3ALJA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, reduced form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
369
structure length
369
Chain Sequence
b'TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 130
structure length 369
sequence length 369
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3aljA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3aljA01
2YVJA 3P9UA 1E1MA 5KRQA 3AEFA 4M52A 2VQBA 4P9SA 4XWRA 2BS3A 1D7LA 4AOXA 3HZLA 1D5TA 2GMHA 4HA6A 4A65A 3DH9A 1JU2A 3NTAA 1E7PA 1B37A 1ZY8A 1LTXR 3IHMA 1IUVA 4JQ9A 4UDPA 4GR1A 1IUXA 2BACA 4ZCDA 2Z5XA 3P4QA 2WETA 4IA5A 3AE8A 1F6MA 3D1CA 3O0HA 1CC4A 1D7YA 2C75A 3LJPA 4JNAA 1DODA 2GR0A 3NG7X 4IA6A 3ICTA 2B7RA 5TR3A 1FCDA 3P4RA 4BJYA 4RG4A 2VVLG 2YLZA 3ATQA 2XLTA 4YWOA 3DJJA 1DOCA 2AQJA 2JKCA 2JK6A 1GEUA 2OLOA 3CGDA 3UKHA 5GRTA 1PXAA 4K8DA 3UKLA 1O94A 1Y0PA 3PVCA 1N1PA 3GDPA 4NTDA 4AT2A 1PBDA 2EQ7A 2UZZA 3NLCA 2GEWA 3QJ4A 3AECA 2E1MA 4GCMA 4XWZA 2V60A 2XLPA 4OVIA 3UKPA 4J56A 2C7GA 1JEHA 2C67A 5JCLA 3AEDA 1PJ7A 4U8OA 3V3OA 4EQXA 1E1NA 3CPHG 3OC4A 1PBCA 1BZLA 4TM3A 1RYIA 3QVRA 2YG7A 2NPXA 3GSIA 3NH3X 2GV8A 5J60A 1NHPA 2BYBA 2R46A 1CJCA 1N4VA 2WDRA 2B9WA 3DMEA 4HB9A 3ZYXA 4B1BA 3CNJA 2WHDA 2Q0KA 2WESA 4NTCA 4C3YA 3B6DA 3DGZA 1S3BA 2WP5A 4H4WA 2C72A 2OA1A 4B66A 2XLSA 2YG5A 3P4SA 3AE2A 2AR8A 5EBKA 2VVLA 2IVEA 2QCUA 4FX9A 5BVAA 3NK0X 4YTPA 3P1WA 1ZKQA 4H50A 5M10A 4X9NA 1CJ4A 1VG0A 3UP4A 2XFQA 3IWAA 1ZDLA 4GDPA 3NGCX 1NHSA 3RP7A 2BC0A 4EQSA 4AT0A 4B63A 1KNPA 4B69A 3CGEA 1KSSA 2X8GA 2WDVA 1Q1RA 4Z25A 1JNRA 2GH5A 4FK1A 1Q9IA 2V3AA 2X50A 4H4UA 3RP6A 2XFUA 4LU6A 4GUVA 1OJ9A 1GERA 4OPIA 2Z5YA 3D8XA 2C73A 3AE7A 3V3NA 1EL5A 2E5VA 1VG9A 1DOBA 2YWLA 3BI4A 1DJNA 3LOVA 3Q6JA 4JY3A 4H4SA 1GV4A 1PHHA 5M0ZA 3E1TA 1L9DA 1X31B 5JCNA 3EF6A 3QSSA 1ZOVA 3G5RA 3R9UA 2GR1A 4ADWA 1O5WA 4H4XA 5KWFA 2PHHA 3VR8A 2OAMA 1H86A 1MOKA 5U1OA 1GESA 3ALMA 2YR5A 2C3DA 1GETA 1NG4A 2X8CA 1ZMCA 1D4DA 3C96A 2XVJA 1K0LA 3AEBA 2FJAA 4A99A 3ITJA 5KOWA 1KF6A 1ZMDA 2R4EA 1H7XA 2Q6UA 3V76A 1E6EA 4J2WA 4UDRA 1NHRA 4Z26A 3GMBA 3NRNA 1GNDA 1JRZA 1PXBA 1PJ5A 2WP9A 1FOHA 3QVPA 1CHUA 2R4JA 2BCPA 4ZN0A 3UOXA 3CPIG 3AYLA 4H7UA 3VRDB 1BWCA 1PBFA 1TDFA 4WCTA 3UCLA 1PDHA 4RG3A 4OPCA 1N4WA 2V3BA 1KDGA 3CGCA 3AE5A 2VQ7A 1GRHA 1IUWA 3GWFA 1TDEA 3S5WA 1JNZA 3QSEA 1HYUA 4DSGA 4U2LA 2WEUA 5ER0A 1S2YA 3AEEA 3GRTA 1LQUA 3VQRA 5L46A 4NEVA 1F3PA 4NEWA 2XVHA 2ZZBA 4FK1C 5GSNA 4B64A 3LXDA 2YVFA 4N9XA 1S2QA 3ICRA 1E1KA 2O9ZA 1LQTA 1IJHA 2XLRA 2B9YA 3VRBA 4NZHA 2TMDA 4B68A 5JCIA 3VRAA 1F8SA 1FEAA 5FS9A 4J57A 2WU2A 1ZK7A 3BNUA 1CC2A 3LADA 4GDEA 5C2TA 1NENA 3C4AA 4CBQA 2WOVA 4H2NA 2Q0LA 1VQWA 2IIDA 3FBSA 3GYIA 3K30A 4U8LA 2XFNA 4YSYA 4YT0A 5U63A 2YG4A 4BK3A 5HYMA 3UKFA 4YSXA 1ZX9A 4H4ZA 1TDNA 5EOWA 1F8RA 2ZBWA 3LB8A 3GD3A 3C4NA 4OPLA 4B65A 2WPEA 4U2TA 3S61A 3VR9A 3KD9A 3DJGX 3NT6A 2JAEA 1PXCA 1GRGA 4KX6A 1L9EA 1LPFA 4H4TA 4I58A 2FJDA 3UOVA 1AOGA 1YKJA 2CFYA 2XFOA 4K22A 3KPFA 2WOIA 1D4CA 3IC9A 5KVIA 3NYFA 4J34A 4UDQA 1W4XA 3UOYA 4Z2UA 3AB1A 4IV9A 3SQPA 4CNJA 1CL0A 4TM4A 4BV6A 3AYJA 1PN0A 4FDCB 2X8HA 1Q1WA 2V5ZA 2XYOA 1VDCA 4A79A 3AE1A 1DNCA 2APGA 3NHOX 4Z2RA 3EANA 3ICSA 2BC1A 2PYXA 3BHFA 5HY5A 4Y4LA 2GQFA 4U8JA 3NTDA 4U8IA 1K0IA 4K7ZA 5U25A 2WS3A 5FS7A 4U8NA 4EQRA 3CNSA 2OLNA 2VVMA 2V6OA 3AXBA 4J31A 3IF9A 2C65A 1M64A 2RABA 5IQ4A 2WOWA 3AE9A 2QAEA 2GMJA 4BJZA 2FBWA 4U8MA 4YSZA 1GRTA 1YQ3A 5JCMA 4H4VA 2JB2A 2XCGA 3UKAA 4JDRA 1TYPA 3LZWA 4EQWA 4AP3A 4MJWA 4NTEA 4GRTA 5FS6A 2TPRA 3ATRA 1H6VA 2WPFA 4J33A 4REKA 1EL9A 2J3NA 3UTEA 2C70A 2YG3A 3BHKA 1L0VA 1OJDA 1RSGA 4A5LA 3QFAA 5IQ1A 2JB1A 3AEAA 5BRTA 3EPTA 1RP0A 5FMHA 2YLXA 1BGJA 2Q7VA 1XHCA 2NVKX 2H88A 5EB5A 3SFDA 3GMCA 1KNRA 3DJDA 3NIXA 1XPQA 5J7XA 5BUKA 2R0CA 3IHGA 1GTHA 3GD4A 1K4QA 3CGBA 3GWDA 4TLXA 1PBEA 3UP5A 4DNAA 4H4QA 1JRXA 1JRYA 5HHFA 3QSMA 3F8DA 3KKJA 2BABA 2YM2A 3NYEA 3GDNA 3I6DA 4D03A 3FMWA 1YQZA 2C3CA 3P4PA 4CRTA 1NG3A 4CCQA 4TM0A 4Y4MA 3WE0A 3Q9TA 1XANA 2FJBA 2HQMA 3DK4A 1H82A 3SFEA 3DK9A 3KU9A 4OPUA 3NK2X 2I0ZA 1Z6LA 2C66A 3L8KA 3UKKA 1OJCA 2R9ZA 1L9CA 3DA1A 1IUSA 2YLTA 1QLBA 4JY2A 2F5ZA 1VRQB 2YLWA 2GAHB 4O5QA 2WBAA 1E39A 1LVLA 1E1LA 1P2EA 3M13A 2RGJA 4X4JA 1BF3A 4EM3A 3COXA 3KLJA 4PAAA 4RSLA 1COYA 3QFBA 2VRMA 2XDOA 1PBBA 4CNKA 1GRBA 2GB0A 2YG6A 1REOA 2GR2A 4E0VA 4Z43A 3UOZA 2C64A 1CJ2A 3K7MX 4KPRA 4BURA 3ALJA 3AEGA 3K7TA 3L1RA 4H2PA 2R0GA 4C74A 3F8RA 1O95A 2EQ6A 2YLSA 4H4RA 4A6NB 4CCRA 1ONFA 4LIIA 5BULA 2DKIA 1GRAA 2CULA 2Y6RA 1TYTA 2XFPA 2C76A 2YM1A 3ADAB 4A9WA 4CY8A 4YXDA 4H4YA 3CNPA 2A89A 1ZP0A 2IVDA 3JSKA 3UTFA 2GRTA 1N4UA 4LA1A 5JCKA 1B4VA 1OJTA 4H2QA 2JBVA 4BK2A 4YKFA 2YLRA 3AYIA 4YTNA 2A8XA 2BXSA 4Z2TA 3BNMA 1JOAA 4H4PA 2XVEA 1EBDA 3F8PA 3PO7A 1Y56B 3AE4A 2RGHA 2VOUA 1P2HA 1K0JA 1H83A 2ZZ0A 1CC6A 1XDIA 5FS8A 3UKQA 2Y6QA 4Z44A 2VZ2A 4YKGA 2B7SA 1GALA 4USQA 1TDOA 3SM8A 1NEKA 3II4A 1V59A 2BK4A 1NDAA 4EM4A 2XVIA 5CKUA 1QJDA 4OCGA 3KVEA 5KOXA 2WP6A 2XVFA 3ISHA 2E4GA 1EL7A 3NN0X 5IPYA 1GREA 1H84A 3CIRA 5CQFA 4UP3A 3ALLA 2R45A 1YY5A 2WQYA 2R0PA 4D04A 3ABVA 2BCGG 2GF3A 3GYJA 4C3XA 4EMJA 4C77A 1KSUA 3FG2P 1GRFA 2CVJA 2FJEA 1CF3A 3CNDA 2H89A 4K5SA 1EL8A 2GQWA 3CPJG 3G5SA 3KA7A 4O5UA 4OPGA 1BGNA 1FL2A 2BS4A 4YSHA 1IUTA 2WPCA 3CNTA 1B8SA 2B76A 5KXJA 4OPDA 2BK3A 3NNEA 3AE3A 4IVMB 4YTMA 3DJEA 3GRSA 4I59A 4AP1A 4H2RA 1OJAA 1QO8A 4K2XA 1DXLA 4B67A 3K7QX 3H4KA 5EB4A 3NKSA 1F8WA 5DBJA 2QA1A 1LJ1A 1GSNA 3BI2A 4APNA 1GXFA 4DGKA 4EMWA 1S3EA 1M6IA 2QA2A 4A6NA 1MO9A 2DKHA 3NN6X 4U8PA 4XXGA 2YVGA 1FECA 3H8IA 3H8LA 3OZ2A 2JB3A 2X3NA 3I3LA 1DJQA 2RGOA 2V61A 4WX1A 4ECHA 1GT8A 2B9XA 1NHQA 1TDKA 1GTEA 3PS9A 2EQ9A 3RNMA 1TRBA 3AWIA 2W0HA 3NYCA 3SGLA 3EAOA 4A7AA 2GR3A 4AOSA 4DSHA 1MXTA 4U2SA 1PJ6A 2WU5A 1Y56A 2BS2A 2CDUA 1ELIA 3AD7B 3FIMB 4CY6A 1CJ3A 3DK8A 4PABA 2BK5A 1CBOA 4J36A 3REDA 4U8KA 4EIQA 4ICYA 3UTHA 1UKVG 2WDQA 3DGHA 5HXIA 2X99A 1KFYA 3CN8A 4C5OA 2YR4A 4USRA 3RHAA 1DOEA 2GAGB 2ZZCA 4ZCCA 1PS9A 1GOSA 3BI5A 4JNQA 2OALA 1D4EA 2YR6A 1LV0A 3B3RA 1NPXA 1YQ4A 2A87A 3AE6A 2YQUA 4GF7A 3UTGA 1IUUA 2BA9A 3NK1X 4IVOB 4X9MA 2XLUA 2YAUA 2ACZA 1ZOYA 3ZDNA 3FPZA 2BXRA 1H7WA 4JN9A 1GPEA 4BK1A 4TLZA 4EIPA 1H81A 1B5QA 3URHA 1SEZA 2EQ8A 1BKWA 2GVCA 3RP8A 3LZXA 3M12A 2AAQA 5LV9A 1FEBA 3AD9B 3AD8B 1NAAA 4OPTA 4Y4NA 4K5RA 4EMIA 3G5QA 3T37A 4Z24A 2VRLA 3M0OA 3CTYA 5KVHA 2ARDA 5C3JA 4TM1A
chains in the Genus database with same CATH superfamily
2YVJA 4II3A 3P9UA 1E1MA 3HYXA 2DU8A 5KRQA 3AEFA 4M52A 2VQBA 4P9SA 4XWRA 2BS3A 1D7LA 4AOXA 3HZLA 1D5TA 2GMHA 4HA6A 4A65A 3DH9A 1JU2A 3NTAA 1E7PA 1C0KA 1DDOA 1B37A 3IHMA 1IUVA 1LTXR 1ZY8A 2C4CA 1IUXA 2BACA 4GR1A 2Z5XA 3P4QA 4UDPA 4ZCDA 4IA5A 2WETA 3AE8A 1F6MA 3D1CA 3O0HA 1CC4A 1D7YA 2C75A 3LJPA 4JNAA 1DODA 2GR0A 3NG7X 4IA6A 3ICTA 2B7RA 5TR3A 1FCDA 3P4RA 4BJYA 4RG4A 2VVLG 2YLZA 3ATQA 2XLTA 4YWOA 3DJJA 1DOCA 2AQJA 3T31A 2JKCA 2JK6A 1GEUA 2OLOA 3CGDA 3UKHA 5GRTA 1PXAA 4K8DA 3UKLA 1O94A 1Y0PA 3PVCA 1N1PA 3GDPA 4NTDA 4AT2A 1PBDA 2UZZA 2EQ7A 3NLCA 2GEWA 3QJ4A 3AECA 2E1MA 4XWZA 4GCMA 2V60A 2XLPA 4OVIA 3UKPA 4J56A 2C7GA 1JEHA 2C67A 5JCLA 3AEDA 1PJ7A 4U8OA 3V3OA 4EQXA 1E1NA 3CPHG 4YJFA 3OC4A 1PBCA 1BZLA 4TM3A 1RYIA 3QVRA 2YG7A 2NPXA 3GSIA 3NH3X 2GV8A 5J60A 1NHPA 2BYBA 2R46A 4GAPA 1CJCA 1N4VA 2WDRA 3DMEA 2B9WA 4HB9A 3ZYXA 4B1BA 3CNJA 2WHDA 2Q0KA 2WESA 4NTCA 4C3YA 3B6DA 3DGZA 1S3BA 2WP5A 4H4WA 2C72A 2OA1A 4B66A 2XLSA 2YG5A 4QFDA 3W4IA 3P4SA 3AE2A 2AR8A 5EBKA 3SYIA 2VVLA 2IVEA 2QCUA 4FX9A 5BVAA 1AN9A 3NK0X 4YTPA 3P1WA 1ZKQA 4H50A 5M10A 4X9NA 1CJ4A 1VG0A 3UP4A 2XFQA 3IWAA 1ZDLA 4GDPA 3NGCX 1NHSA 3RP7A 2BC0A 4EQSA 4AT0A 4B63A 1KNPA 4B69A 3CGEA 1KSSA 2X8GA 2WDVA 1Q1RA 4Z25A 1JNRA 2GH5A 4FK1A 1Q9IA 2V3AA 2X50A 4H4UA 3SX6A 3RP6A 2XFUA 4LU6A 4GUVA 1OJ9A 1GERA 4OPIA 2Z5YA 3D8XA 2C73A 3AE7A 3V3NA 1EL5A 2E5VA 1VG9A 1VE9A 1DOBA 2YWLA 3BI4A 1DJNA 3LOVA 3Q6JA 4JY3A 4H4SA 1GV4A 1PHHA 5M0ZA 3E1TA 1L9DA 1X31B 5JCNA 3EF6A 3QSSA 1ZOVA 3G5RA 3R9UA 2GR1A 4ADWA 1O5WA 4H4XA 3W4KA 5KWFA 2PHHA 3VR8A 2OAMA 1H86A 2E4AA 1MOKA 5U1OA 1GESA 3ALMA 2YR5A 2C3DA 1GETA 1NG4A 2X8CA 1ZMCA 3C96A 1D4DA 2XVJA 1K0LA 3AEBA 2FJAA 4A99A 3ITJA 5KOWA 1KF6A 1ZMDA 2R4EA 1H7XA 2Q6UA 3V76A 1E6EA 4J2WA 4UDRA 1NHRA 4Z26A 3GMBA 3NRNA 1GNDA 1JRZA 1PXBA 1PJ5A 2WP9A 1FOHA 3QVPA 1CHUA 2R4JA 2BCPA 4ZN0A 3UOXA 3CPIG 3WGTA 3AYLA 4H7UA 3SZWA 3VRDB 1BWCA 1PBFA 1TDFA 4WCTA 3UCLA 3ZNOA 1PDHA 4RG3A 4OPCA 1N4WA 2V3BA 1KDGA 3CGCA 3AE5A 2VQ7A 1GRHA 1IUWA 3GWFA 1TDEA 3S5WA 1JNZA 3KPKA 3QSEA 1HYUA 4DSGA 4U2LA 2WEUA 5ER0A 1S2YA 3AEEA 3GRTA 1LQUA 3VQRA 5L46A 4NEVA 1F3PA 4NEWA 2XVHA 2ZZBA 4FK1C 5GSNA 4B64A 3LXDA 2YVFA 4N9XA 1S2QA 3ICRA 1E1KA 2O9ZA 1LQTA 1IJHA 2XLRA 2B9YA 3VRBA 4NZHA 1EVIA 2TMDA 4B68A 5JCIA 3VRAA 1C0IA 1F8SA 1FEAA 5FS9A 4J57A 2WU2A 1ZK7A 3BNUA 1CC2A 3LADA 4GDEA 5C2TA 4JQ9A 1NENA 3C4AA 4CBQA 2WOVA 4H2NA 2Q0LA 1VQWA 2IIDA 3FBSA 3GYIA 3K30A 4U8LA 2XFNA 4YSYA 4YT0A 5U63A 4BK3A 2YG4A 5HYMA 3UKFA 4YSXA 1ZX9A 4H4ZA 1TDNA 5EOWA 2E49A 1F8RA 2ZBWA 3LB8A 3HYVA 3GD3A 3C4NA 4OPLA 4B65A 2WPEA 4U2TA 3S61A 3VR9A 3KD9A 3DJGX 3NT6A 2JAEA 1PXCA 1GRGA 4KX6A 1L9EA 1LPFA 4H4TA 4I58A 2FJDA 3UOVA 1AOGA 1YKJA 4II2A 2CFYA 2XFOA 4K22A 3KPFA 2WOIA 1D4CA 3IC9A 5KVIA 3NYFA 4J34A 4UDQA 1W4XA 3UOYA 4Z2UA 3AB1A 4IV9A 3SQPA 4CNJA 1CL0A 4TM4A 4BV6A 3AYJA 1PN0A 4FDCB 2X8HA 1Q1WA 2V5ZA 2XYOA 1VDCA 4A79A 3AE1A 1DNCA 2APGA 3NHOX 4Z2RA 3EANA 3ICSA 4YJDA 2BC1A 3BHFA 2PYXA 5HY5A 4Y4LA 2GQFA 4G74A 4U8JA 3NTDA 4U8IA 1K0IA 4K7ZA 5U25A 2WS3A 5FS7A 4U8NA 4EQRA 3CNSA 2OLNA 3AXBA 2V6OA 2VVMA 4J31A 3IF9A 2C65A 1M64A 2RABA 5IQ4A 2WOWA 4G73A 3AE9A 2QAEA 2GMJA 4BJZA 2FBWA 4U8MA 4YSZA 1GRTA 1YQ3A 5JCMA 4H4VA 2JB2A 2XCGA 3UKAA 4JDRA 1TYPA 5KMRA 3SXIA 3LZWA 4EQWA 4AP3A 4MJWA 4NTEA 4GRTA 5FS6A 2TPRA 3ATRA 3SZ0A 1H6VA 2WPFA 4J33A 4REKA 1EL9A 2J3NA 3UTEA 2C70A 2YG3A 3BHKA 1L0VA 1OJDA 1RSGA 4YJGB 4A5LA 3QFAA 5IQ1A 2JB1A 3AEAA 5BRTA 3EPTA 1RP0A 5FMHA 2YLXA 1BGJA 3G3EA 2Q7VA 1XHCA 2NVKX 2H88A 5EB5A 3SFDA 3DJDA 3GMCA 1KNRA 3NIXA 1XPQA 5J7XA 5BUKA 2R0CA 3IHGA 1GTHA 3GD4A 1K4QA 3CGBA 3GWDA 4TLXA 1PBEA 3UP5A 4DNAA 4G6GA 4H4QA 1JRXA 1JRYA 5HHFA 3QSMA 2E48A 3F8DA 3KKJA 2BABA 2YM2A 3NYEA 3GDNA 3I6DA 4D03A 3FMWA 1YQZA 2C3CA 3P4PA 4CRTA 1NG3A 4CCQA 4TM0A 4Y4MA 3WE0A 3Q9TA 1XANA 2FJBA 2HQMA 3DK4A 1H82A 3SFEA 3DK9A 3KU9A 4OPUA 3NK2X 2I0ZA 1Z6LA 2C66A 3L8KA 3UKKA 4YJFB 4G6HA 1OJCA 2R9ZA 1L9CA 3DA1A 1IUSA 2YLTA 1QLBA 4JY2A 2F5ZA 1VRQB 2YLWA 2GAHB 4O5QA 2WBAA 1E39A 3M13A 1E1LA 1LVLA 1P2EA 2RGJA 4X4JA 1BF3A 4EM3A 3COXA 4PAAA 4QFCA 3ZNQA 3KLJA 4RSLA 3HYWA 1COYA 3QFBA 2VRMA 2XDOA 3SZFA 1PBBA 4CNKA 4YJHB 1GRBA 2GB0A 2YG6A 1REOA 2GR2A 4E0VA 4Z43A 2BRAA 1C0LA 2C64A 3UOZA 1CJ2A 3K7MX 4KPRA 4BURA 3ALJA 3AEGA 3K7TA 3L1RA 4H2PA 2R0GA 4C74A 3F8RA 1O95A 2EQ6A 2YLSA 4H4RA 4A6NB 4CCRA 1ONFA 4LIIA 3W4JA 2DKIA 1GRAA 5BULA 2CULA 2Y6RA 1TYTA 2XFPA 2C76A 2YM1A 3ADAB 4A9WA 4CY8A 4YXDA 4YJGA 5KMPA 4H4YA 3CNPA 5KMSA 2A89A 1ZP0A 2IVDA 3JSKA 3UTFA 2GRTA 1N4UA 4LA1A 5JCKA 1B4VA 1OJTA 4H2QA 2JBVA 4BK2A 4YKFA 2YLRA 3AYIA 4YTNA 2A8XA 2BXSA 4Z2TA 3BNMA 1JOAA 4H4PA 2XVEA 1EBDA 3F8PA 3PO7A 1Y56B 3AE4A 2RGHA 2VOUA 1P2HA 1K0JA 3ZNNA 1H83A 2ZZ0A 1CC6A 3T0KA 1XDIA 5FS8A 3UKQA 2Y6QA 4Z44A 2VZ2A 4YKGA 2B7SA 1GALA 4USQA 1TDOA 3SM8A 1NEKA 3II4A 1V59A 2BK4A 1NDAA 4EM4A 2XVIA 5CKUA 1QJDA 4OCGA 3KVEA 5KOXA 2WP6A 2XVFA 3ISHA 2E4GA 1EL7A 3NN0X 5IPYA 1GREA 1H84A 3CIRA 5CQFA 4UP3A 2R45A 3ALLA 1YY5A 2WQYA 5KMQA 2R0PA 4D04A 3ABVA 4NWZA 2BCGG 2GF3A 3GYJA 4C3XA 4EMJA 4NNJA 1KSUA 4C77A 3FG2P 1GRFA 2CVJA 2FJEA 1CF3A 1C0PA 2H89A 3CNDA 4K5SA 1EL8A 2GQWA 3CPJG 3G5SA 3KA7A 4O5UA 4OPGA 1BGNA 1FL2A 4YSHA 2BS4A 1IUTA 2WPCA 3CNTA 3SY4A 1B8SA 2B76A 5KXJA 4OPDA 2BK3A 3NNEA 3AE3A 4IVMB 4YTMA 3DJEA 3GRSA 4I59A 4AP1A 4H2RA 4YJHA 1OJAA 1QO8A 1DXLA 4K2XA 3K7QX 3H4KA 4B67A 5EB4A 3NKSA 1F8WA 5DBJA 2QA1A 1LJ1A 1GSNA 3BI2A 4APNA 1GXFA 4DGKA 4EMWA 1S3EA 1M6IA 2QA2A 4A6NA 1MO9A 2DKHA 3NN6X 4U8PA 4XXGA 2YVGA 1FECA 3H8IA 3H8LA 3OZ2A 2JB3A 2X3NA 3I3LA 1DJQA 2RGOA 2V61A 4WX1A 4ECHA 1GT8A 2B9XA 1NHQA 5KNLA 1TDKA 1GTEA 3PS9A 2EQ9A 3RNMA 2E82A 3AWIA 3NYCA 1TRBA 3SGLA 2W0HA 3EAOA 2GR3A 4A7AA 4AOSA 4DSHA 1MXTA 4U2SA 1PJ6A 3AD7B 1Y56A 2BS2A 2CDUA 1ELIA 2WU5A 3FIMB 4CY6A 1CJ3A 3DK8A 4PABA 3GYXA 2BK5A 1CBOA 4J36A 3REDA 4U8KA 3T14A 4EIQA 4ICYA 3UTHA 1UKVG 2WDQA 3DGHA 3ZNPA 5HXIA 2X99A 1KFYA 4GAVA 3CN8A 4C5OA 2YR4A 4USRA 3RHAA 1DOEA 2GAGB 2ZZCA 4ZCCA 1PS9A 2BRYA 1DAOA 1GOSA 3BI5A 4JNQA 1KIFA 2OALA 1D4EA 2YR6A 1LV0A 3CUKA 4G9KA 3B3RA 1NPXA 1YQ4A 2A87A 3AE6A 2YQUA 4GF7A 3UTGA 1IUUA 2BA9A 3NK1X 4IVOB 4X9MA 3CMMA 2XLUA 2YAUA 2ACZA 1ZOYA 3T2KA 3ZDNA 3FPZA 2BXRA 1H7WA 4BK1A 1GPEA 4JN9A 4TLZA 4EIPA 1H81A 1B5QA 3URHA 1SEZA 2EQ8A 1BKWA 2GVCA 3RP8A 3LZXA 3T2YA 3M12A 2AAQA 3T2ZA 5LV9A 1FEBA 3AD9B 3AD8B 1NAAA 4OPTA 4Y4NA 4K5RA 4EMIA 3G5QA 3T37A 4Z24A 3SZCA 2VRLA 3M0OA 3CTYA 5KVHA 2ARDA 5C3JA 4TM1A
chains in the Genus database with same CATH topology
2YVJA 4II3A 3P9UA 1E1MA 3HYXA 5KRQA 3AEFA 4M52A 2VQBA 4P9SA 4XWRA 2BS3A 1D7LA 4AOXA 3HZLA 1D5TA 2GMHA 4HA6A 4A65A 3DH9A 1JU2A 3NTAA 1E7PA 1B37A 1ZY8A 1LTXR 3IHMA 1IUVA 2C4CA 4JQ9A 4GR1A 1IUXA 2BACA 4UDPA 2Z5XA 3P4QA 4ZCDA 4IA5A 2WETA 3AE8A 1F6MA 3D1CA 3O0HA 1CC4A 1D7YA 2C75A 3LJPA 4JNAA 1DODA 2GR0A 3NG7X 4IA6A 3ICTA 2B7RA 5TR3A 1FCDA 3P4RA 4BJYA 4RG4A 2VVLG 2YLZA 3ATQA 2XLTA 4YWOA 3DJJA 1DOCA 2AQJA 3T31A 2JKCA 2JK6A 1GEUA 2OLOA 3CGDA 3UKHA 5GRTA 1PXAA 4K8DA 3UKLA 1O94A 1Y0PA 3PVCA 1N1PA 3GDPA 4NTDA 4AT2A 1PBDA 2EQ7A 2UZZA 3NLCA 2GEWA 3QJ4A 3AECA 2E1MA 4GCMA 4XWZA 2V60A 2XLPA 4OVIA 3UKPA 4J56A 2C7GA 1JEHA 2C67A 5JCLA 3AEDA 1PJ7A 4U8OA 3V3OA 4EQXA 1E1NA 3CPHG 3OC4A 1PBCA 1BZLA 4TM3A 1RYIA 3QVRA 2YG7A 2NPXA 3GSIA 3NH3X 2GV8A 5J60A 1NHPA 2BYBA 2R46A 4GAPA 1CJCA 1N4VA 2WDRA 2B9WA 3DMEA 4HB9A 3ZYXA 4B1BA 3CNJA 2WHDA 2Q0KA 2WESA 4NTCA 4C3YA 3B6DA 3DGZA 1S3BA 2WP5A 4H4WA 2C72A 2OA1A 4B66A 2XLSA 2YG5A 3P4SA 3AE2A 2AR8A 5EBKA 3SYIA 2VVLA 2IVEA 2QCUA 4FX9A 5BVAA 3NK0X 4YTPA 3P1WA 1ZKQA 4H50A 5M10A 4X9NA 1CJ4A 1VG0A 3UP4A 2XFQA 3IWAA 1ZDLA 4GDPA 3NGCX 1NHSA 3RP7A 2BC0A 4EQSA 4AT0A 4B63A 1KNPA 4B69A 3CGEA 1KSSA 2X8GA 2WDVA 1Q1RA 4Z25A 1JNRA 2GH5A 4FK1A 1Q9IA 2V3AA 2X50A 4H4UA 3SX6A 3RP6A 2XFUA 4LU6A 4GUVA 1OJ9A 1GERA 4OPIA 2Z5YA 3D8XA 2C73A 3AE7A 3V3NA 1EL5A 2E5VA 1VG9A 1DOBA 2YWLA 3BI4A 1DJNA 3LOVA 3Q6JA 4JY3A 4H4SA 1GV4A 1PHHA 5M0ZA 3E1TA 1L9DA 1X31B 5JCNA 3EF6A 3QSSA 1ZOVA 3G5RA 3R9UA 2GR1A 4ADWA 1O5WA 4H4XA 5KWFA 2PHHA 3VR8A 2OAMA 1H86A 1MOKA 5U1OA 1GESA 3ALMA 2YR5A 2C3DA 1GETA 1NG4A 2X8CA 1ZMCA 3C96A 1D4DA 2XVJA 1K0LA 3AEBA 2FJAA 4A99A 3ITJA 5KOWA 1KF6A 1ZMDA 2R4EA 1H7XA 2Q6UA 3V76A 1E6EA 4J2WA 4UDRA 1NHRA 4Z26A 3GMBA 3NRNA 1GNDA 1JRZA 1PXBA 1PJ5A 2WP9A 1FOHA 3QVPA 1CHUA 2R4JA 2BCPA 4ZN0A 3UOXA 3CPIG 3AYLA 4H7UA 3SZWA 3VRDB 1BWCA 1PBFA 1TDFA 4WCTA 3UCLA 1PDHA 4RG3A 4OPCA 1N4WA 2V3BA 1KDGA 3CGCA 3AE5A 2VQ7A 1GRHA 1IUWA 3GWFA 1TDEA 3S5WA 1JNZA 3KPKA 3QSEA 1HYUA 4DSGA 4U2LA 2WEUA 5ER0A 1S2YA 3AEEA 3GRTA 1LQUA 3VQRA 5L46A 4NEVA 1F3PA 4NEWA 2XVHA 2ZZBA 4FK1C 5GSNA 4B64A 3LXDA 2YVFA 4N9XA 1S2QA 3ICRA 1E1KA 2O9ZA 1LQTA 1IJHA 2XLRA 2B9YA 3VRBA 4NZHA 2TMDA 4B68A 5JCIA 3VRAA 1F8SA 1FEAA 5FS9A 4J57A 2WU2A 1ZK7A 3BNUA 1CC2A 3LADA 4GDEA 5C2TA 1NENA 3C4AA 4CBQA 2WOVA 4H2NA 2Q0LA 1VQWA 2IIDA 3FBSA 3GYIA 3K30A 4U8LA 2XFNA 4YSYA 4YT0A 5U63A 4BK3A 2YG4A 5HYMA 3UKFA 4YSXA 1ZX9A 4H4ZA 1TDNA 5EOWA 1F8RA 2ZBWA 3LB8A 3HYVA 3GD3A 3C4NA 4OPLA 4B65A 2WPEA 4U2TA 3S61A 3VR9A 3KD9A 3DJGX 3NT6A 2JAEA 1PXCA 1GRGA 4KX6A 1L9EA 1LPFA 4H4TA 4I58A 2FJDA 3UOVA 1AOGA 1YKJA 4II2A 2CFYA 2XFOA 4K22A 3KPFA 2WOIA 1D4CA 3IC9A 5KVIA 3NYFA 4J34A 4UDQA 1W4XA 3UOYA 4Z2UA 3AB1A 4IV9A 3SQPA 4CNJA 1CL0A 4TM4A 4BV6A 3AYJA 1PN0A 4FDCB 2X8HA 1Q1WA 2V5ZA 2XYOA 1VDCA 4A79A 3AE1A 1DNCA 2APGA 3NHOX 4Z2RA 3EANA 3ICSA 2BC1A 2PYXA 3BHFA 5HY5A 4Y4LA 2GQFA 4G74A 4U8JA 3NTDA 4U8IA 1K0IA 4K7ZA 5U25A 2WS3A 5FS7A 4U8NA 4EQRA 3CNSA 2OLNA 2VVMA 2V6OA 3AXBA 4J31A 3IF9A 2C65A 1M64A 2RABA 5IQ4A 2WOWA 4G73A 3AE9A 2QAEA 2GMJA 4BJZA 2FBWA 4U8MA 4YSZA 1GRTA 1YQ3A 5JCMA 4H4VA 2JB2A 2XCGA 3UKAA 4JDRA 1TYPA 5KMRA 3SXIA 3LZWA 4EQWA 4AP3A 4MJWA 4NTEA 4GRTA 5FS6A 2TPRA 3ATRA 3SZ0A 1H6VA 2WPFA 4J33A 4REKA 1EL9A 2J3NA 3UTEA 2C70A 2YG3A 3BHKA 1L0VA 1OJDA 1RSGA 4A5LA 3QFAA 5IQ1A 2JB1A 3AEAA 5BRTA 3EPTA 1RP0A 5FMHA 2YLXA 1BGJA 2Q7VA 1XHCA 2NVKX 2H88A 5EB5A 3SFDA 3GMCA 1KNRA 3DJDA 3NIXA 1XPQA 5J7XA 5BUKA 2R0CA 3IHGA 1GTHA 3GD4A 1K4QA 3CGBA 3GWDA 4TLXA 1PBEA 3UP5A 4DNAA 4G6GA 4H4QA 1JRXA 1JRYA 5HHFA 3QSMA 3F8DA 3KKJA 2BABA 2YM2A 3NYEA 3GDNA 3I6DA 4D03A 3FMWA 1YQZA 2C3CA 3P4PA 4CRTA 1NG3A 4CCQA 4TM0A 4Y4MA 3WE0A 3Q9TA 1XANA 2FJBA 2HQMA 3DK4A 1H82A 3SFEA 3DK9A 3KU9A 4OPUA 3NK2X 2I0ZA 1Z6LA 2C66A 3L8KA 3UKKA 4G6HA 1OJCA 2R9ZA 1L9CA 3DA1A 1IUSA 2YLTA 1QLBA 4JY2A 2F5ZA 1VRQB 2YLWA 2GAHB 4O5QA 2WBAA 1E39A 1LVLA 1E1LA 1P2EA 3M13A 2RGJA 4X4JA 1BF3A 4EM3A 3COXA 3KLJA 4PAAA 4RSLA 3HYWA 1COYA 3QFBA 2VRMA 2XDOA 3SZFA 1PBBA 4CNKA 1GRBA 2GB0A 2YG6A 1REOA 2GR2A 4E0VA 4Z43A 2BRAA 3UOZA 2C64A 1CJ2A 3K7MX 4KPRA 4BURA 3ALJA 3AEGA 3K7TA 3L1RA 4H2PA 2R0GA 4C74A 3F8RA 1O95A 2EQ6A 2YLSA 4H4RA 4A6NB 4CCRA 1ONFA 4LIIA 5BULA 2DKIA 1GRAA 2CULA 2Y6RA 1TYTA 2XFPA 2C76A 2YM1A 3ADAB 4A9WA 4CY8A 4YXDA 5KMPA 4H4YA 3CNPA 5KMSA 2A89A 1ZP0A 2IVDA 3JSKA 3UTFA 2GRTA 1N4UA 4LA1A 5JCKA 1B4VA 1OJTA 4H2QA 2JBVA 4BK2A 4YKFA 2YLRA 3AYIA 4YTNA 2A8XA 2BXSA 4Z2TA 3BNMA 1JOAA 4H4PA 2XVEA 1EBDA 3F8PA 3PO7A 1Y56B 3AE4A 2RGHA 2VOUA 1P2HA 1K0JA 1H83A 2ZZ0A 3T0KA 1CC6A 1XDIA 5FS8A 3UKQA 2Y6QA 4Z44A 2VZ2A 4YKGA 2B7SA 1GALA 4USQA 1TDOA 3SM8A 1NEKA 3II4A 1V59A 2BK4A 1NDAA 4EM4A 2XVIA 5CKUA 1QJDA 4OCGA 3KVEA 5KOXA 2WP6A 2XVFA 3ISHA 2E4GA 1EL7A 3NN0X 5IPYA 1GREA 1H84A 3CIRA 5CQFA 4UP3A 3ALLA 2R45A 1YY5A 2WQYA 5KMQA 2R0PA 4D04A 3ABVA 4NWZA 2BCGG 2GF3A 3GYJA 4C3XA 4EMJA 4NNJA 1KSUA 4C77A 3FG2P 1GRFA 2CVJA 2FJEA 1CF3A 3CNDA 2H89A 4K5SA 1EL8A 2GQWA 3CPJG 3G5SA 3KA7A 4O5UA 4OPGA 1BGNA 1FL2A 2BS4A 4YSHA 1IUTA 2WPCA 3CNTA 3SY4A 1B8SA 2B76A 5KXJA 4OPDA 2BK3A 3NNEA 3AE3A 4IVMB 4YTMA 3DJEA 3GRSA 4I59A 4AP1A 4H2RA 1OJAA 1QO8A 4K2XA 1DXLA 4B67A 3K7QX 3H4KA 5EB4A 3NKSA 1F8WA 5DBJA 2QA1A 1LJ1A 1GSNA 3BI2A 4APNA 1GXFA 4DGKA 4EMWA 1S3EA 1M6IA 2QA2A 4A6NA 1MO9A 2DKHA 3NN6X 4U8PA 4XXGA 2YVGA 1FECA 3H8IA 3H8LA 3OZ2A 2JB3A 2X3NA 3I3LA 1DJQA 2RGOA 2V61A 4WX1A 4ECHA 1GT8A 2B9XA 1NHQA 5KNLA 1TDKA 1GTEA 3PS9A 2EQ9A 3RNMA 1TRBA 3AWIA 2W0HA 3NYCA 3SGLA 3EAOA 4A7AA 2GR3A 4AOSA 4DSHA 1MXTA 4U2SA 1PJ6A 2WU5A 1Y56A 2BS2A 2CDUA 1ELIA 3AD7B 3FIMB 4CY6A 1CJ3A 3DK8A 4PABA 3GYXA 2BK5A 1CBOA 4J36A 3REDA 4U8KA 3T14A 4EIQA 4ICYA 3UTHA 1UKVG 2WDQA 3DGHA 5HXIA 2X99A 1KFYA 4GAVA 3CN8A 4C5OA 2YR4A 4USRA 3RHAA 1DOEA 2GAGB 2ZZCA 4ZCCA 1PS9A 2BRYA 1GOSA 3BI5A 4JNQA 2OALA 1D4EA 2YR6A 1LV0A 4G9KA 3B3RA 1NPXA 1YQ4A 2A87A 3AE6A 2YQUA 4GF7A 3UTGA 1IUUA 2BA9A 3NK1X 4IVOB 3CMMA 4X9MA 2XLUA 2YAUA 2ACZA 1ZOYA 3T2KA 3ZDNA 3FPZA 2BXRA 1H7WA 4BK1A 1GPEA 4JN9A 4TLZA 4EIPA 1H81A 1B5QA 3URHA 1SEZA 2EQ8A 1BKWA 2GVCA 3RP8A 3LZXA 3T2YA 3M12A 2AAQA 3T2ZA 5LV9A 1FEBA 3AD9B 3AD8B 1NAAA 4OPTA 4Y4NA 4K5RA 4EMIA 3G5QA 3T37A 4Z24A 3SZCA 2VRLA 3M0OA 3CTYA 5KVHA 2ARDA 5C3JA 4TM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVJ A;  3P9U A;  1E1M A;  5KRQ A;  3AEF A;  4M52 A;  2VQB A;  4P9S A;  4XWR A;  2BS3 A;  1D7L A;  4AOX A;  3HZL A;  1D5T A;  2GMH A;  4HA6 A;  4A65 A;  3DH9 A;  1JU2 A;  3NTA A;  1E7P A;  1B37 A;  1ZY8 A;  1LTX R;  3IHM A;  1IUV A;  4JQ9 A;  4UDP A;  4GR1 A;  1IUX A;  2BAC A;  4ZCD A;  2Z5X A;  3P4Q A;  2WET A;  4IA5 A;  3AE8 A;  1F6M A;  3D1C A;  3O0H A;  1CC4 A;  1D7Y A;  2C75 A;  3LJP A;  4JNA A;  1DOD A;  2GR0 A;  3NG7 X;  4IA6 A;  3ICT A;  2B7R A;  5TR3 A;  1FCD A;  3P4R A;  4BJY A;  4RG4 A;  2VVL G;  2YLZ A;  3ATQ A;  2XLT A;  4YWO A;  3DJJ A;  1DOC A;  2AQJ A;  2JKC A;  2JK6 A;  1GEU A;  2OLO A;  3CGD A;  3UKH A;  5GRT A;  1PXA A;  4K8D A;  3UKL A;  1O94 A;  1Y0P A;  3PVC A;  1N1P A;  3GDP A;  4NTD A;  4AT2 A;  1PBD A;  2EQ7 A;  2UZZ A;  3NLC A;  2GEW A;  3QJ4 A;  3AEC A;  2E1M A;  4GCM A;  4XWZ A;  2V60 A;  2XLP A;  4OVI A;  3UKP A;  4J56 A;  2C7G A;  1JEH A;  2C67 A;  5JCL A;  3AED A;  1PJ7 A;  4U8O A;  3V3O A;  4EQX A;  1E1N A;  3CPH G;  3OC4 A;  1PBC A;  1BZL A;  4TM3 A;  1RYI A;  3QVR A;  2YG7 A;  2NPX A;  3GSI A;  3NH3 X;  2GV8 A;  5J60 A;  1NHP A;  2BYB A;  2R46 A;  1CJC A;  1N4V A;  2WDR A;  2B9W A;  3DME A;  4HB9 A;  3ZYX A;  4B1B A;  3CNJ A;  2WHD A;  2Q0K A;  2WES A;  4NTC A;  4C3Y A;  3B6D A;  3DGZ A;  1S3B A;  2WP5 A;  4H4W A;  2C72 A;  2OA1 A;  4B66 A;  2XLS A;  2YG5 A;  3P4S A;  3AE2 A;  2AR8 A;  5EBK A;  2VVL A;  2IVE A;  2QCU A;  4FX9 A;  5BVA A;  3NK0 X;  4YTP A;  3P1W A;  1ZKQ A;  4H50 A;  5M10 A;  4X9N A;  1CJ4 A;  1VG0 A;  3UP4 A;  2XFQ A;  3IWA A;  1ZDL A;  4GDP A;  3NGC X;  1NHS A;  3RP7 A;  2BC0 A;  4EQS A;  4AT0 A;  4B63 A;  1KNP A;  4B69 A;  3CGE A;  1KSS A;  2X8G A;  2WDV A;  1Q1R A;  4Z25 A;  1JNR A;  2GH5 A;  4FK1 A;  1Q9I A;  2V3A A;  2X50 A;  4H4U A;  3RP6 A;  2XFU A;  4LU6 A;  4GUV A;  1OJ9 A;  1GER A;  4OPI A;  2Z5Y A;  3D8X A;  2C73 A;  3AE7 A;  3V3N A;  1EL5 A;  2E5V A;  1VG9 A;  1DOB A;  2YWL A;  3BI4 A;  1DJN A;  3LOV A;  3Q6J A;  4JY3 A;  4H4S A;  1GV4 A;  1PHH A;  5M0Z A;  3E1T A;  1L9D A;  1X31 B;  5JCN A;  3EF6 A;  3QSS A;  1ZOV A;  3G5R A;  3R9U A;  2GR1 A;  4ADW A;  1O5W A;  4H4X A;  5KWF A;  2PHH A;  3VR8 A;  2OAM A;  1H86 A;  1MOK A;  5U1O A;  1GES A;  3ALM A;  2YR5 A;  2C3D A;  1GET A;  1NG4 A;  2X8C A;  1ZMC A;  1D4D A;  3C96 A;  2XVJ A;  1K0L A;  3AEB A;  2FJA A;  4A99 A;  3ITJ A;  5KOW A;  1KF6 A;  1ZMD A;  2R4E A;  1H7X A;  2Q6U A;  3V76 A;  1E6E A;  4J2W A;  4UDR A;  1NHR A;  4Z26 A;  3GMB A;  3NRN A;  1GND A;  1JRZ A;  1PXB A;  1PJ5 A;  2WP9 A;  1FOH A;  3QVP A;  1CHU A;  2R4J A;  2BCP A;  4ZN0 A;  3UOX A;  3CPI G;  3AYL A;  4H7U A;  3VRD B;  1BWC A;  1PBF A;  1TDF A;  4WCT A;  3UCL A;  1PDH A;  4RG3 A;  4OPC A;  1N4W A;  2V3B A;  1KDG A;  3CGC A;  3AE5 A;  2VQ7 A;  1GRH A;  1IUW A;  3GWF A;  1TDE A;  3S5W A;  1JNZ A;  3QSE A;  1HYU A;  4DSG A;  4U2L A;  2WEU A;  5ER0 A;  1S2Y A;  3AEE A;  3GRT A;  1LQU A;  3VQR A;  5L46 A;  4NEV A;  1F3P A;  4NEW A;  2XVH A;  2ZZB A;  4FK1 C;  5GSN A;  4B64 A;  3LXD A;  2YVF A;  4N9X A;  1S2Q A;  3ICR A;  1E1K A;  2O9Z A;  1LQT A;  1IJH A;  2XLR A;  2B9Y A;  3VRB A;  4NZH A;  2TMD A;  4B68 A;  5JCI A;  3VRA A;  1F8S A;  1FEA A;  5FS9 A;  4J57 A;  2WU2 A;  1ZK7 A;  3BNU A;  1CC2 A;  3LAD A;  4GDE A;  5C2T A;  1NEN A;  3C4A A;  4CBQ A;  2WOV A;  4H2N A;  2Q0L A;  1VQW A;  2IID A;  3FBS A;  3GYI A;  3K30 A;  4U8L A;  2XFN A;  4YSY A;  4YT0 A;  5U63 A;  2YG4 A;  4BK3 A;  5HYM A;  3UKF A;  4YSX A;  1ZX9 A;  4H4Z A;  1TDN A;  5EOW A;  1F8R A;  2ZBW A;  3LB8 A;  3GD3 A;  3C4N A;  4OPL A;  4B65 A;  2WPE A;  4U2T A;  3S61 A;  3VR9 A;  3KD9 A;  3DJG X;  3NT6 A;  2JAE A;  1PXC A;  1GRG A;  4KX6 A;  1L9E A;  1LPF A;  4H4T A;  4I58 A;  2FJD A;  3UOV A;  1AOG A;  1YKJ A;  2CFY A;  2XFO A;  4K22 A;  3KPF A;  2WOI A;  1D4C A;  3IC9 A;  5KVI A;  3NYF A;  4J34 A;  4UDQ A;  1W4X A;  3UOY A;  4Z2U A;  3AB1 A;  4IV9 A;  3SQP A;  4CNJ A;  1CL0 A;  4TM4 A;  4BV6 A;  3AYJ A;  1PN0 A;  4FDC B;  2X8H A;  1Q1W A;  2V5Z A;  2XYO A;  1VDC A;  4A79 A;  3AE1 A;  1DNC A;  2APG A;  3NHO X;  4Z2R A;  3EAN A;  3ICS A;  2BC1 A;  2PYX A;  3BHF A;  5HY5 A;  4Y4L A;  2GQF A;  4U8J A;  3NTD A;  4U8I A;  1K0I A;  4K7Z A;  5U25 A;  2WS3 A;  5FS7 A;  4U8N A;  4EQR A;  3CNS A;  2OLN A;  2VVM A;  2V6O A;  3AXB A;  4J31 A;  3IF9 A;  2C65 A;  1M64 A;  2RAB A;  5IQ4 A;  2WOW A;  3AE9 A;  2QAE A;  2GMJ A;  4BJZ A;  2FBW A;  4U8M A;  4YSZ A;  1GRT A;  1YQ3 A;  5JCM A;  4H4V A;  2JB2 A;  2XCG A;  3UKA A;  4JDR A;  1TYP A;  3LZW A;  4EQW A;  4AP3 A;  4MJW A;  4NTE A;  4GRT A;  5FS6 A;  2TPR A;  3ATR A;  1H6V A;  2WPF A;  4J33 A;  4REK A;  1EL9 A;  2J3N A;  3UTE A;  2C70 A;  2YG3 A;  3BHK A;  1L0V A;  1OJD A;  1RSG A;  4A5L A;  3QFA A;  5IQ1 A;  2JB1 A;  3AEA A;  5BRT A;  3EPT A;  1RP0 A;  5FMH A;  2YLX A;  1BGJ A;  2Q7V A;  1XHC A;  2NVK X;  2H88 A;  5EB5 A;  3SFD A;  3GMC A;  1KNR A;  3DJD A;  3NIX A;  1XPQ A;  5J7X A;  5BUK A;  2R0C A;  3IHG A;  1GTH A;  3GD4 A;  1K4Q A;  3CGB A;  3GWD A;  4TLX A;  1PBE A;  3UP5 A;  4DNA A;  4H4Q A;  1JRX A;  1JRY A;  5HHF A;  3QSM A;  3F8D A;  3KKJ A;  2BAB A;  2YM2 A;  3NYE A;  3GDN A;  3I6D A;  4D03 A;  3FMW A;  1YQZ A;  2C3C A;  3P4P A;  4CRT A;  1NG3 A;  4CCQ A;  4TM0 A;  4Y4M A;  3WE0 A;  3Q9T A;  1XAN A;  2FJB A;  2HQM A;  3DK4 A;  1H82 A;  3SFE A;  3DK9 A;  3KU9 A;  4OPU A;  3NK2 X;  2I0Z A;  1Z6L A;  2C66 A;  3L8K A;  3UKK A;  1OJC A;  2R9Z A;  1L9C A;  3DA1 A;  1IUS A;  2YLT A;  1QLB A;  4JY2 A;  2F5Z A;  1VRQ B;  2YLW A;  2GAH B;  4O5Q A;  2WBA A;  1E39 A;  1LVL A;  1E1L A;  1P2E A;  3M13 A;  2RGJ A;  4X4J A;  1BF3 A;  4EM3 A;  3COX A;  3KLJ A;  4PAA A;  4RSL A;  1COY A;  3QFB A;  2VRM A;  2XDO A;  1PBB A;  4CNK A;  1GRB A;  2GB0 A;  2YG6 A;  1REO A;  2GR2 A;  4E0V A;  4Z43 A;  3UOZ A;  2C64 A;  1CJ2 A;  3K7M X;  4KPR A;  4BUR A;  3ALJ A;  3AEG A;  3K7T A;  3L1R A;  4H2P A;  2R0G A;  4C74 A;  3F8R A;  1O95 A;  2EQ6 A;  2YLS A;  4H4R A;  4A6N B;  4CCR A;  1ONF A;  4LII A;  5BUL A;  2DKI A;  1GRA A;  2CUL A;  2Y6R A;  1TYT A;  2XFP A;  2C76 A;  2YM1 A;  3ADA B;  4A9W A;  4CY8 A;  4YXD A;  4H4Y A;  3CNP A;  2A89 A;  1ZP0 A;  2IVD A;  3JSK A;  3UTF A;  2GRT A;  1N4U A;  4LA1 A;  5JCK A;  1B4V A;  1OJT A;  4H2Q A;  2JBV A;  4BK2 A;  4YKF A;  2YLR A;  3AYI A;  4YTN A;  2A8X A;  2BXS A;  4Z2T A;  3BNM A;  1JOA A;  4H4P A;  2XVE A;  1EBD A;  3F8P A;  3PO7 A;  1Y56 B;  3AE4 A;  2RGH A;  2VOU A;  1P2H A;  1K0J A;  1H83 A;  2ZZ0 A;  1CC6 A;  1XDI A;  5FS8 A;  3UKQ A;  2Y6Q A;  4Z44 A;  2VZ2 A;  4YKG A;  2B7S A;  1GAL A;  4USQ A;  1TDO A;  3SM8 A;  1NEK A;  3II4 A;  1V59 A;  2BK4 A;  1NDA A;  4EM4 A;  2XVI A;  5CKU A;  1QJD A;  4OCG A;  3KVE A;  5KOX A;  2WP6 A;  2XVF A;  3ISH A;  2E4G A;  1EL7 A;  3NN0 X;  5IPY A;  1GRE A;  1H84 A;  3CIR A;  5CQF A;  4UP3 A;  3ALL A;  2R45 A;  1YY5 A;  2WQY A;  2R0P A;  4D04 A;  3ABV A;  2BCG G;  2GF3 A;  3GYJ A;  4C3X A;  4EMJ A;  4C77 A;  1KSU A;  3FG2 P;  1GRF A;  2CVJ A;  2FJE A;  1CF3 A;  3CND A;  2H89 A;  4K5S A;  1EL8 A;  2GQW A;  3CPJ G;  3G5S A;  3KA7 A;  4O5U A;  4OPG A;  1BGN A;  1FL2 A;  2BS4 A;  4YSH A;  1IUT A;  2WPC A;  3CNT A;  1B8S A;  2B76 A;  5KXJ A;  4OPD A;  2BK3 A;  3NNE A;  3AE3 A;  4IVM B;  4YTM A;  3DJE A;  3GRS A;  4I59 A;  4AP1 A;  4H2R A;  1OJA A;  1QO8 A;  4K2X A;  1DXL A;  4B67 A;  3K7Q X;  3H4K A;  5EB4 A;  3NKS A;  1F8W A;  5DBJ A;  2QA1 A;  1LJ1 A;  1GSN A;  3BI2 A;  4APN A;  1GXF A;  4DGK A;  4EMW A;  1S3E A;  1M6I A;  2QA2 A;  4A6N A;  1MO9 A;  2DKH A;  3NN6 X;  4U8P A;  4XXG A;  2YVG A;  1FEC A;  3H8I A;  3H8L A;  3OZ2 A;  2JB3 A;  2X3N A;  3I3L A;  1DJQ A;  2RGO A;  2V61 A;  4WX1 A;  4ECH A;  1GT8 A;  2B9X A;  1NHQ A;  1TDK A;  1GTE A;  3PS9 A;  2EQ9 A;  3RNM A;  1TRB A;  3AWI A;  2W0H A;  3NYC A;  3SGL A;  3EAO A;  4A7A A;  2GR3 A;  4AOS A;  4DSH A;  1MXT A;  4U2S A;  1PJ6 A;  2WU5 A;  1Y56 A;  2BS2 A;  2CDU A;  1ELI A;  3AD7 B;  3FIM B;  4CY6 A;  1CJ3 A;  3DK8 A;  4PAB A;  2BK5 A;  1CBO A;  4J36 A;  3RED A;  4U8K A;  4EIQ A;  4ICY A;  3UTH A;  1UKV G;  2WDQ A;  3DGH A;  5HXI A;  2X99 A;  1KFY A;  3CN8 A;  4C5O A;  2YR4 A;  4USR A;  3RHA A;  1DOE A;  2GAG B;  2ZZC A;  4ZCC A;  1PS9 A;  1GOS A;  3BI5 A;  4JNQ A;  2OAL A;  1D4E A;  2YR6 A;  1LV0 A;  3B3R A;  1NPX A;  1YQ4 A;  2A87 A;  3AE6 A;  2YQU A;  4GF7 A;  3UTG A;  1IUU A;  2BA9 A;  3NK1 X;  4IVO B;  4X9M A;  2XLU A;  2YAU A;  2ACZ A;  1ZOY A;  3ZDN A;  3FPZ A;  2BXR A;  1H7W A;  4JN9 A;  1GPE A;  4BK1 A;  4TLZ A;  4EIP A;  1H81 A;  1B5Q A;  3URH A;  1SEZ A;  2EQ8 A;  1BKW A;  2GVC A;  3RP8 A;  3LZX A;  3M12 A;  2AAQ A;  5LV9 A;  1FEB A;  3AD9 B;  3AD8 B;  1NAA A;  4OPT A;  4Y4N A;  4K5R A;  4EMI A;  3G5Q A;  3T37 A;  4Z24 A;  2VRL A;  3M0O A;  3CTY A;  5KVH A;  2ARD A;  5C3J A;  4TM1 A; 
#chains in the Genus database with same CATH topology
 2YVJ A;  4II3 A;  3P9U A;  1E1M A;  3HYX A;  2DU8 A;  5KRQ A;  3AEF A;  4M52 A;  2VQB A;  4P9S A;  4XWR A;  2BS3 A;  1D7L A;  4AOX A;  3HZL A;  1D5T A;  2GMH A;  4HA6 A;  4A65 A;  3DH9 A;  1JU2 A;  3NTA A;  1E7P A;  1C0K A;  1DDO A;  1B37 A;  3IHM A;  1IUV A;  1LTX R;  1ZY8 A;  2C4C A;  1IUX A;  2BAC A;  4GR1 A;  2Z5X A;  3P4Q A;  4UDP A;  4ZCD A;  4IA5 A;  2WET A;  3AE8 A;  1F6M A;  3D1C A;  3O0H A;  1CC4 A;  1D7Y A;  2C75 A;  3LJP A;  4JNA A;  1DOD A;  2GR0 A;  3NG7 X;  4IA6 A;  3ICT A;  2B7R A;  5TR3 A;  1FCD A;  3P4R A;  4BJY A;  4RG4 A;  2VVL G;  2YLZ A;  3ATQ A;  2XLT A;  4YWO A;  3DJJ A;  1DOC A;  2AQJ A;  3T31 A;  2JKC A;  2JK6 A;  1GEU A;  2OLO A;  3CGD A;  3UKH A;  5GRT A;  1PXA A;  4K8D A;  3UKL A;  1O94 A;  1Y0P A;  3PVC A;  1N1P A;  3GDP A;  4NTD A;  4AT2 A;  1PBD A;  2UZZ A;  2EQ7 A;  3NLC A;  2GEW A;  3QJ4 A;  3AEC A;  2E1M A;  4XWZ A;  4GCM A;  2V60 A;  2XLP A;  4OVI A;  3UKP A;  4J56 A;  2C7G A;  1JEH A;  2C67 A;  5JCL A;  3AED A;  1PJ7 A;  4U8O A;  3V3O A;  4EQX A;  1E1N A;  3CPH G;  4YJF A;  3OC4 A;  1PBC A;  1BZL A;  4TM3 A;  1RYI A;  3QVR A;  2YG7 A;  2NPX A;  3GSI A;  3NH3 X;  2GV8 A;  5J60 A;  1NHP A;  2BYB A;  2R46 A;  4GAP A;  1CJC A;  1N4V A;  2WDR A;  3DME A;  2B9W A;  4HB9 A;  3ZYX A;  4B1B A;  3CNJ A;  2WHD A;  2Q0K A;  2WES A;  4NTC A;  4C3Y A;  3B6D A;  3DGZ A;  1S3B A;  2WP5 A;  4H4W A;  2C72 A;  2OA1 A;  4B66 A;  2XLS A;  2YG5 A;  4QFD A;  3W4I A;  3P4S A;  3AE2 A;  2AR8 A;  5EBK A;  3SYI A;  2VVL A;  2IVE A;  2QCU A;  4FX9 A;  5BVA A;  1AN9 A;  3NK0 X;  4YTP A;  3P1W A;  1ZKQ A;  4H50 A;  5M10 A;  4X9N A;  1CJ4 A;  1VG0 A;  3UP4 A;  2XFQ A;  3IWA A;  1ZDL A;  4GDP A;  3NGC X;  1NHS A;  3RP7 A;  2BC0 A;  4EQS A;  4AT0 A;  4B63 A;  1KNP A;  4B69 A;  3CGE A;  1KSS A;  2X8G A;  2WDV A;  1Q1R A;  4Z25 A;  1JNR A;  2GH5 A;  4FK1 A;  1Q9I A;  2V3A A;  2X50 A;  4H4U A;  3SX6 A;  3RP6 A;  2XFU A;  4LU6 A;  4GUV A;  1OJ9 A;  1GER A;  4OPI A;  2Z5Y A;  3D8X A;  2C73 A;  3AE7 A;  3V3N A;  1EL5 A;  2E5V A;  1VG9 A;  1VE9 A;  1DOB A;  2YWL A;  3BI4 A;  1DJN A;  3LOV A;  3Q6J A;  4JY3 A;  4H4S A;  1GV4 A;  1PHH A;  5M0Z A;  3E1T A;  1L9D A;  1X31 B;  5JCN A;  3EF6 A;  3QSS A;  1ZOV A;  3G5R A;  3R9U A;  2GR1 A;  4ADW A;  1O5W A;  4H4X A;  3W4K A;  5KWF A;  2PHH A;  3VR8 A;  2OAM A;  1H86 A;  2E4A A;  1MOK A;  5U1O A;  1GES A;  3ALM A;  2YR5 A;  2C3D A;  1GET A;  1NG4 A;  2X8C A;  1ZMC A;  3C96 A;  1D4D A;  2XVJ A;  1K0L A;  3AEB A;  2FJA A;  4A99 A;  3ITJ A;  5KOW A;  1KF6 A;  1ZMD A;  2R4E A;  1H7X A;  2Q6U A;  3V76 A;  1E6E A;  4J2W A;  4UDR A;  1NHR A;  4Z26 A;  3GMB A;  3NRN A;  1GND A;  1JRZ A;  1PXB A;  1PJ5 A;  2WP9 A;  1FOH A;  3QVP A;  1CHU A;  2R4J A;  2BCP A;  4ZN0 A;  3UOX A;  3CPI G;  3WGT A;  3AYL A;  4H7U A;  3SZW A;  3VRD B;  1BWC A;  1PBF A;  1TDF A;  4WCT A;  3UCL A;  3ZNO A;  1PDH A;  4RG3 A;  4OPC A;  1N4W A;  2V3B A;  1KDG A;  3CGC A;  3AE5 A;  2VQ7 A;  1GRH A;  1IUW A;  3GWF A;  1TDE A;  3S5W A;  1JNZ A;  3KPK A;  3QSE A;  1HYU A;  4DSG A;  4U2L A;  2WEU A;  5ER0 A;  1S2Y A;  3AEE A;  3GRT A;  1LQU A;  3VQR A;  5L46 A;  4NEV A;  1F3P A;  4NEW A;  2XVH A;  2ZZB A;  4FK1 C;  5GSN A;  4B64 A;  3LXD A;  2YVF A;  4N9X A;  1S2Q A;  3ICR A;  1E1K A;  2O9Z A;  1LQT A;  1IJH A;  2XLR A;  2B9Y A;  3VRB A;  4NZH A;  1EVI A;  2TMD A;  4B68 A;  5JCI A;  3VRA A;  1C0I A;  1F8S A;  1FEA A;  5FS9 A;  4J57 A;  2WU2 A;  1ZK7 A;  3BNU A;  1CC2 A;  3LAD A;  4GDE A;  5C2T A;  4JQ9 A;  1NEN A;  3C4A A;  4CBQ A;  2WOV A;  4H2N A;  2Q0L A;  1VQW A;  2IID A;  3FBS A;  3GYI A;  3K30 A;  4U8L A;  2XFN A;  4YSY A;  4YT0 A;  5U63 A;  4BK3 A;  2YG4 A;  5HYM A;  3UKF A;  4YSX A;  1ZX9 A;  4H4Z A;  1TDN A;  5EOW A;  2E49 A;  1F8R A;  2ZBW A;  3LB8 A;  3HYV A;  3GD3 A;  3C4N A;  4OPL A;  4B65 A;  2WPE A;  4U2T A;  3S61 A;  3VR9 A;  3KD9 A;  3DJG X;  3NT6 A;  2JAE A;  1PXC A;  1GRG A;  4KX6 A;  1L9E A;  1LPF A;  4H4T A;  4I58 A;  2FJD A;  3UOV A;  1AOG A;  1YKJ A;  4II2 A;  2CFY A;  2XFO A;  4K22 A;  3KPF A;  2WOI A;  1D4C A;  3IC9 A;  5KVI A;  3NYF A;  4J34 A;  4UDQ A;  1W4X A;  3UOY A;  4Z2U A;  3AB1 A;  4IV9 A;  3SQP A;  4CNJ A;  1CL0 A;  4TM4 A;  4BV6 A;  3AYJ A;  1PN0 A;  4FDC B;  2X8H A;  1Q1W A;  2V5Z A;  2XYO A;  1VDC A;  4A79 A;  3AE1 A;  1DNC A;  2APG A;  3NHO X;  4Z2R A;  3EAN A;  3ICS A;  4YJD A;  2BC1 A;  3BHF A;  2PYX A;  5HY5 A;  4Y4L A;  2GQF A;  4G74 A;  4U8J A;  3NTD A;  4U8I A;  1K0I A;  4K7Z A;  5U25 A;  2WS3 A;  5FS7 A;  4U8N A;  4EQR A;  3CNS A;  2OLN A;  3AXB A;  2V6O A;  2VVM A;  4J31 A;  3IF9 A;  2C65 A;  1M64 A;  2RAB A;  5IQ4 A;  2WOW A;  4G73 A;  3AE9 A;  2QAE A;  2GMJ A;  4BJZ A;  2FBW A;  4U8M A;  4YSZ A;  1GRT A;  1YQ3 A;  5JCM A;  4H4V A;  2JB2 A;  2XCG A;  3UKA A;  4JDR A;  1TYP A;  5KMR A;  3SXI A;  3LZW A;  4EQW A;  4AP3 A;  4MJW A;  4NTE A;  4GRT A;  5FS6 A;  2TPR A;  3ATR A;  3SZ0 A;  1H6V A;  2WPF A;  4J33 A;  4REK A;  1EL9 A;  2J3N A;  3UTE A;  2C70 A;  2YG3 A;  3BHK A;  1L0V A;  1OJD A;  1RSG A;  4YJG B;  4A5L A;  3QFA A;  5IQ1 A;  2JB1 A;  3AEA A;  5BRT A;  3EPT A;  1RP0 A;  5FMH A;  2YLX A;  1BGJ A;  3G3E A;  2Q7V A;  1XHC A;  2NVK X;  2H88 A;  5EB5 A;  3SFD A;  3DJD A;  3GMC A;  1KNR A;  3NIX A;  1XPQ A;  5J7X A;  5BUK A;  2R0C A;  3IHG A;  1GTH A;  3GD4 A;  1K4Q A;  3CGB A;  3GWD A;  4TLX A;  1PBE A;  3UP5 A;  4DNA A;  4G6G A;  4H4Q A;  1JRX A;  1JRY A;  5HHF A;  3QSM A;  2E48 A;  3F8D A;  3KKJ A;  2BAB A;  2YM2 A;  3NYE A;  3GDN A;  3I6D A;  4D03 A;  3FMW A;  1YQZ A;  2C3C A;  3P4P A;  4CRT A;  1NG3 A;  4CCQ A;  4TM0 A;  4Y4M A;  3WE0 A;  3Q9T A;  1XAN A;  2FJB A;  2HQM A;  3DK4 A;  1H82 A;  3SFE A;  3DK9 A;  3KU9 A;  4OPU A;  3NK2 X;  2I0Z A;  1Z6L A;  2C66 A;  3L8K A;  3UKK A;  4YJF B;  4G6H A;  1OJC A;  2R9Z A;  1L9C A;  3DA1 A;  1IUS A;  2YLT A;  1QLB A;  4JY2 A;  2F5Z A;  1VRQ B;  2YLW A;  2GAH B;  4O5Q A;  2WBA A;  1E39 A;  3M13 A;  1E1L A;  1LVL A;  1P2E A;  2RGJ A;  4X4J A;  1BF3 A;  4EM3 A;  3COX A;  4PAA A;  4QFC A;  3ZNQ A;  3KLJ A;  4RSL A;  3HYW A;  1COY A;  3QFB A;  2VRM A;  2XDO A;  3SZF A;  1PBB A;  4CNK A;  4YJH B;  1GRB A;  2GB0 A;  2YG6 A;  1REO A;  2GR2 A;  4E0V A;  4Z43 A;  2BRA A;  1C0L A;  2C64 A;  3UOZ A;  1CJ2 A;  3K7M X;  4KPR A;  4BUR A;  3ALJ A;  3AEG A;  3K7T A;  3L1R A;  4H2P A;  2R0G A;  4C74 A;  3F8R A;  1O95 A;  2EQ6 A;  2YLS A;  4H4R A;  4A6N B;  4CCR A;  1ONF A;  4LII A;  3W4J A;  2DKI A;  1GRA A;  5BUL A;  2CUL A;  2Y6R A;  1TYT A;  2XFP A;  2C76 A;  2YM1 A;  3ADA B;  4A9W A;  4CY8 A;  4YXD A;  4YJG A;  5KMP A;  4H4Y A;  3CNP A;  5KMS A;  2A89 A;  1ZP0 A;  2IVD A;  3JSK A;  3UTF A;  2GRT A;  1N4U A;  4LA1 A;  5JCK A;  1B4V A;  1OJT A;  4H2Q A;  2JBV A;  4BK2 A;  4YKF A;  2YLR A;  3AYI A;  4YTN A;  2A8X A;  2BXS A;  4Z2T A;  3BNM A;  1JOA A;  4H4P A;  2XVE A;  1EBD A;  3F8P A;  3PO7 A;  1Y56 B;  3AE4 A;  2RGH A;  2VOU A;  1P2H A;  1K0J A;  3ZNN A;  1H83 A;  2ZZ0 A;  1CC6 A;  3T0K A;  1XDI A;  5FS8 A;  3UKQ A;  2Y6Q A;  4Z44 A;  2VZ2 A;  4YKG A;  2B7S A;  1GAL A;  4USQ A;  1TDO A;  3SM8 A;  1NEK A;  3II4 A;  1V59 A;  2BK4 A;  1NDA A;  4EM4 A;  2XVI A;  5CKU A;  1QJD A;  4OCG A;  3KVE A;  5KOX A;  2WP6 A;  2XVF A;  3ISH A;  2E4G A;  1EL7 A;  3NN0 X;  5IPY A;  1GRE A;  1H84 A;  3CIR A;  5CQF A;  4UP3 A;  2R45 A;  3ALL A;  1YY5 A;  2WQY A;  5KMQ A;  2R0P A;  4D04 A;  3ABV A;  4NWZ A;  2BCG G;  2GF3 A;  3GYJ A;  4C3X A;  4EMJ A;  4NNJ A;  1KSU A;  4C77 A;  3FG2 P;  1GRF A;  2CVJ A;  2FJE A;  1CF3 A;  1C0P A;  2H89 A;  3CND A;  4K5S A;  1EL8 A;  2GQW A;  3CPJ G;  3G5S A;  3KA7 A;  4O5U A;  4OPG A;  1BGN A;  1FL2 A;  4YSH A;  2BS4 A;  1IUT A;  2WPC A;  3CNT A;  3SY4 A;  1B8S A;  2B76 A;  5KXJ A;  4OPD A;  2BK3 A;  3NNE A;  3AE3 A;  4IVM B;  4YTM A;  3DJE A;  3GRS A;  4I59 A;  4AP1 A;  4H2R A;  4YJH A;  1OJA A;  1QO8 A;  1DXL A;  4K2X A;  3K7Q X;  3H4K A;  4B67 A;  5EB4 A;  3NKS A;  1F8W A;  5DBJ A;  2QA1 A;  1LJ1 A;  1GSN A;  3BI2 A;  4APN A;  1GXF A;  4DGK A;  4EMW A;  1S3E A;  1M6I A;  2QA2 A;  4A6N A;  1MO9 A;  2DKH A;  3NN6 X;  4U8P A;  4XXG A;  2YVG A;  1FEC A;  3H8I A;  3H8L A;  3OZ2 A;  2JB3 A;  2X3N A;  3I3L A;  1DJQ A;  2RGO A;  2V61 A;  4WX1 A;  4ECH A;  1GT8 A;  2B9X A;  1NHQ A;  5KNL A;  1TDK A;  1GTE A;  3PS9 A;  2EQ9 A;  3RNM A;  2E82 A;  3AWI A;  3NYC A;  1TRB A;  3SGL A;  2W0H A;  3EAO A;  2GR3 A;  4A7A A;  4AOS A;  4DSH A;  1MXT A;  4U2S A;  1PJ6 A;  3AD7 B;  1Y56 A;  2BS2 A;  2CDU A;  1ELI A;  2WU5 A;  3FIM B;  4CY6 A;  1CJ3 A;  3DK8 A;  4PAB A;  3GYX A;  2BK5 A;  1CBO A;  4J36 A;  3RED A;  4U8K A;  3T14 A;  4EIQ A;  4ICY A;  3UTH A;  1UKV G;  2WDQ A;  3DGH A;  3ZNP A;  5HXI A;  2X99 A;  1KFY A;  4GAV A;  3CN8 A;  4C5O A;  2YR4 A;  4USR A;  3RHA A;  1DOE A;  2GAG B;  2ZZC A;  4ZCC A;  1PS9 A;  2BRY A;  1DAO A;  1GOS A;  3BI5 A;  4JNQ A;  1KIF A;  2OAL A;  1D4E A;  2YR6 A;  1LV0 A;  3CUK A;  4G9K A;  3B3R A;  1NPX A;  1YQ4 A;  2A87 A;  3AE6 A;  2YQU A;  4GF7 A;  3UTG A;  1IUU A;  2BA9 A;  3NK1 X;  4IVO B;  4X9M A;  3CMM A;  2XLU A;  2YAU A;  2ACZ A;  1ZOY A;  3T2K A;  3ZDN A;  3FPZ A;  2BXR A;  1H7W A;  4BK1 A;  1GPE A;  4JN9 A;  4TLZ A;  4EIP A;  1H81 A;  1B5Q A;  3URH A;  1SEZ A;  2EQ8 A;  1BKW A;  2GVC A;  3RP8 A;  3LZX A;  3T2Y A;  3M12 A;  2AAQ A;  3T2Z A;  5LV9 A;  1FEB A;  3AD9 B;  3AD8 B;  1NAA A;  4OPT A;  4Y4N A;  4K5R A;  4EMI A;  3G5Q A;  3T37 A;  4Z24 A;  3SZC A;  2VRL A;  3M0O A;  3CTY A;  5KVH A;  2ARD A;  5C3J A;  4TM1 A; 
#chains in the Genus database with same CATH homology
 2YVJ A;  4II3 A;  3P9U A;  1E1M A;  3HYX A;  5KRQ A;  3AEF A;  4M52 A;  2VQB A;  4P9S A;  4XWR A;  2BS3 A;  1D7L A;  4AOX A;  3HZL A;  1D5T A;  2GMH A;  4HA6 A;  4A65 A;  3DH9 A;  1JU2 A;  3NTA A;  1E7P A;  1B37 A;  1ZY8 A;  1LTX R;  3IHM A;  1IUV A;  2C4C A;  4JQ9 A;  4GR1 A;  1IUX A;  2BAC A;  4UDP A;  2Z5X A;  3P4Q A;  4ZCD A;  4IA5 A;  2WET A;  3AE8 A;  1F6M A;  3D1C A;  3O0H A;  1CC4 A;  1D7Y A;  2C75 A;  3LJP A;  4JNA A;  1DOD A;  2GR0 A;  3NG7 X;  4IA6 A;  3ICT A;  2B7R A;  5TR3 A;  1FCD A;  3P4R A;  4BJY A;  4RG4 A;  2VVL G;  2YLZ A;  3ATQ A;  2XLT A;  4YWO A;  3DJJ A;  1DOC A;  2AQJ A;  3T31 A;  2JKC A;  2JK6 A;  1GEU A;  2OLO A;  3CGD A;  3UKH A;  5GRT A;  1PXA A;  4K8D A;  3UKL A;  1O94 A;  1Y0P A;  3PVC A;  1N1P A;  3GDP A;  4NTD A;  4AT2 A;  1PBD A;  2EQ7 A;  2UZZ A;  3NLC A;  2GEW A;  3QJ4 A;  3AEC A;  2E1M A;  4GCM A;  4XWZ A;  2V60 A;  2XLP A;  4OVI A;  3UKP A;  4J56 A;  2C7G A;  1JEH A;  2C67 A;  5JCL A;  3AED A;  1PJ7 A;  4U8O A;  3V3O A;  4EQX A;  1E1N A;  3CPH G;  3OC4 A;  1PBC A;  1BZL A;  4TM3 A;  1RYI A;  3QVR A;  2YG7 A;  2NPX A;  3GSI A;  3NH3 X;  2GV8 A;  5J60 A;  1NHP A;  2BYB A;  2R46 A;  4GAP A;  1CJC A;  1N4V A;  2WDR A;  2B9W A;  3DME A;  4HB9 A;  3ZYX A;  4B1B A;  3CNJ A;  2WHD A;  2Q0K A;  2WES A;  4NTC A;  4C3Y A;  3B6D A;  3DGZ A;  1S3B A;  2WP5 A;  4H4W A;  2C72 A;  2OA1 A;  4B66 A;  2XLS A;  2YG5 A;  3P4S A;  3AE2 A;  2AR8 A;  5EBK A;  3SYI A;  2VVL A;  2IVE A;  2QCU A;  4FX9 A;  5BVA A;  3NK0 X;  4YTP A;  3P1W A;  1ZKQ A;  4H50 A;  5M10 A;  4X9N A;  1CJ4 A;  1VG0 A;  3UP4 A;  2XFQ A;  3IWA A;  1ZDL A;  4GDP A;  3NGC X;  1NHS A;  3RP7 A;  2BC0 A;  4EQS A;  4AT0 A;  4B63 A;  1KNP A;  4B69 A;  3CGE A;  1KSS A;  2X8G A;  2WDV A;  1Q1R A;  4Z25 A;  1JNR A;  2GH5 A;  4FK1 A;  1Q9I A;  2V3A A;  2X50 A;  4H4U A;  3SX6 A;  3RP6 A;  2XFU A;  4LU6 A;  4GUV A;  1OJ9 A;  1GER A;  4OPI A;  2Z5Y A;  3D8X A;  2C73 A;  3AE7 A;  3V3N A;  1EL5 A;  2E5V A;  1VG9 A;  1DOB A;  2YWL A;  3BI4 A;  1DJN A;  3LOV A;  3Q6J A;  4JY3 A;  4H4S A;  1GV4 A;  1PHH A;  5M0Z A;  3E1T A;  1L9D A;  1X31 B;  5JCN A;  3EF6 A;  3QSS A;  1ZOV A;  3G5R A;  3R9U A;  2GR1 A;  4ADW A;  1O5W A;  4H4X A;  5KWF A;  2PHH A;  3VR8 A;  2OAM A;  1H86 A;  1MOK A;  5U1O A;  1GES A;  3ALM A;  2YR5 A;  2C3D A;  1GET A;  1NG4 A;  2X8C A;  1ZMC A;  3C96 A;  1D4D A;  2XVJ A;  1K0L A;  3AEB A;  2FJA A;  4A99 A;  3ITJ A;  5KOW A;  1KF6 A;  1ZMD A;  2R4E A;  1H7X A;  2Q6U A;  3V76 A;  1E6E A;  4J2W A;  4UDR A;  1NHR A;  4Z26 A;  3GMB A;  3NRN A;  1GND A;  1JRZ A;  1PXB A;  1PJ5 A;  2WP9 A;  1FOH A;  3QVP A;  1CHU A;  2R4J A;  2BCP A;  4ZN0 A;  3UOX A;  3CPI G;  3AYL A;  4H7U A;  3SZW A;  3VRD B;  1BWC A;  1PBF A;  1TDF A;  4WCT A;  3UCL A;  1PDH A;  4RG3 A;  4OPC A;  1N4W A;  2V3B A;  1KDG A;  3CGC A;  3AE5 A;  2VQ7 A;  1GRH A;  1IUW A;  3GWF A;  1TDE A;  3S5W A;  1JNZ A;  3KPK A;  3QSE A;  1HYU A;  4DSG A;  4U2L A;  2WEU A;  5ER0 A;  1S2Y A;  3AEE A;  3GRT A;  1LQU A;  3VQR A;  5L46 A;  4NEV A;  1F3P A;  4NEW A;  2XVH A;  2ZZB A;  4FK1 C;  5GSN A;  4B64 A;  3LXD A;  2YVF A;  4N9X A;  1S2Q A;  3ICR A;  1E1K A;  2O9Z A;  1LQT A;  1IJH A;  2XLR A;  2B9Y A;  3VRB A;  4NZH A;  2TMD A;  4B68 A;  5JCI A;  3VRA A;  1F8S A;  1FEA A;  5FS9 A;  4J57 A;  2WU2 A;  1ZK7 A;  3BNU A;  1CC2 A;  3LAD A;  4GDE A;  5C2T A;  1NEN A;  3C4A A;  4CBQ A;  2WOV A;  4H2N A;  2Q0L A;  1VQW A;  2IID A;  3FBS A;  3GYI A;  3K30 A;  4U8L A;  2XFN A;  4YSY A;  4YT0 A;  5U63 A;  4BK3 A;  2YG4 A;  5HYM A;  3UKF A;  4YSX A;  1ZX9 A;  4H4Z A;  1TDN A;  5EOW A;  1F8R A;  2ZBW A;  3LB8 A;  3HYV A;  3GD3 A;  3C4N A;  4OPL A;  4B65 A;  2WPE A;  4U2T A;  3S61 A;  3VR9 A;  3KD9 A;  3DJG X;  3NT6 A;  2JAE A;  1PXC A;  1GRG A;  4KX6 A;  1L9E A;  1LPF A;  4H4T A;  4I58 A;  2FJD A;  3UOV A;  1AOG A;  1YKJ A;  4II2 A;  2CFY A;  2XFO A;  4K22 A;  3KPF A;  2WOI A;  1D4C A;  3IC9 A;  5KVI A;  3NYF A;  4J34 A;  4UDQ A;  1W4X A;  3UOY A;  4Z2U A;  3AB1 A;  4IV9 A;  3SQP A;  4CNJ A;  1CL0 A;  4TM4 A;  4BV6 A;  3AYJ A;  1PN0 A;  4FDC B;  2X8H A;  1Q1W A;  2V5Z A;  2XYO A;  1VDC A;  4A79 A;  3AE1 A;  1DNC A;  2APG A;  3NHO X;  4Z2R A;  3EAN A;  3ICS A;  2BC1 A;  2PYX A;  3BHF A;  5HY5 A;  4Y4L A;  2GQF A;  4G74 A;  4U8J A;  3NTD A;  4U8I A;  1K0I A;  4K7Z A;  5U25 A;  2WS3 A;  5FS7 A;  4U8N A;  4EQR A;  3CNS A;  2OLN A;  2VVM A;  2V6O A;  3AXB A;  4J31 A;  3IF9 A;  2C65 A;  1M64 A;  2RAB A;  5IQ4 A;  2WOW A;  4G73 A;  3AE9 A;  2QAE A;  2GMJ A;  4BJZ A;  2FBW A;  4U8M A;  4YSZ A;  1GRT A;  1YQ3 A;  5JCM A;  4H4V A;  2JB2 A;  2XCG A;  3UKA A;  4JDR A;  1TYP A;  5KMR A;  3SXI A;  3LZW A;  4EQW A;  4AP3 A;  4MJW A;  4NTE A;  4GRT A;  5FS6 A;  2TPR A;  3ATR A;  3SZ0 A;  1H6V A;  2WPF A;  4J33 A;  4REK A;  1EL9 A;  2J3N A;  3UTE A;  2C70 A;  2YG3 A;  3BHK A;  1L0V A;  1OJD A;  1RSG A;  4A5L A;  3QFA A;  5IQ1 A;  2JB1 A;  3AEA A;  5BRT A;  3EPT A;  1RP0 A;  5FMH A;  2YLX A;  1BGJ A;  2Q7V A;  1XHC A;  2NVK X;  2H88 A;  5EB5 A;  3SFD A;  3GMC A;  1KNR A;  3DJD A;  3NIX A;  1XPQ A;  5J7X A;  5BUK A;  2R0C A;  3IHG A;  1GTH A;  3GD4 A;  1K4Q A;  3CGB A;  3GWD A;  4TLX A;  1PBE A;  3UP5 A;  4DNA A;  4G6G A;  4H4Q A;  1JRX A;  1JRY A;  5HHF A;  3QSM A;  3F8D A;  3KKJ A;  2BAB A;  2YM2 A;  3NYE A;  3GDN A;  3I6D A;  4D03 A;  3FMW A;  1YQZ A;  2C3C A;  3P4P A;  4CRT A;  1NG3 A;  4CCQ A;  4TM0 A;  4Y4M A;  3WE0 A;  3Q9T A;  1XAN A;  2FJB A;  2HQM A;  3DK4 A;  1H82 A;  3SFE A;  3DK9 A;  3KU9 A;  4OPU A;  3NK2 X;  2I0Z A;  1Z6L A;  2C66 A;  3L8K A;  3UKK A;  4G6H A;  1OJC A;  2R9Z A;  1L9C A;  3DA1 A;  1IUS A;  2YLT A;  1QLB A;  4JY2 A;  2F5Z A;  1VRQ B;  2YLW A;  2GAH B;  4O5Q A;  2WBA A;  1E39 A;  1LVL A;  1E1L A;  1P2E A;  3M13 A;  2RGJ A;  4X4J A;  1BF3 A;  4EM3 A;  3COX A;  3KLJ A;  4PAA A;  4RSL A;  3HYW A;  1COY A;  3QFB A;  2VRM A;  2XDO A;  3SZF A;  1PBB A;  4CNK A;  1GRB A;  2GB0 A;  2YG6 A;  1REO A;  2GR2 A;  4E0V A;  4Z43 A;  2BRA A;  3UOZ A;  2C64 A;  1CJ2 A;  3K7M X;  4KPR A;  4BUR A;  3ALJ A;  3AEG A;  3K7T A;  3L1R A;  4H2P A;  2R0G A;  4C74 A;  3F8R A;  1O95 A;  2EQ6 A;  2YLS A;  4H4R A;  4A6N B;  4CCR A;  1ONF A;  4LII A;  5BUL A;  2DKI A;  1GRA A;  2CUL A;  2Y6R A;  1TYT A;  2XFP A;  2C76 A;  2YM1 A;  3ADA B;  4A9W A;  4CY8 A;  4YXD A;  5KMP A;  4H4Y A;  3CNP A;  5KMS A;  2A89 A;  1ZP0 A;  2IVD A;  3JSK A;  3UTF A;  2GRT A;  1N4U A;  4LA1 A;  5JCK A;  1B4V A;  1OJT A;  4H2Q A;  2JBV A;  4BK2 A;  4YKF A;  2YLR A;  3AYI A;  4YTN A;  2A8X A;  2BXS A;  4Z2T A;  3BNM A;  1JOA A;  4H4P A;  2XVE A;  1EBD A;  3F8P A;  3PO7 A;  1Y56 B;  3AE4 A;  2RGH A;  2VOU A;  1P2H A;  1K0J A;  1H83 A;  2ZZ0 A;  3T0K A;  1CC6 A;  1XDI A;  5FS8 A;  3UKQ A;  2Y6Q A;  4Z44 A;  2VZ2 A;  4YKG A;  2B7S A;  1GAL A;  4USQ A;  1TDO A;  3SM8 A;  1NEK A;  3II4 A;  1V59 A;  2BK4 A;  1NDA A;  4EM4 A;  2XVI A;  5CKU A;  1QJD A;  4OCG A;  3KVE A;  5KOX A;  2WP6 A;  2XVF A;  3ISH A;  2E4G A;  1EL7 A;  3NN0 X;  5IPY A;  1GRE A;  1H84 A;  3CIR A;  5CQF A;  4UP3 A;  3ALL A;  2R45 A;  1YY5 A;  2WQY A;  5KMQ A;  2R0P A;  4D04 A;  3ABV A;  4NWZ A;  2BCG G;  2GF3 A;  3GYJ A;  4C3X A;  4EMJ A;  4NNJ A;  1KSU A;  4C77 A;  3FG2 P;  1GRF A;  2CVJ A;  2FJE A;  1CF3 A;  3CND A;  2H89 A;  4K5S A;  1EL8 A;  2GQW A;  3CPJ G;  3G5S A;  3KA7 A;  4O5U A;  4OPG A;  1BGN A;  1FL2 A;  2BS4 A;  4YSH A;  1IUT A;  2WPC A;  3CNT A;  3SY4 A;  1B8S A;  2B76 A;  5KXJ A;  4OPD A;  2BK3 A;  3NNE A;  3AE3 A;  4IVM B;  4YTM A;  3DJE A;  3GRS A;  4I59 A;  4AP1 A;  4H2R A;  1OJA A;  1QO8 A;  4K2X A;  1DXL A;  4B67 A;  3K7Q X;  3H4K A;  5EB4 A;  3NKS A;  1F8W A;  5DBJ A;  2QA1 A;  1LJ1 A;  1GSN A;  3BI2 A;  4APN A;  1GXF A;  4DGK A;  4EMW A;  1S3E A;  1M6I A;  2QA2 A;  4A6N A;  1MO9 A;  2DKH A;  3NN6 X;  4U8P A;  4XXG A;  2YVG A;  1FEC A;  3H8I A;  3H8L A;  3OZ2 A;  2JB3 A;  2X3N A;  3I3L A;  1DJQ A;  2RGO A;  2V61 A;  4WX1 A;  4ECH A;  1GT8 A;  2B9X A;  1NHQ A;  5KNL A;  1TDK A;  1GTE A;  3PS9 A;  2EQ9 A;  3RNM A;  1TRB A;  3AWI A;  2W0H A;  3NYC A;  3SGL A;  3EAO A;  4A7A A;  2GR3 A;  4AOS A;  4DSH A;  1MXT A;  4U2S A;  1PJ6 A;  2WU5 A;  1Y56 A;  2BS2 A;  2CDU A;  1ELI A;  3AD7 B;  3FIM B;  4CY6 A;  1CJ3 A;  3DK8 A;  4PAB A;  3GYX A;  2BK5 A;  1CBO A;  4J36 A;  3RED A;  4U8K A;  3T14 A;  4EIQ A;  4ICY A;  3UTH A;  1UKV G;  2WDQ A;  3DGH A;  5HXI A;  2X99 A;  1KFY A;  4GAV A;  3CN8 A;  4C5O A;  2YR4 A;  4USR A;  3RHA A;  1DOE A;  2GAG B;  2ZZC A;  4ZCC A;  1PS9 A;  2BRY A;  1GOS A;  3BI5 A;  4JNQ A;  2OAL A;  1D4E A;  2YR6 A;  1LV0 A;  4G9K A;  3B3R A;  1NPX A;  1YQ4 A;  2A87 A;  3AE6 A;  2YQU A;  4GF7 A;  3UTG A;  1IUU A;  2BA9 A;  3NK1 X;  4IVO B;  3CMM A;  4X9M A;  2XLU A;  2YAU A;  2ACZ A;  1ZOY A;  3T2K A;  3ZDN A;  3FPZ A;  2BXR A;  1H7W A;  4BK1 A;  1GPE A;  4JN9 A;  4TLZ A;  4EIP A;  1H81 A;  1B5Q A;  3URH A;  1SEZ A;  2EQ8 A;  1BKW A;  2GVC A;  3RP8 A;  3LZX A;  3T2Y A;  3M12 A;  2AAQ A;  3T2Z A;  5LV9 A;  1FEB A;  3AD9 B;  3AD8 B;  1NAA A;  4OPT A;  4Y4N A;  4K5R A;  4EMI A;  3G5Q A;  3T37 A;  4Z24 A;  3SZC A;  2VRL A;  3M0O A;  3CTY A;  5KVH A;  2ARD A;  5C3J A;  4TM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...