2V0AA 3P3UA 4WUUA 3LSOA 5TK2A 4DVBA 3ZDXE 3OZ9H 4X6DF 1QW8A 5AOMA 4AJ0A 3BH4A 4WKXA 3IJHB 5AW5B 5DS8B 2AV1A 4NUQA 3ESUF 5BQ7B 4IKIA 1MVUB 2VO8A 1WCBA 1WAEA 2I60H 2WXMA 1OOAA 2NT0A 3FO2A 4PJ9C 3IGUA 1S7UA 1ZSDA 3HC4L 4E5XB 2AKRB 2X2HA 1I1FA 3AITA 1V3LA 3PWUA 3QB7C 1Q0XH 3SQRA 5FGRA 3UZVB 2XJLA 2WTPA 1IUZA 1PPIA 3F7LA 1MHEA 4APQD 3IFPA 1G9NC 5E6IA 5IJKC 2XVBA 2XOTA 3KDPB 3DJ9A 4DCQA 3C2AH 4DGWC 3TCXA 5J11B 5F9OL 4A1RA 4I0KA 3MRKA 5IFJB 2FB4H 3TF7C 5J1AA 1N64L 1I85C 4IRJA 3R0MA 5EZPA 3LNEA 1WG3A 3KPSE 3BWAB 2ZYIA 4X9HA 5GPRA 2F5BH 4CVWA 4U31A 1U6AL 1PMYA 1CGTA 1JI2A 2AK4A 1XGTB 2CIIA 1YNKH 3LNFA 2OP4H 4WCYH 4NXKA 3OXRA 3QW9A 4JMNA 3AC0A 1IGJB 3CFQA 1J5OL 1E5YA 1LYQA 3V0VA 3GI8L 4P5SA 4UOZA 4TPRL 1OP3K 43CAA 1J9CT 4U49A 3F7VA 1YA5A 1PLGH 4YHOL 4AOFA 1JD7A 5D1QD 3VI4E 1ZMYA 1KEGL 4LVOB 2G60H 3GZQA 3SBRA 4OFPA 4AQZA 2XT1B 2Z0UA 4C47A 1U8LA 3QUMB 5H2BA 1AGBA 3WTUA 4C54A 1JHTA 3U2SB 1SEBB 2BIHA 2J1WA 3QPQC 1K8DB 4JM0A 4ZUUB 1WZKA 3GRBA 4J4PD 1CK0L 3S5LA 3MPCA 5M95B 4QXTB 5CZXD 4PTUA 4LCUA 2K9UA 4JKPH 1RD6A 1T89A 3PV6B 4K5LA 4Z7QF 4M7JH 1KJ3H 3QUML 4XPTL 1WV7T 5L2JA 1JV2A 2E4FA 3KWUA 3RJDA 3N43F 4FYQA 1J1XL 3DA0A 3HB3D 3RFZB 2YD0A 3K2KA 2OR9L 1C5DB 1BVLA 3RI5F 1KY6A 4MXQD 4AG4H 3FFCB 4MDIA 3FUIA 4ZXBD 5LBGA 3P69A 3GHBH 3TIEB 1KTKE 3BYYA 2XHNA 1LQSR 1ONQA 3MA7B 3AXIA 1KIUB 5LXVA 4P9ML 1DUZA 2EYSA 3BVTA 1E9OA 3QNYB 5AW4B 4H1LB 4MA3A 3F7YB 4JDVB 4DEPC 5FGCB 2BSED 3NYKA 2V2TA 1UG9A 5KYWA 3QDGA 2ZWLT 1E7UA 1GAFL 5A2AA 1VFAB 1U58A 4DN4L 3NCFB 2ZX8A 4UV7L 4DVRH 4XVTL 2AGJL 1FNGB 4OZIE 1JZJA 3EYQC 1CIDA 3IJEB 3TNNB 5GGQL 1EDQA 5FLUA 4QOKD 5FKAB 5EU7E 2O61B 4EMZA 1TTRA 3IDUA 1BBJA 4M4PA 1VGKA 4U0RC 1XH3B 3VVVA 4X6FB 4HFWB 1VF5C 3WEXB 2KERA 4RETB 4PJ9B 3KBFA 3S4SB 2QMKA 2XG4A 3SDXB 3ZU8A 4ADJA 1J9RA 2JKRM 5DC2A 3SCMC 5A7EA 1YEKL 1RSYA 3SPVA 4KMTH 1HZHL 5IBTH 3V55A 5CBAB 3VYPA 1JZ4A 2W9EL 2LGNA 3QSKB 4MLSA 1AIZA 2JJWA 1BXXA 2QFPA 4NERA 2R8SH 4JQVA 5CEXA 1T1WA 4JKLA 4WTXA 4HU8A 3SE3A 1FJ1A 3LKOA 2M26A 1M71A 2EH8L 3PJSB 3ZDXB 2IQ9L 3KW8A 1NKGA 3C5JB 4N22A 1PZ3A 2YD8A 4F92B 5EU7C 1AZZC 1OCWH 2E7HA 4I13B 4JFDD 3HE7C 4PWFA 3CZFA 2AFNA 1CFQA 1OLZA 3VH8G 5KBDA 3GTVA 2ZXAA 1SVZA 5KSAA 4N0YL 2WGXA 4MNQD 1B4LA 5IEHA 4GRLD 2DF3A 4DKDC 1IKFL 4WU5A 5CZVH 4YZFF 1TQVA 2AK1H 3MJ7A 5HDRA 2E6PA 4MB3A 3ETTA 4WGVB 4OZFA 2ZNWA 4W9IC 4H8UA 4BQ9A 1E4XH 5K9KA 5TF1L 5EU5A 1MCBA 1P7QB 5DZLA 2R29L 2LV4A 4MJ2A 1FN4B 3KPSB 5I1EL 5FA3B 3OF6A 5IVNA 2Q9OA 3OX8B 1S9YA 3DX7B 3E7JA 2OX5B 4FFZA 2WVTA 3GWJA 2X9WA 3V4UH 4XN1A 2QR0B 5JXED 2XA8L 5JOFB 1Q0EA 1U3HD 5F1NA 2TAAA 3ZDZE 4FG0A 5CSZA 4N8VA 4ZW6A 1SXSA 2Z35A 5GGUA 2X1WL 3GUTB 1U8CA 1GGCL 3AUVA 1Y07A 2KC0A 3QO0A 3US9A 1BVKA 4Y0GA 5JZ7D 3HE6A 4HUVA 4OGXH 1S9VB 4IBZA 1HDMA 3ARZA 3ES6B 3MLSL 4LMQI 4NAMA 4PRAA 5JHLA 4XP9H 5AFAA 4FTVD 2Y7QB 4M56A 1KGIA 3W5NA 4H0HB 4DEPB 3DWTA 5IQ7L 2WAHA 2BS71 4WHTA 3AS2A 1DJZA 3O4LA 4FEIA 1MI5B 4YR6A 1U8IB 3RUGE 2D3JA 8FABB 1E7VA 2GC4C 1DDTA 1H9VA 3T3MF 3Q3GB 4Z8FH 4OKVB 4G5AA 3W0WD 2J20A 1CBVH 4U0RB 1A6TA 1FO0B 1TTUA 2WWMD 4PLKC 1LMKA 2CXKA 3D4ZA 3GLAA 5DRWB 3VM7A 4AYFB 2NY4D 3UTPD 4TL5A 2WZAA 3L9YA 2DIBA 2YD6A 2OZ4L 4BA0A 3GRGA 3GLEA 5T5FA 1IL1A 5CEYA 3JYBA 4HIEA 2QGDA 4TTDD 2I9LB 1QFUH 4R83A 5F8QC 5ADPL 4HP5A 1QHQA 3KWVA 4MJ6A 4R8WL 1MFUA 3LPGA 5DWUL 1BQHA 4HUUA 4M5YL 4EN2A 3CIQA 3HKZA 4KHXH 3WLBB 5CIPB 2DYPB 2JKXA 5DA0B 4PJXE 1TOXA 3QUYA 2FBOJ 2GBTA 1WHPA 2WHVA 4LFHG 3OKNB 1KIQA 1PLCA 4GG8A 4JY5H 5AB1A 4OZIB 1GC1H 1XH1A 1Q9OA 4L8CB 4I0CC 4KKPA 2OSWA 5I6OA 4LNRA 3WMQA 2CJUH 2W1NA 3NCMA 1RIHL 2ZUTA 1C12B 1LO2H 1FVEA 3FOLB 1LO5B 2WM0A 3ULUF 1Q4NX 1XWVA 1DQMH 4PRID 2BOBA 3X3FL 4ZNEA 2W65B 1BYPA 4F2MA 3O6KH 4LAQL 1WVZA 3BX7C 4JO3L 3WDHA 3AU1A 3B9KA 4PAZA 2XVGA 1XGYL 4KMQA 2VXQH 3LZLA 1JDDA 3ULVL 4ZUVB 4TNVF 1NCBH 2QKSA 3HZVB 4I3RL 5E4EB 1RU9L 2J57A 1F90H 3VU1A 1GYVA 4R96A 3JUYA 4CVZB 2LVCA 1NC2D 3NDZE 2CM6A 2R0WL 4TNEA 3DJZA 5DURB 1VACA 3LKPA 1JPSH 4ERSH 1MJUL 2VABB 3HNVL 1JNNH 4R4FH 1IO4C 1CDUA 4Q2ZA 1INQA 5A2LH 1N7ML 5EIVA 3BEVA 4XPBH 4HJIA 4IYKA 4YWGH 3SDCD 2GAZA 2VDPH 3TESA 2AXFA 2CUHA 4YDVA 3MLWL 1SYVB 4Z95H 1L9MA 1X5KA 3TTSA 5J57B 5EBMA 5ABAA 1G7LB 3IRPX 4N3UA 5A7BA 2YBRA 1CDGA 1KYUA 3CDZA 5DD5L 3K6SB 1JWSA 2EVFA 1WC7B 5IROD 3B3BA 3LVTA 3S36L 4PV1C 5IESH 2HRPL 4R7NB 3FZUC 4YZWA 1IQDA 3GKZA 5DYOA 1Z5LA 2PNDA 1AC6A 5DMKB 4BFGA 2BHZA 1CD8A 5D2NE 2XUWA 1TMQA 1HOEA 4JO4L 4AQ8A 2V4LA 1NOAA 3PDDA 2PXYB 5F1SA 3MX0B 5C9JB 4J3UA 2P8MA 4UB0H 4ZFZB 2FLRT 5F1OB 5EDSA 2GFBA 3IMSA 5TK4A 3ISWA 1DTUA 1MQ8A 2FWUA 4PB9L 3ZDZB 4LLVB 4BH7A 5F3FA 2JI1A 4H8PA 1HC1A 2VLJA 2ENJA 4OLEA 5AZEH 2GBUA 3IBEA 5BV7L 2J6WA 3WIIH 4XMXA 3EYVA 1YMHB 1R3HA 2VLKE 1P9MA 1SOXA 4ZMWA 4A55A 4MD4A 1QYGL 4H26A 1T4KA 1P5UA 4ZZKA 1AKJD 3ZBMA 4O2EB 3RTQA 2EEBA 3IDGB 4NT6B 3SO5A 1Z3RA 2EYTA 3UTSE 5CBEA 3HG2A 4QXUH 3SKJL 1L9OA 5D2NC 1NGXB 3ARDB 3Q9PA 2QLYA 4NM8L 4PP1C 3NACL 3RUGB 3UZEC 4BKLB 1JL8A 2YPKA 3VD5A 5T1JA 3ZGHA 1CE6B 2BZCA 2AF2A 2YRZA 3OVUB 4B9KC 5KSBF 2BVTA 2X2YA 5TQ2H 4DP5X 2CCLA 4OJFL 3CLFH 3ZKMD 1GYUA 3BAJA 3G3LA 4PLOB 5KJ4A 4K5OA 4UOW1 3M7FB 4ES8A 4Z7QE 3ATAA 4MSWB 4KUZH 4JGNA 3PHAA 3FT9A 1IC4L 1S7XB 3CN2A 3KAAA 3QJXA 1HU8A 4MJHA 3U7WH 1IBFA 1Z0NA 3BVUA 3GKWL 4LIQE 4UTBL 5E2UH 1KPUB 4CRPA 5C3TA 2XY2A 4LP4A 4DPAX 1ZV2A 4YHNA 1MG2C 1NFDE 2Z31C 3NMEA 3QEHA 4V1DE 2DW5A 3EJUA 4PJXB 1I9RH 1A8JH 2BVOB 3UO1H 5HBBA 5LXGL 4AJWA 1E2VA 3TVMC 4HOMA 4XBGA 1ZXQA 4PJIF 1PIFA 15C8L 3D52A 5I66B 3PLYA 3FFDB 2X05A 1FG9C 1UEMA 1T5KA 2GK2A 5DR5L 1B3JA 3M46A 5FV1L 3UPRA 5JO5B 1CMOA 5JHAA 2KT6A 1DLHA 3QFJE 3CX5K 3TZVD 5KJRH 2EVGA 3U0WH 2O93L 1EQWA 1H6UA 2P8LB 4N87A 2E47A 4W68A 4FQ2L 2ITCB 3SD2A 3C6SA 2WV3A 3KYOB 4KKCD 5JNYB 4ANKA 4FLSA 4P5TA 2B1AL 1PS3A 4JKKA 2YXVA 1BM3H 4PW4A 3QH3A 2IDFA 5I82A 1PVHA 3HAEB 3L1OL 3G5XA 5AZUA 3N1FC 4N0UE 3TEYA 5BOPA 4OGQC 3QDME 5IB1A 1WFMA 3L3OC 3O6LL 5TDOB 3AT0A 4J8RA 3S48A 1MUJB 3WHE1 4OIIH 3Q05A 3ZKND 2ICEC 2L3BA 3WTXA 2UVFA 4HISA 1ZTXE 2DMKA 3GSUA 1ASPA 3OSKA 1BX2A 1T66D 3JXAA 1XSKA 3FFCD 4MRBA 5IHUL 2ETWA 3QIWA 1BPVA 4KI5E 4FQJL 1CDJA 1NJ9A 3FU5A 4NENB 3VSQA 4NQDA 4P0DA 5J1TC 1ADWA 4HCRL 4AE1A 1RUML 2NMSA 4WI5A 3K72B 3WNKA 4QEGA 1FPTL 2E7MA 3QDAA 5D2NB 4NHCL 2FR4A 1CF8L 1XF5A 1JN6A 4OCNC 4NJ9H 3KPOB 4OQ1A 3HLKA 1MCCA 1EFQA 2VDQB 3W2DH 1SNRA 2X7LB 5GZNC 1WGOA 1RPUA 1D5ZA 5DUPH 2NX5E 5K1NA 1ZGLA 5BRPA 5IF0A 5HP5A 1FAIH 1KN4H 2VDQL 3GMMB 1A0QL 3SGJC 1F11A 1BEXA 2E74C 5DJCB 4PJHA 3ZGIA 4I4WA 1EAOA 1K5NB 4NQCA 4Y4FC 5EOQH 4DP2X 3AMKA 4CSPA 1MJJB 2K8MA 2ZD0A 4F80A 4U1MB 5BJTA 6CGTA 1Q94B 2QQNL 4JRYA 4PJ9D 4UMGA 5EBLB 3GLZA 3VU2A 4TXVB 3GBEA 2IAMA 5KVGE 2YGOA 1QSFA 4KI5C 2EDKA 2Z31B 5DI8B 5TE6L 4PGEB 2AEOA 1JK8A 4HF5L 4K2UH 4U6HB 3RZCC 3BZDA 3T6ZA 4XNDA 2FTAA 4ZPVB 5I1KH 2L4OA 2J6EH 3C5XA 1XGUB 5KTEL 3LH2H 3TVMB 4CC4A 4QRPE 3WJMB 4KZDH 4N2HA 4PUBH 1D6EA 3N50A 4YSSA 2VRKA 2XQBH 1CDCA 2ZYSA 1WCQA 2J2ZB 3DHPA 4WQOA 3T3ME 3LKNA 1G7MA 4Z7QB 1IBHA 4P49A 3QHFL 4LARH 3SE9H 2VLME 4NBXB 3WTSA 4HG4K 3TH4T 2IH1A 1MJ7H 1A9EB 5F2FA 3TLRA 2AV7B 3TNMB 3TL5A 4DGVH 2CR6A 4NO0B 4H8WH 3S34H 3S3SA 3NP4A 4HJJH 3DVFA 1N6QH 1NFDB 4V1DB 3IKCA 1MCQA 3LS5L 1XIWA 3MRGB 3IDYC 1X7QA 2VQ4A 3FQ1A 4Y5YC 2XN9A 2VT0A 5DU7A 2VXTH 5FCUL 4ANWA 2B1HH 2W0KA 1YQVH 1XEDA 3EW3B 3UTTB 2Y7OA 1NGPH 1P7QD 5LN4A 2AAAA 1UJ3A 2DPKA 1MJ8H 4ANVA 3VG9C 1KTJA 4KTEH 3QPQD 3P11H 3KPSD 4YHML 2IWFA 4Y2DA 3T0XA 4K94H 2NZ9C 2IADA 1EZVX 1LO3L 3L3OB 1M4KA 1LK2A 4QGTA 2PYFA 4I3GA 2ZCHH 2GBVA 3QZWA 2XZCL 4N20A 2FO8A 2EDRA 4F33B 4QXGH 3QFJB 2JV6A 4Z3FA 3ULUE 4XNXL 3IAPA 3RPIB 3OR6A 1SEQL 2DTSA 3NT0A 1FP5A 4N5ED 1K6QH 1Q1JH 2GIMA 1XF3B 1U93A 1L5GB 3FCUB 4LLDB 4M62H 3WO4B 4BSWB 4LNVA 5C1MB 2WNGA 5INCA 2W94A 3PNRB 3L9RA 5IBUB 2OW6A 1D2PA 4LLUB 3L5XH 2BP5M 2V8MA 3VFVB 4ABWA 2EUVA 1RERA 5JQHC 1IT9L 3T4YB 4PMFA 1SJMA 3JTBA 2GCYA 4G3YH 3FRPA 4U1LA 5TE4L 4OQTH 1A25A 2OYMA 1DEEA 1S5IL 1KN2L 2BDNL 3IDNA 3SBQA 1MI5D 2WO3B 5EDXA 4N0UB 5F6IC 4FABH 3GRWA 5HD8C 4EUPH 3QNXB 4HULB 2I25N 2Q8BL 3CFJB 5HYSG 1UFGA 3GMLA 4FG2A 5CJXA 3X3GL 4NC0B 4XO9A 4ZQKA 3ULUC 3QJQB 3O0LA 5TDPA 3QZPA 4R97B 5FO9B 3HC3L 3O2WH 3FQWB 1R34A 1K9TA 3C6LA 4A7SA 1CXEA 1K4DB 3EDFA 1ZTXL 3DECA 1NPNA 5E8OB 2EECA 3RZCB 2CO7B 3NSDA 4CBPA 5L6YH 5IV2B 3TIDA 1WF5A 3JVGA 5GRWA 3RDTC 4Z7UE 5EZJA 3QEQE 1DQJB 4Y5VC 4NN6C 4OH2A 5ESQA 2DYPD 2NX5B 2YKKA 1A1NB 3M1BB 2O5XH 4IOFD 5DJAB 4HJEA 4M3JA 3RE0A 5AUMA 5HTSA 1PEZA 4N2OA 1T5XB 4PPTA 5DUML 1OT4A 4F7EA 5DEFB 2FEEI 3K2UL 1M56B 3NIGB 5I1LB 4JPQA 1MRFL 3UGUA 3IDIB 1LO0L 3FPXA 5F88B 4W6WB 3PAVA 5DRXB 5MERB 3ZJAA 3ULVD 5I6MA 4XO3A 2FECL 3I50H 1AOHA 1I7ZA 1UQSB 3CVHA 3L54A 5C7ZA 2BERA 4K7PH 5L7XH 2MTPA 2OQJA 2A9MH 2AQ3A 2G3XA 2HVJB 2NY5H 3T0AA 3TP4A 5D72H 3ZN6A 2X4RB 4IU3A 3S7GA 1N6VA 2MPAL 3IDYB 1J18A 3CXHJ 4RSYA 1MCFA 4NZFA 4Y5YB 3KEDA 5KVGL 1PTZA 5DK2A 3QDJA 5GS0H 1OXYA 4BKSC 3VD7A 1AO7A 3CN1A 3G08A 4EZMA 4QRPB 1PIGA 2H6PB 2B16A 5TPWL 2HLEB 2GKIA 3T8VA 2GTWB 5BVJB 4U3SB 3KGUA 3VG9B 5L2KB 5I23A 1XVSA 3FYEB 5DURD 1P4IL 3NPSC 2NW3B 3WKMH 5JIHA 5C0BA 2X4NA 4YVNA 3ILPB 3MRNA 4FMKA 4PWKA 3T3MB 4QHLA 4JO8A 5KSBE 1ZHBB 3B2VL 4OD3L 3CFEA 4F7PB 1A7PH 1ES0A 5IKCB 4AIZA 4ZYKB 4F5CE 2AJSL 3AWEA 5FKPA 5IEKB 1EHNA 1FNEA 2E9JA 4FQXC 3HG1B 3CSTA 1MZZA 3LAFA 4PRHE 2GPZA 3NZ8A 1TTGA 3CFTA 4GKOA 4X8JA 4XP4L 1QTSA 2YXMA 4P4KC 4DSYA 3Q8BA 3B8SA 2OMBA 3DRTB 4NOBA 3T6WA 1SLVA 4G7VL 1BZ9B 5CLYA 4KKLC 5D71H 3KPLB 1NC4B 2KZWA 1HT6A 1Q1PA 5BW7A 4JLRB 3KM1A 4LPTA 5E1AA 3KGSA 5DVKA 1E8XA 1LO4H 1X44A 1DN0B 1CLYH 3PUCA 4ZODA 2PXYD 2XTSA 3VI3F 5F6IB 3E8VA 2APWA 5F3HB 1L9RA 2WN3A 2NLJA 5C09A 1X5ZA 2A9BA 2EDDA 4X98B 4NUMA 3QPXH 1J5DA 2HT4C 3H9SE 2K0RA 4PLKD 5D5MF 5E1QA 4Z76A 4NI6A 2EC9U 3AREA 3HC0B 3MAWA 5MEOA 2JNZA 1BQLL 3BEWA 3OAWA 4Z7AA 5FYJE 1I3GL 1SJHB 4I77L 4G80A 4ONGL 4X9YA 4HH8A 4NI3A 1OE1A 5AW2B 1S7RB 2DQEL 5D6DA 1FFOA 3EO1A 4FKEA 5J3HC 3SEPA 3LEVH 1Z9SA 4I2XB 4C4BA 3RDTB 4S0SD 5GRVL 1SJEB 5ACZB 4Y5VB 3F65A 4NN6B 5F3BB 1NMAL 2MJWA 2RBLA 2P43B 3VXRE 4L8DB 2CXGA 1CFMA 5BCAA 3ARDD 1G7JB 3FB6A 1NDMA 1KTCA 4UNIA 3AS0A 5GGSY 1FG2B 4MJIE 3RNKA 4LQ1A 1F42A 1U2CA 5KSVB 2W07A 1PX4A 3FTZA 2BHYA 3SPHA 4JHAL 3V6BR 2H3XC 5H35B 5EBWB 1PW3A 1ZVHA 4NAQA 4TKWA 1G9MC 3GSXA 4G72B 2JKSA 4LLMA 2ZTBA 4GFXA 3QQ4A 4JZJA 2YN3A 1WBYB 5A6LA 4ODUA 4PJAE 1CGWA 2UXFA 4G8GA 2Y36L 4X80L 1JF1B 5KANI 2NY7L 5IG7B 2FO1A 1DVUA 2RHEA 4NUGH 3WNMA 2MPVA 1A2YB 1IM3B 1E27B 4Z7UB 5T1DL 1P2CB 2ADGA 2YAEA 4IS6B 4NWUL 5T1KB 4HA1A 3MZGB 2HFFB 4P3DA 3UBXB 4ZMLA 2NUPB 4OCWH 4WRLA 3O6FC 3NPSB 2IV8A 1IIIA 2FX9H 2CO4A 3ULSB 1O9WA 3L3IB 2HMID 3IMTA 4UDTB 4HHGA 4G6FB 4QCIB 3KBPA 1ODAA 4AQEA 5J5EA 3IJSB 3CFBA 4Z9KB 5CR1A 3OQ3B 4D9RE 1FVCA 4FQXB 4KRMB 3ZE1F 1KIRA 4F7TA 2WVVB 5E9DB 1A1OB 3PAZA 5TDNB 1FFPA 1FZJA 4PYHA 2Z92B 1JGLL 4P4KB 4M6OH 3VE0B 1EUUA 4LVNC 4OGAC 5ECJE 1ZT7B 2G5UA 5I1HL 1X7SA 3DMMC 4OTXL 4JRFA 1X9LA 4H0IA 3FZUD 3QFGA 3U7AA 2YR3A 3EYOB 3FU3A 2DWSA 4G9FE 4ODSH 5AOZA 4C83A 1YY8A 3MLPA 2R23B 1PSKL 4HMEA 3D0AA 4N4YB 3LD8C 3D33A 1N5AB 3L4YA 4GJTB 4FADA 1FZMA 3FRUB 1CFTB 4M61A 2CHWA 1ZHNB 4HJGA 2YPLE 1JV5A 3WFCL 4GLRH 3OHXA 3SY0A 4YSTA 4PRHB 1CLOH 3KNBA 3DO7A 3I6GB 2P7TB 4RX4A 5IK3B 1M6OA 3DRQA 5EO1B 4Q14A 3U6XS 4BQ8A 3RVTC 2XJKA 5CF3A 2DBJA 3D50A 4NO5B 3OMIB 3GI9L 4ODHH 2ZE0A 3ATDA 1PF3A 4AEIH 1B90A 1R19A 3HMXH 1ZS2A 4HGWA 3VAEA 1EA9C 3IF1B 4ZO8A 1CR9L 2P49B 2J7LA 2XBDA 2VW7A 3RVXC 4PP1D 4JDEA 3HUJB 4JAMA 4B9PA 2DI9A 1A22B 3PWNA 3EAKA 3JWNG 3POCA 1QSEA 2VMCA 1U92B 2BSBA 5HHXL 4ZO9A 1M1XA 3WFDH 4BQCA 1JGEA 1KLFB 3GGWB 4NZTH 5L4FA 4LDOB 3EGDA 4KXDA 3OB0H 4XPAL 2Q0ZX 3CSPA 2Y9RT 1BFTA 1GYWA 1N3NA 2CGRH 3HEIB 2DL9A 5CILH 1N2RB 4RISH 1W0WB 2MNWA 1D9KA 3G6DL 2VDRB 2VOTA 3FAWA 3DV4A 4AV0A 5FW8A 1UVQA 2EDXA 3H1ZA 3MLTA 3DROA 1IC0A 3OXSA 4F37F 4J2XA 4LRNH 4J3OC 3CZEA 1G9ML 2DWYA 2CRMA 1ZRUA 2LU5A 4PHZA 1OM9A 1YCSA 4K5PA 2Z31D 1AXTH 2VDRL 3LYRA 1EXUA 1S9WB 5D7LB 5LGJB 4WTWA 3O6FB 3STBA 2VXSH 2AVGA 4ODVL 1WT5A 2EILB 2OXHB 3IN0A 4Y19E 1WFOA 1IM9B 1NFKA 3TVMD 3CN3A 3HFML 3IU3A 4MJIB 3QJRB 5F93C 1OCZB 5CFHA 5IWLA 3OKMA 3RWIB 5JHDA 1IAII 3QJSB 1I8LC 1HXYB 4YNYB 1VGEL 5C86A 3WAKA 4O5LL 1LEIB 5CJBA 4POUB 4JM4L 4ZNCD 2E7LA 3O6ML 4FQ1H 5E8NA 3JWNH 5GGSB 2B9AA 1D5BB 2DTMH 4PJAB 5B1JC 3KJ6H 4LVNB 2GEEA 3RGVC 3UPCA 3N55A 1KNOA 2Q2LA 4NO0D 1HHGA 3U6XA 4GSRA 5I0YA 4V1DD 5T1LA 3UC0H 3KPPB 3NA9H 5LUMA 1FFTB 1EHAA 2VLRA 1B0GA 4KDTA 2WKOF 4LSDA 3UTTD 3LD8B 5CCKH 1N8ZB 3SGDH 4KTDL 3RHWK 1AACA 1QFPA 4JCLA 2R1WA 4HIXH 2JMRA 1VFUA 4RFEB 3SN6N 1BWMA 1EEUA 3EGSB 1NLDL 1TG8A 3P9WB 4MHHI 5ALCL 3X12B 3K6IA 4HWZB 1F0LA 4G2AA 4QHKI 2DKMA 4R7VA 3V4LA 5HJ3A 4BK8A 5HXMA 1A6VH 1BQHG 1CFNA 3QFJD 4O2FA 4WTQA 3ZT5A 3VDBA 3QQ9C 3GZOA 3MOAH 1BGXH 5AYUH 2B0SL 2B15A 4L4TA 3RJOA 3NFSL 3REVA 1ROWA 1CD1B 1MQKH 2NCEA 3TGXA 4L0YA 2X3AA 1VIWA 3D51A 2NTSP 3VFOB 3ASWA 4UNVA 3FO9B 3BLKA 4TULL 4WFFE 4L4VB 5EEWA 4Z3EA 2NW2A 1SZNA 1QO3B 1AHWC 4ZMVA 1JFQL 2IDQA 4OQTA 4PRBB 3UOAB 3QEGH 4XN7A 3QQDA 2ATKB 1PZSA 1TMCB 3LDBC 2OI9C 2YS4A 4GMTH 4LZKA 2YPLB 2X70A 1RJYA 1H3TA 2ADFL 5I75B 2WVUA 1FYTA 3TA3A 4URTB 3DUHA 3VXUE 3VXSE 3WIHA 4NYLB 3GMOB 5MEPB 1QBMH 2Z1PA 3OQRA 2N7SA 5HYQA 2X9YA 4PV9A 3EYFA 1F3JB 3CH1A 4U1KB 4PJGA 3V2AR 4KGJA 4KI5D 3BH9B 5FDWB 1KXHA 1XF1A 1FRGH 3DX8A 4JY6A 1H6EA 4PEEA 4A38A 3B5HA 3V79C 1II4E 1JPFA 4FN0A 3QJZA 1ZA3B 4ZFOA 3TBVA 5DD3H 5B4MC 4DUXA 3Q2LA 4ZMTA 4S1SL 3OKDB 4X4YB 3MLXH 4GIOA 4P5MB 3IMWA 5HGHB 2AQ1A 4AGMA 4PTTB 3MKKA 1QTYT 3U30C 3IJYB 4LLQA 3SBWA 5AAWA 3LIZA 5C08E 3VI3E 1WO2A 5JW3H 2TSBA 2OFQA 4HWEH 5E5MA 5FB8B 3FUKA 3INUH 1L9TA 1N5YH 1GY1A 1P6AB 1PQZA 3O81A 5D5ME 1RUKL 3CUPA 4N1EA 2O5YL 2P5EB 3RGVB 3EOBB 5DDHB 1KJVA 2DICA 4TSCH 4UIMB 5B1AB 1F6FB 1F4WL 3RY6A 4AENB 5B8CA 5ETUB 3CFUA 1N19A 2ZWNA 4O4YH 2E9BA 5C0RL 4W1TA 2P8PA 5TGBB 3PGCB 4OF3A 4QUOA 2P47B 1OAXH 5C0IB 2H0EA 4Y19B 1ORQA 1T2QH 2HA1A 1SYSA 4IGBD 4QRPD 4R3SB 5CLXA 5L2KD 5INDA 4FMFA 4D9QE 1NBZB 3OLDA 4PJHF 5B7FA 2WZ0A 4X4KA 3TCLA 3VWKA 4G8IB 2N3JA 1UACH 4RIRB 2EKSB 5FOBA 2VLMD 5JUEH 3NABH 4HKXB 3HG3A 5K69A 1E4WH 1ZVYA 4JE4B 1LM8V 3QA3A 1L7IL 1LNUB 4ZTOH 3O45A 3U83A 3D12B 1DQTA 3HG1D 4NC1E 5ITFA 3MRBB 1G6RA 1RAMA 2VDLH 1A1MA 1JUFA 3K71A 1CLZH 2C9VA 2LHAA 7PCYA 3FSAA 3X1BA 1PZBA 3D08A 1EDHA 4DGIL 1NC4D 1GGIL 1UKSA 1AHWB 1ZEAL 3GS7A 5TQ0L 3H4HA 2F6AA 3PP4H 3QUXC 1D7CA 5JOEA 3OAYK 5IMLA 4U4IA 4RWYH 4XAKE 1KB3A 2J1ZA 2OI9B 3LDBB 3QCTH 3WKQA 1RIVL 3QEUA 2UWEF 2JIXA 5C0CE 4X7FC 4WW2A 2A74C 4TMPA 4G6MH 4YE4H 5HD8D 4EKJA 2F7PA 5A2FA 1Q9LA 1TKWB 4AMWA 2CAKA 4ETYA 1UURA 3MNWA 4XPHL 1J87A 4FFYH 1HSBB 3AQZA 4U1SB 1B0WA 3Q44A 4Q6YA 5ITBH 4QRRA 3MYJB 4NC1C 4XRCB 3EDJA 3FN9A 5HHQA 5I30L 1CURA 3D9AL 3NJFA 3X11B 1PU0A 3L1EA 4UQ3B 4Y1AB 5EC2B 1JHLL 3EJPA 1EH9A 4ZFFA 4PI0A 5K9JH 5F9WC 1AZRA 4JDTL 3MRIA 4LLYA 3MV7E 1A3LL 4M8VA 1DVFA 2BSDA 2HLAA 4NRYA 4U6XB 3WS6C 3AUWB 3UGXA 5B38G 2DQDL 5DZNA 1ML0A 1TQBC 4R7DA 3BSGA 1EO8H 1RPQA 2ALAA 2KHAA 4JX0A 4XNMA 5G2NA 2YPVA 4JFEE 3U30B 3HVDA 4NSKA 2VL4A 3Q1SH 2VR6A 3K6DA 2WMPB 2YKLL 5KVDE 5DO8A 3QHZH 3DYPA 4XBEL 5JPMA 2C9SA 2DQIH 3QFDB 4RMVA 3VXUB 4IK6A 1NA8A 4JFPB 3VXSB 2OJ1A 5A2IH 1WA0X 4J12A 4NC2B 3GSNB 4FLQA 4X5WA 4AQOA 1LQBC 3ZHKA 1TVBA 1AGEB 4OCYL 4N0FB 4QD2E 1GZHC 2WXLA 1Q38A 3LQMA 3NSXA 1IE4A 3ENEA 5JR1L 3VGGA 3GSNL 4TV3A 4YPGA 2D03L 5DC4B 2PCYA 2ITEA 2OTPA 3CNKA 4Z77B 2EIKB 3K74B 1UD3A 3V5DB 4AK2A 2UYLA 1IM3D 5GS3A 3DC0A 1UT1A 1CT8A 3C75A 5T1KD 4U1NB 5GGVL 3L3DB 4E9SA 1VENA 5C08B 3B1UA 5DHVH 4ZTPL 4L18A 3IN2A 3TO4A 4G1EA 4G6FD 3VRJA 4QT5B 5AKTA 5JQ6H 3PU7A 4NLHA 3K2IA 1B2WL 3UMNA 1IGYA 1GS8A 2F2HA 2GJZB 1FC1A 1S7TB 1XB6A 2XY1A 5D5MB 1WA2X 4AL8H 1MCIA 2DEXX 3ZOAA 4MA8L 1AY1H 4FQXD 4XMVA 5BOJA 4JK0D 3QHTC 1UH2A 3KDMA 5E9DD 4X99A 2Y69B 3NRPA 3RHWF 4N2EA 1PZ5A 2QHRL 2Z8SA 2ZWKA 4GO6B 2WQ8A 5HJBA 1SVBA 1Z9LA 3OSVA 2ZCKL 3MROA 4PM1A 4KX9A 3QG7H 1ZHKA 1BYNA 4OCXL 2DZEA 3VVWA 2BNQB 3L9EA 2X89A 2VUYA 4KROC 4UT6A 2C4XA 1M1SA 3BDYL 3GSQA 4X8XA 1UYWL 3MR9A 5DLMH 3RU8H 2I9TB 3THMH 1WAAF 2J21A 2OTWB 1KZQA 4WGWB 1OHZA 1TJHL 2A74B 1GY2A 4QHUB 4YL4A 5FGSA 5AVWB 1DBKH 1R5VA 4MXWL 4HV8A 3T65B 7FABH 4ZMPA 2XETA 3P4NB 2FE0A 3OKEB 1AQKH 2HTLC 4F8NA 2VIRA 3U36A 1KBVA 3OKLA 1ETZB 3GXPA 1DSFH 5T8IA 4Y9FA 4HD5A 2VISB 5E1GA 4O51B 5D7IB 1XZ0B 2J1XA 3QZMA 2QPUA 5F9WB 5J3HD 2F7OA 4NRZA 4C55A 3R7QA 3MTXA 1MY5A 3TEXA 2VERA 4BQBA 5I9QC 3AROA 4LSVH 3T8MA 5DGRA 1XB3A 2Z4QB 3WE6A 4XPFH 1TQBB 4N6RA 3R1GL 1QRNA 1WZAA 3ZVVA 2WKGA 2OJZH 1D5MA 2J88L 2RQEA 1ASOA 3G5VA 3LJ3A 3RKDD 5AZ2L 3HPLA 2J56A 4DKFL 5EC1B 1FL5A 4KJYB 3US1A 4GQQA 4HIJA 3B7TA 3AXHA 2F61A 1OGTA 3OMAB 1F4XL 4LCVA 3U4EB 4JN2A 4EDXA 4JPVH 1X9RA 1F2XK 3HN3A 1AFVL 1DLFL 3KL0A 4YSAA 4UTAL 1L0PA 3ZMRA 2LU3A 1WZ1L 3RWFB 2IMMA 3MV7B 1GZPA 4FA6A 4P59L 5JW5A 1CI5A 2Y7LA 3GBDA 3DIVA 4W4NA 3N44F 3U46A 1R17A 2VXVH 3DHMA 5L9DH 5EULV 5D7LD 3T09A 3L5JA 1BBDL 4JR9L 4JFEB 3O6FD 5AALA 1D5IL 4DP4X 1RJLA 1YJDL 2JE8A 1A4JB 1WITA 3Q2VA 4MJID 1DL7H 4LVEA 1HL5A 3OJDB 3GMPA 5DRZB 2VW4A 2XYCA 4IEFA 5C0EA 4DETA 1AANA 2F0CA 1LDPL 1HKLL 1IGIL 4YDZA 3GD1C 3F5WB 3EOAA 1EVTC 1NGQL 5EU4B 5FECB 2HYMA 3CXDH 1MCKA 4U1HB 1UD6A 3QWRA 3NTCL 4Y2LA 1N12A 1NEZB 4WWOA 1EJFA 4L1BA 1LE5B 2FIKB 4DN3H 2EDYA 3T4AC 1JWUB 2E27L 5C71A 4FHBD 2G3ZA 1RKRA 1TIUA 1Y18B 5ISZB 1GHFH 1VEOA 4JQXA 3C60A 4G7YH 3TPKA 1GSMA 1S8DB 1NBVH 1XCTB 2XWJB 1W8EA 4LCWE 2O30A 4GYBA 4EN3C 3VFRB 5IGXL 4Q8BA 2QSTA 3QIUA 1GPOL 4LASH 4MX7A 1AS7A 3SPGA 1J05B 1M7DB 4HPOL 1WYJA 5E6RB 2IXQB 3UJTH 5JIDA 5K1JA 3VNYA 2J5WA 3VW3H 1TTFA 5EU3B 5LCVL 1EHXA 1QBAA 4HUMB 1ZJAA 5C0GB 1T20A 4J3VA 4D9RD 1F4AA 3QIBC 4L5FH 1D3CA 2Y23A 3DSNB 4HKJB 1J8KA 1SJXA 5DGQA 2GUOB 3NSJA 5DD0H 3RAJH 4NGHL 2XZZA 3ZX1A 1T04B 3RVTD 3BGFC 4OY9A 2X6UA 5I9QB 2Q7AA 1INDL 2JCCB 3ZSSA 5ID1B 3PL6A 1TJIH 1UXSB 4JFYA 4XNYL 4KKZA 3IPBA 5J56B 5HHME 3MA9L 4Z5RB 2VM3A 2JKLA 1AAJA 2PP7A 3UEQA 5HDQL 1LWJA 1U30A 3P73A 3N85L 3RVXD 4GQ9H 1A6UH 4L4VD 4N2DA 3VXOA 1AQDB 1WUNT 2ZJSL 2H1PL 2W0PA 2Y5QA 5EO0A 2NUTA 4KVPA 1FH5L 1I3UA 1CTMA 4OLUH 2YPLD 3HI6L 3LRKA 2CKBH 1HHIA 1QNIA 4X4ZA 1RULL 3H9ZA 4NFCA 3SYCA 1M7IB 1MCPH 5DO2C 4EVNA 1J0YA 1JZDC 4KRLB 3IRZA 1W72A 4ZPTA 3B2MA 5IJVA 1BYOA 3PDGA 2JQAA 3GS4A 1A7QH 3O3EA 4G42B 4J3OD 2ZYHA 3QI9A 2AEQL 2E46A 1QBLH 4QLRA 3EH1A 3UYRL 5D7KE 1G1OA 2LLLA 4X7CC 5GGTA 3B2UC 2GIYA 4A7GF 4EI6A 3G6JA 2XWXA 5C0DB 4KWUA 4GO8A 3QYCA 1CL7L 4IJ3C 5IP4A 1TFHA 3T77B 5A2KH 4X9IA 4G6AD 4NKOA 2YUXA 4GW4B 4UM9B 1UCTA 3HHSB 4AZUA 4BZ1A 5CJOL 4QRFA 2APTA 4WWKC 4BDVA 2DI7A 2ENPA 5KYYA 1M42A 4BSVA 1NGZB 1Z9NA 1A4AA 2G30A 1A6ZA 1CICC 4O2CB 4YSQA 4NP4L 5C0FA 4JFHE 2EQDA 3CD4A 3MRMB 3SPJA 2FT7A 2R56L 1H5BC 4IBLT 3T4AB 2P5ED 3KWWA 3RGVD 4HX1A 4XWOC 3DTDA 4Y9CA 1GMEA 2H0JA 3MBEA 4K73A 1T1YA 1ND0B 5AW7B 4BZ2A 3DOSA 3WJLA 4JZOB 5C0AE 2O5ZL 4JJ5B 2ZXDA 4MQ7A 4XMWA 2CO1A 4NQXA 4EN3B 1K72A 3JSSA 3L3GA 1NIAA 5HYIA 1CGSH 3SE8L 4DZBA 1JGIA 3L7EB 3MRPB 1E9PA 3CFDB 1TYJA 3CDCA 3GO1H 4KFZC 1I1AA 3V95A 4NIYE 4AH2B 3QIBB 4XNZC 2BIPA 2CDGB 43C9A 1MFMA 5BS0B 3KPQA 4AZ8B 1U8PA 4K55A 4EIZC 3PIQA 2OYKA 1Q9KB 4BFFA 3BUPA 4GKZA 3BGFB 3EYUH 4U1JB 1TYRA 4A2MA 2ITFA 3VCLA 1CF1A 1NPJA 4GRMB 4A2HA 1PJWA 4OCSL 3QUKB 4AY0A 1EMTH 2G60L 1WFIA 2PMZA 4F9PA 3IT8D 5I0WA 2R4RL 3K0WA 5DD1L 2XWDA 1N0LB 1ZLDA 3F85A 3NCJH 5D70H 4PV8B 4XTRC 1RP9A 1WJ3A 4E41A 2VAAB 3MOQA 1NWPA 3PQYA 3T1FB 3X14A 5E5UB 1KLUB 4FNUA 1XGPA 1OWWA 3ZL4H 5FDYA 1K85A 1BZOA 5CWSB 3AW5A 4K4KA 1I8MB 5FC9A 5IVZA 3CSBA 1KGWA 2R69L 3ZQWA 2Q3XA 4JFFE 1H6TA 2E9IA 4FA7B 1AD0B 4Y1AD 2RFXB 2UX6A 2YZ1A 3FCTB 1KPVA 4LCCA 3E1F1 1H3VA 2SEBA 5HHMB 1OKEA 2AXGB 5EO9A 3FU7B 3DKHA 4WFFD 3PWPA 5B4MD 3AMLA 5F8RC 4HKBB 3F01A 4IJ3B 3IS0X 1T4WA 2FRGP 3OKOA 3TBYA 5I5JA 3RL2B 1AZUA 5F9OH 1K2DA 1N10A 2WINB 3MV8D 4S1RL 1WAAE 3HHMA 2B9BA 4WWKB 4AXWB 1N64H 4G59C 5C07A 1L9PA 1M7XA 3VXUD 3HZKB 1EGJL 3VXSD 4Y9GA 3DX6B 4CN4A 3O3AA 1LP9F 4NIKB 1U6AH 4FQQA 1YSOA 2F1AA 4QRUA 5I5MA 3K46A 1H5BB 4V33A 3D39E 3L1FA 2QADC 3AXLB 3WIFA 2UY6A 2CDEA 5D6CB 3VXNB 1J5OH 3BI9X 3FHQA 5ANHA 1K3ZA 1ZK5A 2W60A 2P5WA 3GI8H 4GOSA 4N90D 4X6EB 4WNQB 4BGDA 4TPRH 4EKXA 1DYZA 3P4MA 4FYTA 5F0JB 1WK0A 2Z7YA 4MAUH 2YEQA 1LEGA 4YHOH 3HNTL 5EUOF 3N40F 1GC1C 1KEGH 3PABB 2FZ3B 4JBSA 2RR3A 3CC1A 5DJ2B 4XNZB 4LKCA 5EV7A 1ZE3C 1IRAY 1CK0H 2IH8A 4NZRL 3TURA 2ADIB 3JTTB 3WI9A 4XPTH 3QUMH 1OAUL 2JJSC 3L6FA 1J1XH 2YAHA 3E6FA 3S4SG 3OB0K 3QXTA 2HTKC 2JLLA 1BJ8A 1Z9MA 2OR9H 5H94B 1UEYA 5T3ZE 3F64A 5CZVL 3JWDC 2AK1L 3VFPB 2XVLA 3GJFA 5C0AB 4H8HA 1VA9A 4FZEL 4JM2F 3TT3H 5IVXA 4GKLA 2HJKA 3F12A 3R06A 4RDQG 1KGCE 2BNQD 2R2HB 5EN2A 4ZXBA 3GXFA 5IREA 3I84A 4P9MH 4M8QB 3ZE2F 4CAGA 3MV9E 2OCCB 1E5CA 3DUSA 1UB6A 4Y5XC 4D9QD 1HK6A 4L9DA 1TJMA 2EDOA 4RMSA 1I7RA 3GEWB 1RUQL 3WTTA 1GAFH 2F19L 1DSYA 4DN4H 1LD9B 4H1LH 2E8YA 4GXFA 2AGJH 2N01B 3HZYA 4UV7H 4XVTH 3UH8A 3HNSL 4NNXB 5GGQH 1UOWA 2EZ0C 3MRHB 3E6HB 3LKSA 4WUKL 4DIXA 4HYTB 2GYSA 2DLFL 4HUNB 4PRDB 1WD9A 4JO2H 4OGXL 1KTLB 4AEHL 4ZS6C 3VXME 1YEKH 3IU4L 3ECQA 5D9SB 1HZHH 5A16B 4XP9L 5DUBB 5F96L 1S4IA 3V6ZA 2W9EH 1FWXA 5KWYC 4G8AC 4YVUA 5AVRB 5A3IC 4ODXA 2FBJL 1TQCC 2A0LC 3AM8A 4XAKD 1NCDL 4JO1L 1KOAA 3LKRB 4XMPL 4PMEA 4HC1L 1ITBB 3TC9A 2V6HA 4P2QE 3VXQA 2EDTA 3LN5B 2EH8H 2R1XB 2VSCA 2IQ9H 3VMOA 3VGEA 4GQZA 2GTZA 3SGEH 3IRCA 3FU9A 2Z93A 2QADB 3NJXA 2P28B 4JFFB 1VFBB 1YEDB 4GQPH 1S3RA 4KU1A 1X5IA 1DUYB 1OTTC 5GSVA 3A22A 4N0YH 4AM0B 1KGYE 2JSFA 3MBWB 3E9UA 3BP7B 4BKTC 3H2QA 3HC2A 1IKFH 3MCKA 4M5TA 4PWJA 3BN3B 4O02A 5DJ6B 3FOMA 4HGKC 3MRCB 3S3CB 4Z6AT 5TF1H 2AXJA 2R29H 5E4OA 4GUPA 4Y4HC 3G5ZA 4ORGA 4M1DL 1EO7A 4OCRL 5I1EH 4Z7OB 1JE6A 1TEFA 1RP8A 4MGXA 4C4KO 2Q2EB 3D39B 2Q1EA 1GW6A 4A2FA 1U4EA 4QO1A 2EUZA 2XA8H 1BEYL 3FNKA 4OJAA 3UROR 4OZGE 1E4JA 1GGCH 1I9JL 1C08B 3HR5A 1FQ9C 1L6ZA 3OJVC 3VJ6A 3N9GL 5ISZD 3ZRCC 3MLSH 4PRNA 3JWDL 4ZX5A 2ATAA 1BD2E 5JYMA 4X6BB 4Y5XB 1OPOA 4JHWL 2VDPB 3STZB 1SXNA 5GRZA 5IQ7H 1NFIA 4IRSC 2NR6C 3BZ5A 1ZT1B 4OFVA 4ZOCA 1I8KA 3KGTA 4JFXA 1AJ7L 1FNSL 1ZT4B 3C8KA 5DC0A 2HTLD 2W0LA 4Y7OC 2QSCL 1PBYA 1UGKA 1CZ8L 2VDPL 2C1PB 4CADB 3Q6FA 1QX1A 4H0GA 4P23A 3WHXA 1E3FA 5CU9A 4AGQA 2ZX7A 5EEXA 5F9JA 1FI8C 3BPNC 5E0FA 3L4CA 3STLB 5ICYB 2PWDA 2OZ4H 3FKUS 3ROOA 5LVEA 1SOSA 5G5DB 5IB2B 3X13A 3FTWA 3FU0A 4L3EE 4A2LA 3N44B 5T3ZL 1NAMA 4MTMA 4UUJA 1TQCB 5D1ZI 5ADPH 3MV9B 2O6PA 2XKNB 2VLLB 5IQ9A 4RGNE 3D48R 2R1YA 4R8WH 2HH0H 2L0DA 5DWUH 1YY9C 3AWGA 3LHAA 4FNQA 4HWBA 3DXAA 4YPJA 2G9HB 1HINL 1GS7A 5JXAH 1G1KA 4DH2A 3FONB 1AD9B 5I5IA 5DVPA 4GEIA 5F7NC 2D31A 4KO6A 4QRTB 4F2EA 2J5LC 1MNNA 1RIHH 4B9GA 4PBXA 2OTUA 4BINA 2EEXA 3IGLA 3B7SA 3A4AA 1RK0A 4IBYA 1JPGA 4UQAA 3X3FH 1TSHA 2V9TA 3SPCA 2YXFA 3VXMB 5GGRA 4X8CA 5G55A 3IFOB 3FFOA 4LAQH 4JO3H 1YNTB 4PRIA 2XYBA 2E56A 1VAHA 1XGYH 4Y4KA 4APXA 5GS1B 4UOW0 5GZOD 3SYQA 3ULVH 4X6CF 2ZPKL 1CBJA 3FQTA 4I3RH 1ZS8A 1RU9H 5I5RA 3Q13A 4RGNC 2ZX5A 3MCLL 1HAUA 5B39A 4OLYL 1W0VB 4JHBA 2R0WH 1CFSB 3QWOA 4Y4HB 2WWKT 4NHUA 3U82B 1YDPA 4FFVD 1MJUH 1M05B 4HZ1A 4UM9D 2BP8A 5CHNA 3HNVH 4A68A 5C0JA 2ZIDA 1LWHA 2A83B 4FQHB 3WE1A 1N7MH 5ICZB 4B96A 1MAML 3CFMA 3H53A 3ARYA 3BT2L 3F84A 1JK9B 4WEBL 3MLWH 5FFLA 1IGTB 1R24B 1Y6NR 4UQ9A 1T0MB 1VESA 2MOQA 2QSQA 1KYOJ 4PJCF 1AOZA 4PJEB 3FT4A 5J6HB 3SGEI 2KLTA 3WBDA 5C2UB 5DD5H 1J5IA 4EXPX 2JKIS 3S36H 4NUJB 2YEZB 5CGTA 1TNMA 1AXSB 2FQDA 4EN3D 4EIBA 3MHZA 4LOFA 1KENL 4IRSB 1XHHA 1GA2A 1O9VA 4JO4H 3TFKC 3GPEA 4N1HB 2YN5A 1KTDA 4JPIA 2MOGA 4G9DB 1YECL 3CZLA 2HB0A 2QJDA 2FWOA 2YARA 1A21A 1AIFB 4E9YA 4N68A 4AIXA 4P2RB 1GKOA 1N4XL 3CN0A 4JJOA 4PB9H 1MCRA 3QIBD 3I9GL 4U6YA 4B9IA 4ZMZA 4PD4J 5BS0D 5DQ9A 1QA9A 1HOCB 2C4FT 4OZGB 5BV7H 4F3FA 4B9FA 1EVUA 1WTGT 5CU5A 3L17A 3DX0A 1C5CL 4QYOB 1JCKA 4PJFF 3GHPA 1QYGH 2KL6A 1DJYA 1ZIBA 2FX7H 3O11A 3EG9A 5F9AC 5CD5D 3I6LD 3T0EE 4K94C 1KIPA 4M9OA 5HDOA 3SKJH 1HHJA 1Y0LB 1G7IA 1UWEL 2YAPA 3C5ZC 4NO2B 4NM8H 4YFLI 3NACH 4LGSB 1IFGA 2DJUA 3PHQB 2ZUVA 1N67A 2BP0B 3G6AB 4PBDA 2YD9A 5AYTA 2J5LB 1UB5B 1B9KA 2H2SC 3O9WA 4OIIL 2N7AA 2IO5A 4OJFH 1AZCA 4KOBA 1A4KB 3VMNA 1FGNL 5K9OA 4FI6A 2ZQKA 4JANA 1ET5A 3VXTB 2CLZB 3VWJA 4G6JH 5DS1A 2EVHA 1IC4H 4IU2B 5ANME 3S98A 4UTBH 3GKWH 2B20A 3MXVH 5SWSE 5DS8A 4AQ1C 5GIRA 1YAZA 3U4AA 5HHMD 4C56E 2BK8A 2FYYB 3QS3A 4RGNB 2GY5A 3BHBB 2BH0A 3BW9B 4RA3A 2HFGH 3VB8A 2DJSA 3GJFK 1JYVA 4E5XA 5GSRB 4K7PY 1OQOA 4UT9A 3ZE2E 1MDAA 4EZJA 3RX5A 5LXGH 2CWRA 5J9PA 2WB1A 1IC7L 1MRDL 1RIUL 4K9EH 1UWFA 1FHGA 5AVSB 3MYZA 15C8H 2MCPL 4X7SL 1H19A 3ILDA 1GJWA 5DR5H 2ZICA 3ZQ9A 4GUQA 2BCKA 2L7EA 2JELL 4N2NA 2CNZA 4PGBB 3BWAA 3RFRA 1S7SA 2AJXL 1HL4A 1XGTA 1F1AA 2VR3A 3B3IA 3KXFE 1GGUA 3CU1A 4WO4D 1XCQA 3HBZA 4DKTA 3BP6A 2W5PA 5JIKA 3D2TA 1F3DJ 4FQ2H 2J6EL 4FCHA 2ZSWB 2B1AH 3KJ4C 4MMYA 2QLVB 5L8KB 2IDTA 1WA1X 3FQNB 3GSRB 3CHQA 4PJ5E 2WN2A 3ASNB 5FR3A 1L0QA 1J10A 3L1OH 2O26U 4OI8A 4GP4B 4HJ0C 3DBXB 3ZRSA 3RWHB 2ZKYA 1G7QA 2PKDA 2NY5C 3O6LH 4JFHD 3L4ZA 5D1ZA 4Z78B 5HYJE 1MN4A 4PWEA 3HAEH 1K8DA 3LEYL 4PCTA 3AADB 1MH5A 2EIMB 4QXTA 3T3PE 1RV6X 4BFIB 4WHDA 4O9HL 3BDXA 3X1FA 5IHUH 5C0AD 3OG6B 5EOCL 3RFZA 4FQJH 1R5WB 4OUOA 3U79A 5AOLA 5GHWL 3NRQA 1A4CA 4HCRH 4CILA 1RUMH 1UXWB 4GI9A 4ZMYA 5FOJA 3WJJC 2D3LA 1FPTH 5FS5A 3C5ZB 4NHCH 1CF8H 2Y5TA 3Q5OA 1H3UA 3H54A 3RVWD 4XTRD 4MFHA 3ZW3A 1B2YA 1OV8A 3QNYA 2R0ZL 2K3HA 3V0FA 1YLBB 3F7YA 3L3JB 4Q0XL 3CC5A 2IVFC 1G6VK 4HMDA 2FK9A 1HQ4B 2WQSA 2VDQH 1A0QH 1PKOA 4BEIA 2NYYD 3CCHA 3CSGA 4ZD3L 5L0QC 4HHAB 3B6SA 2ID5A 3TNNA 3IJEA 2Q87A 5KSUA 2V7NA 4PN6A 2QQNH 4AQ1B 5FKAA 2Y5EA 5B7MA 2D9CA 4OVVA 3NIFF 2E59A 1YPZF 5IQMA 2WCSA 4D0DB 3WD5L 1X5FA 1T2XA 1XH3A 1KJMB 3WNJA 1CFVL 5TE6H 1EFXB 1XGQB 4X7TA 2XNAA 3M1OA 1ADQA 1BAGA 3SDXA 1YNLL 1G0YR 4HF5H 2QQQA 3Q5YA 3BN9C 5IOKA 5KTEH 5CBAA 4FZ8L 4NQVA 2CHDA 5IJKA 1MOEA 4WEEA 1SLXA 5F89A 5HHPB 1TZIB 4X5QA 4KHTL 4J3TA 2UZXB 3DK0A 3LZPA 35C8L 3NJIA 3A21A 2JQMA 1I85A 2XN0A 3QHFH 1UA6L 3I6KA 1XAKA 3KGRA 3PJSA 1QHOA 5ANMB 2X40A 3C5JA 1WIPA 4K8RL 1B3IA 4MA1C 4OJEH 3RWDB 5SWSB 4CC0A 3NJJA 3DVGB 4C56B 1BP3B 2TSAA 3FPYA 4FFWC 3B1TA 3GMNB 2XWEA 4S1DC 1OF2B 3S97C 2AANA 3LS5H 2F8OA 2WQRA 4XH2B 4XMTA 3NCCB 3T2OA 4D2NA 1DE4B 3KJ4B 3ZE2B 5FCUH 3P4OB 4Q52A 5IHLB 1EPFA 2CO6B 3ZTDC 1S9XA 2BS8A 3WFEL 3IMRA 4C4UA 2EIZB 3FB7B 5HDWA 3BE1L 1JZ2A 4YHMH 4XN9A 1I8IA 1AZNA 2VSMB 3VFNA 4U0QB 3FT1A 1LO3H 2HKFL 3D3VB 4XE0A 4F8LA 4OD1L 1FN4A 5HYSB 4NDMB 3KPSA 3SE4A 5DJDA 1AQMA 4ZSOE 1I7UB 2XZCH 2HTKD 3B37A 5T5NG 4AQAB 1K4CA 3I02A 2KQMA 2VC2B 3HS8A 3P54A 5LHDA 1SEQH 1YEHL 4AUJA 1R3JB 4PS8A 3I9PA 2QR0A 2ARJB 1ED3B 2A4EA 2JK5A 4MB5A 5JOFA 3TBTB 4Y16A 3MODL 4EO5A 2XV6B 4MDRA 3IGAA 4DP0X 1P7KB 2VC2L 3NZSA 1KLGB 4I8DA 4NKDA 1OCOB 4E9QA 2AMGA 1IT9H 4D0CA 3N91A 9PCYA 4P2OC 4PJ5B 2EJ1A 2NNAA 3VI4A 3LN4A 1VFOA 1ZWIB 5TE4H 2Y7QA 1S5IH 5B3NA 1XGRA 1KN2H 1TCRB 2BDNH 2QTVA 4LFHD 3ZUCA 1A7PL 2OLDA 3BUYA 1FL6B 3DDFA 5HYJB 1BQKA 5DK0A 1QR4A 3CBJB 1EEYB 2Q8BH 2IOIA 4GIAA 3DX3A 8FABA 2OJEB 2Y0SA 3X3GH 1INEL 1OL0A 4U6TA 3Q3GA 3T3PB 3T9WA 1JXGA 2WIIB 3TBWB 4H7VA 4WDIB 1F58L 2OZ4A 4RFOL 5E56A 2ITDA 5AL8A 5T3ZD 2NXZC 4PJBF 1MFEL 1I9IL 3HC3H 1RK7A 1FO0A 1JGUL 4G8EB 4PJCE 1KB5B 4HDIA 3HOGA 5D71L 1G7HA 2COVD 4LU5L 2XWBB 5A3ID 3N40P 4PJ8B 2G75B 3CLEL 3SCMA 4NOFA 5F72S 1BECA 2A0LD 4CW1B 2ARJQ 5D8JL 3MRDA 3F7KA 1J9QA 2C7UB 1KB5L 2R0KL 4N1CA 3BVWA 2WLJA 4AX3A 1T89C 2I9LA 5IOPB 2WLIB 3GUFA 1SQMA 1ZDQA 4G83A 1UCBL 2F74A 4FKKA 2VUOA 3WLBA 5CIPA 5DUMH 3AG2B 5LBSL 5ESAB 3K2UH 2X4UA 2HX9A 1MRFH 2KPWA 4K3DL 3HIZA 1LO0H 2ORBL 4OZIA 4MA1B 1HJBC 1OTTD 4E0RA 2WD0A 3HE7A 3P0GB 5E99L 1A7OH 1C12A 1LO5A 4JRXA 5F1IB 2ENQA 2DN7A 3C8HA 3OJ2C 3RWGB 4F8OA 2MPAH 3WNPA 4YMPA 3U6RA 4ZK8A 2W65A 2Y1VA 5KVGH 4DVBB 1CGXA 3VDAA 3RNQB 4CMHC 1NGWA 2Q76A 4XX5A 1D6VL 1HL8A 1JVOA 2IQAA 1ZAGA 5TPWH 3QCUL 4ZUVA 3ZZQA 2BVEA 5EIIG 2AV1B 5I6NA 5CMAA 1P4IH 3AG1B 1XBDA 4CVZA 1WCBB 5HVWA 3JWNE 3T6VA 1KT2B 3FO2B 2HSIA 3PNWA 5JW4N 1S7UB 1ZSDB 1OSPL 4OD3H 3HFFA 4OJYA 1QMUA 4ESKA 2Z7WA 2AJSH 3WNOA 1MHEB 3BWUF 1T0NA 3IFPB 3B34A 1VB9A 4WFGE 2CD0A 2F54E 5CXPA 3UEZA 3WO3B 2WTRA 2WBJA 3LNDA 3OMZA 1KF9B 4J8QA 4PGJA 4ZOAA 4MLIA 3MRKB 3FUEA 3RJQB 3T2PA 5JPNA 2Y07L 2ZXBA 1TVHA 3SE3C 1S6NA 3ZYOA 3VD2A 2GT9A 3FSWA 3PXHA 4HFUL 4G7VH 3EYSL 2VSKB 2R0LL 5IJDC 1NCNA 3NFNA 2XN1A 4P2OB 2J25A 2AK4B 2CIIB 1SOKA 4IRSD 2NR6D 3S3BB 3DTXA 1NH6A 3AABA 4HK0A 4R7NA 4B50A 1IV8A 2G4GA 3CZKA 4HEPA 2BNRE 3JWNC 2X38A 3PUUA 1QW9A 5CKGA 4IBQA 3BUTA 1QPPA 5JDSA 4FAAB 43CAB 1NMCC 2XKUA 4P2RD 5B7EA 4DK6A 4ENEC 4ZSOB 4NPKA 4ELMF 2HCZX 1BF5A 1WBZA 1BQLH 2GJ6E 3U48A 4JEGB 2NXZB 3LPFA 2FATL 4CMMA 4IBSA 4I77H 5F1KC 4ONGH 2KS0A 4AUYA 2AABL 2E5EA 1VEPA 1U8LB 4GKNB 4Q58C 2VR8A 1AGBB 1EO5A 2DQEH 2HRLA 1H3PL 2HAZA 2QQKL 2X6BA 3RY4A 3V0AC 4D9LL 3LZRA 2F15A 4I48A 3S5LB 3QNZB 4X83A 3BUBA 4LCUB 1LMIA 5IR1B 1NMAH 3NG5A 3UBFA 4I0PA 1RZFL 1AQ8A 2LAGB 5CP3H 3IDGA 5L88L 1ZLUH 1BVLB 3G04A 4WFEE 4MDIB 4AGLA 5CGBA 1NGXA 3NIDE 4ES9A 3RUGA 2BVPB 1MAKA 2QMJA 2QZ5A 1ONQB 1CE6A 4IRZA 5AB2A 2EYSB 1DVXA 3IS1X 1E9OB 3ARXA 3WKYA 2Z4TA 1WFUA 2QKIC 2ZUSA 5B21A 4BFOA 4L48A 2F53A 3FN0L 4PJCB 3GTNA 2WLLB 5I74C 1Y6MR 3RVUC 4NBYB 2V2TB 3NJNA 3SO3C 1BWWA 5KYWB 3QDGB 5GRXG 2Y36H 4X80H 4MSWA 1RFDL 4LT7A 2NY7H 3FCSA 5DMGC 1U58B 1S7XA 1E43A 5HHOA 2DQTL 4CMHB 5DXWA 3N0AA 1TJXA 4M6AA 4RGND 1NBYB 4B6ZA 5T1DH 2CPUA 5C92A 5GISL 4NWUH 1T1ZA 4V2BA 1UJTA 3S6CA 4UNUA 1BBJB 3P30L 1VGKB 3GMQA 1XH2A 2BIIA 3LRHA 4L23A 4KVNL 2X1OA 4H40A 1R1CA 2H8PB 3W37A 4DESA 2XG4B 1FV1B 3UL4A 4ZNEE 2C9UA 2BVOA 4MJJA 3SPVB 4F2ME 4QDGA 4R2GC 3H42L 5I15L 1MZYA 1DQKA 2PPEA 1MFBL 1TZGL 3FT0A 1RZKL 2R2EB 4TQHA 5I1IL 5F7LB 3JV4A 4KX7A 3LRSA 4LRNL 1KCRL 3UAJD 1ET7A 1XR9A 5CEXB 1T1WB 1JGLH 4EBQL 5JO5A 3WYRA 4R9HA 1FJ1B 3LKOB 4WF7A 1M71B 5I1HH 3QUYC 1M9WA 3NIFE 1X5LA 3C6EA 4OTXH 3REWB 4Z7WA 2OCJA 3MRQB 4YDJB 4KRNA 3OD3A 1QSVA 3BZ4A 1E8WA 1T7XA 5JQIB 1S5HA 2YD1A 1AMYA 3FH8A 1MFAL 4QAWA 3TFKD 1P5VB 5D7SL 5JOPE 2ITCA 5ELIA 5BRZE 1PSKH 3DK2A 3GTTA 4OBRA 2BRRL 3KYOA 3S2CA 5E2TL 1QPKA 4FOMA 1NMCB 4OU3A 4OUUB 3LNGA 4C58B 2R51A 1J0IA 4RMTA 3ECVA 3B9KC 2IMNA 2QELA 4HXBL 2VQ1A 3P0VL 2F54B 2K6WA 5HGGS 2EADA 3M1CA 4OZHA 2UUDH 3WFCH 1QQDA 3NCBB 1R0AL 5K9KB 4X6DA 5EU5B 3C08L 5EIIA 4H20L 3DYMA 4OF8A 3ZHNA 1RHFA 2DJ4A 4ZJ9A 2IPUK 3HI5L 2X10A 3MTRA 3GI9H 3TEWA 1S9YB 1G9EA 5KYXA 1RLBA 3TJEL 1CR9H 5K9QG 1VKXA 5F1NB 3TO2B 2BNRB 1EJOL 4DUVA 4PG9A 3EGXA 4P3CL 3BGMA 4FFZL 5D2NA 5F7DA 5HHXH 5I71C 2H2SD 3KPOA 3QO0B 3MGAA 1BVKB 3UZEA 4HUVB 1ID5I 4XPAH 1HDMB 4JHUA 4PRAB 4XGZB 3GNML 1X4XA 3G6DH 4JPSA 2ICES 4NX0A 5E6YA 3N06B 5I74B 3GMMA 4OCLC 4FLHA 3SO3B 4WHTB 5EF2A 1IGML 4HOXA 1G9MH 2G2PA 2VLKA 4YR6B 3ARSA 5SX4I 4WEUD 4DKEL 5ID0A 1QKZL 1GZQA 4ZDHA 2VDRH 1EFXD 5FO8A 2XZAL 2BS9A 1PDKB 4WKZA 2LT9A 4WIQA 1OAZL 4ODVH 4PGEA 3MRLA 3MFFA 4JNXA 1U2HA 5T33L 3UTSA 3SQOL 2DWEB 3IDMA 3HFMH 4U6HA 4AYEC 4QKXB 4D0BB 1DHKA 3CZNA 4ZPVA 3NIDB 4LCYA 1JZ3A 5E8PB 3FHEA 3ARPA 4NQUA 1MFDH 1XGUA 5CGYC 3WSQL 3ZDWA 5CEYB 4R2GB 3WJMA 4K8RD 1VGEH 1AYRA 1P7BA 2QPFA 1XGZA 4O5LH 2LE9A 5CINL 4JM4H 3RY5A 1P5UC 5T5FL 3O6MH 3V0EA 4JKMA 1PCXA 1BQHB 4HUUB 5BQDA 1OCRB 1FRGL 1HILA 5SWSD 2CJTA 4IMKC 4PJBE 3QUYB 3TV8A 2RAMA 4V11A 4C56D 1GGBL 1A9EA 3BISA 3BAWA 2YJLA 1DVSA 2AV7A 2A6IB 3QRLA 4GG8B 1Q9OB 4A7QA 4UT7L 3F05A 2X5PA 3R7RA 4APQC 5D1QE 3AGVA 5AKVA 4NO0A 3ZO0A 1PY4A 1PY0A 1A6WL 1NFDA 4KJWC 5LJYH 1MF2L 4XOEA 4ZMNA 4HCFA 1TSRA 2BOBB 3A4EA 3B7UX 3MRGA 5ILTL 1VPOL 4KTDH 1UZ8B 2P46B 3UJJH 4HS8L 4F2MB 1P7HL 1RI8A 2KBGA 3KYKL 1S3KL 4X4XA 3B9KB 4MD0A 1U8KA 4HJ0D 2CHZA 1NLDH 4L0ZA 2XPYA 3D3VD 2IBBA 2ILLA 5ALCH 2WZ6A 1USZA 3KE0A 4R96B 3BRFA 3L3OA 1L3WA 2ICEA 3VSTA 2JTYA 1VACB 2B0SH 1QUNA 4JZNA 3NFSH 4F33A 4NP9A 3GHEL 2HWZL 1OP4A 2A9AA 1AG0A 1INQB 4NS0A 1O7VA 3PGDA 5FM5M 1T1XA 5D1QC 4RMUA 4J7RA 4XBPB 4TULH 4BSWA 2GAZB 2PYEE 3BXNA 1P84K 2AXFB 4NM4L 4YDVB 4Q9QL 1JFQH 4AL8C 5I71B 3MCG1 4JG9A 4G7QB 3T4YA 2APSA 1QNZL 3PXLA 2YBRB 4J4PC 2VDLB 5KVFL 4X42A 5GZNA 3CDZB 2ADFH 5CZXC 3UTQB 2CM5A 1KTRL 4QTIL 1DZ0A 3CSYA 2AP2A 2AXWA 3DSFL 3UBGA 4N0UA 1I3VA 1IQDB 1GOFA 1Z5LB 3QDMA 3SGJA 4RRPM 3VFTB 2DKSA 4MXQC 4RRPA 5DEGA 3DI3B 4FNLL 4P5TC 3TEZA 4Y4FA 2C4FU 2X3BA 4OI9A 4LEBA 1AZVA 2P8MB 3QYMA 1CXKA 1YEWA 2GFBB 1MXDA 3FQWA 3AAZA 4J3OH 2BSRA 1CDYA 2JJUA 3ETBJ 4PJ8D 4X0KA 1JBJA 3PGFL 4PJ7E 4RQQA 1FCCA 5D7JA 3LN9A 2EIJB 2VLJB 4L8BB 3RZCA 1PYWB 4L05A 2CO7A 1DEDA 3EYVB 4G6ML 4B53A 5IV2A 4NJAL 4NQCE 3Q48A 3WGUB 3UDWC 5I6LA 5DJZB 1DQJA 4JRYE 4MD4B 1IC5L 3OB8A 2NX5A 3OC5A 1A1NA 3M1BA 3QIWC 1P5UB 5SX5H 4JFDE 2ADYA 3MNZA 2UXTA 4RA0C 4ELME 5ABDE 1T03H 3BWUC 2O5YH 5CBEB 3D7PA 5DEFA 1AMXA 4EF3A 5K9JL 4PVMA 1YO4A 3H3KA 2G0LA 4FFWD 1KPRA 4M6NL 3DPBB 1UKQA 2YPKB 4S1DD 2IGFL 5MERA 3MC0A 5C0RH 4APQB 2YGPA 1J12A 5J6GA 2X4OA 3BSZA 1NANH 3CQQA 4JPKL 3FQXA 1MWOA 2X4RA 1PX8A 2ZSVB 5MEQA 3FK3A 4Y5YA 3CAFA 3MGTB 1NSNL 4QRPA 2H6PA 4OGYL 5BVJA 3KYAA 2DMBA 4YEEA 1TEGA 3DJRA 4YHNB 3AT8A 4HS3A 5EWIL 4BUQA 4CDGC 3SDDA 2YMOA 1I82A 1KC5L 1SN2A 4DPRA 4JCWA 1L7IH 1YN6A 4YSOA 1WFTA 4QJ4B 1QZNA 4JFSA 3SDXF 5EOCJ 2XN9E 2E9GA 1EAPA 4YHKL 5FF6A 1QR1A 1AI1L 4XBGB 3UP1A 1N9PA 4R4BA 3V6OE 5D1QB 1SN0A 4IRJD 4FGMA 1X7TA 3VFWB 1RK1A 3KHQA 4FTVE 3V8OA 4DGIH 1URIA 1GGIH 3BC9A 4HLJA 5TQ0H 4FNSA 3DRTA 3RQ3A 2AK4D 3FSOA 1TZ8A 1BZ9A 4QGYA 1YC7A 3OTTA 4YXHL 4X50A 3DVNA 1RIVH 4L1SA 4L5FE 4LHUG 5JQ6L 3ZDXF 4UTCA 3BKYL 1UUSA 1U3JA 1SXBA 2CO2A 3BAEL 4ZFQA 2PCXA 4F1SA 1JDAA 3SYAA 3W0WE 2OMWB 4RAHA 4XPHH 5JXEC 5F3HA 1VADA 2GC7C 5C0NC 4WSGA 3C6SB 5KYUA 3WG7B 2WO4A 1ZIAA 3EUUA 2NXZD 4P5TB 1SHSA 5I30H 1L9NA 4OZ4A 3D9AH 2UX7A 4LHJB 4QRQA 3CHRA 3QH3B 1JHLH 2ZZUT 3P77A 4HAKA 3V6OC 1ORSB 4ONFL 4G82A 1MFNA 1SJHA 4JDTH 3GEFA 3QWQB 1A3LH 1MHHA 1RJZA 2IDUA 2PYEB 3M07A 4PFEA 4UNTA 2DIAA 2DQDH 3GSWA 1UGNA 4ODWB 2ZAHA 4J8RB 3QZOA 5GGRY 3AQDA 2WWNA 1CN4A 1LDSA 1XF4B 4F57L 3RDTA 1SJEA 4LRIC 5ACZA 4H44C 1BX2B 4XHJC 4LPUA 5F3BA 2YKLH 4XBEH 3QIWB 1HJCA 3AFLA 3T8XB 4YFLF 3QRBA 3II1A 1KGUA 2K9FB 4OCYH 4G11A 2ZUUA 4K7FA 5KSVA 2WO2B 5D2LF 7CGTA 1XF5B 5FAAA 1JN6B 2WAQA 1NUDA 4OB5L 4Q7DA 3VSUA 3MDJA 2QVFB 5EBWA 5JR1H 4F1ZA 2X1XR 3PRZA 1U8JB 4LSVL 4P5RA 1D5ZB 2D03H 1YN7A 3AS3A 4FRWA 4NCC2 4TTDC 3QDGD 2NY0C 4S2SB 1RHHA 1ZGLB 4LOEA 5IF0B 4PJ7B 1RUAL 4J6RL 4IKNA 1KYAA 3RLSA 1C8PA 4JKNA 4NBZB 4GP8B 3I85A 5E8EA 3NN8A 4NQCB 1A2YA 5IFAL 5GGVH 1X4ZA 2W80C 3QEQA 4ZTPH 4IS6A 2Y1ZA 1RZIB 4JRYB 3L4XA 2Q7NA 3WDIA 4F15C 2HMIC 3MJ9A 1ZA6A 4XPGL 4JFDB 1B2WH 2BXYA 2Y7NA 3FTGB 3D18A 2JVUA 2YMXL 3L3IA 3TX4A 5C6WH 5JHBA 4MA8H 4UDTA 3ATBA 1JK8B 4DO5A 3AU0A 1NEUA 4N6QA 5FXCH 1SM3L 2G5RA 3WTYA 2PCPA 4HJTA 2A6JA 2QHRH 2P80D 1V8HA 3VYNA 4UU9A 1D6EB 2V5RA 4LDCA 2ZCKH 1NDTA 3OR7A 4KZEL 3CU7A 4JDZA 5L9DL 4OCXH 5IJCC 4P4KA 3LKNB 4TQ8A 1G7MB 2HFTA 4FCAA 3VE0A 3BDYH 1ZT7A 1UYWH 1JNLL 4N24A 5AVVB 2AQPA 4IBWA 4XOBA 2KH2B 3MJ6A 1TJHH 2WTOA 3P3SA 4EI5A 3OZKA 4MXWH 1HI6A 3NUKA 1NANI 2NSQA 3FTXA 1W6WA 4ENED 2R23A 3CFKA 4ZUSA 1T7WA 3H3BC 2EDEA 3FSZA 2YSSA 3IKCB 2AITA 5KSBA 1R46A 3CQPA 2F54D 3ULVF 2NY1B 1N5AA 2PTTA 2XN9B 2PETA 3FRUA 3KM2A 3R4RA 4OLVL 4F5CA 1G84A 2HRGA 4AVIA 3IFNL 2VB5A 4PRHA 4Z7IA 4FTVB 1WUZA 4F9LA 5F0MB 1KB9K 3OF6D 2IADB 3F6LA 2VN6A 1DZBA 4Z3IA 2YUWA 3R1GH 4KKNA 1LK2B 4AKPA 2GG1A 2MHAB 3S8GB 2J88H 4I1PA 1AP2A 4OLZL 4ODBD 4ZOEA 3ZXAC 4YS4A 5CKAA 1MVFA 5DQJA 5AZ2H 3W11C 1N0XL 3MUUA 3W0WB 1U93B 3HBGA 1SOQA 1H0DA 3HE6D 1SF5A 2JTDA 5DFAA 3DO4A 3BPCB 1YQ2A 4JE0A 2XIIA 4KBPA 1OP5K 1F4XH 4UQBA 1BOGA 2BWIA 1DR9A 1E5BA 4PJIA 4H2AA 4MQXC 3H9SA 1N18A 1AFVH 2ZUQB 1CIUA 4LB8A 2FH8A 4MA7L 5BW7C 4UTAH 2D0FA 1LEKB 2GCYB 1WZ1H 3FRPB 4U1LB 2NY0B 3ZTJG 1DEEB 1TJIL 5DMGD 2O6FA 4JGJA 3LPWA 3SDYL 4NQSA 2MNJB 5EH1A 4YX2L 3LV3B 1RVFL 5E5LA 3ZMNA 1JXFA 3K1DA 3E2HC 1D5IH 1YJDH 3LZNA 4ZQKB 5EZOL 1MHCA 2QDWA 5CJQL 3ULAB 2Z1KA 3GRWL 1JVLA 2E75C 3RWCA 1XSIA 5TDPB 3VXRA 1FDLL 3RURA 4K07A 5AAMC 3GINA 2OXHA 1IM9A 4R2GD 3UZQA 1LDPH 1DFXA 1HKLH 1QLFB 4MJIA 5GRJL 5JORA 1TO4A 3RG1C 1N26A 3ZY7A 1NGQH 4AVKA 1OZUA 3NTCH 1HXYA 3MNDA 4PB0L 5CNHA 5EZJB 4PY8J 1WGVA 5ESQB 2E27H 5GGSA 3QUYD 1A8ZA 3CG8A 4F7EB 1YEIL 3H9HB 2CLRB 2BMKA 1OM3L 5J12B 2DKUA 1EAQA 3DMMA 3FTVA 2YQBA 5JDJA 5IGXH 1F3DH 2EO9A 1GPOH 3ZTJH 3TJHC 3JZYA 4KPHL 1MXGA 4HPOH 1I7ZB 2PWGA 3CVHB 1OGSA 3LVEA 4JZJC 3E80A 2OQJB 5LCVH 3SKMB 3B9KD 4IU3B 4LSRL 1T83C 1DANT 4PCKA 2YGNA 5KUKA 3MCYA 3CVHL 3QDJB 4YXLL 3G08B 1A9BA 2PO6C 2WJ7A 1WWAX 3EGSA 4NGHH 3TZVC 5KN5B 3QXVA 2GBAA 3X12A 1ZLVH 4HWZA 4M5ZL 4M8UA 3FFCE 1OP9A 2X4NB 1INDH 5C0BB 5FO7B 5SV3A 2C3WA 5I6KA 2HT2C 1SUJA 4QHLB 2GABA 4NN7C 4WHYG 3F58L 3MGOB 4XNYH 1NUGA 2DWDB 4WI0A 3MA9H 3CFEB 3MV01 4I3SL 4KKCC 4PJXF 5HDQH 5A2BA 1SLWA 1C5BL 1ES0B 2FJUB 4HW6A 4AIZB 3N85H 4G9FA 5FKPB 2WXPA 1FNEB 1P1ZA 3DGGA 5JOPD 1B88A 2ZJSH 4BZYA 1S9KC 2H1PH 3VFOA 3DOIA 3FO9A 1CE1L 2X2UA 4AUUA 1QO3A 1FH5H 4G6KL 4BGLA 2ATPA 3HI6H 2WLZA 2ICWI 2YJQA 2ATKA 2KPNA 1RULH 1CDHA 3MJGX 2ZG1A 1BM7A 1S46A 2YPLA 3OAZH 5E1AB 5KYNA 1T66C 1CS6A 3BD4A 2AEQH 1XDTT 2OSLB 4Q56A 4K71C 5FM5O 4LQFL 3UYRH 2LVEA 4MCYA 4KXAA 1KCWA 1P69B 1F3JA 2H0PA 4PGCA 3S88L 3ZT7A 4LK4A 3E2HB 5FDWA 5I76B 5LNGA 1PZUB 1NZRA 4Z76B 2P45B 4OFQA 4BHUI 1CL7H 2OULB 2VLJD 3DJTA 3OHXC 2BJML 1JNHA 1ZA3A 3CX5J 5F6HJ 4MB4A 2OMYB 2DBLL 4G80B 4PJDF 5CGYD 4YBHA 4ETQB 4WHYH 3OKDA 4U6VL 4Y2OA 1HKFA 5CJOH 3ZLQC 3GMRA 3EO1B 3IETB 4G71B 2X6VA 1FL3B 2B2XL 5KBLA 3IJYA 2EO1A 2UY7A 4KXZH 4CSSA 3UPAA 4NP4H 1GS6X 3WEAA 3TWYA 2R56H 4RZCA 4OD2A 1A47A 1XFPA 5GRUL 5I8KL 3VXPB 4YQXL 3FB6B 1SXAA 1DQDL 3ABZA 3IJ9A 3JV6B 5B1JA 3RIAK 1QSZA 2X42A 4UIMA 5DDHA 3RNKB 2O5ZH 4MZ3A 4WVRA 3RDJA 2XU9A 4WI8A 4DPCX 3EBHA 4BBWA 4KJWD 5CGMA 3LY6A 4JCMA 4LSTL 4G43B 5TGBA 3E3QE 3SE8H 3CK0L 3KPRA 3GSXB 5FM8A 3A6BL 3PFUA 5BUAA 1KACB 1R4XA 2V5SA 4JZJB 1D9KC 4PY7B 4Y19A 4DOHE 3LPPA 4CNIA 4F8QA 1FYHB 2VZUA 3O2DL 4TNVK 5DUJA 1ZLUK 3SKUD 2F7RA 1IKOP 2PO6B 2GI0A 2HVKB 2ADGB 2L7QA 3TZVB 3C2SA 3P2TA 4P3DB 2EKSA 4RIRA 2EO7A 5D2LE 3VGAC 4YLCA 4IKLA 3GDBA 2A3TA 4Z7VE 4MAUL 4NN7B 4UBDC 4ACTA 3APCA 4OCSH 4Q6IC 4DZ8A 3VD4A 4N8CL 2G3MA 3MRBA 1FCGA 2IFGA 2NXYC 3CSFA 3QPKA 4QTFA 5ENWB 1J0ZA 3CFBB 2DV6A 3LQAC 2QPDB 1FVCB 3E3QC 2R4RH 4U1GC 4ISVB 5DD1H 3SQBB 2GI7A 4K15A 4G7RB 2EYRB 2Q3ZA 1I3RB 3P9LA 3J8F7 3BIAX 1J1PL 1MI5E 4YFDB 4ZUTA 3LXBA 5CZKA 5CO1A 1JG9A 3BD5A 1RMFL 2NQCA 4L4TE 4MDJA 2DQ6A 2L7UA 3EFDH 3FB8B 3EJSA 5F7WC 3HI1A 2R69H 1NL0L 4XC3L 4YSRA 4I9XA 5DTFB 4E9VA 2EVIA 2WP3T 4C83B 1YY8B 4P5TD 4N5EC 2OAAA 5EU6E 2VDKB 1R3IL 4KDTC 4K71B 2BSCA 3TT3L 2V3DA 1NFDF 1G43A 2AJUL 3NQIA 3KD4A 3MYJA 3QZNA 4GAAA 4XRCA 1SLUA 3X11A 1FZMB 5I1JL 4M61B 5EC2A 2VDKL 4HJGB 2PYED 1WSST 4TYUA 1CLCA 1E6OL 2Z91A 4MCZB 3OHXB 1HNFA 3QP3A 3H0TB 1KFAL 3KNBB 2W9LA 4U6XA 4K3HA 4GT7A 1M6OB 3DRQB 4S1RH 4ZRGA 3VACA 2AEIT 3CHSA 4B41A 4D8PA 5DA4A 3GLDA 3QIWD 4ELDA 1EGJH 1TJGL 3LZQA 6PAZA 2RH0A 4AGPA 4JO2L 3KR3L 3E9TA 4HGWB 3QFDA 1CJYA 1A7NL 3ULVE 3WDJA 3ZKSD 1FFNA 4JDEB 5LAPA 4JAMB 3GSNA 3PWNB 1UH4A 2C9QA 2YAFA 1QSEB 3M86A 5GJTL 2WIMA 2Z7ZA 1CI3M 1M1XB 1WHOA 3LXCA 1OE3A 4LP8A 3HNTH 4JVWA 3KLHC 3M6DA 2FQEA 1N3NB 3TA3C 4X5LA 1GYCA 1D9KB 2IG2L 4NQCD 4IOFC 1E2ZA 1DQVA 1GSKA 3DV4B 1ZOXA 1UVQB 4XXDB 3MLTB 4YAQB 3DROB 1WP6A 3DUUB 2FJHA 3EOTL 3OXSB 4JRYD 1A4BA 4OW6A 3V4PB 1QSFD 4NZRH 5C08A 3VI3A 1ODUA 1EXUB 2B7DT 4LKXA 5K59E 1FAKT 1OAUH 2VUKA 3ULVC 3A6CL 1BIHA 5DZVA 3VGAB 5T5NF 1U95B 4KI5F 2BHFA 1S7TA 3Q43A 5D5MA 3V4PL 1KJ2H 2PWFA 1KXTA 3HMWL 2DQHL 3IU3B 4Q6IB 1NUNB 3FUMA 2VR4A 3OKMB 2NXYB 4FZEH 4KXZI 5E9AA 2QQLL 5MHSE 4GG6E 3Q8AA 5E4EC 5AAWC 3VX0A 4W9KC 2BZ7A 2ICWA 1NM9A 4U1GB 4PSPA 3ESOA 2FL5B 4DOHB 1HWHB 3SOTA 5K39A 3LQAL 3QUXA 3NFPB 1RUQH 4AEFA 1KNOB 2F19H 2YWYA 3TYFB 2ZF9A 3NIGF 4EXKA 4NZJA 5GS2D 4OFYA 4AK1A 2XV0A 3HNSH 5T1LB 2G2RB 2P3YA 4QHUA 5C0ND 4WUKH 3VFUB 1TZHA 2NY1D 3N2JA 4TM9A 3OKEA 5D2LB 2DLFH 4JY4A 5FO2A 1B0GB 2XN9D 1HHHA 2D2OA 1SBSL 1M57B 4BHUA 4XZUB 4Z7VB 2GSMB 2DQCL 3EO0B 3QCVL 1WWBX 4XCYA 4KJPD 4AEHH 2YAMA 2R1WB 2FO4A 2A4CA 3IU4H 4AYGA 2UVEA 3K4AA 5F96H 1K3IA 3EF4A 3QXDB 1UM5L 4HUWB 2X4QA 4Y2DD 2RA1A 2X4SA 3VWKC 4CUCA 2FBJH 2JCWA