3ZZSA

Engineered 12-subunit bacillus stearothermophilus trp rna-binding attenuation protein (trap)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
64
Chain Sequence
SDFVVIKALEDGVNVIGTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ATTENUATION PROTEIN MTRB
publication title How to Change the Oligomeric State of a Circular Protein Assembly: Switch from 11-Subunit to 12-Subunit Trap Suggests a General Mechanism
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 15
structure length 64
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 3zzsA00
3ZZSA 1QAWA 1UTDA 2ZP9A 3ZZQA 5EF3A 5EF1A 5EF0A 3ZTEA 2ZD0A 1GTNA 2ZP8A 1C9SA 2EXSA 3AQDA 5EEZA 5EEXA 2EXTA 5EEVA 1WAPA 2ZCZA 5EEYA 1GTFA 5EEUA 5EF2A 3ZZLA 4B27A 5EEWA
chains in the Genus database with same CATH superfamily
4YOKA 1S9XB 3KPSE 4HS6A 5CHNB 3R7QA 4HWNA 5L9DH 2V2XB 1GJWA 1UWFA 1P5VB 1AIFA 5FGCB 3LSOB 1NBVL 1ETZB 2EXYD 4YFLI 1GKEA 1RPUA 4K3JH 1J1OH 2YLHA 4ZNEE 1T0MA 3PFUA 4YZFE 4AMXA 3GIZL 1WD8A 3PYCA 3VXUB 4TTGA 1C12A 2BH0A 2XFGB 4FFTA 4GMTH 4KKCD 1YQVL 5TDNA 3DDFA 4LSTH 2K7PA 1K6QL 5DYFA 4PJGE 2ESVB 2Z8RA 5GGUA 3V79C 3VWJD 3ZZLA 1QLRA 3PQYB 1T2QL 5CEXB 1ZTXL 1SOSA 3OKMB 5ABZA 4W9LC 3OKLA 5DJZA 4W4OC 4N9OB 4JO3H 1UWXH 3PJLA 1F3DJ 3LS4H 1P1ZA 4L8SC 1YJDH 4LCYB 4XNQA 2EUZA 4PR5A 1TO5A 3IDXL 4DW2H 3O3EA 2C4FU 2RQEA 2MQCA 3EDEA 3QXAA 5EEZA 5K9KA 3T65B 1W6LA 2F8OA 3OV6A 3QAZC 4EQ3A 1UD8A 3EYFA 3SD2A 2DH3A 4G8GA 3FRPB 4IM8A 2R9HC 3S5LA 5AG8A 1K8DB 5I71C 3IWUA 1ZS2A 2IIJA 4OLYH 3UZEC 1VPOL 4M7KL 2CHNA 2LTQB 1SJMA 5J1TC 4OLUL 2AAVA 2D9QB 3FK3A 5DK0A 4PQXA 3LIZH 3ULUD 2CCVA 1PLAA 2MQGA 1I7RB 2ZAIA 4N25A 4PJ8B 2JIXB 2LFEA 1IM3D 4YHNB 2VE6B 3ZTEA 1QBBA 1QP1A 5TQ0H 5MP6H 3JWNC 5DHDA 4YX2L 1GGTA 2D4FA 2CNYA 2DIBA 2WQXA 5DEFB 4O51A 2O6PA 2ICES 1R9FA 2WBKA 5TQ2L 4IRZL 4CNIA 2AMUA 3UJJL 3VMOA 3VXNB 4ES8A 2F53E 4QXTA 3HOGA 3ZQXA 7PCYA 5HHVH 4ODUA 4HEME 4LSUH 3MBEB 2FJFA 2OAAA 1INQB 2VIRB 4HH9B 1S7RA 3HAEB 1EEQA 1ZLVH 2K6YA 3FO2B 2IG2L 3V95A 2XWCA 2ZP8A 5GSVB 3VD9A 1KC5L 2NY5H 2XTJC 2YD8A 3LNGA 2DQJL 4WNQA 1JBJA 4NAQA 4JRYE 2AGJL 1CF1A 2ED6A 4Z7VF 3S88H 3HUJF 5INDA 1DQML 5E8NA 1SM3L 1E3XA 4OIIL 2IFFH 3OKEB 4PJBB 3RPIB 3CDFA 4KKQA 1ZV2A 4TVUA 2K4WA 1A65A 2FO4B 1KWKA 3DUUA 3CN4A 3HZMB 3WEBA 2HT4D 4A7GF 1Q1JH 3LPPA 3LH9A 4G5ZL 1L7TH 3NFPA 3S34H 1H3PH 1X5JA 3HLKA 1TZOA 4F57H 1PX8A 1WFNA 1U91A 2GHWB 3KGUA 1PY4A 3TNNB 5D4IA 1BIHA 4PRPE 3DX8B 3BLPX 2XQBL 2ZCZA 1NBYA 4G9FE 4RFNB 5F7WC 5ICYB 3CHRA 4MNQE 3WELA 4X4YA 4LVNC 2YXWA 1MVUA 5AW2B 4AYBA 2A9BA 1XCTA 6CGTA 3O9WA 4HQQL 4ORGB 5IFJA 3D85B 4ZOCA 3LRMA 3IJEA 3DXAD 5JXED 4CU8A 1AKJA 3VFVA 3RAJL 2OFQA 4L3CA 4QKXB 5HDQL 2YRZA 4KH9A 4TULH 4N3UA 4KFMA 5BS0B 2FX9L 4O4YL 2QMJA 3NTCH 1U4EA 3QXWA 4AE1A 4E9SA 3VX1A 4LLVB 2WQSA 2O6DA 2Q8AL 1UWXK 4DEWA 2N01B 1ZXQA 4OR1A 3TBTB 3DX9B 3W0WE 3KVDD 4AIXA 3VDAA 2PCPB 3ATBA 3VXPB 3H85A 3UPCA 2A9CA 2HMID 4I5BA 5AW6B 2V9RA 3EOBA 4P48A 3BXNB 4JKKA 4UZSA 4WFED 1FN4B 3VWKD 3WG7B 4E68A 3ECBA 2M83A 4XHJC 3MV8B 3DURB 4I0KA 5EOQL 5B39G 3NAAL 4F58H 4QTIH 2EDDA 1AO7D 4JFDB 4DFHA 1GMEA 3FAWA 1YNLH 3SYAA 4JHVA 3VXMD 5I1IL 3QEGL 1PZCA 1QUPA 3CNKA 2VC2L 2MWCA 4Y9EA 4HIPA 3KPMA 4HU2A 4KOBA 1U4FA 2EP6A 4X42A 5LCVH 4XBGB 3SZKC 4F15B 1NJ9A 5EOTA 1DVFC 2VQ1A 3PAZA 3U1SL 2UY6A 1AGFA 4BH7B 4ZAKC 2JB6A 2DLTA 3Q44A 3ULVD 5JO5B 2WQWA 4PBXA 4LLDB 1QFUH 5FHAH 3WFDH 3D5OF 2NXYD 3ZR5A 1FZMA 1A4KB 1KIRA 4XOEA 5KYXA 4KQ4H 3FCTB 1LXMA 2X0VA 3L95A 4KRPC 4OZIF 2DY2A 5JTWA 1ZLVK 4YL4A 4Y1AE 4PJFF 3U4AA 5C0AA 1H5BA 2VDPH 3FT9A 2HH0H 2EDLA 2DTMH 2CO2A 4HK0B 5AVWB 3N1FC 3NA9L 4NM4H 3QQ9D 5E9DE 4KZCA 5I1DA 1E50A 3RIAK 1CK0H 5LJYH 2XI9A 5E6ZA 5F93C 3F12A 5IESH 3BD5A 3TA3C 3N40F 2F7RA 3FHEA 2HLFC 4Y4HD 3BUTA 3MNVA 4LEEA 2OMVB 3N40P 4JRLA 4QXUL 5DRXA 5MEPA 5T3XD 1HSAB 3QIBA 3M17B 5I5IA 1UEYA 4ZFQA 4KO6A 4BYHA 1ZLEA 1XCQA 4NBZB 4L9LA 3VE0A 3PP3H 3PWPB 5B38G 4XNYL 4YHKH 1TVBB 4WU7B 4FABL 4KHTL 3N06B 2PWEA 3T6VA 2HCZX 2H7WA 3TVMB 3MRMA 3OPUA 4AT6B 1IGYA 2P5EA 4ZFZA 4PTTB 2HLAA 4NJAH 5CZRA 1YO4A 3BSZH 4XNUL 4LVHC 3WKML 3U2SA 4LPTA 3OXSB 1IGFH 3EJTA 3UTZA 2XWTA 3K72B 1GGIL 4GXUN 2HA1A 1KYFA 3RB5A 4BFIA 1TOXA 4S10A 4N1EA 5GGRY 5K9QG 1HH9A 1SUHA 3MFGB 1C5DA 5I66B 3H0TB 5E00B 5GJSH 3DVGA 2A9ML 2E5EA 5CD3A 4Z95L 1RUKL 3LKSA 4WU5A 1UYWL 1IM9B 1IVTA 1MFMA 3SEPA 5L2KA 2JK5A 3B6SB 2A1WH 3I9GH 4B9KC 1M6OA 2DWXA 4XGZB 4JO2L 3D30A 3MJ9A 2BIOA 4GKOA 4KKAD 4M5ZH 4WHYH 3IDJA 4ZTPL 1A14H 1TU2A 3EJZC 1AD9B 4ODHH 1T4KB 5SWSA 1X9UA 1W6WA 2WJ7A 4NAJA 1QABA 1JZ8A 5FIEA 4GSUA 4POZC 1E28A 1T0NA 4JR9L 4KI5F 2HKHH 2JJWA 4UBDD 3VH8G 2Q0ZX 4QRRA 2FGWH 1GA2A 5GGTA 1QI5A 4HK3J 4ZFGL 1ZK9A 4ZSOA 5KW9H 3SYQA 2KQNA 4PG2C 1MLBA 1RUQL 5C09D 4Z3EA 3OB8A 4NQED 3GI9L 2F6AA 3O4OC 5EBWA 3SE6A 5ITBL 4UF7C 1CXIA 2GJ6D 2UZIL 2XNAB 2VSCA 1F8TL 2ZP9A 3QUKA 3EJYD 4UYQA 2WVTA 5HYEA 3QYCA 3FT1A 2W9DH 2ADGB 3UJIH 3AMKA 4NEHB 1IBFA 2BHYA 1GY2A 4M61B 2XCMC 2GC4C 1QFWL 1WQVT 3ZTJG 3RIFK 1G7LB 1KYUA 1A1MA 4Y19E 1V3KA 1E0OB 4JG1L 4PW4A 2R29H 5KVMC 1OIOA 1QA9B 2DLFH 1UB6A 1XH3B 3KBEA 1A6VL 1RZKC 1SF3A 5IM7A 3DUSB 2MPAH 4PJHA 4Y7OC 4NUJA 5C0IA 3LKRA 3VFGH 3RWDA 2VQUA 3RUGA 4QRQA 2EECA 1XMEB 2Y7SA 1WIPA 5C0BB 4F7MB 4YSSA 3TL5A 4K7FB 1TEYA 1ZHKB 5E7BA 3CLFH 3FUIA 1IVLA 5JHLH 4M7JH 4P05A 5HHOB 1V05A 3K6SB 3FB8A 4TUOB 2C9RA 1Y6NR 4FP8H 1F0LA 1EAQA 3V9EA 2YK1H 3O2DL 1I7TA 1KIUB 4JW3A 4PLOB 2WUBL 2EXTA 3IXTA 3APDA 3NUKA 1B4TA 3W57A 3D1MC 3QPQD 4DPAX 5I5JA 1OL0A 4XAKD 3P9MA 2XV2A 1Y0LB 3PP3K 5TFSH 3V52L 5DD0L 2QGBA 3EG9A 3GGWB 2D3NA 4R90H 1CG9B 3X11B 3ZT5A 3VFSA 5C6WH 4XPFL 4HJEA 3Q3GB 2BDNH 2WBJA 1BVNP 1QSFA 4K7PY 1GYCA 5D7IF 2VLLB 3RNQB 5MEQB 4NSKA 4H20L 1CFTA 1VZHA 2QADB 5I1JH 3AT9A 3DX0A 4QYOB 3JWDC 4KK8C 2VKXA 4GKSA 4MMZA 2DWDB 4HS3B 3K46A 3A47A 4UT6L 1X7TA 2Q76B 5AUMB 4DF9A 5JW4R 4AQAA 3FNKA 2C5DC 3H7LA 4MNGA 2EKSB 4YDZA 4G8IA 1I85A 2NNRA 4W81A 3D50A 4FZEL 5IMMA 4NKIH 1RIUH 4GAJL 1OKEA 4HCIA 5HDRA 3H2QA 3C6LD 4DUVA 4E5XB 3RY4A 5JHDA 1DLFH 3UZVA 1U8PB 3WS6C 4YZWA 3RTQB 2AJ3A 3P77A 3QJOA 2QVKA 2YAEA 2NYYC 3LKNA 3ZZ1A 3S36X 2BNQA 2ZF9A 4DPCX 1UM5L 3LZLA 2X2IA 3SQBA 3CFDA 2QTVA 5IQ9B 5TF1L 1T1XB 4KFZC 2IQAA 2PLTA 4CSSA 5JIDA 1AZZC 4L1DA 1JMZA 3QJFB 3HE7A 1V7ML 4L4VB 5CU5A 4XP5L 1PVHA 2PP8A 2VQTA 2ARJA 1D9KD 3GNMH 4RZKA 5ANMB 3BOVA 5KZCB 3HZVB 3OAYH 4U6XA 3RURA 3VFOB 1OGAD 2WO2B 3EJQA 4MZIA 5AEAA 3N1MC 1SBBA 3KPOA 4KRLB 5A43C 4OI7A 2DAVA 4YVUA 4M1DL 3KLHC 1P6WA 1ZVNA 3OKOB 4LXFA 4OF5A 4YXLL 3MCKB 3L3OA 3ME0A 4G6AC 2JWYA 2ZSVA 3T6ZA 3VB9A 4CRPA 3OGOE 4ETYA 4OZGE 1LJMA 3JUYA 1BOYA 2VAAA 1CYWA 2OXGB 5J12B 2R2CA 5GS1B 2X3CA 3H4FA 3SCMA 4UM8A 2Y3NA 4WFGD 4PN6A 3S2CA 2GIYA 3T0AA 4HLEA 1PZ5A 3R4DA 43C9B 1YEEL 2NLJA 4G80A 2IPTL 2J57A 4ALAH 3MRIB 1WGVA 1KCUL 1BM7A 3QUZB 4H5SA 5CGYC 1U8LA 5AWNL 3DJSA 4KNQA 4QO1B 3VI4F 2EEFA 3ISYA 1XHHA 5IBTL 1B2WH 4JREB 1RZ7H 5IKCB 4K8RD 1G4RA 1CYXA 2DZEA 5E24E 4LLWA 3UCRA 5B3SB 4JQXC 1Q90A 3F01A 3CN2A 1T7VA 2PYEB 2VXQA 3ZGHA 3FSOA 1XGTB 2XZAL 4O02H 4NPYA 4LU5L 4C55A 1A3QA 1S5HA 3D06A 4MAYC 2ESVD 4QTHA 1EEZB 4HWZA 4F20A 1I8IB 4N2MA 3BWAA 4HWEL 1YQ2A 2VB5A 2JLLA 4MMYB 4Z7VB 3BN9D 3OC8A 3HUJB 1A3LL 3PE9A 4GI8A 2AEPH 2YN3A 3CPLA 3KH3A 2NY1C 5BQ7B 3QUYB 1D7CA 1U3HA 3EF7A 4ZYKA 4UQBA 1V3MA 2CDEB 1NSNL 4ZG1A 4UMSA 5JQHC 2QPDB 3CHPA 1GOHA 3TLRA 2H9GA 5BRQA 4N8VB 5D6DA 1ET7A 2FEDD 4RISH 5MEOA 3DX4A 1W8NA 2ODIA 1N4XL 1RK1B 5I6OA 2A77L 2UXGA 4GUPA 4NGHL 1FG9C 4F8LA 3G08A 1MFCL 2OS7A 1AI1H 4EI6B 2YR3A 3LDBB 1ULVA 5T1DL 1IGML 2HFGL 5K69A 5CNHA 1MAJA 3MN8A 5HVFB 3RWGB 1J9QA 4F2FA 1N9PA 2KMWA 4YSUA 4XNDA 1KFAL 4FXLA 4HD9A 1RUPH 2ZAGA 4NZJA 2FYYA 4PJ8D 2JIXD 2WYIA 3MA7B 2NPLX 1GC1H 2VLRB 4MVBD 4Z76B 1OTSD 3KXFE 3QE5A 4BZ1A 3CN3A 1PKQA 3GI8L 8FABA 2BVOB 3U6XS 2BSBA 4WCYH 3TO4B 3WTXA 3JWOL 4U6HB 1DBBH 1CXFA 3KPQA 1T6WA 1Q94A 4U6VH 1PD6A 3OAYK 4S1DD 3H42L 2NY6C 3MBED 1M7UA 4YPGA 3EFOB 3U0TA 4FQLL 4WNSA 5JHAA 3QP3A 5IW6B 3N91A 1TENA 2E27L 2EUXA 4J3BA 2QPEB 2ADJA 2JJUA 3NDZE 3QJHA 4XP9L 3GKWH 4YBLC 3IVKB 4R7XA 5JXAL 1E8ZA 2FIKB 2X9XA 3EO9L 4XB3A 4JO4H 1G9HA 2WLLB 1CGTA 2VZSA 3HR5A 3T9WA 3PAUA 2Q8BH 3SGKC 5FO7A 2P7TA 5AYTA 4C8XA 2FLMA 5CN2A 1J86A 4Y4FD 4G7SB 4FFYA 3LQMA 4GXVL 5CZXD 2BIMA 4LHUA 3BVTA 2IGLA 4LCCC 1MLCA 2Z7WA 4XVSL 3ESPA 3PGFL 4ZMOA 3MZTA 4KO9A 1T83A 2KC0A 4LSPH 3EXLA 4KK6D 2MMXA 1CE1L 5T1LD 4HU8A 2GHZA 1GCFA 5AVUB 1MRFL 2E9GA 4NP4L 3JT2A 4NC0B 1ZHLB 2WVSA 3QZOA 5HI5C 3ARGA 4XCCL 2XACC 4M6NH 4JM4L 3P4MA 2NTFA 4L8SB 4WENB 3CVDA 4OZIB 4DO5A 4IU3A 3BJLA 4PBVC 3MRNB 4TNVF 3TV3L 3C5XA 3D85D 5C0CE 3FSVA 3MV9B 4LRIC 3AU1A 5TH2B 5I23A 2GTWB 5BS0D 1CFSB 1W2KT 3CPUA 1AQKL 1RZ8B 4ZNCD 3OX8A 3X2QB 3W2DH 2WWNA 3A4FA 5DK2A 1EHXA 1PG7H 1M3IA 4X6FA 1FORL 5L6YL 5MENA 4FQ2L 4FG6D 3FB7B 1MVYA 3OVUB 4A6YH 3MX0B 2F54D 3MJ7A 4M4RA 4CADB 3MV11 3TBYA 1A47A 5DJ0B 4NI3A 4BK5A 3RUGF 5I1HH 3D4YA 1T4WA 3MV8D 4CMHC 2W0PA 2EO7A 1O9VA 3VG0L 4BQ6A 3AY4C 3HBPA 3L16A 1JVOA 4JFDD 1H6TA 4JDVA 4M62L 1S3RA 3UPRB 3QXVA 4ZUTB 1KYAA 1LEKA 2LLNA 2ERJC 4LNRB 4PJDE 1PZ2A 2Y6TE 1YMME 1KCKA 3I74A 3NIDE 4L4TB 1KB5L 3TJPA 4FS0A 4HF5H 4LGRB 5J9PB 1EDYA 4LIQL 1DQQB 4LDLB 4EOWH 5AZEL 2FT7A 3PAVA 1CF8H 2QR0A 1NEZB 1XXDC 1U8QB 2DQIH 3STBA 1FZJA 3CMGA 2KPWA 2OJZH 3HCVB 2O5YL 4ONHA 1ZT1B 2E9IA 4Z3TA 4B3EA 4HUNB 4D0BA 3MACH 3MO1A 4E42B 4X6DE 1UVQB 2WXRA 4OGYH 5E6IB 1JRHH 3L8QA 2AJVH 3Q8BA 5HGGS 35C8H 4JY6A 4WWPA 5C0JA 5K33A 4YSRA 4CN1A 4GQ9H 4NYLB 2GCYB 1JCKA 4PCYA 4L3EE 5ACZA 3W56A 5JPMB 1GGYA 3TJHC 1PZDA 4PPTA 1Z9SB 1INDH 1MWAA 3LKOB 2V5RA 4IBQA 4P57B 4YHIB 4O9HH 4ANKA 3V6FA 1AFVL 4WI9A 2MFNA 3ZE2F 1S9VA 1G5GA 1CC3A 2YPKA 4NDMB 1P69B 4PY8I 4X6BA 2IDSA 4D2NA 1ESOA 1KJVB 1CFQA 2A3TA 2H2PC 3MRKA 4PRNA 1I1AC 3X12A 2UWEA 1C7TA 5EBLA 2R8SL 1AIFB 3G04B 1KULA 4D7PA 1IQDA 4TRPL 1WA0X 3K3QA 4Z3HA 2XG5A 5HHNB 3F8UB 2GJZA 4QNPE 3PWPD 4WRLA 5JOFA 3EFDH 1C12B 2BP8B 5GZOD 1P7KB 3P2BA 2VO5A 4XWGL 5H2BA 2AK1H 3TVMD 3QUXB 5I6KA 4P4KB 3BZFB 1QLRB 1X5FA 3AQXA 3WL9A 2XWXA 2EABA 5I8OH 4JRXB 3OKLB 5DJZB 3B1TA 2VTFA 4EIZC 2NUTA 3BT2H 4M6OH 2PPDA 4OH2A 3I9PA 3FFCE 3N9GH 3QORC 4P99A 4G11A 1PLBA 1L0XA 4MYWB 4ONOA 3KLSA 3PXHA 4NT6A 4FQHA 1X7QA 4LPXA 2ZX7A 1D6VH 3NK4A 2DYPB 2E47A 4APQC 1BVKA 4QHPA 1GYUA 3QXAB 4TNEA 3IDYB 5IEHB 1JHTA 3QR2A 3AS3A 1I8AA 2YQ2A 3KYNA 4XN9A 4ZO8A 2ICEC 5KAQG 3BPLC 2KUTA 3MLUH 2DMBA 1IM9D 1ICTA 4H26A 5CAYB 1T22A 4IIQA 5CJQH 1MI5E 2Z4QA 4MZRA 5IY5B 1OP9A 1I8UA 4N2GA 3EDFA 5LBVA 1WWBX 4OGAC 5DK0B 4IU2B 5GGQL 4TQEL 3ALPA 3A6OA 1UOKA 2ENJA 2LHAA 2WXHA 7FABH 2HVKB 5HYFA 2LOEA 4TUJA 1H3WM 2YAMA 4R9HA 4TPRL 3UXFA 3SQRA 1J9CT 5BNXD 5JW5A 1ZHBB 3P40A 2EE3A 2OMXA 3BCDA 3QWOA 4LL4A 4PJCE 5T3ZL 1F3JA 4J2QA 4HJ1A 5ABDE 5DUPL 3KPTA 4KRPB 3UO1L 3FZUD 4E9TA 1VGKA 4KY1L 3LRSA 5L7XL 2MCPH 5D7IB 5JIPA 4BFFA 1TR7A 4QXTB 4RRPG 1NUDA 3PHSA 1SXNA 1SHXA 4N90E 4FGMA 2XTJE 1M1XB 2OSWA 4QDGA 4F7EA 9CGTA 4N2EA 2RCSL 4R8WH 2BVYA 4M8QA 4QUOA 3WNKA 1RJZA 4KNTA 2I27N 4PY8J 4WHDA 5I30L 3WTUA 3CAFA 3CC5A 3L5IA 1E9OA 5GRUL 3HI5H 4MS8C 3V5DB 3H3PH 1I1YB 2R1YA 1BX2A 3HEIB 3NJXA 3GSNL 1RZJL 1SZNA 3EBAA 5IGXL 4QOKA 4M7LL 3HS0A 4D0CA 2WGXA 5DMGC 2Z3FA 3GIVA 2CA4A 3CGTA 4YS4A 1I7ZA 4IRZA 5C0BD 4TVPD 3JUZA 4BINA 3UBGA 1PTZA 3RU8H 1DANT 4XMUA 4XXWA 1NAML 5I0WA 3S97C 1U36A 2V9QA 3L7FA 1F1AA 4WW2A 3OMZA 4MZ2A 4OFIA 4C83B 1GAFL 4EE2A 3H9ZA 2V5SA 4XB7A 1FO0L 3WNIA 3EBGA 4NBYB 5IFHH 4QRTA 5DLLA 2J1XA 2WZPA 4F27A 1YY9D 5IQOA 4Z7UE 2BVUA 2CWRA 2VDRL 3QHFH 4X4YB 1IQWL 3AACA 3OXRA 5J13C 4L0PB 1HCYA 1MVUB 4XX1G 1JPTL 1VFMA 3FCSB 4HWBL 2OK0H 5SWZE 1WE5A 3U36A 4MQXC 5DDHB 1MHHB 2IADA 4L3CB 1ZPLA 3GHEL 3MTXA 4NO2B 4RMWA 4R7DB 4P9HC 2EXWC 4XB8A 3ZIMA 2DM7A 4F2EA 4B9PA 4M1GL 2HLEB 2WLKA 3MBWA 2Z0BA 4JFXB 1XV8A 3CK0H 4Z9KB 4J3OG 1R24B 3SDXE 3FU7B 1E40A 4DN3L 1JWMA 4PJ6A 4TQ8A 4NQDE 2QQLH 1VJSA 1WD9A 3N41B 1SHMA 4JPWH 1T1ZB 4QF1B 1P7QA 3VI4B 1A7OL 1L9MA 2K8QA 4MAUL 1M7IA 1TJMA 3S3SA 4Y9BA 1OLLA 2IPUG 3OJVC 4PS4H 1P84K 3WYRA 2WO4A 5EC2B 3GJFH 2BW5A 3CDZB 1G1KA 4Y1SA 4N0UB 2HP4A 3ZE1E 4FQQB 3M7FB 5I6LA 4W9EC 4FQJH 4H2AA 2FNBA 5DJXA 3RTQD 5BCAA 1L0YA 3CZFB 2Q87A 3REVA 3FL7A 4LCVA 1AGEA 1NJ9B 2VLKE 3F7QA 3MLXL 4N0YL 4P46C 3SYPA 4G6JL 2DI8A 1EERB 2FATL 5B3JF 4L4VD 3C2AH 1QR1A 3LHPL 4AYFA 3QEQA 2QPSA 5KZCD 2DM4A 1KIRB 4H88L 4HC1H 1KTDB 1CFVL 3RVWD 4JHBA 4LSQH 3NPSC 1UACH 2NY7L 5HDBB 5ICUA 3W9DA 4DP4X 3CH8A 1DVYA 3OKYA 5KYUA 1J8RA 2VR6A 4JFHE 1ZXKA 4NRYB 4LCWB 1QHOA 3AQZA 4KNSA 3IJHA 2D8KA 3ML9A 5EU5B 5D7LB 4AH2B 4PG9A 5C0AB 4R7NA 4OM1L 4KJPC 4HT1H 3X3GH 2K8MA 2WLMA 3KYAA 3TN0B 2V6HA 4ICXA 4JZOB 2VM4A 1MRDH 1OSZB 1F42A 1NFAA 1PBYA 4PJ7E 4RLDA 5IR1B 3D05A 4EI5A 4CN4A 1FFOA 2ZUYA 3C8KB 3BQVA 3L3DA 3FT2A 1LWHA 1S7VB 3L4YA 4F8PA 3TCXA 5JZ7D 1QATA 5EF3A 3AGVA 4OF0A 1T5WB 2OTUA 1ZK5A 5L4IA 1XCQB 2XQ0A 1A7NL 3O2WH 4OFPA 4L9LB 3QUZD 1JE6A 3B3IA 4UUJA 4BFOA 5IB5B 3BD3A 2X4OB 1BFVH 1TJGH 3L13A 2CK0H 3NCYP 5KEZA 3FOLA 4WV1A 5HHPB 1UWGH 4YEFA 4FNLL 3WKQA 2GI7A 3DMMC 2KLTA 3RBSA 5C0EB 2KL6A 2PYED 2BVTA 3K2IA 3WHE1 1YNKH 2V17H 2E59A 2AV1B 3QQXA 3UEQA 1OHQA 3M6DA 3RGBA 2K9FB 1L5GB 2FWLB 4UNVA 3DJTA 1IKFH 1ERNA 1TEFA 4PD4K 4TNGA 2ZXCA 4YDIL 3SDCA 3GS4A 5K1VA 3NJJA 3BWSA 2WOBA 1RQ5A 3H3KA 4HCRL 1AXIB 3SDDC 2TRYA 4PREA 5CCKL 5L2KB 4GAGL 1A7RH 3D2UB 1N6QH 5IJCC 2DQGH 4F37F 3BUYB 1AGDB 1RZKH 2EADA 3V8CA 4A2EA 2C9PA 4NC1E 2VN6A 3DGGB 3Q01A 4IOIA 5FKAA 2PO6A 3FPYA 5HHQA 4D0DB 4JDEB 1TZGL 5IF0A 3CFTA 3O3UN 4MBOA 3KPRE 3KWWA 2VJ0A 3QRLA 4WFEE 4FLSA 4GG6F 3WNLA 2YUZA 1SN0A 3BZ4A 2ZZUT 2ZUSA 3LCYA 1N68A 3QO1A 2IWFA 1CXLA 3GJFK 1OT4A 2CM6A 4KROD 3C60A 4L8DA 2IAMA 4M5SA 5ERWA 2V5TA 2ADFL 2I7OA 4FNUA 4RFEA 1FNSL 1G7JB 4UDTB 3OHXA 3BCFA 4ZSOB 2UWEF 3EYOA 1MLBB 4DVRH 3VXME 2J20A 4F7PA 1GHFH 3ARDB 2WNXA 5E99L 4DUWA 3M1BA 5H37H 5EBWB 2D4DA 2VLRD 2W9LA 3DO7A 3O2VL 3WN6A 4PRIB 5F9OL 3QUKB 4L29B 4FF9A 4G42A 2UZYB 5KBNC 2ENPA 2PTTB 3UYPB 3TO4D 2W95A 1E2VA 2KLSA 3T3PF 1U8CA 4FNSA 2F5BH 4N1CA 5E7FA 3S3PA 4JDZB 4GBXB 4KUZL 1XF3B 2UX6A 5GGSA 1M3JA 3POHA 5IJVB 4IRJA 4OLZL 3ESVF 2A6JA 1C8QA 1N26A 5AL0A 2Y1AA 4I18A 1WS7A 1IBGH 1E5UI 4JDTL 3UACA 3RFZB 1YEJL 3MBXL 1EA9C 2ITCB 1GZQA 4GLRH 3RUGB 1NAKL 3OMNB 1E4JA 3VXQA 1FSKB 1VZIA 1L3NA 4YHZL 2OSXA 2DQDH 2DQEH 4BKLB 3UPAA 1RP9A 5KBLA 2APWA 1FFPA 1AHWC 1KIPB 1A7PL 5BOZG 4UOJA 1U8IA 1UCBL 2BOLA 3IGLA 4AVKA 1BP3B 2W0KA 3F3HA 4AIZB 1X5KA 2X2HA 2JKRM 3SDAC 4DAGH 1IJ9A 2G3XA 4CU6A 5JPNA 5L88H 2ZOKA 3NIFF 1CLZH 3T3ME 4IIZA 3L45A 3KL5A 3PCYA 2I9LB 2LE9A 2YRLA 4IKKA 4AEFA 2QHLA 4X9IA 1G7IA 1FIGH 1GY1A 2GSIB 2W81C 3RWEB 3DBSA 4QCIA 2ZCHL 3VFSB 4W9FC 1TJHH 5DEGA 3VH8A 4KVCL 5GS2D 4R4FL 4YC2C 3QDGE 1LWJA 4PJAB 3SGEH 4NNPL 1IV8A 3MGTA 1HEZA 2OMZA 2VDOL 5EO9B 1BQLH 1ETB1 2AF2A 5BUGA 3B2UD 1E27A 4NQSB 5EUKB 2X4RB 2G3ZA 5DQDL 4ZQKA 2BSEA 3O2DA 3GLEA 4HEMA 2QGCA 3QIUC 5EBGA 2OMWA 3DPDA 3KZ8A 1CBVH 4ZXBB 1MY5A 2R9HD 5GGRA 5TGBA 4UV4H 4NOFA 3EAKA 1KG0A 4A2DA 4BD4A 1JN6A 1QQDA 1QD0A 2D31A 1OT1A 3BP4B 1AOZA 2V3EA 3SKJL 5K9QI 3CVHL 1A66A 3ESUF 2YEVB 3WUWA 1AZBA 4TLTA 3QJRB 3SO3C 4I87A 5LUMA 3DOSA 3B9KA 1EEYA 5DFTA 4IKLA 3WIHL 4ZMLA 4MDRA 4BKSC 1UZGA 4X8JB 2K3HA 2B0SL 4OZFG 3IFLH 4IMLA 2K45A 4DP6X 4C47A 5DSCB 2IAAC 1I9IH 1I9JH 3CFDB 2B5IC 2XLLA 2E7HA 4WW2F 4ZMTA 5HYQA 5I1GH 4OTXH 3OLDA 4M93C 1BQRA 3OZKA 1YC8A 4N5ED 2AQ1A 4UT6A 4L4TD 1WJ3A 1LYQA 3P30L 4FZ8L 5DTFA 4UT7L 3JTBA 3WXVL 3S35X 3O0RH 2ZPKL 4M4PA 2G75A 3F6LA 5FM5M 3TS8A 1XEDA 2CLRA 5EZIL 3MJGX 5DWPA 3QDME 1F6LL 2AKRA 1BAWA 4UTCA 2FWSA 2ZSVB 5DHEA 1IC0A 2YOCA 5FGBC 1IZJA 5TK4A 4OUUA 4EAEA 4I1PA 2XIIA 5ITFA 2AQ2A 4YWGL 1XZ0A 3ULUL 5E9AA 1N8ZA 2EIMB 4UM8B 2F58L 2EDJA 4P8QA 4ZX5A 3FBKA 4NZTL 4KVNL 2GC7C 4GI9A 1X6LA 2I32A 1DQLL 4H5SB 4LL1A 4R4BA 5IW1B 3TIEA 3X1GA 3S8FB 3PHAA 3IAQA 1U8LB 3PHOA 4NQQA 1QO3A 1PD0A 2BM3A 2AQNA 3AUWB 3RVTC 1U8JA 5L8LB 3GRGA 4NJ9L 4Y8DC 3U4EA 2E56A 1CLVA 1JGLL 3PPEA 1AXTL 4EQ2A 3FSWA 3HG1A 4J27A 4GINA 4WI2A 4XE5B 2OX5A 4NPYB 4JL2A 4WK0B 4CW1A 3LNDA 1H0DA 1WVZA 4G43B 4P04A 3QUXD 4P2CG 2PR4L 4P4KD 1M4KA 4ZMPA 4JRXD 4ZUWB 3PXLA 5J6HB 2P80D 1Q4NX 4M7ZB 2ZP0T 3UGEA 3ZKSD 3JZ7A 2BNRB 3GUTA 2KI6A 3NJLA 3HPLB 4FG4A 4ELKB 3WFCL 4P2RB 5I76A 2R4SH 4HP5A 2R7EA 1UB5A 1OW0C 4IK7A 2DYPD 3NG5A 1JGDA 5ESAA 2CRZA 1Y6MR 5DLMH 3THMH 4HG4K 5AD0B 4X99B 1R3KB 3TT3L 3NZ8A 4F92B 2HG5B 4Y1AA 1YEIH 2JFCA 2VDKB 2W0LA 3DSNB 2EKJA 4GUPB 3FTGB 1OEZW 3LPGA 2BWDA 4K2UH 4KDVA 5DHMC 1L6XA 1JNNH 5A7BA 4ZAKD 4DVBA 3EOTH 2FYYB 1MPAH 5E94A 2ENSA 5D71L 5DRWA 2VDNH 5EWIH 4CL7A 1WIOA 3BE1L 5D7HA 4DKFH 1F4YH 1PKQB 2AABH 2M8XA 3QZWG 8FABB 1IGCH 1PCSA 1HZLA 4KRPD 4E41A 1LTXA 4OJFL 1L6ZA 3ASOB 3E2HC 4K3DH 4KQ3H 4C56A 2R23B 4FA7B 2X6AA 4OZ4B 1WAAA 2WKGA 3RA7L 1E9PB 4AK1A 2HPOA 3HZKB 1HAUA 1QUNA 4JZNB 2UY7B 1NWPA 3QEUA 4PGCB 3U0TB 3NJGA 2EDHA 3IJ7A 4WKZA 3HRZA 1OGAE 3D3VA 5TF0A 3L5HA 3AAZB 1CU4H 2GEQA 1QACA 4RDBA 4S2SB 1S78D 5LNEA 2HN7A 3PWJA 2DICA 1B0GA 2I07A 3L5XH 4A39A 3S9DB 2GYSA 1A3ZA 3ZL1A 1TMCB 1MFBH 1JNJA 4NUPA 3D4GA 4PRHE 1KCRH 1H15A 1JNHA 5I8EB 4KKNA 3GEWB 3D4ZA 4LLUB 1OXYA 3Q8AA 4NQCD 1E6JH 3UYRL 4F9LC 4Y16C 1T1WA 1MZZA 5E4EC 5CGBA 5I0VA 1CGYA 4IOSD 1WAEA 2X6BA 3GJEB 4QHKI 1U8NB 4AEIH 1EUUA 2ZE0A 3ULVL 3NRPA 4URKA 2XXMB 5CZVH 3HA0A 4AJVA 4LSRL 3QUMB 1KBVA 1QLEB 3KDPB 4K15A 1K5NB 4OCRH 5FUCC 1E90A 3B1UA 1OCZB 3I6LE 1M71B 3QNYB 3WJMA 3WSQH 4NN5B 5DO2D 5LAXA 2Y07L 2IANA 1BFOB 1HHHB 3I6KB 4HCFA 2QSCL 4RGOL 2G2RB 2JI1A 1MIML 1NANI 3HG4A 2WANA 3PDDA 4KI5C 1MJ7L 3G5XB 5LBSL 1PIFA 3VXUE 1IL1B 1U3JA 2B1OA 4LKXB 4HKBA 4YDKL 2APSA 1UT9A 4S11A 3MODH 5CGTA 3QGVA 5IQMA 4OF7A 4XN5A 2WO3B 3PQYE 2FR4B 4RMRA 5DK2B 3FQRB 2X6CA 3ENEA 2LLGA 3EH1A 2BSRA 2IH1B 2X53A 4TL4A 4X6FB 5IMLB 1MRCH 1RURH 4I9WD 5CO1A 4RFOL 3ATDA 4M8UA 5DRNB 5GHWH 1UD3A 3AQDA 5C0FA 4N6RB 1S9WA 4CVXB 1TIUA 5HYJB 4JGMA 3MJ8A 1JDAA 1CXEA 2FSEB 3F6IA 2JSFA 1TMQA 5I1EL 3I02B 3MCLL 1FVCB 2XVLA 2AEQL 5E2UH 4FLOA 2FVNA 5EORL 3WMPA 4CN6A 1CO1A 5AW1B 1QNZH 2ITEA 1EO8H 1TYJA 3JVFC 3RWFB 2J72A 4LPVA 1ZWIA 3ILDA 1MCKA 1HS6A 1TTGA 3IMRA 1BQHG 4OCMC 1N59B 2ZKHH 4CBZA 3U0PA 4QJ4B 2C34A 4JRWA 2F15A 4Q2ZB 5D1QA 4NPKA 5DFAA 3SQOL 1WBXA 1FPTL 2QR0B 3ULAB 1RUML 3MRGA 5I19H 1G1OA 4MTMA 3SE9L 1UT1A 3RGVB 4N86A 1UC6A 3CVBA 1BA9A 4TF4A 2WXOA 1SXSA 3ZK0A 1MH5B 4CSPA 1OSPH 5EC1B 4D0BB 3HNTH 1HIML 1EHAA 1ET5A 4H1LH 4PV9A 2FYVA 3PNRB 4XPGH 2X2YA 3MLWL 3DYMA 4YXKL 5IB2A 4EZMA 2YMOA 5ACZB 4I4WB 5I28A 2VITA 1EMTH 4F7CA 4LCWD 4KKLC 1T6VN 4JFPA 2CJUL 1KB5A 3KE0A 5D7LD 3V6FB 4FQCL 4R5XA 3RNKA 3HS8A 1DBKL 1S9VB 4GG6B 3TN0D 1N5AA 1WTLA 1SLVA 2JJSC 3GFUA 5INCA 1CFQB 3S7GA 3MRKB 1O9ZA 2W0FA 4PRNB 4S0SD 3RY6A 4KX8A 2C7UA 1FH5H 3GZQA 3VAEA 2CO1A 3MREA 4JKPL 1OAKH 2UWEB 5LDSA 1WS8A 3OGCA 1SMAA 4PI2A 3Q6FA 3UL4A 3D18B 4N9GA 2FD6L 4NS0A 4ECNA 2HX8A 2VN4A 5D2LB 4AYDC 2V8MA 4RZCB 3I84A 1BMZA 5TPWL 3T3PB 3G5WA 1D7BA 4TSAH 2B14A 4CSTA 3Q2VA 5C08A 2FH6A 2BRRH 3WL9B 1Q0YH 3JT0A 1MNUH 3O4LE 3TP4A 4BM7A 1I1FB 1N18A 2A2QT 1SXCA 2EDQA 4TSBL 5E95B 1UXLA 3T2NL 3T08A 3V8OA 2N7SA 3AM8A 3GSOA 4FQHB 1YEDB 4Q6IC 3W82A 3ZJAA 1FQ9C 2IGFL 4WO4C 2X28A 5C7XL 4A38A 1CZ8L 1BVKB 2QMKA 3CFCH 3IKCB 1JTOA 4UZGA 1QFOA 1JHTB 3FO9A 3KCWA 3QCTL 3VFPB 5HGHB 3FMGH 4Q4EA 1UOVA 2A6DB 1OB1B 3D2UD 4N2KA 5AYUL 3SOBH 1NGWA 1KYOJ 1BZEA 3O9WC 1VHPA 3PHQB 3OKKA 2NYYD 1R5IB 4WY7H 2CMRL 3MNWA 4UNIA 4PJXE 3CFBA 4DGVL 1PDKA 4LCUB 1A3RH 1H3TA 2FGZA 3X14B 1BG9A 4TUJB 2CALA 1IC5L 2YARA 1KN2L 2Q7NA 2PUQT 1OAZL 4Z7WF 3I9AA 5DS1A 4JK0D 4PJ5D 4M3JA 4AE0A 2OL3H 3ARDD 1QKZH 3MROA 5JDSB 5EU4A 2Z91A 2DYSB 1DN0B 3PF2A 3T8XB 2CRMA 4PRID 2KH2B 1NDGA 2RFXA 5L9DL 4YDVB 4ETQB 2DI9A 3GBMH 4S1QL 4WFFE 1BAFL 1KTLA 3CC5B 4KNUA 4F3FA 2XKNA 1XF1A 1E8XA 4JMXA 2DD8L 3ZZQA 4GBXD 4XP1L 5F97E 5J11B 3LD8C 1VF5C 1ETA1 3GS0A 3I6SA 5LGJA 4XO9A 1KGCE 4GMTL 4P9HH 4LZKA 2BS9A 2OW7A 2UVEA 3APNA 4JFQA 1T7XA 3ALXA 4GW4A 5CFAA 1MCEA 1U6AH 4PJIA 5IFAH 3NSFA 5DD1L 3RLSA 1QOKA 4ZD3L 2H3XC 2O4EA 4MASA 3NCJH 5C0DA 3U83A 2CLVB 4ODTL 1CJYA 1XGZA 4N2LA 3KYMB 2JKLA 2ZJSH 3MAWA 3P3SA 5C0GB 5FUOH 4NB7A 1LDPH 5CJ8A 4DW2L 5CEYA 3V9CA 2VJ8A 1A0QH 3LV3B 3V5KB 3IWVA 1H5BC 1MJJA 3GSNA 5DJYA 3BPOB 1SEBA 2WZ6A 4GFXA 1IKNA 4Q9QL 4GRWH 1K4DA 2X4UA 3DKHA 4YMPA 2OR9L 5C7ZA 2XWJA 3LIZL 1BREA 3B5HA 3N43F 1ZPUA 4OF8A 1IFHL 1WCBA 2VR5A 4B7LA 1E8YA 1TLKA 1YCSA 3QIBC 3C75A 5AL8A 1ZVYA 1NFDE 2EIEA 3MLYH 4XT1C 2ZOUA 4HUWA 4RRPA 3UROR 4NXKA 1WAAF 3GMPA 1UZ8B 2JCCE 3V6ZA 1DQKA 5HGBA 2CKBB 1NMAH 5DZNA 1W91A 1USQA 1FO0A 2KYIA 2LGNA 2Y2TA 3LPWA 4ZXBD 4D8PA 2OTWA 3STZA 4DSYA 3F7PC 2PKDA 3RZCB 1HWHB 2DMHA 1S8DB 3PIQA 3C2SA 4GSDH 5FYLD 4LSUL 1I8KB 3UEZA 2O5XL 1XSKA 4FLQA 4GRWE 1X6NA 2P46B 4K8RL 2FX8L 5FHBH 3SOTA 5AYQA 5I17A 4DN4H 2Y6SD 2IVFC 2IBZY 3VJ6A 3BP6B 3ZKQD 1HYSD 4EVNB 3TYGL 4WWID 1MG3C 1L7IH 4YHLH 2K6ZA 4JB9H 4JFTA 4PGJA 1U8MB 2BZCA 4U05A 1PF3A 1AGEB 1RJYA 2JELH 5I8CB 2ITDA 1XH0A 2IFFL 2RGSA 3NRQA 1A5FL 2NY6D 4ZO9A 1HHIB 4BFNA 1BJMA 4ENEC 4S1RL 2DQMA 1QBAA 1YEKL 5E5LA 4YHOL 4AYFB 5KN5B 3CTTA 5DEZA 1U93A 1Z3GL 3EJRA 1NCDH 2BO0A 1H3PL 3ILPA 2HTKC 2NQDA 3Q05A 1JMXA 4A66A 4HKXA 4DP9X 4EN3B 4TSCH 2Z8VC 1RIVH 3QEHB 4PCSA 5DF0A 4LP4A 1LEIA 5C0CA 3ZKND 4H8PA 1KJ2L 2W07A 1WZKA 5GRWA 3AG2B 1FH2A 2AVFA 1MAML 1LP9A 1OTTC 3O3AB 4UU9A 4PW3A 3ZO9A 3C5ZA 3VFMB 5CEZH 2QT6A 4MCMA 5AB2A 3OC5A 4UILL 3L3DB 1CL7H 5A2LH 4L2YA 2N7AA 3HC2A 4P3CH 2B20A 3NTCL 3SJVA 3VRJA 1VGEH 3FUHA 1BOGA 4WI8A 5E5MB 1ZVSB 2FZ3B 3CXHK 2DBLH 1SRDA 1KXVA 1DN2A 2A6KA 4GRLA 5B39B 1Z32X 4JLRB 3HHSA 1TETH 3OJMB 1KEGH 3L9RB 5GZNC 5F7DA 5HHOE 4WV1B 4Z0BL 2J6EL 1OVZA 1K2DA 1NMCC 4H44C 4P3DB 3ROLB 5F2FA 1YEFH 1KXTA 3PG2A 4R5VA 4BKTC 5A16A 2XU9A 4X6EA 3BRGC 3VQLA 2OCJA 3BKYH 2PW2A 4OCLC 4JJOA 5D96C 2VLMD 2YMXH 1DQTA 2XVKA 3CBKB 3NZUA 1N0LB 2Q86A 3FU0A 5CEZE 2CPUA 3SGJC 4W6XB 5L4FA 2FO8A 4AZ8A 3ZHFA 2MOVA 3IEAA 4GQRA 1CMOA 1NCHA 3WEXB 5BMFL 4RMUA 2J44A 1U8OA 4Y2DB 4HIHA 2BNRD 2AJZB 5LCVL 5I2IB 2F19L 2GITA 1ILUA 4JY4A 4L1LA 1VADA 4AKPA 3NABL 5ALBL 4P2RD 4E9XA 4EF3A 3IDUA 1YA5A 5C07B 2BIPA 3ZZSA 3P4NB 2ICWI 2XN9B 4AX3A 3DTXB 3A6CL 1QFUL 3BQUC 3DJZA 4TNWK 3PL6A 4ZS7H 5FHAL 4X5WA 1FFRA 4G1EB 2XG4A 3A3YB 4RAUA 1FLRL 4M93B 4YFDB 2VAJA 1J8HD 3GBLA 1FLTX 2WBJC 3RIKA 1FBIH 2K70A 4KJQD 3PPSA 2VN5A 1BD2A 3KWWB 3L3JB 4MQSB 4OJYA 5EPMB 5KJRH 4J3WA 4L37B 1PLGL 4FL4C 4XNXH 3E8UH 3CHQA 4MMZC 3VD7A 5LHDA 4NM4L 3MGOB 4LSSL 5E8OB 2P5WE 1KFGA 4HCRA 4V1DD 1CK0L 3SODB 3AREA 2VZOA 1QTPA 3OF6D 5EB9A 1U8HA 5B38B 2V5YA 2ATKA 1I85C 1UENA 1JGEB 1IAIL 2EC9T 5T1MB 4ZDHA 4YLBA 3DIDA 1J1XH 1JFHA 1PFCA 5D1XA 4ERSL 2JV6A 5D5MF 3IJSB 4FXTA 3TJHD 1R33A 1IAKA 4YHKL 4XP4H 1MCWW 1HCZA 2YD1A 1G7PA 4CGTA 2O61B 4AC4A 1MCHA 2H2PD 3QI9A 4WHYG 3RDTA 3KWUA 2ETWA 3K4DA 1AHMA 5DZJA 3MMEB 4Z3GA 2ZXDA 4HV8B 3MRDB 3QFGA 4FHKA 3VU1A 2EYRA 4PFEA 2UZXA 5ETUB 4FFZL 1T1YB 4P23B 4KK9D 3OKNB 4J6IA 4U2YA 4HIJA 1PL3A 2NX5A 3LB6C 1MHCA 1JFQL 1NH6A 2FJGA 2LW3A 4MCYB 5TJWK 3PY9A 2ZOLB 3KEHA 2CBTA 3VXTA 3GYRA 5SWQA 4UM9B 1UT2A 1MI5A 1FYTE 3S8GB 1NCUA 5HSFA 4KGJA 2DWSA 2W65A 1C5CL 3L3OC 3MR9A 1XGQA 4FTVE 4JFFB 1II4E 5L0QC 4N2OA 1Q9WA 2FIRT 1GL4B 5I1AB 5F7EL 1QG3A 2X70B 4QCIB 3SO5A 1TSHA 2VABB 4GKZB 1RP8A 3TOPA 4MXVF 3VH8B 5DS8B 3QXDB 1BZDA 1J0ZA 3SCMC 1MEXL 3AQYA 2XWBA 3RJQB 4QLWA 2ICWJ 1M57B 3FH8A 1IBYA 4A7SA 2PYEE 2HKHL 3PP4H 4TS6A 2YGNA 5FM8A 2OMWB 1U2YA 5KW9L 2ZX8A 3HKZA 4JZJA 4G7VL 5GGRB 4Y9CA 2ORBH 4NM8H 3DV6B 1QQDB 4M3KB 3IMSA 2B77A 4YIQA 5KUMA 4ZX4A 2IQ9H 3NJHA 4OGAD 4Y4KA 2PCFB 2Z31A 3D08A 3F7VB 4Z7VE 4XZUA 3HUJE 1IEBA 1IC7L 1LVEA 1SJEA 2WNKA 5CJOH 5IJBC 4XNMB 4JFEE 3QWRA 2WWKO 3B9KB 3REWB 1R5VA 2RAMA 5FO9A 5HYJD 2Z6FA 1XEUA 2R29L 4YE4L 4B0MM 1IBZA 3WDJA 1FDLH 3CZKA 3VFTA 3MLTB 3MYJA 3WLWD 4HOXA 32C2B 5HYQB 2MOGA 1U3HC 3L2LA 1LO0L 4AGQA 5I24A 1G5AA 3G5VA 4JN1H 2VT0A 3QH3A 3A4EA 4MJIB 4W4NA 4ODBD 2VUYA 3CLFL 5DTFB 4M7JL 4JQIH 5EO0B 5D6DC 3AABA 5ADPL 2CBOA 3RI5F 4L18A 3CVHA 4MS8D 1AJ7L 2AJXH 3KPPA 3L9YA 5CIPH 5IJKA 2YK1L 4AQ1A 4MD5B 2VMFA 1SFHA 3RGVD 3UG5A 2CLRB 1TG8A 1TTCA 1CYGA 4Z7OF 4TQHA 2LT9A 3H2WA 2AKRB 5DMGD 3WIHA 3NESA 5C3LD 3BHBA 4EDXA 3IU3A 1F3DH 4RWHA 4DCQB 2JI3A 3V5HA 2CR6A 1OLZA 3EJSA 4TLSA 5TD4A 1XR8B 5GGVH 4XNZC 3VWJA 4NQXA 4UOZA 1A9BA 2EH7H 2P43B 1XO8A 4XXCA 1N8ZB 3S4SG 3WD5L 3RB7A 5F1IA 2AEIT 4G7YL 1FNGA 2W91A 1U3ZA 2YLKA 2BHFA 4KTDH 4O2EA 5D7KD 3H6JA 4AL8H 3WHE0 3CMOL 4IOFD 2ITFA 1BPVA 4HUCA 4L2LA 3VMNA 3BIKB 3TIEB 1LK2B 4OQTH 4N1HB 4Z7WB 4WO0A 1BFSA 4AUJA 1QO3B 4AZUA 4E0RA 2W59A 4D9LH 5KVFH 5IT2H 3SKMA 4PLKC 4TN9A 3NBNA 2JKXA 3UBXG 3F7LA 1JXGA 3P3RA 5DHXB 4MQXD 3U4EB 4Q4IA 4JPQA 1EHNA 3V0FA 3DHPA 2UXTA 4NLHA 1WRFA 1MJUH 2CUIA 2EXWD 4ONFL 1JUFA 3KVPA 4LP8A 1QZNA 3T0DA 2Z93A 4F5CE 3R1GH 1SOXA 1IM3A 5JORB 4JHWH 3ROOA 2R2BB 1DEEA 3GUTB 1YLBB 2VZUA 1CLOH 4OCSH 5KSVA 1ADQA 5J6GA 1T83C 4OZIE 4XZ4A 1ZEAH 1ORQB 3QRFM 4TVPL 2K78A 2Y0SA 2FEEI 1BVLB 1JGDB 4QRFA 4PJFE 3MV9E 5FAAA 3ARGC 1TJIH 5FA3A 4HDIB 4ADGA 4A2MA 2DQTH 15C8L 3P0YL 2Y7MA 1I3UA 2NTSP 4ZJ9A 5BUPA 3MKGA 4G1MB 1NC2B 3WN5A 4I85A 5F1NB 2WQVA 1LP9F 3MNZA 1AYRA 4NNXB 3QS2A 1KCBA 4CJ0A 3FXIC 2XTLA 1BLIA 4TVSa 1S9KC 5IOKA 5D6CB 5GRJL 3V4PA 5E94B 4J3OF 3E80A 3Q43A 1UM6H 4E5XG 1JV2A 4F9PA 2PWGA 3N43B 1MQKL 2BSCA 5IHUH 2ZYHA 1YMHB 3L6FA 5CSZA 5D70L 5IVXB 3TESA 2G60L 1UASA 4W9ZA 5FOBB 1N0XH 1CDCA 4H8UA 5F6IC 4C56B 4MDIB 2DWTA 2L7EA 3T6QC 1W0VA 3NIGB 3P0VH 3WDIA 2IXQA 1QW9A 4U3XA 4BFGA 1YY8A 3DTUB 2NYZA 3G9VA 2CGZA 2OP4L 1G6RH 2Z4TA 1RZ7L 3Q1EA 3D48R 2HJFA 4BSVA 3SD5A 2D7MA 2EZ0C 3LEXB 4IQHA 5IB3B 3MOAH 1B9ZA 1MHEA 5JXEA 3DXAA 4HUVB 1YAZA 3I3DA 3IXAA 4XPAH 3CCHA 4HIEA 3KS0H 1CFNA 4XMLH 2FJHA 3QPXH 2ENQA 1T3FA 3IFNH 5ILTL 4YL9A 3TEUA 1RUAL 1MNNA 2P24B 5B7MA 3GDBA 1J12A 3PFQA 4DKEL 3O41A 1VZGA 4ZUSB 1QRNB 5FUCE 4Y88A 1OQXA 3V0EA 1IT9H 1KZYA 3APMA 3TONA 2VDLH 4KI5E 5GRYA 4CKQA 2R2HB 3L48A 3O6LH 2EEBA 1X5XA 4RISL 3VWKA 4WUUB 1LO2L 5AZ2L 3WTWA 1G9MC 3RVXC 3DSFL 4FN0A 2BFVH 5JOPE 3T77B 3IGUA 1AO7A 1ZE3C 3ZGIA 2DLIA 4CVZB 1VCAA 4QRUB 5F0PB 3OJDA 1PNDA 4LEOA 1I7UA 3UJTH 3VXMA 4DZBB 5K5YA 4FEMA 5IMOA 2Q6WA 3ARRA 3U0WL 5JDJA 5I0DA 5I9QB 2BVQB 1TZIB 3CJJA 4ZFOL 4JX0A 2FH8A 1XF2B 4J3UA 5KYNA 2Y1YA 4YSDA 1HOCA 5J1AA 1GC1L 1BWMA 4KZEH 4HLZH 2A7BA 1SLWA 4UINL 3CN1A 2DS4A 4KDTC 3GBNH 4QGYA 1YRKA 4XPTH 3BEWB 1CBJA 3LAFA 3NJMA 5K9JH 5DZVA 5DFVD 4IW4C 3RZCD 4K5LA 1TZHA 4HPYH 4U6VL 5AQ0A 2GUOA 3OKDA 3VFNA 2J1YA 3I6GB 2O5NA 1BIIB 2J73A 4HXBH 5LBSA 2O6FA 1OM3L 4G8GE 3SKOA 3F5WA 3DROA 5KG9A 5GIRA 1BXXA 3U0PB 1JF1A 5EZLB 2Q8BL 2HT2C 5D1QB 2NXZB 4U3SA 2CUAA 2OW6A 3SY0A 4Y4HA 5FPIA 2H32A 4IIQC 1MG2C 5HVHC 4ABVA 4P2QB 4NRZA 2OXHB 3X17A 4U1GC 4IHOA 4LOUC 2YEZB 2VERA 1U95B 2B3IA 1A22B 5BW7C 2ZXBA 3FQ1A 3FU8A 5T1JA 3TBVB 2I5YH 4AYSA 4BZYA 4KQ0A 5KBMA 3CXDH 3QDGA 4WK4B 4EN3D 3WEAA 4LHJB 5MI0B 2YGQA 1KYDA 3NH7L 2ZWNA 2VITB 5I1KL 3PNWA 1ZJBA 2PN5A 1HC1A 2XX0A 1JXKA 4PJ9B 1JWSA 3U82B 3AG3B 2HRLA 2Z8SA 1E5CA 4JM2C 5ID1A 3MQIA 3DRQA 1FVEB 5ECGA 3O81A 4XAWH 4QPEA 3FUKA 3H9HB 1KEMH 3L5WB 1KOAA 4JMNA 4B53A 4A63A 4XC3H 1CR9H 4DPBX 2HJKA 3BYTA 2FBJH 2APXA 4D9RE 1J87A 2ZG2A 3W2DL 2DQCH 4PVNA 4U1NA 4YQXH 5G2NA 1HI6A 1U92A 4OCYL 3NSJA 3D39B 2Z9TA 5JW4M 1MFAH 3D0LA 2QQQA 4M43L 3MTRA 5HHMB 3HS0C 4L05A 4PRBB 5D5MB 4E9VA 4HW6A 3UIYA 2ZXQA 3ZRCC 5I1HL 2BP0B 2FT8A 4X6CF 4MDJA 1BYOA 2J88L 4JKNA 2VXUH 4O2CB 4XXWC 1ZJAA 1IUZA 4WW2C 2J1ZA 4OCXH 2AK4B 2EIJB 4EEEA 5C09A 1CD0A 1GIGH 2WVVA 4NQEA 5I75C 1TZAA 4G70B 2GJ6A 4ODVH 3QCUL 3PGCA 4ODWB 1QRKA 1LO4L 2PP9A 4Y2DD 4DETA 4EOWL 5B4MC 3AWGA 3RHWF 2NW3B 4LRNH 1UD6A 4H40A 5C9KA 5AKSA 1INEL 3LXCA 5EIQA 5C07D 1ZT4A 2EAEA 2XN9D 3UAFA 3Q6GH 1IJNA 5GPRA 3LPFA 1NLDH 2XKUA 1KPVA 2IFGA 3HE6C 3ZO0A 5JIMA 1A4JA 1OOWA 3CFBB 1PDKB 1AR1C 3VGDA 4U7SA 5IWLA 1KNOB 4TTDC 1AGBA 2G5BB 3JWNG 1EEUA 4NQTA 3GB7A 1QVOB 3KLQA 5EDSA 1OPOA 3IN2A 4F2MB 1FGVL 3N1PC 4YAQB 2YBRA 4XOCA 5E03A 4JJ5B 1INDL 4ZRGA 4GP4B 2R0ZH 5DC9B 1YUHB 4XRCA 1GW0A 2F7IA 2BX5A 3PGDA 3UDWA 4BFRA 2Q9OA 4RAVA 5GISL 5ID0A 3ZKXC 4N0UE 1D5IH 3CFIC 4J8RB 3GMNB 1CTNA 3BPCA 4BFEA 3L08A 4HAKA 1KLFA 2CGYA 4YHYC 2RFXB 1DJSA 1A1NB 1R3JA 4OKVB 1C08A 4HX1A 2C3HA 1C16B 1XGUB 1XAKA 3KJ4B 1HWGB 2YUVA 3WNNA 3G5YB 4EBQL 4GG8A 1FVDA 3ULUF 4XWOD 4W6YB 4XNAA 2DMGA 2EUWA 3BKML 3TWYA 4WLCA 2XV3A 4PI0A 1ED3A 2HTLC 3HVNA 1WBYA 3FQUA 2AK1L 4MJ5A 1A6WL 4YN3A 5C97A 4UMGA 3SE4A 2IOIA 1KPUA 3TPUA 1UXWA 1ILSA 5BZWB 1LDSA 3N0AA 5I18H 5ALCL 4GAYA 3U6RB 3PV7A 5DHYA 3WU1A 1YN7B 4HIXL 3BT2L 4I89A 1JGVH 5FV1L 4U4IA 3RVTD 1NMCB 3U7WL 3EUUA 4AVHA 5C0AE 4P23D 5C0DB 3BH9B 1E2WA 4MWFB 3ZE0F 2YAOA 4FRWA 1LO3H 1RLWA 2WXFA 4NFDA 3HC3H 4XBPA 1IE4A 3MLRH 4ELMF 1RZIA 1CE6B 1MF2L 1TQTA 4UM9D 2DJ4A 3N0PB 4ZS6C 3QFJB 3WIFB 3WAJA 1MIEH 2DQFA 5SV3A 1XSJA 1URIA 3ULSB 1MN4A 2RD0A 4JFFD 1KBWA 1YYLH 5GRZA 1SEBB 5CJQL 5KBPA 3WTYA 1R19A 3C6LA 1SYSB 3GTTA 4XBEH 2Z1KA 4Z7OB 3N1GC 1HHKA 5DD3L 1OE3A 3LNEA 1W72B 4EI5C 3IFOB 1NPUA 3O3BA 2XY2A 2G0LA 5EIIA 2P48B 3FUNA 1NAMB 5A7EA 3ETSA 4E9WA 2P5EE 2L04A 2J2ZB 4L1TA 1MCWM 1U33A 2FQDA 1IU1A 5A6MA 3HC4H 3MJ9H 3FYIB 3RVVC 4TV3A 3CU1A 3CZGA 2VXVH 1NIDA 4PGBA 1A8ZA 1D9KA 4LNVA 2IALA 1LK3H 4UV7L 1HH6A 2HVJA 2GBVA 4LLYA 5D2NB 4D8PB 4BZ2L 4JGNA 3EHBB 5DYOA 1OGAA 2VDRB 1RI8A 5DQ9A 1MVFA 3P4OA 5GGTH 4R8WL 3VXRB 5IIEA 4WJ5A 1A2YA 1J88A 3DVNA 4OGXL 3BVVA 1QBML 4N8CH 1FFNA 4MA8H 2OM5A 2DJUA 2I24N 5L2KE 3GSQB 5AG9A 3H3PL 4OGZA 4UQIM 1I9RH 4Q56A 1BG1A 3L4TA 3SDCC 1N3NB 1NBCA 2OSLA 3MSPA 2VSMB 1DSFH 1KTKE 4IEFB 1RZFL 2ED9A 1AHKA 4PLJC 3L2NA 1XTMA 5T1KB 4FXGA 2V2TB 2NY4C 2RACA 5DT1H 5SWSE 1X5LA 1ZS8A 3EYQC 3HPJA 4MJID 3WHXA 3FCBA 2FLBT 1WZ1H 3K6FA 5BJTA 1F6AB 1HL5A 4QRRE 1S9XA 1CGSH 5CHNA 4ZSOE 3DIFA 4IJ3B 2V2XA 3EBIA 2XZQH 4N5UA 2NSXA 5FF6A 5J0BA 4ONGL 2D03L 3M8OL 3QDAA 3NK3A 4NHCH 3RWJB 1PS3A 3LSOA 4BGDA 3RYMA 1NCWL 5EN2B 3LJ3A 3C60C 1IARB 2IAMC 2ZF8A 4AGLA 2EQDA 1ZANL 4HISA 1KENH 3VXUA 3OHXC 5AW3B 2A0LC 1UH4A 3K5RA 1JZJA 3DHUA 1OOAA 1RCYA 2ICWB 2ESVA 4G5AA 4TUKL 3PQYA 5I6NA 1ZA6B 3OKMA 2TSBA 4B3VA 3CFEA 3WBDA 5I74B 4PJHE 3ULVF 3RUGE 2E7CA 4G8AC 4U31A 1BMWA 1O7SA 2FL5B 4KHXL 4LCYA 1BW8A 3RVUD 5EFIB 3GZOA 2XWZA 1ECYA 4H0LC 2Y24A 4N0RA 4I18C 2QZQA 3T65A 1K2DB 1USZA 2A83B 2X89D 2E7LA 2WZ5A 3QO0B 2B1AL 2FK9A 1KJ2A 2QQLL 4MA3B 4WW1A 1Z9NA 3FUDA 4X6EB 5A16B 2XC8A 3HZ3A 4UNUA 2NR6C 1K8DA 3ARSA 1EWHA 2ZICA 3F05A 4HEPG 5LWYH 1E3ZA 2CHZA 3II2A 2TSAA 4ZMNA 3LNFA 3TT1L 1IIKA 3TZVB 1XR9B 4MB4A 3BUQA 3IPFA 1I7RA 4RGMC 2J8OA 3ARVA 3JTTB 4FQJL 4X9GA 1JD9A 4PJ8A 2JIXA 4YHNA 5EF0A 1XIWC 2VE6A 4WUKH 1JK8B 3LH2H 3MV7B 5JPNC 3PXJA 4NO5B 4L5FL 2VR4A 2WYTA 3KNBB 5D8JH 3D7PA 1G6VK 3U25A 1CDJA 2H2SC 4NN7B 5DD5H 2J6EA 3VXNA 1E4KA 4IBZA 3D4CA 1FIEA 2OMTA 1QX1A 3MZGB 5B1KA 3ZE2E 3MBEA 2VDML 1TTAA 1INQA 2VIRA 3E6FB 4HH9A 3HAEA 3VXSD 1WGOA 3BKCH 1I82A 3FO2A 3EGXB 1NC2D 3IMTA 4MNGE 1NMBL 5BPPA 2G5RA 5GSVA 2X0WA 3ZYZA 1IE5A 3DUHA 3X3GL 3HNVH 4PGZA 1TT6A 5D4JA 5DQJB 4KV5F 4GS7C 4Y5VB 1U8HB 3MLZH 4Y4FA 3UG3A 3OKEA 4PJBA 3RPIA 2NNXA 5JIKA 2FO4A 3HZMA 1RIHH 2HZHA 2BNQE 2JKSA 4Y89A 1RL1A 2F0CA 5TE6H 4XNZB 4JHAH 5E2VH 5D1XB 1O6VA 4KKLD 5T1LA 3APCA 1DJXA 1I1CA 1XCWA 3GXUB 1BFVL 1D5RA 4C54A 2ZKXA 3TNNA 1T0PB 3QI9B 2ZCKL 1UWGL 3DX8A 1S4IA 2YPLB 4YSCA 1XF2A 4WTXA 4IDJH 4YJZL 4JO8A 1HEHC 5IBLD 5ICYA 4DO4A 2EYTB 1DBML 3T0EB 3EUDA 5K93A 3MNDA 4JG0H 2AZUA 4MD4B 2BP3A 2D7PA 2BSSA 3D85A 3INUH 2V17L 4NKDB 2B4CC 4Z7AA 4I77H 3ZL4L 3ZSTA 4ATWA 2FJGB 1MOEA 2NY5C 4WEEA 5BS0A 5I6XC 3NZHH 1F97A 3UABA 3I2CH 2VXQH 5TDOB 5SWQB 1AS8A 1X44A 3IDNB 5H37G 3UP1A 4LLVA 1GKOA 2EH8L 3BAEL 4L23A 1CS6A 2P44B 3C9NB 3TBTA 1QRND 1N5YL 1CI5A 3DX9A 2JKNA 1X5YA 2YZ8A 4G7QB 2PCPA 2E0PA 3DX3A 4MMXB 3O6FC 5E8PA 4DK3A 4OAWB 2F54A 5EF2A 4I3RL 3BXNA 3WAKA 4F91B 4X5QA 4NQVB 4YNYA 4YXHH 1FN4A 4WUUD 2XRAH 1ETJA 1LD9B 5FA4B 3MV8A 2GFBB 4R4NC 4NUGH 3DETD 2BERA 2E8ZA 4HSCX 4TQIA 4WO4D 4JFDA 4FFZA 2XWBB 1PZ3A 2ZYRA 1HXMB 1NGPH 2NZ9C 3AG4B 2AQRA 1KCSH 1B4RA 4PHZA 2GBAA 3NFSL 3B7UX 5DVPA 4GMSH 2ID5A 1M05B 1HESA 2WCSA 2BY3A 1KMGA 2E6JA 1VKXB 2ZUQC 3BWZA 5C0NC 4XBGA 5KJ4A 3HC0A 1B4JL 2CJTA 4LASL 1NBQA 5CBAB 2BZ7A 3VYOA 4DESA 5JUEH 5JO5A 4LLDA 1G4MA 1E4XH 4G3YH 3IDGB 5IW3A 5GS3A 3IE9A 1IAOB 4X4MA 4BZ1H 4PJGF 4P59L 3FCTA 5E1IA 3U2JA 1J8SA 1CLYL 2AI0L 1CCZA 1CXKA 2R83A 2QQKH 4LDOB 4R26H 3RVUC 5D1ZI 5F9WB 3FO0H 5CGMA 3K2UH 1S7WB 4PV8B 1WTGT 3HG0A 4HK0A 3TWCL 4AM0Q 4LSVH 1LQBC 1PU0A 3H9SB 3JWDL 4X6CB 1NQBA 1F4XL 4LMQE 3QDJB 3DRTB 4L3FA 4XNBA 3SGDH 1WFOA 3KM2A 2OMVA 4WEBL 4JRFA 4WHTB 2YSTA 1JNLL 1HSAA 2YKKA 1FCCA 4FMFA 3M17A 4P2QD 3FUJA 3G7TA 4X7TB 1QEWB 5L88L 3PWPA 2BOCB 1PKQE 1MCOH 3X3FH 4EMZA 1CLZL 1TVBA 5GZOA 4U1SA 4WU7A 1E9QB 5C9JB 3K74B 3V5HB 4FFYH 5DI8B 1ZOXA 5KSUA 4WGKA 4R0LC 3TVMA 4AT6A 3L54A 1GYWA 4NQXB 4PTTA 1A9BB 4Q0XL 1N70A 5L4MA 1TJHL 3NP4A 3IU4L 4PJ9D 1F90L 5T5FA 4BRVA 1OO2A 2OKMA 2AEWA 3OXSA 1L9NA 4PWJA 3QNZB 2BS8A 3K72A 4HAGA 3OZ9H 4AVIA 1MJ8L 4FYQA 4ZK8A 3FB6A 4XMKL 4HUMB 4DZ8B 4E0RB 1CBVL 5I66A 4X83A 3X1NA 3H0TA 4ICWA 5E00A 2YQGA 2F1BA 1WHOA 5EEYA 1KTCA 2WQ8A 1R0AH 1B90A 5J3HC 3SB3A 3ABKB 4M5TA 1IM9A 1DFXA 3B2PA 1FI8C 4WFHD 3B6SA 3V0WL 1GPOH 3D39D 4OZFB 3GHBH 1E6OL 2XZCL 5KSBB 1YN6B 3ISRA 3BUPA 4MQ7B 5D7SL 3TA4D 5HHMD 5FYJD 2Z93B 2B2XH 2YPVL 2V37A 3ALWA 1AD9A 3LEYH 1TQBC 1T4KA 1LM8V 3IFLL 1I3RB 2BJMH 3W3BA 4IS6B 4KJWD 1PX4A 1V27A 3FQXB 1I9JL 2BRQA 3MLVH 5AVYB 2YWYA 5I1GL 3U4BH 1IGTB 2AK4D 4X7CC 3H1ZA 3B9EA 7CGTA 5FUZL 1BYPA 1UM4L 2R0KH 3VD3A 3ZYOA 3JBG7 3MA9H 3V4UH 1P5UC 1EANA 3FFOA 3HBGA 5AAWA 4UIMB 25C8L 2W9EL 4ELMB 3KCPB 2EDNA 3PS6A 2ADGA 3HFMH 3BZDA 1DJHA 1HE8A 4DP2X 4HFUH 1OAQL 1NGXA 1G7LA 1Q0EA 1E65A 2XQYA 3EIFA 1YG9A 1Z5HA 5MENE 1H8LA 4OLWH 4AW7A 5C6TL 1XH3A 1A8JH 2DM3A 1NC4B 3DUSA 4ENED 4LFHD 4U1GB 1MW1A 1NFKA 4Y5YA 5FV2A 3HB3C 1KGXA 5E1AA 1BVOA 3U30C 5C0BA 4F7MA 1KJ3H 4K7FA 3RDJA 4DGYH 4WSGA 3O8XB 3GMLB 1JG9A 3WIIH 4OFVA 4TUOA 5F1KC 2WLHA 3RE0A 1MWAH 1MFNA 2I69A 4YBQC 1KIUA 1EFXB 1ZE3H 5KVEL 4JM2B 1CTMA 3ZXAC 2DV6A 3IFPB 1OTTD 1YC7A 1NCIA 2DL2A 1BF5A 4I3SH 2P8LA 5FYLL 1Y0LA 4JPIB 4GIAA 2BXZA 1OF2B 2IH3B 4ABUA 4JFYB 2Q5BA 1TFPA 3UTSD 2CHXA 5C0RH 2DQHH 4OJDH 3GGWA 1FUNA 1KGJA 3OPZH 2AV7B 3SE3C 1GW6A 3X11A 2GKIA 4R3SB 2J8UB 2R0LH 2VR8A 2B3RA 4AJWA 1HL4A 4ZOEA 3KDMB 2H41A 4CU7A 2H0EA 4V33A 1GSKA 3Q3GA 4B7IA 4BWWA 4BXVA 2EIDA 4Z6AT 1TDQA 3FCUB 5GZND 3U1PA 4IBVA 3T1FB 2DDQL 3ZHDA 3VGEA 3VW3H 5DWUL 5IQ7H 5FGRA 4DQOH 4QYOA 3WFEH 3QCVL 1KGIA 2R4SL 2HKFH 2DWDA 3SBPA 4HS3A 5F3BB 4TLKA 5HI3D 5DD6B 4B9FA 2Q76A 5AUMA 3LZFH 4GKLA 4WTZA 5KVGL 1W0WB 1HT6A 2GVYA 2VLJB 3QFJD 4HFWB 4Y5XC 1O7VA 2H4EA 3NVQA 1SDAB 3KPNB 2UWEE 3TJEL 1IC4L 4AQEB 1BZ7B 1O5DT 4Z0XB 5KOVC 3UBXI 1NBVH 4CVWA 5F9JB 1YECL 2BMKB 2XYBA 4E5XA 1UQSB 5SX4H 1L6PA 4QIRA 4K2UL 3RY6C 3WJJC 1U8PA 5EUOB 3RTQA 4H7VA 1JNNL 3QZWB 5FW7A 3ARFC 4H2CA 2GB2A 5ISZB 5K9OB 3TCLB 1BBJB 2WN3A 3LN9A 4HJIA 1K6QH 1MPAL 1WWAX 2QSQA 1FA4A 3BQUD 2H0FA 4OB5H 1T2QH 5IQ9A 2GT9A 1T1XA 4W68A 3HE6B 4JG9A 3EZJB 5IVZB 5FYKD 3QJFA 4LQ1A 4L4VA 1EK3A 4H0IA 2WBJD 3TF7C 1QSFD 1SN2A 2PYFB 4K3DL 2NXYB 5ANMA 5A6LA 3HZVA 3VFOA 3S98A 1K8IA 3EHBD 2WWMC 4I48A 4PS8A 3OKDB 2AXFB 2OTPA 4O5LH 4D3CL 4P2OC 3VXRD 3VRIA 2PCYA 3QISA 3OKOA 2Z65C 3KYKL 3UG4A 1EBPA 5DVNA 1Z9LA 3AM8C 3MCKA 4HHGA 1JZDC 5D9SB 3ELAT 2QVIA 1JZ5A 4GEIA 4A7QA 4PRAB 1JF1B 1WA1X 4OLUH 1ZTXE 2OXGA 3NIFE 2F7PA 5I73C 3CFUA 5J6SA 5LVEA 3R19A 5GS1A 1JXDA 5H4ZA 5T1KD 3INOA 4RMSA 4Z18A 2OULB 3FT4A 1BM3L 2K4AA 3MRIA 4NZFA 4F37K 1MFUA 4YX2H 1E6JL 4D9QD 2YMTA 3QUZA 4HJJL 1E43A 3L4XA 4NIKB 4QO1A 4IRZH 1AE6H 4ZOAA 5IKCA 1DQJA 3UJJH 1R3IL 1T20A 1MCLA 2H1XA 4QT5A 4EIGB 2PYEA 3BFOA 4HAFA 1FCGA 3ZHNA 3WSQL 4OT1L 1XGTA 2CZNA 3FTVA 3OLEA 3VTTA 2EDEA 2IG2H 4NKMB 4Q14A 1Q0XL 1KJMB 1CD8A 1AYOA 4G6KL 1YYML 3US0A 3H8NA 5GS0D 3GF8A 1I8IA 2DQJH 4P5TB 4MMYA 3NACL 2AGJH 4QOKE 5KBDA 1GGUA 4J3OD 1DQMH 2CBQA 4HZLB 1SM3H 4AQ8A 5BQ7A 5CCGE 3QUYA 1HI6B 1X5MA 4OIIH 2NY2C 4Z77B 3HTLX 3IMBA 1JZEA 5ENWB 2CDEA 5J8OA 5JOEA 4ALAC 5DUJA 2XWDA 4CC4A 2O1AA 2YSSB 5HDOA 2OCCB 1TJXA 4G5ZH 2ADIB 1RK1A 1QSEB 2V8LA 1VAHA 4LPUA 3UTTD 4W9CC 3TPKA 5KS9B 4JPSA 4EI6A 4KBPA 1ASOA 1JTPA 1BQHB 4K3EL 2MQ0A 2YD3A 4K71B 5E2UL 3F65A 2A9NH 5BV7B 1A4BA 3QRBA 3RWGA 3MNMA 3TZVD 2J55A 2PPFA 2FTAA 2B7DT 3HI6L 3MLSH 4HQQH 4K9EL 3MV01 2ZKHL 3MA7A 4N0CD 4AIOA 2QLYA 2VLRA 4Z76A 3C6SB 3RAJH 2E75C 3QSKB 3KLAB 3MV7D 5HDQH 4JAMA 5J5EA 2A4CA 4XOBA 2FX9H 5I19L 4O4YH 2BVOA 3TO4A 3LZOA 4U6HA 4Z5RB 3ZR6A 1GR7A 1UADC 4JFZL 1IKNC 2Q8AH 4OLXH 4ZZFA 1KT2B 4PWKA 2EDYA 2Q20A 5EULV 1TVDA 4OCWL 4UAOB 4KPHH 1U2HA 3EFOA 5CLZA 5IW6A 1EMTL 1OZUA 1BEYL 3MFFB 3IVKA 1VRSA 3QUML 3NAAH 1JGUH 2GEEA 2FIKA 3EYVB 2EDWA 2LAGB 4XRCB 3C87A 5IB4B 1DVTA 2FX7H 1BQ5A 3NSCA 2EYSB 2AQPA 1CVSC 1WFTA 5JYMA 4IGBC 3QEGH 4I3GA 1IRAY 3WMSA 3WFZA 1RHFA 3WNPA 4HCGA 2I60L 2VC2H 1T7ZA 2C26A 12E8L 1FH5L 3KPSB 4G9DA 5CXPA 1N64L 1FE8L 4MCNA 4RQQB 1V54B 1I4FB 3CFJB 3OBAA 4LARL 3VSUA 5IV2B 1XWVA 4BFKA 5TE7L 2HUEA 3E6HB 4M5YL 5DUML 1HKLL 1RJCA 2BW4A 1FVDB 1DL7L 4IRSB 1OY3B 3RKDC 3U1SH 2PPAA 4PBDA 4F5CA 1L4IA 4FI8A 1ZHLA 1HL9A 3K1KC 3QEQE 3MRCB 1SY6L 2R59A 3FJTA 4PJGB 4L8SA 2YPLD 2DIAA 2WSKA 2NW2B 1NFIB 1MNUL 1T80A 1ES0B 3BO8B 3K0WA 4FXKC 3T0ED 3MRNA 4PLKD 2BWQA 2ZUTA 4DGUA 1NCBL 2JKIS 4WWKB 3JVGA 4JQVC 3MV9A 4ZW3A 1CXHA 1BCIA 2EVIA 4XBPB 5TH2A 1NWOA 1KELL 2OV0A 3NA9H 1NCTA 1CFSA 1UA3A 1RZ8A 5KVDL 2FE0A 3BVWA 2VW4A 3CFCL 2KDGA 1P7HL 2AS5M 1LGVA 3N85L 1WCQA 3TEYA 3Q2WA 1EVTC 1FGNL 3FMGL 3FB7A 2QEJA 2ZWSA 4XN4A 3F83A 4TXVB 1U0QA 3C6LB 4Q6YA 1AD0B 3SOBL 5AVZB 1CURA 2WOYA 1HHKB 2DYRB 1MXGA 2HB0A 3ILQC 3LRLA 4CADA 1H3UA 3TASA 3C5ZC 5DJ0A 4B9CA 4XNYH 4ELDA 4FABH 4KHTH 3GMMB 4NLAA 1WK0A 1CICC 4GQQA 1UGKA 4Y8AA 4HVBA 3UPRA 4ZUTA 4XPHL 1JRHI 2CXGA 4LNRA 3S3JA 4YDLC 4KO5A 4OSUL 4XNUH 4AW4A 4U0RC 4L4TA 4GRLC 1KXVC 3WKMH 1OARL 2OQJB 1AZUA 2GIXA 5J9PA 1TITA 3AU0A 1GGIH 1FFTB 3BKJL 4JE4B 4UQEA 1OGPA 1DQQA 4FERA 1FL6A 5HVGB 1X4ZA 2F53B 4I9XA 1U8QA 3NOIA 5DVOA 2C9VA 4FA6A 1TQUA 2QPUA 2WIIB 3PAYA 3F84A 4ZFFB 2WAQA 4FJYA 4I88A 3UIZA 1RUKH 4E42A 1UVQA 3BDBA 4M1CD 1YEGL 3T4AC 3D0VB 4A04A 1R5WB 4H0GA 4NYLA 2GCYA 3HMXA 3CVCA 2FJUB 4JRYB 5JPMA 3S96A 4JO2H 2YFOA 4ZTPH 1Z9SA 2J7LA 5E8EB 2NUPB 4P57A 4YHIA 1IBBA 1LEGA 2AQSA 2D73A 4EDWH 1NL0H 3UTQB 2V4LA 1J0YA 1U6AL 4BZ2A 3H9SD 4NDMA 2WLIA 4X8GA 1KJVA 1SMDA 2RALA 4AMKL 5GRVL 2WTRB 3QDJD 4JR9H 3PL6C 4BQ9A 4ZFGH 2XFXB 2D2CC 3DIFB 4CAGA 4PH8A 2KPNA 3P9LB 5FUOL 1LDPL 5FF6B 4QHUB 3G04A 3GI9H 4GY4A 2DF3A 2X4SB 5EOCH 1V8HA 5ITBH 1A0QL 2UZIH 3HS9A 4PU2A 2OI9B 5G5DB 5HHNA 2XV6B 2GTQA 4QXGL 4G9FB 2E3VA 2BP8A 3KD4A 3L3IB 1P7KA 4MB1A 4OFDA 2DQUL 1XSOA 2YIHA 4ANXA 1UXSB 3HN3A 4JGUA 3WE1A 1QFWH 3QUXA 4I0CC 4P4KA 3BZFA 4P9MH 4Q8BA 4JG1H 4JRXA 4NWUL 2P80A 3CFEB 4L8BA 1A6VH 1B0RB 3QG7H 4RNRB 1WYJA 4QD2E 3MLYL 5G55A 2VOTA 1NBZB 3UADA 4G82A 2EDKA 4JY5L 2QSTA 3RX9A 2UX7A 2ZX9A 2CDFB 2DYPA 1OM9A 2N0MA 3BP5B 1J05B 1NMAL 3W0WB 3AJ7A 4BK8A 4ZT1A 5DZOA 4GOSA 5IEHA 5DJDB 3RDTC 4OW6A 1KJ2B 4WW1B 4QJ5B 3I9IA 3F7YB 2V33A 3O2DH 3K80A 4LOFA 4XH2A 2BSDA 2WUBH 5I0ZA 2Y4SA 3KJ6L 4Q9RL 2J4WL 3P4LA 2C9UA 4IU2A 3DC0A 5CCJA 1BLNB 1MCFA 3JYCA 3V52H 5DD0H 2BCKB 2H0PA 4ZAKA 1PAZA 2HVKA 3BLBA 3GZKA 4R6UA 4YHLL 4RMVA 3IE4A 1ZHBA 4K23L 3V7AG 1KSRA 3TF4A 3DTDA 1F00I 4NNYB 5D93B 5BRZD 2WIMA 4BFBD 3L9EA 4XCFH 5D7IA 2OMTB 3IGAB 3RL2B 1M1XA 1NCDL 5CLYA 1T7WA 1IGIH 4MXWL 3CUPA 4UT6H 2VZTA 1P2CB 2NSQA 3Q8EA 3SE8H 4PVMA 3IETB 5CWSB 2O26U 2B4CH 4W9JC 5JLZB 5LGYA 3V5DA 5DZPA 1I1YA 3CV5A 4UQ2B 1Z5LB 4WSKA 2X1XR 4FZEH 3O0LA 3VGBA 5CM1A 3A5VA 5DC4B 5KYYA 5MHSE 4LHQB 3DV4B 4JZJC 4YHPB 4GAJH 4RGNC 3RFRA 7TAAA 1NC4D 5E9DB 4OV5B 2GJPA 4RIRB 2IJ0C 3IYLW 5DVKA 1CPUA 3WUZA 4GYBA 4Y4KC 2D2OA 4Y4FB 1P4UA 2Z31C 5CEZL 3K6NA 4PCTA 2GQHA 4N24A 2W80C 1T89A 4NQCA 1HE7A 5HD8C 4R0LB 1UM5H 3O8XD 1WV7T 2FECI 2H5UA 5TF1H 4C83A 4Z3IA 5PCYA 4IOSA 5T1LB 2WTOA 5KSAB 2Y36H 2DBJA 3L4VA 4UIKL 1V7MH 1QPPA 5IREA 2CKBL 4HSAC 1EFXD 4JM2D 3DK2A 1MUJB 1VSCA 2IBZX 2VDPB 4NZRL 4BE6A 2WD0A 2Y5QA 3NIDF 4M1DH 2ZG3A 2YMXL 3BH4A 3LN4B 2ZG1A 3FCSA 2BSSB 5JIIA 1RZQA 4YXLH 1XGPB 5DDHA 1MHHA 2QV4A 4NO2A 5IJKC 4R7DA 3OZLA 4G59C 5KJ7E 1H3GA 2BS71 4PS3A 4AQ1C 3OLIA 2PXYB 4W9HC 1SPDA 3SPVB 3VVWA 2XIBA 5D1ZB 1YHPA 1IAMA 1XB8A 2D9CA 4JFXA 4KKCC 4X6DF 2VXTH 3K91A 4PUBL 4NC2B 1YEEH 2F18A 5E8PB 2IPTH 3ZDZE 2F54B 3CVIH 1R24A 1FZKB 5FR3A 3FU7A 2VDQH 1KCUH 4PMFA 2CQVA 3MRFB 4QWWD 4YNYB 5F44A 2VLJD 3VWJC 1MQ8A 1T1ZA 4QF1A 4XXCC 1KIQB 3E8VA 5AWNH 3VI4A 4URTB 5IBTH 2R51A 5HDWA 1BZOA 2DEXX 2PNDA 4MA7L 4DTGL 1G9NL 1GXEA 4FQXB 5EC2A 3CDZA 2ALWA 4N0UA 2RJMA 5D7JC 5SX5H 4FQQA 4WTWA 5B4MD 3STLB 1K4CB 1K72A 3VI3F 4AGNA 3HG1E 1PNCA 3APFA 2CO6B 2XZAH 3D09A 5ISZD 2APTA 1D5MB 3CZFA 4LU5H 3N1QC 5DZ9A 4QRPD 5C8JB 1IEHA 2HFTA 3HC0B 5JIQA 1LILA 3WKNA 1OGSA 4OBSA 4P2YA 1KF9B 3HE6D 1M42A 4C59B 4HWEH 4QNPF 4J39A 3UTPD 1A3LH 4S1SH 4TTDD 4GFTB 4X2UA 3JSSA 2YA0A 3QPKA 3U30B 1KTDA 2C3VB 4WGWB 3J8F7 4ZUVA 1NSNH 1OCCB 4Y19B 1NKRA 5D4QA 2AANA 5DCCA 2FB4L 3IBOA 4XP6L 4NRYA 4LCWA 5AOIA 1N4XH 4Z78B 2A77H 5D7LA 5EU5A 4AH2A 1AXSB 3HHRB 2HRHA 5EZJB 4F7TB 1S3KH 1MFCH 3TN0A 4P5KB 1SDYA 4JZOA 1OSZA 5BZXA 5IR1A 1IGMH