3ALLA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant y270a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
370
structure length
370
Chain Sequence
b'KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKAETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 128
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3allA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3allA01
3CGCA 1TYPA 3PS9A 2FBWA 2A87A 4ECHA 1GPEA 5IQ1A 1MO9A 3UOVA 1REOA 1CBOA 2BACA 2IVEA 3UTFA 2BS3A 4TLXA 2WBAA 5EOWA 1GV4A 1CJ3A 3ZYXA 2EQ8A 1CL0A 1DJNA 2WESA 1P2HA 2XFUA 1O5WA 2R46A 1CHUA 3M12A 1FEAA 1OJAA 4J2WA 2OLOA 2Q7VA 2UZZA 4UDPA 2AR8A 2WP5A 3IHGA 3UP5A 4GR1A 2Y6RA 3DK4A 3QSMA 1LV0A 2JKCA 2R0CA 3C4AA 3AE5A 1LTXR 4ZN0A 3KD9A 3NGCX 4U8IA 3CPJG 4AOSA 2GMHA 1MOKA 2BK5A 4REKA 4H4YA 3ABVA 3UOYA 1JOAA 2EQ6A 4BK3A 4EM3A 1DOBA 1JEHA 2V61A 4Z44A 3DGZA 3AYIA 5BRTA 1PHHA 3LZWA 1F8RA 3DJEA 2ZZ0A 3KKJA 3AE2A 5HHFA 1DODA 1F8SA 5ER0A 2V3BA 3CNTA 1KDGA 2EQ7A 3D8XA 4H4UA 3VQRA 2XVEA 3QSEA 5BVAA 1OJDA 2R0GA 2A8XA 1E1NA 3BNMA 4A99A 3CGEA 4FK1C 1ZMDA 2PHHA 4IA5A 4Z24A 1H81A 3K7TA 4JNQA 3F8PA 1MXTA 2R4EA 4NTCA 4CY8A 3ICTA 2DKHA 1L9CA 4CBQA 1Y0PA 1OJ9A 1GRGA 3UOZA 1E1KA 1CF3A 5L46A 3DJDA 4P9SA 5FS8A 3UOXA 1NPXA 3K7QX 2VQBA 2VRMA 2YG7A 3R9UA 3VR9A 2VQ7A 1IUUA 1PJ5A 1E6EA 1PBEA 2WETA 4AT0A 2YR6A 3P9UA 3GDPA 2BK4A 3V3OA 3LOVA 3VR8A 3ISHA 2PYXA 2ZBWA 3UKAA 4PABA 5BUKA 4A6NB 4JY3A 3AE1A 3BNUA 4OPGA 1NHRA 1TDEA 3BI2A 4U8OA 4XXGA 1W4XA 4O5QA 2XFNA 2WPCA 4A65A 1GRHA 3ALMA 3QVRA 1S2YA 1NG3A 2WOIA 4YKFA 4IA6A 2HQMA 5CQFA 4PAAA 2TMDA 2GAHB 3G5QA 1PBBA 1GESA 1N4VA 2JB1A 3NK2X 4H4SA 3UTHA 4EMIA 2QAEA 1E39A 2YLWA 1O95A 5KOWA 2WPEA 3RHAA 3ALLA 4K8DA 4GUVA 2JAEA 2XYOA 4JN9A 3UTEA 4Z2UA 3EF6A 1GRFA 2IIDA 1Z6LA 1OJTA 3G5SA 5DBJA 4JY2A 2GRTA 3GD4A 1JNZA 1H86A 3O0HA 3UTGA 4B65A 4Z43A 2YLZA 4YT0A 2H88A 5EB4A 1B4VA 1ZKQA 1FL2A 3P1WA 4B1BA 3CGDA 1E1LA 3RNMA 1RYIA 2WDRA 1Q1RA 3AE6A 2YAUA 2Q0KA 1YQ3A 2XVIA 3CTYA 4O5UA 3QVPA 3GSIA 2GR0A 4YTPA 2ACZA 4CRTA 1YKJA 4H4RA 5JCNA 5KOXA 3AE9A 1ONFA 1PXBA 4YSHA 3UKPA 2WQYA 5FS6A 4H2QA 2BK3A 3H8IA 1D4EA 3GD3A 5C3JA 2XFQA 3SFDA 5C2TA 2AQJA 2YG6A 1GERA 1NG4A 2C65A 2BC1A 5U63A 1KSUA 3CNDA 4EQSA 4MJWA 4TM1A 5J60A 3AEEA 4JNAA 4DGKA 2WOVA 1BKWA 1OJCA 4WX1A 1VDCA 2F5ZA 3UCLA 3GYIA 1PBFA 3CPIG 5FMHA 4Y4LA 3NT6A 1QJDA 2XVFA 5M0ZA 3GMBA 4B68A 4FX9A 1GSNA 2C3DA 1VG9A 4FDCB 1H83A 1TDFA 3DMEA 1HYUA 3QJ4A 1JU2A 3NHOX 2YG4A 4YSXA 2YG3A 3PVCA 1X31B 2YVJA 1DOEA 3KVEA 4USRA 1D7YA 1FOHA 2NPXA 4Z25A 4B63A 4YTNA 3AD7B 2WOWA 1CJ4A 2YLTA 4E0VA 4B69A 4OPIA 3NYFA 1NEKA 3RP8A 4Z2RA 4B66A 4BURA 2QA1A 3D1CA 1F8WA 4EMWA 4K2XA 4ADWA 2C3CA 4H4TA 4YSYA 2WU5A 2I0ZA 4GDEA 3EAOA 3ICSA 1PBCA 3AXBA 1K0JA 2W0HA 4GCMA 5U25A 2BCPA 4BK1A 1KF6A 4OPCA 2CULA 3F8DA 1O94A 4EM4A 1Y56A 3FIMB 5EBKA 3AB1A 4TM3A 3LADA 2OALA 2XLRA 3FPZA 4C5OA 2XLTA 1S3EA 1ZMCA 4NZHA 2XVHA 2XVJA 2E4GA 2VZ2A 2BXSA 2C66A 5KXJA 4ZCCA 4YWOA 1IUTA 4NTDA 3AE4A 5IQ4A 2E1MA 5KVHA 1PS9A 3HZLA 5EB5A 3AE3A 2GV8A 4GRTA 1GETA 3T37A 5HYMA 2TPRA 4OPLA 1IJHA 2GR2A 4K5SA 2JB3A 3P4QA 2FJBA 3K30A 2H89A 4UDQA 2WDVA 3AD8B 1KNRA 4GF7A 1PJ6A 1XHCA 2OAMA 1JNRA 3KPFA 3LXDA 2CVJA 1KNPA 3NTAA 4FK1A 1TYTA 3I6DA 1S3BA 1IUXA 1H6VA 1H84A 2XDOA 5GRTA 2NVKX 1EL5A 2GH5A 1GRBA 2VRLA 1BZLA 1N1PA 3CNSA 2BABA 3IF9A 4KPRA 2V6OA 4X4JA 2WU2A 4TM4A 3G5RA 4U2SA 3I3LA 1B5QA 3NYEA 5M10A 1EBDA 1ZP0A 2YVFA 3FBSA 2GVCA 1N4UA 2JK6A 3KA7A 5JCIA 5JCKA 4EQRA 4C74A 2Q0LA 2FJDA 4OPUA 4X9NA 3SM8A 4OPTA 4U2TA 2B9XA 4J36A 2YR4A 4UP3A 3AEGA 2XLSA 1FECA 4H4XA 4C3XA 3SGLA 4IVMB 3ICRA 1K4QA 4EQXA 2WEUA 1XDIA 2X8GA 3ATRA 1GREA 5LV9A 4U8JA 2C72A 2ARDA 1PXAA 2BYBA 3NNEA 5BULA 2APGA 2V60A 5HXIA 1F6MA 2J3NA 2DKIA 2EQ9A 1KSSA 2BXRA 1B37A 2BS2A 2C70A 4IV9A 4CNKA 5IPYA 1ZX9A 3BHFA 4HA6A 3BI4A 3ADAB 3C4NA 4H4QA 4TLZA 5KVIA 1H82A 3P4PA 4APNA 1VRQB 2A89A 3NN6X 4H4WA 1M64A 1GRTA 3CIRA 3V3NA 1BF3A 1GOSA 3KU9A 1PBDA 2QA2A 1SEZA 1K0LA 4A9WA 3P4SA 3H8LA 2GAGB 3UKFA 3II4A 3NLCA 4GDPA 4USQA 5FS9A 2FJEA 2RGOA 1ELIA 2YR5A 1ZDLA 4UDRA 4XWZA 1L0VA 3AD9B 1NHQA 1VG0A 1IUWA 1P2EA 3DGHA 1CC4A 3UP4A 2Y6QA 4K7ZA 4NEWA 3SFEA 1QO8A 2WDQA 1XPQA 3LZXA 2FJAA 2BA9A 4J56A 4A6NA 2YM1A 4X9MA 2JB2A 4A79A 2CFYA 1DXLA 2RGHA 3L8KA 4H50A 4BV6A 2YLRA 3S61A 1TDKA 2WP6A 1RSGA 1PDHA 2ZZBA 1Q9IA 3AYJA 2Q6UA 5FS7A 3RP6A 3GWFA 3UKQA 1UKVG 3IHMA 2RABA 4EIPA 1XANA 4A5LA 4CY6A 3DK8A 4H2PA 2O9ZA 4AT2A 1JRZA 4ZCDA 3JSKA 3F8RA 3EPTA 3Q9TA 4IVOB 4BK2A 1H7XA 1ZOYA 1EL8A 3CPHG 4U8NA 3V76A 2OA1A 5JCMA 2GF3A 1CJCA 3URHA 1E1MA 2C7GA 1GALA 3DJGX 1FEBA 3Q6JA 4YKGA 4YSZA 5JCLA 2OLNA 3AE8A 3IC9A 4YXDA 1BGJA 3IWAA 4D04A 2C67A 2BC0A 2XFOA 4C3YA 3OZ2A 1D5TA 3E1TA 4ICYA 4H2NA 3NTDA 4JDRA 1GT8A 1GRAA 4H4ZA 2X8HA 2X99A 1F3PA 2WP9A 2XFPA 4OPDA 1JRXA 3NG7X 4Y4MA 1TDNA 4BJYA 5HY5A 3WE0A 4Z26A 1L9EA 1L9DA 2C76A 4M52A 1COYA 1B8SA 2C64A 4CNJA 3AE7A 2YWLA 3GWDA 2BCGG 3SQPA 4CCRA 3DK9A 4BJZA 3FMWA 1CJ2A 1GNDA 1LQUA 2GEWA 2B7RA 3NK1X 4H4PA 4HB9A 2C73A 3NKSA 2YLXA 1N4WA 4RSLA 4K22A 2B7SA 4U8KA 5TR3A 2CDUA 1CC2A 3B3RA 2E5VA 4A7AA 2XLUA 3REDA 2X3NA 3EANA 1IUSA 1VQWA 2XCGA 4C77A 4U8MA 2YM2A 2XLPA 3NYCA 1GXFA 3ITJA 4RG4A 4NEVA 5GSNA 3AEAA 2GQWA 2ZZCA 3P4RA 4B67A 4AOXA 1ZK7A 1K0IA 3GRTA 3GMCA 3C96A 3AEDA 3CNPA 3CN8A 1PN0A 2GMJA 1LJ1A 2VVLG 3COXA 1ZY8A 3AWIA 1D4DA 2B9WA 1BWCA 1CC6A 1DNCA 1LVLA 2R45A 3KLJA 2B9YA 2VVLA 4H7UA 3VRBA 3B6DA 2BS4A 4EQWA 1S2QA 2GQFA 3GDNA 2GR3A 3NK0X 2YVGA 1LQTA 3AEFA 3NN0X 1D4CA 1ZOVA 2JBVA 3NIXA 1FCDA 3S5WA 1YQ4A 2Z5YA 4N9XA 1LPFA 3ALJA 1NENA 3DA1A 4WCTA 3H4KA 4LIIA 4D03A 1AOGA 2WHDA 3M0OA 3VRAA 3AYLA 4I59A 4AP1A 2V3AA 1PXCA 3AEBA 2RGJA 3ATQA 4J57A 5KRQA 3OC4A 3UKHA 1E7PA 3ZDNA 3NH3X 2AAQA 4KX6A 2YG5A 3DH9A 2VOUA 4J33A 1V59A 4H4VA 2V5ZA 4Z2TA 1RP0A 3QFAA 1D7LA 4U2LA 4OVIA 3VRDB 2GR1A 1GTHA 4EIQA 1NAAA 4OCGA 1KFYA 1EL7A 1YQZA 3QFBA 4CCQA 1TRBA 2R9ZA 4J31A 2YLSA 1NHSA 4K5RA 2X8CA 3BI5A 1TDOA 3AECA 3L1RA 4JQ9A 2B76A 3RP7A 1DOCA 5KWFA 4LU6A 2QCUA 1DJQA 1GTEA 3CNJA 4Y4NA 2IVDA 4DNAA 2VVMA 1BGNA 3UKKA 2Z5XA 4B64A 5CKUA 3GRSA 4U8PA 1M6IA 1GEUA 4I58A 1YY5A 4H2RA 1PJ7A 3LB8A 1QLBA 3DJJA 4NTEA 3M13A 4YTMA 1EL9A 4J34A 3CGBA 4EMJA 3NRNA 4DSGA 1JRYA 3UKLA 4DSHA 1NDAA 1IUVA 4LA1A 5U1OA 1Q1WA 4AP3A 4XWRA 4RG3A 4U8LA 2R0PA 3BHKA 2GB0A 3PO7A 2C75A 4TM0A 2WS3A 3QSSA 1Y56B 3LJPA 2R4JA 5J7XA 2YQUA 3K7MX 1NHPA 2X50A 3FG2P 3GYJA 2WPFA 1H7WA
chains in the Genus database with same CATH superfamily
3CGCA 1TYPA 3PS9A 2FBWA 2A87A 4ECHA 1GPEA 5IQ1A 1MO9A 3UOVA 1REOA 1CBOA 2BACA 2IVEA 3UTFA 2BS3A 4TLXA 2WBAA 5EOWA 1GV4A 1CJ3A 3ZYXA 2EQ8A 1CL0A 5KNLA 1DJNA 2WESA 1P2HA 2XFUA 1O5WA 2R46A 3M12A 1CHUA 1FEAA 1OJAA 4J2WA 2OLOA 2Q7VA 2UZZA 4UDPA 2AR8A 2WP5A 3IHGA 3UP5A 4GR1A 2Y6RA 4YJGA 3DK4A 3QSMA 1LV0A 2JKCA 2R0CA 3C4AA 3AE5A 1LTXR 4ZN0A 3SZ0A 3KD9A 3NGCX 4U8IA 3CPJG 4AOSA 2GMHA 1MOKA 2BK5A 4REKA 4H4YA 3ABVA 3UOYA 1JOAA 2EQ6A 4BK3A 4EM3A 1DOBA 1JEHA 2V61A 4Z44A 3DGZA 3AYIA 5BRTA 3T31A 1PHHA 3LZWA 1F8RA 3DJEA 2ZZ0A 3KKJA 3AE2A 5HHFA 1DODA 1F8SA 5ER0A 2V3BA 3CNTA 1KDGA 2EQ7A 3VQRA 3D8XA 4H4UA 2XVEA 3QSEA 5BVAA 1OJDA 4NNJA 2R0GA 2A8XA 1E1NA 3BNMA 4A99A 3CGEA 4IA5A 2PHHA 1ZMDA 4FK1C 3HYVA 4Z24A 1H81A 3K7TA 4JNQA 3F8PA 1MXTA 2R4EA 4NTCA 2E48A 4YJFB 4CY8A 3ICTA 2DKHA 1L9CA 4CBQA 1Y0PA 1OJ9A 1GRGA 3UOZA 1E1KA 1CF3A 5L46A 3DJDA 4P9SA 5FS8A 3UOXA 1NPXA 3K7QX 2VQBA 2VRMA 2YG7A 3R9UA 3VR9A 2VQ7A 1IUUA 1PJ5A 1PBEA 1E6EA 2WETA 4AT0A 2YR6A 3P9UA 3GDPA 2BK4A 3V3OA 3LOVA 3VR8A 3ISHA 2PYXA 3SYIA 2ZBWA 3UKAA 4PABA 5BUKA 4A6NB 4JY3A 3AE1A 3BNUA 4OPGA 1NHRA 1TDEA 3BI2A 4U8OA 4XXGA 1W4XA 4O5QA 2E4AA 2XFNA 1KIFA 2WPCA 4A65A 1GRHA 3ALMA 3QVRA 1S2YA 1NG3A 2WOIA 4YKFA 4IA6A 2HQMA 5CQFA 4PAAA 2TMDA 2GAHB 3G5QA 1PBBA 1GESA 1N4VA 2JB1A 3NK2X 4H4SA 3UTHA 4EMIA 2QAEA 1E39A 2YLWA 1O95A 5KOWA 2WPEA 3RHAA 3ALLA 4K8DA 4GUVA 2JAEA 2XYOA 4JN9A 3KPKA 3UTEA 4Z2UA 3EF6A 1GRFA 2IIDA 1Z6LA 1OJTA 3G5SA 5DBJA 4JY2A 2GRTA 3GD4A 1JNZA 1H86A 3O0HA 4II2A 3UTGA 4B65A 4Z43A 2YLZA 4YT0A 2H88A 5EB4A 1B4VA 1ZKQA 1FL2A 3P1WA 4B1BA 3CGDA 1E1LA 3RNMA 4G74A 1RYIA 2WDRA 1Q1RA 3AE6A 2YAUA 2Q0KA 5KMSA 1YQ3A 2XVIA 3CTYA 4O5UA 3QVPA 3GSIA 2GR0A 4YTPA 2ACZA 4CRTA 1YKJA 4H4RA 5JCNA 5KOXA 3AE9A 4QFDA 1ONFA 1PXBA 4YSHA 3UKPA 2WQYA 5FS6A 4H2QA 2BK3A 3H8IA 1D4EA 3GD3A 5C3JA 2XFQA 3SFDA 5C2TA 4YJHB 2AQJA 2YG6A 1GERA 4GAVA 1NG4A 2C65A 2BC1A 3ZNQA 3NTAA 5U63A 1KSUA 3CNDA 4EQSA 4MJWA 4TM1A 5J60A 3AEEA 4JNAA 4DGKA 2WOVA 1BKWA 1OJCA 4G73A 4WX1A 1VDCA 2F5ZA 3UCLA 3GYIA 1PBFA 3CPIG 5FMHA 4Y4LA 3NT6A 1QJDA 2XVFA 5M0ZA 3GMBA 4B68A 4FX9A 1C0LA 1GSNA 1VG9A 2C3DA 4FDCB 1H83A 3DMEA 1TDFA 1HYUA 1C0PA 1JU2A 3NHOX 2YG4A 3QJ4A 4YSXA 2YG3A 3PVCA 1X31B 2YVJA 1DOEA 3KVEA 4USRA 1FOHA 1D7YA 2NPXA 4Z25A 4B63A 4YTNA 3AD7B 2WOWA 1CJ4A 2YLTA 4E0VA 4B69A 4OPIA 3NYFA 3RP8A 1NEKA 4Z2RA 4B66A 4BURA 2QA1A 3D1CA 1F8WA 4EMWA 4K2XA 4ADWA 2C3CA 4H4TA 4YSYA 2WU5A 2I0ZA 4GDEA 3EAOA 3ICSA 1PBCA 3AXBA 1K0JA 2W0HA 4GCMA 5U25A 4BK1A 2BCPA 1EVIA 1KF6A 4OPCA 2CULA 3F8DA 1O94A 4EM4A 1Y56A 3FIMB 5EBKA 3AB1A 4TM3A 3LADA 4GAPA 2OALA 2XLRA 3FPZA 4C5OA 2XLTA 1S3EA 1ZMCA 4NZHA 2XVHA 2XVJA 2E4GA 2VZ2A 2BXSA 2C66A 5KXJA 4ZCCA 4YWOA 1IUTA 4NTDA 3AE4A 5IQ4A 2E1MA 5KVHA 3HZLA 1PS9A 5EB5A 3AE3A 2GV8A 4GRTA 1GETA 4II3A 5HYMA 3T37A 2TPRA 4OPLA 1IJHA 2GR2A 4K5SA 3W4KA 2JB3A 3P4QA 5KMRA 4G6GA 2FJBA 3K30A 2H89A 4UDQA 3AD8B 2WDVA 1KNRA 3T2YA 1PJ6A 4GF7A 3ZNOA 1XHCA 1JNRA 2OAMA 3CMMA 2CVJA 1KNPA 3KPFA 3LXDA 4FK1A 1TYTA 3SZFA 3I6DA 1S3BA 1IUXA 1H6VA 1H84A 2XDOA 5GRTA 2NVKX 1EL5A 2GH5A 1GRBA 2VRLA 3IF9A 1BZLA 1N1PA 2BABA 1DAOA 3W4IA 2V6OA 3CNSA 4KPRA 4X4JA 1C0KA 2WU2A 4TM4A 3G5RA 4U2SA 3I3LA 1B5QA 3NYEA 5M10A 1EBDA 1ZP0A 2YVFA 3FBSA 2GVCA 1N4UA 2JK6A 3KA7A 5JCIA 5JCKA 4G9KA 4EQRA 4C74A 2Q0LA 2FJDA 4OPUA 4X9NA 3SM8A 4NWZA 4OPTA 4U2TA 2B9XA 4J36A 2YR4A 4UP3A 3AEGA 2XLSA 1FECA 4H4XA 4C3XA 3SGLA 4IVMB 3ICRA 5KMQA 1K4QA 4EQXA 2WEUA 1XDIA 2X8GA 3ATRA 1GREA 5LV9A 4U8JA 2C72A 2ARDA 1PXAA 2BYBA 3NNEA 3ZNPA 5BULA 2APGA 2V60A 5HXIA 3SZWA 1F6MA 2J3NA 2DKIA 2EQ9A 1KSSA 2BXRA 1B37A 2BS2A 2C70A 4IV9A 4CNKA 5IPYA 1ZX9A 3SZCA 3BHFA 4HA6A 3C4NA 3ADAB 3BI4A 4H4QA 4TLZA 5KVIA 1H82A 3P4PA 4APNA 1VRQB 2A89A 4YJFA 1C0IA 3NN6X 1M64A 4H4WA 1GRTA 3CIRA 3V3NA 1BF3A 1GOSA 3KU9A 1PBDA 2QA2A 1SEZA 1K0LA 4A9WA 3P4SA 3H8LA 2GAGB 3T14A 3UKFA 3II4A 3NLCA 4GDPA 4USQA 5FS9A 2FJEA 2RGOA 1ELIA 2YR5A 1ZDLA 4UDRA 4XWZA 1L0VA 3AD9B 1NHQA 4YJGB 1IUWA 1P2EA 1VG0A 1CC4A 3DGHA 3UP4A 2Y6QA 4K7ZA 4NEWA 3SFEA 2DU8A 1QO8A 2WDQA 1XPQA 3LZXA 2FJAA 2BA9A 4J56A 4A6NA 4X9MA 2YM1A 2JB2A 4A79A 2CFYA 1DXLA 2RGHA 3L8KA 4H50A 4BV6A 2YLRA 3S61A 1TDKA 2WP6A 1RSGA 1PDHA 2ZZBA 1Q9IA 3AYJA 2Q6UA 3RP6A 5FS7A 3GWFA 3UKQA 1UKVG 3IHMA 2RABA 4EIPA 1XANA 4A5LA 4CY6A 3DK8A 4H2PA 2O9ZA 4AT2A 1JRZA 4ZCDA 3JSKA 3F8RA 3EPTA 3Q9TA 4BK2A 4IVOB 1H7XA 1ZOYA 1EL8A 3CPHG 4U8NA 3V76A 2OA1A 5JCMA 2GF3A 1CJCA 3URHA 1E1MA 2C7GA 1GALA 3DJGX 1FEBA 3Q6JA 4YKGA 4YSZA 5JCLA 2OLNA 3AE8A 3IC9A 4YXDA 1BGJA 3IWAA 4D04A 2C67A 2BC0A 2XFOA 4C3YA 3G3EA 3OZ2A 1D5TA 3E1TA 4ICYA 4H2NA 3NTDA 4JDRA 1GT8A 1GRAA 4H4ZA 2X8HA 2X99A 1F3PA 4BJYA 2WP9A 2XFPA 1JRXA 3NG7X 4OPDA 1TDNA 4Y4MA 5HY5A 3WE0A 4Z26A 1L9EA 3SXIA 1L9DA 2C76A 4M52A 1COYA 1B8SA 4QFCA 2C64A 3GYXA 4CNJA 3AE7A 2YWLA 3GWDA 2BCGG 3SQPA 4CCRA 3CUKA 4BJZA 3DK9A 3FMWA 1CJ2A 2E82A 4YJHA 1GNDA 1LQUA 2GEWA 2B7RA 3NK1X 1AN9A 4H4PA 4HB9A 2C73A 3NKSA 2YLXA 1N4WA 4RSLA 1DDOA 4K22A 2B7SA 4U8KA 5TR3A 2CDUA 1CC2A 3B3RA 2E5VA 4A7AA 2XLUA 3REDA 2X3NA 3EANA 1IUSA 1VQWA 2XCGA 4C77A 4U8MA 2YM2A 2XLPA 3NYCA 1GXFA 3T0KA 3ITJA 4RG4A 4NEVA 5GSNA 5KMPA 3AEAA 2GQWA 2ZZCA 3P4RA 4B67A 4AOXA 3WGTA 1ZK7A 1K0IA 3GRTA 3GMCA 3C96A 3AEDA 3CNPA 3CN8A 4G6HA 1PN0A 3ZNNA 2GMJA 1LJ1A 2C4CA 2VVLG 3COXA 3AWIA 1ZY8A 1D4DA 2R45A 1CC6A 1BWCA 1DNCA 1LVLA 2B9WA 3KLJA 2B9YA 2VVLA 4H7UA 3VRBA 3B6DA 2BS4A 4EQWA 1S2QA 2GQFA 3GDNA 2GR3A 3NK0X 2YVGA 1LQTA 3AEFA 4YJDA 3NN0X 1D4CA 1ZOVA 2JBVA 3NIXA 1FCDA 3S5WA 1YQ4A 2Z5YA 4N9XA 1LPFA 3T2ZA 3ALJA 3DA1A 4WCTA 1NENA 3H4KA 4LIIA 4D03A 1AOGA 3M0OA 2WHDA 3VRAA 3AYLA 4I59A 4AP1A 2V3AA 1PXCA 3AEBA 2RGJA 3ATQA 4J57A 2E49A 5KRQA 3OC4A 3UKHA 1E7PA 3ZDNA 3NH3X 2AAQA 4KX6A 2YG5A 3DH9A 2VOUA 4J33A 1V59A 4H4VA 2V5ZA 4Z2TA 1RP0A 3QFAA 1D7LA 4U2LA 4OVIA 3VRDB 2GR1A 1GTHA 4EIQA 1NAAA 4OCGA 1KFYA 1EL7A 1YQZA 3QFBA 4CCQA 1TRBA 3SY4A 2R9ZA 4J31A 2YLSA 1NHSA 4K5RA 3HYWA 2X8CA 3BI5A 1TDOA 3AECA 3L1RA 4JQ9A 2B76A 3RP7A 1DOCA 5KWFA 4LU6A 2QCUA 1DJQA 1GTEA 3CNJA 4Y4NA 2IVDA 4DNAA 2VVMA 1BGNA 2BRYA 3W4JA 2BRAA 3UKKA 2Z5XA 4B64A 5CKUA 3GRSA 4U8PA 1M6IA 1GEUA 4I58A 1YY5A 4H2RA 1PJ7A 3LB8A 1QLBA 3DJJA 4NTEA 3M13A 4YTMA 1EL9A 4J34A 3CGBA 4EMJA 3NRNA 3T2KA 4DSGA 1JRYA 3UKLA 4DSHA 1NDAA 1IUVA 4LA1A 5U1OA 1Q1WA 4AP3A 4XWRA 4RG3A 4U8LA 2R0PA 3BHKA 2GB0A 3PO7A 2C75A 4TM0A 2WS3A 3QSSA 3HYXA 1Y56B 3LJPA 2R4JA 5J7XA 3SX6A 1VE9A 2YQUA 3K7MX 1NHPA 2X50A 3FG2P 3GYJA 2WPFA 1H7WA
chains in the Genus database with same CATH topology
3CGCA 1TYPA 3PS9A 2FBWA 2A87A 4ECHA 1GPEA 5IQ1A 1MO9A 3UOVA 1REOA 1CBOA 2BACA 2IVEA 3UTFA 2BS3A 4TLXA 2WBAA 5EOWA 1GV4A 1CJ3A 3ZYXA 2EQ8A 1CL0A 5KNLA 1DJNA 2WESA 1P2HA 2XFUA 1O5WA 2R46A 1CHUA 3M12A 1FEAA 1OJAA 4J2WA 2OLOA 2Q7VA 2UZZA 4UDPA 2AR8A 2WP5A 3IHGA 3UP5A 4GR1A 2Y6RA 3DK4A 3QSMA 1LV0A 2JKCA 2R0CA 3C4AA 3AE5A 1LTXR 4ZN0A 3SZ0A 3KD9A 3NGCX 4U8IA 3CPJG 4AOSA 2GMHA 1MOKA 2BK5A 4REKA 4H4YA 3ABVA 3UOYA 1JOAA 2EQ6A 4BK3A 4EM3A 1DOBA 1JEHA 2V61A 4Z44A 3DGZA 3AYIA 5BRTA 3T31A 1PHHA 3LZWA 1F8RA 3DJEA 2ZZ0A 3KKJA 3AE2A 5HHFA 1DODA 1F8SA 5ER0A 2V3BA 3CNTA 1KDGA 2EQ7A 3D8XA 4H4UA 3VQRA 2XVEA 3QSEA 5BVAA 1OJDA 4NNJA 2R0GA 2A8XA 1E1NA 3BNMA 4A99A 3CGEA 4IA5A 1ZMDA 2PHHA 4FK1C 3HYVA 4Z24A 1H81A 3K7TA 4JNQA 3F8PA 1MXTA 2R4EA 4NTCA 4CY8A 3ICTA 2DKHA 1L9CA 4CBQA 1Y0PA 1OJ9A 1GRGA 3UOZA 1E1KA 1CF3A 5L46A 3DJDA 4P9SA 5FS8A 3UOXA 1NPXA 3K7QX 2VQBA 2VRMA 2YG7A 3R9UA 3VR9A 2VQ7A 1IUUA 1PJ5A 1E6EA 1PBEA 2WETA 4AT0A 2YR6A 3P9UA 3GDPA 2BK4A 3V3OA 3LOVA 3VR8A 3ISHA 2PYXA 3SYIA 2ZBWA 3UKAA 4PABA 5BUKA 4A6NB 4JY3A 3AE1A 3BNUA 4OPGA 1NHRA 1TDEA 3BI2A 4U8OA 4XXGA 1W4XA 4O5QA 2XFNA 2WPCA 4A65A 1GRHA 3ALMA 3QVRA 1S2YA 1NG3A 2WOIA 4YKFA 4IA6A 2HQMA 5CQFA 4PAAA 2TMDA 2GAHB 3G5QA 1PBBA 1GESA 1N4VA 2JB1A 3NK2X 4H4SA 3UTHA 4EMIA 2QAEA 1E39A 2YLWA 1O95A 5KOWA 2WPEA 3RHAA 3ALLA 4K8DA 4GUVA 2JAEA 2XYOA 4JN9A 3KPKA 3UTEA 4Z2UA 3EF6A 1GRFA 2IIDA 1Z6LA 1OJTA 3G5SA 5DBJA 4JY2A 2GRTA 3GD4A 1JNZA 1H86A 3O0HA 4II2A 3UTGA 4B65A 4Z43A 2YLZA 4YT0A 2H88A 5EB4A 1B4VA 1ZKQA 1FL2A 3P1WA 4B1BA 3CGDA 1E1LA 3RNMA 4G74A 1RYIA 2WDRA 1Q1RA 3AE6A 2YAUA 2Q0KA 5KMSA 1YQ3A 2XVIA 3CTYA 4O5UA 3QVPA 3GSIA 2GR0A 4YTPA 2ACZA 4CRTA 1YKJA 4H4RA 5JCNA 5KOXA 3AE9A 1ONFA 1PXBA 4YSHA 3UKPA 2WQYA 5FS6A 4H2QA 2BK3A 3H8IA 1D4EA 3GD3A 5C3JA 2XFQA 3SFDA 5C2TA 2AQJA 2YG6A 1GERA 4GAVA 1NG4A 2C65A 2BC1A 5U63A 1KSUA 3CNDA 4EQSA 4MJWA 4TM1A 5J60A 3AEEA 4JNAA 4DGKA 2WOVA 1BKWA 1OJCA 4G73A 4WX1A 1VDCA 2F5ZA 3UCLA 3GYIA 1PBFA 3CPIG 5FMHA 4Y4LA 3NT6A 1QJDA 2XVFA 5M0ZA 3GMBA 4B68A 4FX9A 1GSNA 2C3DA 1VG9A 4FDCB 1H83A 1TDFA 3DMEA 1HYUA 3QJ4A 1JU2A 3NHOX 2YG4A 4YSXA 2YG3A 3PVCA 1X31B 2YVJA 1DOEA 3KVEA 4USRA 1D7YA 1FOHA 2NPXA 4Z25A 4B63A 4YTNA 3AD7B 2WOWA 1CJ4A 2YLTA 4E0VA 4B69A 4OPIA 3NYFA 3RP8A 1NEKA 4Z2RA 4B66A 4BURA 2QA1A 3D1CA 1F8WA 4EMWA 4K2XA 4ADWA 2C3CA 4H4TA 4YSYA 2WU5A 2I0ZA 4GDEA 3EAOA 3ICSA 1PBCA 3AXBA 1K0JA 2W0HA 4GCMA 5U25A 4BK1A 2BCPA 1KF6A 4OPCA 2CULA 3F8DA 1O94A 4EM4A 1Y56A 3FIMB 5EBKA 3AB1A 4TM3A 3LADA 4GAPA 2OALA 2XLRA 3FPZA 4C5OA 2XLTA 1S3EA 1ZMCA 4NZHA 2XVHA 2XVJA 2E4GA 2VZ2A 2BXSA 2C66A 5KXJA 4ZCCA 4YWOA 1IUTA 4NTDA 3AE4A 5IQ4A 2E1MA 5KVHA 1PS9A 3HZLA 5EB5A 3AE3A 2GV8A 4GRTA 1GETA 4II3A 5HYMA 3T37A 2TPRA 4OPLA 1IJHA 2GR2A 4K5SA 2JB3A 3P4QA 5KMRA 4G6GA 2FJBA 3K30A 2H89A 4UDQA 2WDVA 3AD8B 1KNRA 3T2YA 4GF7A 1PJ6A 1XHCA 2OAMA 1JNRA 3CMMA 3KPFA 2CVJA 1KNPA 3LXDA 3NTAA 4FK1A 1TYTA 3SZFA 3I6DA 1S3BA 1IUXA 1H6VA 1H84A 2XDOA 5GRTA 2NVKX 1EL5A 2GH5A 1GRBA 2VRLA 1BZLA 1N1PA 3CNSA 2BABA 3IF9A 4KPRA 2V6OA 4X4JA 2WU2A 4TM4A 3G5RA 4U2SA 3I3LA 1B5QA 3NYEA 5M10A 1EBDA 1ZP0A 2YVFA 3FBSA 2GVCA 1N4UA 2JK6A 3KA7A 5JCIA 5JCKA 4G9KA 4EQRA 4C74A 2Q0LA 2FJDA 4OPUA 4X9NA 3SM8A 4NWZA 4OPTA 4U2TA 2B9XA 4J36A 2YR4A 4UP3A 3AEGA 2XLSA 1FECA 4H4XA 4C3XA 3SGLA 4IVMB 3ICRA 5KMQA 1K4QA 4EQXA 2WEUA 1XDIA 2X8GA 3ATRA 1GREA 5LV9A 4U8JA 2C72A 2ARDA 1PXAA 2BYBA 3NNEA 5BULA 2APGA 2V60A 5HXIA 3SZWA 1F6MA 2J3NA 2DKIA 2EQ9A 1KSSA 2BXRA 1B37A 2BS2A 2C70A 4IV9A 4CNKA 5IPYA 1ZX9A 3SZCA 3BHFA 4HA6A 3BI4A 3ADAB 3C4NA 4H4QA 4TLZA 5KVIA 1H82A 3P4PA 4APNA 1VRQB 2A89A 3NN6X 4H4WA 1M64A 1GRTA 3CIRA 3V3NA 1BF3A 1GOSA 3KU9A 1PBDA 2QA2A 1SEZA 1K0LA 4A9WA 3P4SA 3H8LA 2GAGB 3T14A 3UKFA 3II4A 3NLCA 4GDPA 4USQA 5FS9A 2FJEA 2RGOA 1ELIA 2YR5A 1ZDLA 4UDRA 4XWZA 1L0VA 3AD9B 1NHQA 1VG0A 1IUWA 1P2EA 3DGHA 1CC4A 3UP4A 2Y6QA 4K7ZA 4NEWA 3SFEA 1QO8A 2WDQA 1XPQA 3LZXA 2FJAA 2BA9A 4J56A 4A6NA 2YM1A 4X9MA 2JB2A 4A79A 2CFYA 1DXLA 2RGHA 3L8KA 4H50A 4BV6A 2YLRA 3S61A 1TDKA 2WP6A 1RSGA 1PDHA 2ZZBA 1Q9IA 3AYJA 2Q6UA 3RP6A 5FS7A 3GWFA 3UKQA 1UKVG 3IHMA 2RABA 4EIPA 1XANA 4A5LA 4CY6A 3DK8A 4H2PA 2O9ZA 4AT2A 1JRZA 4ZCDA 3JSKA 3F8RA 3EPTA 3Q9TA 4BK2A 4IVOB 1H7XA 1ZOYA 1EL8A 3CPHG 4U8NA 3V76A 2OA1A 5JCMA 2GF3A 1CJCA 3URHA 1E1MA 2C7GA 1GALA 3DJGX 1FEBA 3Q6JA 4YKGA 4YSZA 5JCLA 2OLNA 3AE8A 3IC9A 4YXDA 1BGJA 3IWAA 4D04A 2C67A 2BC0A 2XFOA 4C3YA 3OZ2A 1D5TA 3E1TA 4ICYA 4H2NA 3NTDA 4JDRA 1GT8A 1GRAA 4H4ZA 2X8HA 2X99A 1F3PA 4BJYA 2WP9A 2XFPA 1JRXA 3NG7X 4OPDA 1TDNA 4Y4MA 5HY5A 3WE0A 4Z26A 1L9EA 3SXIA 1L9DA 2C76A 4M52A 1COYA 1B8SA 2C64A 3GYXA 4CNJA 3AE7A 2YWLA 3GWDA 2BCGG 3SQPA 4CCRA 4BJZA 3DK9A 3FMWA 1CJ2A 1GNDA 1LQUA 2GEWA 2B7RA 3NK1X 4H4PA 4HB9A 2C73A 3NKSA 2YLXA 1N4WA 4RSLA 4K22A 2B7SA 4U8KA 5TR3A 2CDUA 1CC2A 3B3RA 2E5VA 4A7AA 2XLUA 3REDA 2X3NA 3EANA 1IUSA 1VQWA 2XCGA 4C77A 4U8MA 2YM2A 2XLPA 3NYCA 1GXFA 3T0KA 3ITJA 4RG4A 4NEVA 5GSNA 5KMPA 3AEAA 2GQWA 2ZZCA 3P4RA 4B67A 4AOXA 1ZK7A 1K0IA 3GRTA 3GMCA 3C96A 3AEDA 3CNPA 3CN8A 4G6HA 1PN0A 2GMJA 1LJ1A 2C4CA 2VVLG 3COXA 1ZY8A 3AWIA 1D4DA 2B9WA 1BWCA 1CC6A 1DNCA 1LVLA 2R45A 3KLJA 2B9YA 2VVLA 4H7UA 3VRBA 3B6DA 2BS4A 4EQWA 1S2QA 2GQFA 3GDNA 2GR3A 3NK0X 2YVGA 1LQTA 3AEFA 3NN0X 1D4CA 1ZOVA 2JBVA 3NIXA 1FCDA 3S5WA 1YQ4A 2Z5YA 4N9XA 1LPFA 3T2ZA 3ALJA 1NENA 3DA1A 4WCTA 3H4KA 4LIIA 4D03A 1AOGA 2WHDA 3M0OA 3VRAA 3AYLA 4I59A 4AP1A 2V3AA 1PXCA 3AEBA 2RGJA 3ATQA 4J57A 5KRQA 3OC4A 3UKHA 1E7PA 3ZDNA 3NH3X 2AAQA 4KX6A 2YG5A 3DH9A 2VOUA 4J33A 1V59A 4H4VA 2V5ZA 4Z2TA 1RP0A 3QFAA 1D7LA 4U2LA 4OVIA 3VRDB 2GR1A 1GTHA 4EIQA 1NAAA 4OCGA 1KFYA 1EL7A 1YQZA 3QFBA 4CCQA 1TRBA 3SY4A 2R9ZA 4J31A 2YLSA 1NHSA 4K5RA 3HYWA 2X8CA 3BI5A 1TDOA 3AECA 3L1RA 4JQ9A 2B76A 3RP7A 1DOCA 5KWFA 4LU6A 2QCUA 1DJQA 1GTEA 3CNJA 4Y4NA 2IVDA 4DNAA 2VVMA 1BGNA 2BRYA 2BRAA 3UKKA 2Z5XA 4B64A 5CKUA 3GRSA 4U8PA 1M6IA 1GEUA 4I58A 1YY5A 4H2RA 1PJ7A 3LB8A 1QLBA 3DJJA 4NTEA 3M13A 4YTMA 1EL9A 4J34A 3CGBA 4EMJA 3NRNA 3T2KA 4DSGA 1JRYA 3UKLA 4DSHA 1NDAA 1IUVA 4LA1A 5U1OA 1Q1WA 4AP3A 4XWRA 4RG3A 4U8LA 2R0PA 3BHKA 2GB0A 3PO7A 2C75A 4TM0A 2WS3A 3QSSA 3HYXA 1Y56B 3LJPA 2R4JA 5J7XA 3SX6A 2YQUA 3K7MX 1NHPA 2X50A 3FG2P 3GYJA 2WPFA 1H7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGC A;  1TYP A;  3PS9 A;  2FBW A;  2A87 A;  4ECH A;  1GPE A;  5IQ1 A;  1MO9 A;  3UOV A;  1REO A;  1CBO A;  2BAC A;  2IVE A;  3UTF A;  2BS3 A;  4TLX A;  2WBA A;  5EOW A;  1GV4 A;  1CJ3 A;  3ZYX A;  2EQ8 A;  1CL0 A;  1DJN A;  2WES A;  1P2H A;  2XFU A;  1O5W A;  2R46 A;  1CHU A;  3M12 A;  1FEA A;  1OJA A;  4J2W A;  2OLO A;  2Q7V A;  2UZZ A;  4UDP A;  2AR8 A;  2WP5 A;  3IHG A;  3UP5 A;  4GR1 A;  2Y6R A;  3DK4 A;  3QSM A;  1LV0 A;  2JKC A;  2R0C A;  3C4A A;  3AE5 A;  1LTX R;  4ZN0 A;  3KD9 A;  3NGC X;  4U8I A;  3CPJ G;  4AOS A;  2GMH A;  1MOK A;  2BK5 A;  4REK A;  4H4Y A;  3ABV A;  3UOY A;  1JOA A;  2EQ6 A;  4BK3 A;  4EM3 A;  1DOB A;  1JEH A;  2V61 A;  4Z44 A;  3DGZ A;  3AYI A;  5BRT A;  1PHH A;  3LZW A;  1F8R A;  3DJE A;  2ZZ0 A;  3KKJ A;  3AE2 A;  5HHF A;  1DOD A;  1F8S A;  5ER0 A;  2V3B A;  3CNT A;  1KDG A;  2EQ7 A;  3D8X A;  4H4U A;  3VQR A;  2XVE A;  3QSE A;  5BVA A;  1OJD A;  2R0G A;  2A8X A;  1E1N A;  3BNM A;  4A99 A;  3CGE A;  4FK1 C;  1ZMD A;  2PHH A;  4IA5 A;  4Z24 A;  1H81 A;  3K7T A;  4JNQ A;  3F8P A;  1MXT A;  2R4E A;  4NTC A;  4CY8 A;  3ICT A;  2DKH A;  1L9C A;  4CBQ A;  1Y0P A;  1OJ9 A;  1GRG A;  3UOZ A;  1E1K A;  1CF3 A;  5L46 A;  3DJD A;  4P9S A;  5FS8 A;  3UOX A;  1NPX A;  3K7Q X;  2VQB A;  2VRM A;  2YG7 A;  3R9U A;  3VR9 A;  2VQ7 A;  1IUU A;  1PJ5 A;  1E6E A;  1PBE A;  2WET A;  4AT0 A;  2YR6 A;  3P9U A;  3GDP A;  2BK4 A;  3V3O A;  3LOV A;  3VR8 A;  3ISH A;  2PYX A;  2ZBW A;  3UKA A;  4PAB A;  5BUK A;  4A6N B;  4JY3 A;  3AE1 A;  3BNU A;  4OPG A;  1NHR A;  1TDE A;  3BI2 A;  4U8O A;  4XXG A;  1W4X A;  4O5Q A;  2XFN A;  2WPC A;  4A65 A;  1GRH A;  3ALM A;  3QVR A;  1S2Y A;  1NG3 A;  2WOI A;  4YKF A;  4IA6 A;  2HQM A;  5CQF A;  4PAA A;  2TMD A;  2GAH B;  3G5Q A;  1PBB A;  1GES A;  1N4V A;  2JB1 A;  3NK2 X;  4H4S A;  3UTH A;  4EMI A;  2QAE A;  1E39 A;  2YLW A;  1O95 A;  5KOW A;  2WPE A;  3RHA A;  3ALL A;  4K8D A;  4GUV A;  2JAE A;  2XYO A;  4JN9 A;  3UTE A;  4Z2U A;  3EF6 A;  1GRF A;  2IID A;  1Z6L A;  1OJT A;  3G5S A;  5DBJ A;  4JY2 A;  2GRT A;  3GD4 A;  1JNZ A;  1H86 A;  3O0H A;  3UTG A;  4B65 A;  4Z43 A;  2YLZ A;  4YT0 A;  2H88 A;  5EB4 A;  1B4V A;  1ZKQ A;  1FL2 A;  3P1W A;  4B1B A;  3CGD A;  1E1L A;  3RNM A;  1RYI A;  2WDR A;  1Q1R A;  3AE6 A;  2YAU A;  2Q0K A;  1YQ3 A;  2XVI A;  3CTY A;  4O5U A;  3QVP A;  3GSI A;  2GR0 A;  4YTP A;  2ACZ A;  4CRT A;  1YKJ A;  4H4R A;  5JCN A;  5KOX A;  3AE9 A;  1ONF A;  1PXB A;  4YSH A;  3UKP A;  2WQY A;  5FS6 A;  4H2Q A;  2BK3 A;  3H8I A;  1D4E A;  3GD3 A;  5C3J A;  2XFQ A;  3SFD A;  5C2T A;  2AQJ A;  2YG6 A;  1GER A;  1NG4 A;  2C65 A;  2BC1 A;  5U63 A;  1KSU A;  3CND A;  4EQS A;  4MJW A;  4TM1 A;  5J60 A;  3AEE A;  4JNA A;  4DGK A;  2WOV A;  1BKW A;  1OJC A;  4WX1 A;  1VDC A;  2F5Z A;  3UCL A;  3GYI A;  1PBF A;  3CPI G;  5FMH A;  4Y4L A;  3NT6 A;  1QJD A;  2XVF A;  5M0Z A;  3GMB A;  4B68 A;  4FX9 A;  1GSN A;  2C3D A;  1VG9 A;  4FDC B;  1H83 A;  1TDF A;  3DME A;  1HYU A;  3QJ4 A;  1JU2 A;  3NHO X;  2YG4 A;  4YSX A;  2YG3 A;  3PVC A;  1X31 B;  2YVJ A;  1DOE A;  3KVE A;  4USR A;  1D7Y A;  1FOH A;  2NPX A;  4Z25 A;  4B63 A;  4YTN A;  3AD7 B;  2WOW A;  1CJ4 A;  2YLT A;  4E0V A;  4B69 A;  4OPI A;  3NYF A;  1NEK A;  3RP8 A;  4Z2R A;  4B66 A;  4BUR A;  2QA1 A;  3D1C A;  1F8W A;  4EMW A;  4K2X A;  4ADW A;  2C3C A;  4H4T A;  4YSY A;  2WU5 A;  2I0Z A;  4GDE A;  3EAO A;  3ICS A;  1PBC A;  3AXB A;  1K0J A;  2W0H A;  4GCM A;  5U25 A;  2BCP A;  4BK1 A;  1KF6 A;  4OPC A;  2CUL A;  3F8D A;  1O94 A;  4EM4 A;  1Y56 A;  3FIM B;  5EBK A;  3AB1 A;  4TM3 A;  3LAD A;  2OAL A;  2XLR A;  3FPZ A;  4C5O A;  2XLT A;  1S3E A;  1ZMC A;  4NZH A;  2XVH A;  2XVJ A;  2E4G A;  2VZ2 A;  2BXS A;  2C66 A;  5KXJ A;  4ZCC A;  4YWO A;  1IUT A;  4NTD A;  3AE4 A;  5IQ4 A;  2E1M A;  5KVH A;  1PS9 A;  3HZL A;  5EB5 A;  3AE3 A;  2GV8 A;  4GRT A;  1GET A;  3T37 A;  5HYM A;  2TPR A;  4OPL A;  1IJH A;  2GR2 A;  4K5S A;  2JB3 A;  3P4Q A;  2FJB A;  3K30 A;  2H89 A;  4UDQ A;  2WDV A;  3AD8 B;  1KNR A;  4GF7 A;  1PJ6 A;  1XHC A;  2OAM A;  1JNR A;  3KPF A;  3LXD A;  2CVJ A;  1KNP A;  3NTA A;  4FK1 A;  1TYT A;  3I6D A;  1S3B A;  1IUX A;  1H6V A;  1H84 A;  2XDO A;  5GRT A;  2NVK X;  1EL5 A;  2GH5 A;  1GRB A;  2VRL A;  1BZL A;  1N1P A;  3CNS A;  2BAB A;  3IF9 A;  4KPR A;  2V6O A;  4X4J A;  2WU2 A;  4TM4 A;  3G5R A;  4U2S A;  3I3L A;  1B5Q A;  3NYE A;  5M10 A;  1EBD A;  1ZP0 A;  2YVF A;  3FBS A;  2GVC A;  1N4U A;  2JK6 A;  3KA7 A;  5JCI A;  5JCK A;  4EQR A;  4C74 A;  2Q0L A;  2FJD A;  4OPU A;  4X9N A;  3SM8 A;  4OPT A;  4U2T A;  2B9X A;  4J36 A;  2YR4 A;  4UP3 A;  3AEG A;  2XLS A;  1FEC A;  4H4X A;  4C3X A;  3SGL A;  4IVM B;  3ICR A;  1K4Q A;  4EQX A;  2WEU A;  1XDI A;  2X8G A;  3ATR A;  1GRE A;  5LV9 A;  4U8J A;  2C72 A;  2ARD A;  1PXA A;  2BYB A;  3NNE A;  5BUL A;  2APG A;  2V60 A;  5HXI A;  1F6M A;  2J3N A;  2DKI A;  2EQ9 A;  1KSS A;  2BXR A;  1B37 A;  2BS2 A;  2C70 A;  4IV9 A;  4CNK A;  5IPY A;  1ZX9 A;  3BHF A;  4HA6 A;  3BI4 A;  3ADA B;  3C4N A;  4H4Q A;  4TLZ A;  5KVI A;  1H82 A;  3P4P A;  4APN A;  1VRQ B;  2A89 A;  3NN6 X;  4H4W A;  1M64 A;  1GRT A;  3CIR A;  3V3N A;  1BF3 A;  1GOS A;  3KU9 A;  1PBD A;  2QA2 A;  1SEZ A;  1K0L A;  4A9W A;  3P4S A;  3H8L A;  2GAG B;  3UKF A;  3II4 A;  3NLC A;  4GDP A;  4USQ A;  5FS9 A;  2FJE A;  2RGO A;  1ELI A;  2YR5 A;  1ZDL A;  4UDR A;  4XWZ A;  1L0V A;  3AD9 B;  1NHQ A;  1VG0 A;  1IUW A;  1P2E A;  3DGH A;  1CC4 A;  3UP4 A;  2Y6Q A;  4K7Z A;  4NEW A;  3SFE A;  1QO8 A;  2WDQ A;  1XPQ A;  3LZX A;  2FJA A;  2BA9 A;  4J56 A;  4A6N A;  2YM1 A;  4X9M A;  2JB2 A;  4A79 A;  2CFY A;  1DXL A;  2RGH A;  3L8K A;  4H50 A;  4BV6 A;  2YLR A;  3S61 A;  1TDK A;  2WP6 A;  1RSG A;  1PDH A;  2ZZB A;  1Q9I A;  3AYJ A;  2Q6U A;  5FS7 A;  3RP6 A;  3GWF A;  3UKQ A;  1UKV G;  3IHM A;  2RAB A;  4EIP A;  1XAN A;  4A5L A;  4CY6 A;  3DK8 A;  4H2P A;  2O9Z A;  4AT2 A;  1JRZ A;  4ZCD A;  3JSK A;  3F8R A;  3EPT A;  3Q9T A;  4IVO B;  4BK2 A;  1H7X A;  1ZOY A;  1EL8 A;  3CPH G;  4U8N A;  3V76 A;  2OA1 A;  5JCM A;  2GF3 A;  1CJC A;  3URH A;  1E1M A;  2C7G A;  1GAL A;  3DJG X;  1FEB A;  3Q6J A;  4YKG A;  4YSZ A;  5JCL A;  2OLN A;  3AE8 A;  3IC9 A;  4YXD A;  1BGJ A;  3IWA A;  4D04 A;  2C67 A;  2BC0 A;  2XFO A;  4C3Y A;  3OZ2 A;  1D5T A;  3E1T A;  4ICY A;  4H2N A;  3NTD A;  4JDR A;  1GT8 A;  1GRA A;  4H4Z A;  2X8H A;  2X99 A;  1F3P A;  2WP9 A;  2XFP A;  4OPD A;  1JRX A;  3NG7 X;  4Y4M A;  1TDN A;  4BJY A;  5HY5 A;  3WE0 A;  4Z26 A;  1L9E A;  1L9D A;  2C76 A;  4M52 A;  1COY A;  1B8S A;  2C64 A;  4CNJ A;  3AE7 A;  2YWL A;  3GWD A;  2BCG G;  3SQP A;  4CCR A;  3DK9 A;  4BJZ A;  3FMW A;  1CJ2 A;  1GND A;  1LQU A;  2GEW A;  2B7R A;  3NK1 X;  4H4P A;  4HB9 A;  2C73 A;  3NKS A;  2YLX A;  1N4W A;  4RSL A;  4K22 A;  2B7S A;  4U8K A;  5TR3 A;  2CDU A;  1CC2 A;  3B3R A;  2E5V A;  4A7A A;  2XLU A;  3RED A;  2X3N A;  3EAN A;  1IUS A;  1VQW A;  2XCG A;  4C77 A;  4U8M A;  2YM2 A;  2XLP A;  3NYC A;  1GXF A;  3ITJ A;  4RG4 A;  4NEV A;  5GSN A;  3AEA A;  2GQW A;  2ZZC A;  3P4R A;  4B67 A;  4AOX A;  1ZK7 A;  1K0I A;  3GRT A;  3GMC A;  3C96 A;  3AED A;  3CNP A;  3CN8 A;  1PN0 A;  2GMJ A;  1LJ1 A;  2VVL G;  3COX A;  1ZY8 A;  3AWI A;  1D4D A;  2B9W A;  1BWC A;  1CC6 A;  1DNC A;  1LVL A;  2R45 A;  3KLJ A;  2B9Y A;  2VVL A;  4H7U A;  3VRB A;  3B6D A;  2BS4 A;  4EQW A;  1S2Q A;  2GQF A;  3GDN A;  2GR3 A;  3NK0 X;  2YVG A;  1LQT A;  3AEF A;  3NN0 X;  1D4C A;  1ZOV A;  2JBV A;  3NIX A;  1FCD A;  3S5W A;  1YQ4 A;  2Z5Y A;  4N9X A;  1LPF A;  3ALJ A;  1NEN A;  3DA1 A;  4WCT A;  3H4K A;  4LII A;  4D03 A;  1AOG A;  2WHD A;  3M0O A;  3VRA A;  3AYL A;  4I59 A;  4AP1 A;  2V3A A;  1PXC A;  3AEB A;  2RGJ A;  3ATQ A;  4J57 A;  5KRQ A;  3OC4 A;  3UKH A;  1E7P A;  3ZDN A;  3NH3 X;  2AAQ A;  4KX6 A;  2YG5 A;  3DH9 A;  2VOU A;  4J33 A;  1V59 A;  4H4V A;  2V5Z A;  4Z2T A;  1RP0 A;  3QFA A;  1D7L A;  4U2L A;  4OVI A;  3VRD B;  2GR1 A;  1GTH A;  4EIQ A;  1NAA A;  4OCG A;  1KFY A;  1EL7 A;  1YQZ A;  3QFB A;  4CCQ A;  1TRB A;  2R9Z A;  4J31 A;  2YLS A;  1NHS A;  4K5R A;  2X8C A;  3BI5 A;  1TDO A;  3AEC A;  3L1R A;  4JQ9 A;  2B76 A;  3RP7 A;  1DOC A;  5KWF A;  4LU6 A;  2QCU A;  1DJQ A;  1GTE A;  3CNJ A;  4Y4N A;  2IVD A;  4DNA A;  2VVM A;  1BGN A;  3UKK A;  2Z5X A;  4B64 A;  5CKU A;  3GRS A;  4U8P A;  1M6I A;  1GEU A;  4I58 A;  1YY5 A;  4H2R A;  1PJ7 A;  3LB8 A;  1QLB A;  3DJJ A;  4NTE A;  3M13 A;  4YTM A;  1EL9 A;  4J34 A;  3CGB A;  4EMJ A;  3NRN A;  4DSG A;  1JRY A;  3UKL A;  4DSH A;  1NDA A;  1IUV A;  4LA1 A;  5U1O A;  1Q1W A;  4AP3 A;  4XWR A;  4RG3 A;  4U8L A;  2R0P A;  3BHK A;  2GB0 A;  3PO7 A;  2C75 A;  4TM0 A;  2WS3 A;  3QSS A;  1Y56 B;  3LJP A;  2R4J A;  5J7X A;  2YQU A;  3K7M X;  1NHP A;  2X50 A;  3FG2 P;  3GYJ A;  2WPF A;  1H7W A; 
#chains in the Genus database with same CATH topology
 3CGC A;  1TYP A;  3PS9 A;  2FBW A;  2A87 A;  4ECH A;  1GPE A;  5IQ1 A;  1MO9 A;  3UOV A;  1REO A;  1CBO A;  2BAC A;  2IVE A;  3UTF A;  2BS3 A;  4TLX A;  2WBA A;  5EOW A;  1GV4 A;  1CJ3 A;  3ZYX A;  2EQ8 A;  1CL0 A;  5KNL A;  1DJN A;  2WES A;  1P2H A;  2XFU A;  1O5W A;  2R46 A;  3M12 A;  1CHU A;  1FEA A;  1OJA A;  4J2W A;  2OLO A;  2Q7V A;  2UZZ A;  4UDP A;  2AR8 A;  2WP5 A;  3IHG A;  3UP5 A;  4GR1 A;  2Y6R A;  4YJG A;  3DK4 A;  3QSM A;  1LV0 A;  2JKC A;  2R0C A;  3C4A A;  3AE5 A;  1LTX R;  4ZN0 A;  3SZ0 A;  3KD9 A;  3NGC X;  4U8I A;  3CPJ G;  4AOS A;  2GMH A;  1MOK A;  2BK5 A;  4REK A;  4H4Y A;  3ABV A;  3UOY A;  1JOA A;  2EQ6 A;  4BK3 A;  4EM3 A;  1DOB A;  1JEH A;  2V61 A;  4Z44 A;  3DGZ A;  3AYI A;  5BRT A;  3T31 A;  1PHH A;  3LZW A;  1F8R A;  3DJE A;  2ZZ0 A;  3KKJ A;  3AE2 A;  5HHF A;  1DOD A;  1F8S A;  5ER0 A;  2V3B A;  3CNT A;  1KDG A;  2EQ7 A;  3VQR A;  3D8X A;  4H4U A;  2XVE A;  3QSE A;  5BVA A;  1OJD A;  4NNJ A;  2R0G A;  2A8X A;  1E1N A;  3BNM A;  4A99 A;  3CGE A;  4IA5 A;  2PHH A;  1ZMD A;  4FK1 C;  3HYV A;  4Z24 A;  1H81 A;  3K7T A;  4JNQ A;  3F8P A;  1MXT A;  2R4E A;  4NTC A;  2E48 A;  4YJF B;  4CY8 A;  3ICT A;  2DKH A;  1L9C A;  4CBQ A;  1Y0P A;  1OJ9 A;  1GRG A;  3UOZ A;  1E1K A;  1CF3 A;  5L46 A;  3DJD A;  4P9S A;  5FS8 A;  3UOX A;  1NPX A;  3K7Q X;  2VQB A;  2VRM A;  2YG7 A;  3R9U A;  3VR9 A;  2VQ7 A;  1IUU A;  1PJ5 A;  1PBE A;  1E6E A;  2WET A;  4AT0 A;  2YR6 A;  3P9U A;  3GDP A;  2BK4 A;  3V3O A;  3LOV A;  3VR8 A;  3ISH A;  2PYX A;  3SYI A;  2ZBW A;  3UKA A;  4PAB A;  5BUK A;  4A6N B;  4JY3 A;  3AE1 A;  3BNU A;  4OPG A;  1NHR A;  1TDE A;  3BI2 A;  4U8O A;  4XXG A;  1W4X A;  4O5Q A;  2E4A A;  2XFN A;  1KIF A;  2WPC A;  4A65 A;  1GRH A;  3ALM A;  3QVR A;  1S2Y A;  1NG3 A;  2WOI A;  4YKF A;  4IA6 A;  2HQM A;  5CQF A;  4PAA A;  2TMD A;  2GAH B;  3G5Q A;  1PBB A;  1GES A;  1N4V A;  2JB1 A;  3NK2 X;  4H4S A;  3UTH A;  4EMI A;  2QAE A;  1E39 A;  2YLW A;  1O95 A;  5KOW A;  2WPE A;  3RHA A;  3ALL A;  4K8D A;  4GUV A;  2JAE A;  2XYO A;  4JN9 A;  3KPK A;  3UTE A;  4Z2U A;  3EF6 A;  1GRF A;  2IID A;  1Z6L A;  1OJT A;  3G5S A;  5DBJ A;  4JY2 A;  2GRT A;  3GD4 A;  1JNZ A;  1H86 A;  3O0H A;  4II2 A;  3UTG A;  4B65 A;  4Z43 A;  2YLZ A;  4YT0 A;  2H88 A;  5EB4 A;  1B4V A;  1ZKQ A;  1FL2 A;  3P1W A;  4B1B A;  3CGD A;  1E1L A;  3RNM A;  4G74 A;  1RYI A;  2WDR A;  1Q1R A;  3AE6 A;  2YAU A;  2Q0K A;  5KMS A;  1YQ3 A;  2XVI A;  3CTY A;  4O5U A;  3QVP A;  3GSI A;  2GR0 A;  4YTP A;  2ACZ A;  4CRT A;  1YKJ A;  4H4R A;  5JCN A;  5KOX A;  3AE9 A;  4QFD A;  1ONF A;  1PXB A;  4YSH A;  3UKP A;  2WQY A;  5FS6 A;  4H2Q A;  2BK3 A;  3H8I A;  1D4E A;  3GD3 A;  5C3J A;  2XFQ A;  3SFD A;  5C2T A;  4YJH B;  2AQJ A;  2YG6 A;  1GER A;  4GAV A;  1NG4 A;  2C65 A;  2BC1 A;  3ZNQ A;  3NTA A;  5U63 A;  1KSU A;  3CND A;  4EQS A;  4MJW A;  4TM1 A;  5J60 A;  3AEE A;  4JNA A;  4DGK A;  2WOV A;  1BKW A;  1OJC A;  4G73 A;  4WX1 A;  1VDC A;  2F5Z A;  3UCL A;  3GYI A;  1PBF A;  3CPI G;  5FMH A;  4Y4L A;  3NT6 A;  1QJD A;  2XVF A;  5M0Z A;  3GMB A;  4B68 A;  4FX9 A;  1C0L A;  1GSN A;  1VG9 A;  2C3D A;  4FDC B;  1H83 A;  3DME A;  1TDF A;  1HYU A;  1C0P A;  1JU2 A;  3NHO X;  2YG4 A;  3QJ4 A;  4YSX A;  2YG3 A;  3PVC A;  1X31 B;  2YVJ A;  1DOE A;  3KVE A;  4USR A;  1FOH A;  1D7Y A;  2NPX A;  4Z25 A;  4B63 A;  4YTN A;  3AD7 B;  2WOW A;  1CJ4 A;  2YLT A;  4E0V A;  4B69 A;  4OPI A;  3NYF A;  3RP8 A;  1NEK A;  4Z2R A;  4B66 A;  4BUR A;  2QA1 A;  3D1C A;  1F8W A;  4EMW A;  4K2X A;  4ADW A;  2C3C A;  4H4T A;  4YSY A;  2WU5 A;  2I0Z A;  4GDE A;  3EAO A;  3ICS A;  1PBC A;  3AXB A;  1K0J A;  2W0H A;  4GCM A;  5U25 A;  4BK1 A;  2BCP A;  1EVI A;  1KF6 A;  4OPC A;  2CUL A;  3F8D A;  1O94 A;  4EM4 A;  1Y56 A;  3FIM B;  5EBK A;  3AB1 A;  4TM3 A;  3LAD A;  4GAP A;  2OAL A;  2XLR A;  3FPZ A;  4C5O A;  2XLT A;  1S3E A;  1ZMC A;  4NZH A;  2XVH A;  2XVJ A;  2E4G A;  2VZ2 A;  2BXS A;  2C66 A;  5KXJ A;  4ZCC A;  4YWO A;  1IUT A;  4NTD A;  3AE4 A;  5IQ4 A;  2E1M A;  5KVH A;  3HZL A;  1PS9 A;  5EB5 A;  3AE3 A;  2GV8 A;  4GRT A;  1GET A;  4II3 A;  5HYM A;  3T37 A;  2TPR A;  4OPL A;  1IJH A;  2GR2 A;  4K5S A;  3W4K A;  2JB3 A;  3P4Q A;  5KMR A;  4G6G A;  2FJB A;  3K30 A;  2H89 A;  4UDQ A;  3AD8 B;  2WDV A;  1KNR A;  3T2Y A;  1PJ6 A;  4GF7 A;  3ZNO A;  1XHC A;  1JNR A;  2OAM A;  3CMM A;  2CVJ A;  1KNP A;  3KPF A;  3LXD A;  4FK1 A;  1TYT A;  3SZF A;  3I6D A;  1S3B A;  1IUX A;  1H6V A;  1H84 A;  2XDO A;  5GRT A;  2NVK X;  1EL5 A;  2GH5 A;  1GRB A;  2VRL A;  3IF9 A;  1BZL A;  1N1P A;  2BAB A;  1DAO A;  3W4I A;  2V6O A;  3CNS A;  4KPR A;  4X4J A;  1C0K A;  2WU2 A;  4TM4 A;  3G5R A;  4U2S A;  3I3L A;  1B5Q A;  3NYE A;  5M10 A;  1EBD A;  1ZP0 A;  2YVF A;  3FBS A;  2GVC A;  1N4U A;  2JK6 A;  3KA7 A;  5JCI A;  5JCK A;  4G9K A;  4EQR A;  4C74 A;  2Q0L A;  2FJD A;  4OPU A;  4X9N A;  3SM8 A;  4NWZ A;  4OPT A;  4U2T A;  2B9X A;  4J36 A;  2YR4 A;  4UP3 A;  3AEG A;  2XLS A;  1FEC A;  4H4X A;  4C3X A;  3SGL A;  4IVM B;  3ICR A;  5KMQ A;  1K4Q A;  4EQX A;  2WEU A;  1XDI A;  2X8G A;  3ATR A;  1GRE A;  5LV9 A;  4U8J A;  2C72 A;  2ARD A;  1PXA A;  2BYB A;  3NNE A;  3ZNP A;  5BUL A;  2APG A;  2V60 A;  5HXI A;  3SZW A;  1F6M A;  2J3N A;  2DKI A;  2EQ9 A;  1KSS A;  2BXR A;  1B37 A;  2BS2 A;  2C70 A;  4IV9 A;  4CNK A;  5IPY A;  1ZX9 A;  3SZC A;  3BHF A;  4HA6 A;  3C4N A;  3ADA B;  3BI4 A;  4H4Q A;  4TLZ A;  5KVI A;  1H82 A;  3P4P A;  4APN A;  1VRQ B;  2A89 A;  4YJF A;  1C0I A;  3NN6 X;  1M64 A;  4H4W A;  1GRT A;  3CIR A;  3V3N A;  1BF3 A;  1GOS A;  3KU9 A;  1PBD A;  2QA2 A;  1SEZ A;  1K0L A;  4A9W A;  3P4S A;  3H8L A;  2GAG B;  3T14 A;  3UKF A;  3II4 A;  3NLC A;  4GDP A;  4USQ A;  5FS9 A;  2FJE A;  2RGO A;  1ELI A;  2YR5 A;  1ZDL A;  4UDR A;  4XWZ A;  1L0V A;  3AD9 B;  1NHQ A;  4YJG B;  1IUW A;  1P2E A;  1VG0 A;  1CC4 A;  3DGH A;  3UP4 A;  2Y6Q A;  4K7Z A;  4NEW A;  3SFE A;  2DU8 A;  1QO8 A;  2WDQ A;  1XPQ A;  3LZX A;  2FJA A;  2BA9 A;  4J56 A;  4A6N A;  4X9M A;  2YM1 A;  2JB2 A;  4A79 A;  2CFY A;  1DXL A;  2RGH A;  3L8K A;  4H50 A;  4BV6 A;  2YLR A;  3S61 A;  1TDK A;  2WP6 A;  1RSG A;  1PDH A;  2ZZB A;  1Q9I A;  3AYJ A;  2Q6U A;  3RP6 A;  5FS7 A;  3GWF A;  3UKQ A;  1UKV G;  3IHM A;  2RAB A;  4EIP A;  1XAN A;  4A5L A;  4CY6 A;  3DK8 A;  4H2P A;  2O9Z A;  4AT2 A;  1JRZ A;  4ZCD A;  3JSK A;  3F8R A;  3EPT A;  3Q9T A;  4BK2 A;  4IVO B;  1H7X A;  1ZOY A;  1EL8 A;  3CPH G;  4U8N A;  3V76 A;  2OA1 A;  5JCM A;  2GF3 A;  1CJC A;  3URH A;  1E1M A;  2C7G A;  1GAL A;  3DJG X;  1FEB A;  3Q6J A;  4YKG A;  4YSZ A;  5JCL A;  2OLN A;  3AE8 A;  3IC9 A;  4YXD A;  1BGJ A;  3IWA A;  4D04 A;  2C67 A;  2BC0 A;  2XFO A;  4C3Y A;  3G3E A;  3OZ2 A;  1D5T A;  3E1T A;  4ICY A;  4H2N A;  3NTD A;  4JDR A;  1GT8 A;  1GRA A;  4H4Z A;  2X8H A;  2X99 A;  1F3P A;  4BJY A;  2WP9 A;  2XFP A;  1JRX A;  3NG7 X;  4OPD A;  1TDN A;  4Y4M A;  5HY5 A;  3WE0 A;  4Z26 A;  1L9E A;  3SXI A;  1L9D A;  2C76 A;  4M52 A;  1COY A;  1B8S A;  4QFC A;  2C64 A;  3GYX A;  4CNJ A;  3AE7 A;  2YWL A;  3GWD A;  2BCG G;  3SQP A;  4CCR A;  3CUK A;  4BJZ A;  3DK9 A;  3FMW A;  1CJ2 A;  2E82 A;  4YJH A;  1GND A;  1LQU A;  2GEW A;  2B7R A;  3NK1 X;  1AN9 A;  4H4P A;  4HB9 A;  2C73 A;  3NKS A;  2YLX A;  1N4W A;  4RSL A;  1DDO A;  4K22 A;  2B7S A;  4U8K A;  5TR3 A;  2CDU A;  1CC2 A;  3B3R A;  2E5V A;  4A7A A;  2XLU A;  3RED A;  2X3N A;  3EAN A;  1IUS A;  1VQW A;  2XCG A;  4C77 A;  4U8M A;  2YM2 A;  2XLP A;  3NYC A;  1GXF A;  3T0K A;  3ITJ A;  4RG4 A;  4NEV A;  5GSN A;  5KMP A;  3AEA A;  2GQW A;  2ZZC A;  3P4R A;  4B67 A;  4AOX A;  3WGT A;  1ZK7 A;  1K0I A;  3GRT A;  3GMC A;  3C96 A;  3AED A;  3CNP A;  3CN8 A;  4G6H A;  1PN0 A;  3ZNN A;  2GMJ A;  1LJ1 A;  2C4C A;  2VVL G;  3COX A;  3AWI A;  1ZY8 A;  1D4D A;  2R45 A;  1CC6 A;  1BWC A;  1DNC A;  1LVL A;  2B9W A;  3KLJ A;  2B9Y A;  2VVL A;  4H7U A;  3VRB A;  3B6D A;  2BS4 A;  4EQW A;  1S2Q A;  2GQF A;  3GDN A;  2GR3 A;  3NK0 X;  2YVG A;  1LQT A;  3AEF A;  4YJD A;  3NN0 X;  1D4C A;  1ZOV A;  2JBV A;  3NIX A;  1FCD A;  3S5W A;  1YQ4 A;  2Z5Y A;  4N9X A;  1LPF A;  3T2Z A;  3ALJ A;  3DA1 A;  4WCT A;  1NEN A;  3H4K A;  4LII A;  4D03 A;  1AOG A;  3M0O A;  2WHD A;  3VRA A;  3AYL A;  4I59 A;  4AP1 A;  2V3A A;  1PXC A;  3AEB A;  2RGJ A;  3ATQ A;  4J57 A;  2E49 A;  5KRQ A;  3OC4 A;  3UKH A;  1E7P A;  3ZDN A;  3NH3 X;  2AAQ A;  4KX6 A;  2YG5 A;  3DH9 A;  2VOU A;  4J33 A;  1V59 A;  4H4V A;  2V5Z A;  4Z2T A;  1RP0 A;  3QFA A;  1D7L A;  4U2L A;  4OVI A;  3VRD B;  2GR1 A;  1GTH A;  4EIQ A;  1NAA A;  4OCG A;  1KFY A;  1EL7 A;  1YQZ A;  3QFB A;  4CCQ A;  1TRB A;  3SY4 A;  2R9Z A;  4J31 A;  2YLS A;  1NHS A;  4K5R A;  3HYW A;  2X8C A;  3BI5 A;  1TDO A;  3AEC A;  3L1R A;  4JQ9 A;  2B76 A;  3RP7 A;  1DOC A;  5KWF A;  4LU6 A;  2QCU A;  1DJQ A;  1GTE A;  3CNJ A;  4Y4N A;  2IVD A;  4DNA A;  2VVM A;  1BGN A;  2BRY A;  3W4J A;  2BRA A;  3UKK A;  2Z5X A;  4B64 A;  5CKU A;  3GRS A;  4U8P A;  1M6I A;  1GEU A;  4I58 A;  1YY5 A;  4H2R A;  1PJ7 A;  3LB8 A;  1QLB A;  3DJJ A;  4NTE A;  3M13 A;  4YTM A;  1EL9 A;  4J34 A;  3CGB A;  4EMJ A;  3NRN A;  3T2K A;  4DSG A;  1JRY A;  3UKL A;  4DSH A;  1NDA A;  1IUV A;  4LA1 A;  5U1O A;  1Q1W A;  4AP3 A;  4XWR A;  4RG3 A;  4U8L A;  2R0P A;  3BHK A;  2GB0 A;  3PO7 A;  2C75 A;  4TM0 A;  2WS3 A;  3QSS A;  3HYX A;  1Y56 B;  3LJP A;  2R4J A;  5J7X A;  3SX6 A;  1VE9 A;  2YQU A;  3K7M X;  1NHP A;  2X50 A;  3FG2 P;  3GYJ A;  2WPF A;  1H7W A; 
#chains in the Genus database with same CATH homology
 3CGC A;  1TYP A;  3PS9 A;  2FBW A;  2A87 A;  4ECH A;  1GPE A;  5IQ1 A;  1MO9 A;  3UOV A;  1REO A;  1CBO A;  2BAC A;  2IVE A;  3UTF A;  2BS3 A;  4TLX A;  2WBA A;  5EOW A;  1GV4 A;  1CJ3 A;  3ZYX A;  2EQ8 A;  1CL0 A;  5KNL A;  1DJN A;  2WES A;  1P2H A;  2XFU A;  1O5W A;  2R46 A;  1CHU A;  3M12 A;  1FEA A;  1OJA A;  4J2W A;  2OLO A;  2Q7V A;  2UZZ A;  4UDP A;  2AR8 A;  2WP5 A;  3IHG A;  3UP5 A;  4GR1 A;  2Y6R A;  3DK4 A;  3QSM A;  1LV0 A;  2JKC A;  2R0C A;  3C4A A;  3AE5 A;  1LTX R;  4ZN0 A;  3SZ0 A;  3KD9 A;  3NGC X;  4U8I A;  3CPJ G;  4AOS A;  2GMH A;  1MOK A;  2BK5 A;  4REK A;  4H4Y A;  3ABV A;  3UOY A;  1JOA A;  2EQ6 A;  4BK3 A;  4EM3 A;  1DOB A;  1JEH A;  2V61 A;  4Z44 A;  3DGZ A;  3AYI A;  5BRT A;  3T31 A;  1PHH A;  3LZW A;  1F8R A;  3DJE A;  2ZZ0 A;  3KKJ A;  3AE2 A;  5HHF A;  1DOD A;  1F8S A;  5ER0 A;  2V3B A;  3CNT A;  1KDG A;  2EQ7 A;  3D8X A;  4H4U A;  3VQR A;  2XVE A;  3QSE A;  5BVA A;  1OJD A;  4NNJ A;  2R0G A;  2A8X A;  1E1N A;  3BNM A;  4A99 A;  3CGE A;  4IA5 A;  1ZMD A;  2PHH A;  4FK1 C;  3HYV A;  4Z24 A;  1H81 A;  3K7T A;  4JNQ A;  3F8P A;  1MXT A;  2R4E A;  4NTC A;  4CY8 A;  3ICT A;  2DKH A;  1L9C A;  4CBQ A;  1Y0P A;  1OJ9 A;  1GRG A;  3UOZ A;  1E1K A;  1CF3 A;  5L46 A;  3DJD A;  4P9S A;  5FS8 A;  3UOX A;  1NPX A;  3K7Q X;  2VQB A;  2VRM A;  2YG7 A;  3R9U A;  3VR9 A;  2VQ7 A;  1IUU A;  1PJ5 A;  1E6E A;  1PBE A;  2WET A;  4AT0 A;  2YR6 A;  3P9U A;  3GDP A;  2BK4 A;  3V3O A;  3LOV A;  3VR8 A;  3ISH A;  2PYX A;  3SYI A;  2ZBW A;  3UKA A;  4PAB A;  5BUK A;  4A6N B;  4JY3 A;  3AE1 A;  3BNU A;  4OPG A;  1NHR A;  1TDE A;  3BI2 A;  4U8O A;  4XXG A;  1W4X A;  4O5Q A;  2XFN A;  2WPC A;  4A65 A;  1GRH A;  3ALM A;  3QVR A;  1S2Y A;  1NG3 A;  2WOI A;  4YKF A;  4IA6 A;  2HQM A;  5CQF A;  4PAA A;  2TMD A;  2GAH B;  3G5Q A;  1PBB A;  1GES A;  1N4V A;  2JB1 A;  3NK2 X;  4H4S A;  3UTH A;  4EMI A;  2QAE A;  1E39 A;  2YLW A;  1O95 A;  5KOW A;  2WPE A;  3RHA A;  3ALL A;  4K8D A;  4GUV A;  2JAE A;  2XYO A;  4JN9 A;  3KPK A;  3UTE A;  4Z2U A;  3EF6 A;  1GRF A;  2IID A;  1Z6L A;  1OJT A;  3G5S A;  5DBJ A;  4JY2 A;  2GRT A;  3GD4 A;  1JNZ A;  1H86 A;  3O0H A;  4II2 A;  3UTG A;  4B65 A;  4Z43 A;  2YLZ A;  4YT0 A;  2H88 A;  5EB4 A;  1B4V A;  1ZKQ A;  1FL2 A;  3P1W A;  4B1B A;  3CGD A;  1E1L A;  3RNM A;  4G74 A;  1RYI A;  2WDR A;  1Q1R A;  3AE6 A;  2YAU A;  2Q0K A;  5KMS A;  1YQ3 A;  2XVI A;  3CTY A;  4O5U A;  3QVP A;  3GSI A;  2GR0 A;  4YTP A;  2ACZ A;  4CRT A;  1YKJ A;  4H4R A;  5JCN A;  5KOX A;  3AE9 A;  1ONF A;  1PXB A;  4YSH A;  3UKP A;  2WQY A;  5FS6 A;  4H2Q A;  2BK3 A;  3H8I A;  1D4E A;  3GD3 A;  5C3J A;  2XFQ A;  3SFD A;  5C2T A;  2AQJ A;  2YG6 A;  1GER A;  4GAV A;  1NG4 A;  2C65 A;  2BC1 A;  5U63 A;  1KSU A;  3CND A;  4EQS A;  4MJW A;  4TM1 A;  5J60 A;  3AEE A;  4JNA A;  4DGK A;  2WOV A;  1BKW A;  1OJC A;  4G73 A;  4WX1 A;  1VDC A;  2F5Z A;  3UCL A;  3GYI A;  1PBF A;  3CPI G;  5FMH A;  4Y4L A;  3NT6 A;  1QJD A;  2XVF A;  5M0Z A;  3GMB A;  4B68 A;  4FX9 A;  1GSN A;  2C3D A;  1VG9 A;  4FDC B;  1H83 A;  1TDF A;  3DME A;  1HYU A;  3QJ4 A;  1JU2 A;  3NHO X;  2YG4 A;  4YSX A;  2YG3 A;  3PVC A;  1X31 B;  2YVJ A;  1DOE A;  3KVE A;  4USR A;  1D7Y A;  1FOH A;  2NPX A;  4Z25 A;  4B63 A;  4YTN A;  3AD7 B;  2WOW A;  1CJ4 A;  2YLT A;  4E0V A;  4B69 A;  4OPI A;  3NYF A;  3RP8 A;  1NEK A;  4Z2R A;  4B66 A;  4BUR A;  2QA1 A;  3D1C A;  1F8W A;  4EMW A;  4K2X A;  4ADW A;  2C3C A;  4H4T A;  4YSY A;  2WU5 A;  2I0Z A;  4GDE A;  3EAO A;  3ICS A;  1PBC A;  3AXB A;  1K0J A;  2W0H A;  4GCM A;  5U25 A;  4BK1 A;  2BCP A;  1KF6 A;  4OPC A;  2CUL A;  3F8D A;  1O94 A;  4EM4 A;  1Y56 A;  3FIM B;  5EBK A;  3AB1 A;  4TM3 A;  3LAD A;  4GAP A;  2OAL A;  2XLR A;  3FPZ A;  4C5O A;  2XLT A;  1S3E A;  1ZMC A;  4NZH A;  2XVH A;  2XVJ A;  2E4G A;  2VZ2 A;  2BXS A;  2C66 A;  5KXJ A;  4ZCC A;  4YWO A;  1IUT A;  4NTD A;  3AE4 A;  5IQ4 A;  2E1M A;  5KVH A;  1PS9 A;  3HZL A;  5EB5 A;  3AE3 A;  2GV8 A;  4GRT A;  1GET A;  4II3 A;  5HYM A;  3T37 A;  2TPR A;  4OPL A;  1IJH A;  2GR2 A;  4K5S A;  2JB3 A;  3P4Q A;  5KMR A;  4G6G A;  2FJB A;  3K30 A;  2H89 A;  4UDQ A;  2WDV A;  3AD8 B;  1KNR A;  3T2Y A;  4GF7 A;  1PJ6 A;  1XHC A;  2OAM A;  1JNR A;  3CMM A;  3KPF A;  2CVJ A;  1KNP A;  3LXD A;  3NTA A;  4FK1 A;  1TYT A;  3SZF A;  3I6D A;  1S3B A;  1IUX A;  1H6V A;  1H84 A;  2XDO A;  5GRT A;  2NVK X;  1EL5 A;  2GH5 A;  1GRB A;  2VRL A;  1BZL A;  1N1P A;  3CNS A;  2BAB A;  3IF9 A;  4KPR A;  2V6O A;  4X4J A;  2WU2 A;  4TM4 A;  3G5R A;  4U2S A;  3I3L A;  1B5Q A;  3NYE A;  5M10 A;  1EBD A;  1ZP0 A;  2YVF A;  3FBS A;  2GVC A;  1N4U A;  2JK6 A;  3KA7 A;  5JCI A;  5JCK A;  4G9K A;  4EQR A;  4C74 A;  2Q0L A;  2FJD A;  4OPU A;  4X9N A;  3SM8 A;  4NWZ A;  4OPT A;  4U2T A;  2B9X A;  4J36 A;  2YR4 A;  4UP3 A;  3AEG A;  2XLS A;  1FEC A;  4H4X A;  4C3X A;  3SGL A;  4IVM B;  3ICR A;  5KMQ A;  1K4Q A;  4EQX A;  2WEU A;  1XDI A;  2X8G A;  3ATR A;  1GRE A;  5LV9 A;  4U8J A;  2C72 A;  2ARD A;  1PXA A;  2BYB A;  3NNE A;  5BUL A;  2APG A;  2V60 A;  5HXI A;  3SZW A;  1F6M A;  2J3N A;  2DKI A;  2EQ9 A;  1KSS A;  2BXR A;  1B37 A;  2BS2 A;  2C70 A;  4IV9 A;  4CNK A;  5IPY A;  1ZX9 A;  3SZC A;  3BHF A;  4HA6 A;  3BI4 A;  3ADA B;  3C4N A;  4H4Q A;  4TLZ A;  5KVI A;  1H82 A;  3P4P A;  4APN A;  1VRQ B;  2A89 A;  3NN6 X;  4H4W A;  1M64 A;  1GRT A;  3CIR A;  3V3N A;  1BF3 A;  1GOS A;  3KU9 A;  1PBD A;  2QA2 A;  1SEZ A;  1K0L A;  4A9W A;  3P4S A;  3H8L A;  2GAG B;  3T14 A;  3UKF A;  3II4 A;  3NLC A;  4GDP A;  4USQ A;  5FS9 A;  2FJE A;  2RGO A;  1ELI A;  2YR5 A;  1ZDL A;  4UDR A;  4XWZ A;  1L0V A;  3AD9 B;  1NHQ A;  1VG0 A;  1IUW A;  1P2E A;  3DGH A;  1CC4 A;  3UP4 A;  2Y6Q A;  4K7Z A;  4NEW A;  3SFE A;  1QO8 A;  2WDQ A;  1XPQ A;  3LZX A;  2FJA A;  2BA9 A;  4J56 A;  4A6N A;  2YM1 A;  4X9M A;  2JB2 A;  4A79 A;  2CFY A;  1DXL A;  2RGH A;  3L8K A;  4H50 A;  4BV6 A;  2YLR A;  3S61 A;  1TDK A;  2WP6 A;  1RSG A;  1PDH A;  2ZZB A;  1Q9I A;  3AYJ A;  2Q6U A;  3RP6 A;  5FS7 A;  3GWF A;  3UKQ A;  1UKV G;  3IHM A;  2RAB A;  4EIP A;  1XAN A;  4A5L A;  4CY6 A;  3DK8 A;  4H2P A;  2O9Z A;  4AT2 A;  1JRZ A;  4ZCD A;  3JSK A;  3F8R A;  3EPT A;  3Q9T A;  4BK2 A;  4IVO B;  1H7X A;  1ZOY A;  1EL8 A;  3CPH G;  4U8N A;  3V76 A;  2OA1 A;  5JCM A;  2GF3 A;  1CJC A;  3URH A;  1E1M A;  2C7G A;  1GAL A;  3DJG X;  1FEB A;  3Q6J A;  4YKG A;  4YSZ A;  5JCL A;  2OLN A;  3AE8 A;  3IC9 A;  4YXD A;  1BGJ A;  3IWA A;  4D04 A;  2C67 A;  2BC0 A;  2XFO A;  4C3Y A;  3OZ2 A;  1D5T A;  3E1T A;  4ICY A;  4H2N A;  3NTD A;  4JDR A;  1GT8 A;  1GRA A;  4H4Z A;  2X8H A;  2X99 A;  1F3P A;  4BJY A;  2WP9 A;  2XFP A;  1JRX A;  3NG7 X;  4OPD A;  1TDN A;  4Y4M A;  5HY5 A;  3WE0 A;  4Z26 A;  1L9E A;  3SXI A;  1L9D A;  2C76 A;  4M52 A;  1COY A;  1B8S A;  2C64 A;  3GYX A;  4CNJ A;  3AE7 A;  2YWL A;  3GWD A;  2BCG G;  3SQP A;  4CCR A;  4BJZ A;  3DK9 A;  3FMW A;  1CJ2 A;  1GND A;  1LQU A;  2GEW A;  2B7R A;  3NK1 X;  4H4P A;  4HB9 A;  2C73 A;  3NKS A;  2YLX A;  1N4W A;  4RSL A;  4K22 A;  2B7S A;  4U8K A;  5TR3 A;  2CDU A;  1CC2 A;  3B3R A;  2E5V A;  4A7A A;  2XLU A;  3RED A;  2X3N A;  3EAN A;  1IUS A;  1VQW A;  2XCG A;  4C77 A;  4U8M A;  2YM2 A;  2XLP A;  3NYC A;  1GXF A;  3T0K A;  3ITJ A;  4RG4 A;  4NEV A;  5GSN A;  5KMP A;  3AEA A;  2GQW A;  2ZZC A;  3P4R A;  4B67 A;  4AOX A;  1ZK7 A;  1K0I A;  3GRT A;  3GMC A;  3C96 A;  3AED A;  3CNP A;  3CN8 A;  4G6H A;  1PN0 A;  2GMJ A;  1LJ1 A;  2C4C A;  2VVL G;  3COX A;  1ZY8 A;  3AWI A;  1D4D A;  2B9W A;  1BWC A;  1CC6 A;  1DNC A;  1LVL A;  2R45 A;  3KLJ A;  2B9Y A;  2VVL A;  4H7U A;  3VRB A;  3B6D A;  2BS4 A;  4EQW A;  1S2Q A;  2GQF A;  3GDN A;  2GR3 A;  3NK0 X;  2YVG A;  1LQT A;  3AEF A;  3NN0 X;  1D4C A;  1ZOV A;  2JBV A;  3NIX A;  1FCD A;  3S5W A;  1YQ4 A;  2Z5Y A;  4N9X A;  1LPF A;  3T2Z A;  3ALJ A;  1NEN A;  3DA1 A;  4WCT A;  3H4K A;  4LII A;  4D03 A;  1AOG A;  2WHD A;  3M0O A;  3VRA A;  3AYL A;  4I59 A;  4AP1 A;  2V3A A;  1PXC A;  3AEB A;  2RGJ A;  3ATQ A;  4J57 A;  5KRQ A;  3OC4 A;  3UKH A;  1E7P A;  3ZDN A;  3NH3 X;  2AAQ A;  4KX6 A;  2YG5 A;  3DH9 A;  2VOU A;  4J33 A;  1V59 A;  4H4V A;  2V5Z A;  4Z2T A;  1RP0 A;  3QFA A;  1D7L A;  4U2L A;  4OVI A;  3VRD B;  2GR1 A;  1GTH A;  4EIQ A;  1NAA A;  4OCG A;  1KFY A;  1EL7 A;  1YQZ A;  3QFB A;  4CCQ A;  1TRB A;  3SY4 A;  2R9Z A;  4J31 A;  2YLS A;  1NHS A;  4K5R A;  3HYW A;  2X8C A;  3BI5 A;  1TDO A;  3AEC A;  3L1R A;  4JQ9 A;  2B76 A;  3RP7 A;  1DOC A;  5KWF A;  4LU6 A;  2QCU A;  1DJQ A;  1GTE A;  3CNJ A;  4Y4N A;  2IVD A;  4DNA A;  2VVM A;  1BGN A;  2BRY A;  2BRA A;  3UKK A;  2Z5X A;  4B64 A;  5CKU A;  3GRS A;  4U8P A;  1M6I A;  1GEU A;  4I58 A;  1YY5 A;  4H2R A;  1PJ7 A;  3LB8 A;  1QLB A;  3DJJ A;  4NTE A;  3M13 A;  4YTM A;  1EL9 A;  4J34 A;  3CGB A;  4EMJ A;  3NRN A;  3T2K A;  4DSG A;  1JRY A;  3UKL A;  4DSH A;  1NDA A;  1IUV A;  4LA1 A;  5U1O A;  1Q1W A;  4AP3 A;  4XWR A;  4RG3 A;  4U8L A;  2R0P A;  3BHK A;  2GB0 A;  3PO7 A;  2C75 A;  4TM0 A;  2WS3 A;  3QSS A;  3HYX A;  1Y56 B;  3LJP A;  2R4J A;  5J7X A;  3SX6 A;  2YQU A;  3K7M X;  1NHP A;  2X50 A;  3FG2 P;  3GYJ A;  2WPF A;  1H7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...