3ALMA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant c294a
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
370
structure length
370
Chain Sequence
b'KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMAPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 123
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3almA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3almA01
3IC9A 2WHDA 4TM4A 1EL8A 3AE8A 4ZN0A 1PBCA 3UKKA 1JNRA 2V5ZA 1Y56A 3UP5A 3LJPA 1TRBA 3AYIA 3NK0X 2YG7A 1BWCA 2OALA 3AEAA 1NG3A 2B7SA 2YG5A 3QJ4A 3COXA 3CTYA 3AXBA 5KVIA 5J60A 2JK6A 2XVJA 3EF6A 2Q0LA 4J36A 1NG4A 4A99A 5BULA 4FK1C 2BCPA 4MJWA 3AE2A 3UOYA 1E39A 4GF7A 1H83A 3QSEA 4IVOB 3DGZA 3GMBA 3DJDA 3NTAA 3K30A 4AT2A 1PXAA 1GREA 4BK2A 1IUTA 2BABA 2C65A 1GRBA 4X9NA 5FS6A 3KU9A 1XDIA 3Q6JA 3QVPA 4EQRA 2VRMA 2GVCA 2XVHA 4USQA 2X8CA 2GAHB 4U8MA 3UCLA 1NAAA 2IIDA 3BNUA 2C70A 3V3NA 4BJYA 3NKSA 1Y0PA 2YM2A 1BZLA 2BYBA 4B1BA 1VRQB 2XVEA 2JB1A 1M6IA 2B9WA 5HYMA 1Y56B 2J3NA 2RGJA 3SQPA 1QLBA 3BHFA 2XFNA 4AP3A 1GT8A 5CKUA 1FEBA 2GR1A 4K5RA 1PS9A 3FG2P 5EB5A 4DSHA 2Z5XA 3CPIG 4O5QA 3DK4A 2WBAA 1KF6A 1D4DA 1H86A 3G5SA 2X8GA 5U63A 4Z25A 2NPXA 3UKPA 2VVLG 1IUSA 3ICSA 2YLZA 3EANA 1ZDLA 5IPYA 1D5TA 2YLSA 4X4JA 3QFBA 3LZWA 2IVDA 1CJ3A 1HYUA 1P2HA 5KXJA 1FCDA 1QO8A 3L1RA 1S2YA 4I58A 3CGDA 1VG0A 4OPCA 3UKLA 1RYIA 2Y6QA 2BA9A 1E1NA 1NENA 2EQ8A 2VRLA 3AEGA 3NHOX 4APNA 4CBQA 1DNCA 2XYOA 2R4JA 3GD4A 1DOCA 2JBVA 3QVRA 1GRTA 4JDRA 4JN9A 2BS3A 1TDOA 1D7YA 1EL7A 5HHFA 2R0CA 2BC1A 1SEZA 2GQFA 2R4EA 4TLZA 1MOKA 2RGHA 3FIMB 3KLJA 4Y4LA 1EBDA 4H4RA 4RG4A 2XLPA 3AECA 4WCTA 3URHA 1IJHA 1B8SA 3OC4A 4C77A 2XFUA 2I0ZA 2A87A 4H4WA 4J56A 1ZOYA 4B69A 1N4VA 3VRDB 3UKAA 3UOXA 4BK1A 1GEUA 4ADWA 4CRTA 4EMJA 1PJ6A 4EQXA 1YQ4A 2VOUA 4KPRA 4HA6A 1GALA 2YM1A 3EAOA 4H4QA 4E0VA 3DGHA 3GWDA 4M52A 4YT0A 1PJ5A 1LPFA 2XLUA 1LJ1A 4YSYA 2C3DA 1JRYA 3OZ2A 2AR8A 5GSNA 3RP8A 3II4A 3UKQA 4JY2A 2PHHA 2GR0A 2VQBA 2WU2A 2VZ2A 2XLSA 2VVMA 4C74A 4CY6A 1QJDA 1X31B 1RP0A 4YTNA 1PXBA 1LQTA 4H2NA 2WU5A 5JCMA 1E1KA 1CC4A 2ZZCA 2GQWA 4GCMA 2QCUA 3G5QA 1OJAA 5BRTA 4U8JA 2YLRA 1LVLA 1MXTA 1IUWA 2Q7VA 3F8PA 2RGOA 1H7XA 1IUUA 3NGCX 2BK4A 4JQ9A 3H4KA 3I3LA 3QFAA 2FBWA 4K7ZA 1PHHA 2RABA 2R0GA 5FS9A 1F8WA 4U8OA 4CNKA 3UOZA 2R46A 4NEVA 5CQFA 4P9SA 3ICTA 3P1WA 3AE1A 4UDPA 4B63A 1KNPA 2E5VA 4B68A 3AD8B 3B3RA 1BKWA 3F8RA 1ZOVA 1TDKA 4YWOA 3CNTA 3NNEA 3VRAA 2AAQA 1F3PA 4OPUA 3K7MX 1D4CA 1K0LA 1DXLA 2XVIA 2CFYA 2V6OA 3AD7B 3PS9A 2TMDA 1ZKQA 1VDCA 4UDRA 1B5QA 1S3BA 3UKFA 4NTCA 1CC6A 2WOVA 3NK1X 3ATRA 3B6DA 2UZZA 5BUKA 3G5RA 4H4XA 4J33A 1TYTA 4NTDA 3DA1A 1E7PA 1O5WA 5KRQA 5GRTA 2WP9A 1XHCA 1PXCA 2GF3A 1GTHA 3P4RA 4EM4A 2BK3A 3NYFA 4LA1A 2VVLA 3UTGA 4H2RA 1CBOA 3AE6A 3H8IA 3Q9TA 1JOAA 3S61A 4FDCB 4K2XA 5JCNA 4JNAA 1BGNA 3NN0X 2WP5A 2C64A 3LZXA 1L9EA 1OJDA 2XFOA 4FX9A 2R9ZA 4IA5A 4OPGA 3ISHA 2GV8A 3DJEA 3UTFA 3CNDA 1PJ7A 2WOIA 3AB1A 3SFDA 2FJAA 4H4PA 3F8DA 2GB0A 4C3YA 1D4EA 2XFQA 3LXDA 1DODA 4OPIA 2YVJA 2GMHA 4A6NB 3I6DA 1KNRA 1S3EA 3IWAA 5KOXA 4HB9A 1EL5A 4YTMA 1OJ9A 2XFPA 3NLCA 3PO7A 3ALLA 1GRHA 3QSSA 4C3XA 1W4XA 5JCLA 4JNQA 1L0VA 4H4VA 1ONFA 2C66A 1H7WA 4CY8A 4EIPA 4TLXA 3CNPA 2C76A 1N4UA 4H4SA 4XWRA 4H2PA 3T37A 3ALJA 3DK8A 5L46A 1CJ4A 1IUXA 1GRAA 1GSNA 3KD9A 1S2QA 2ZZ0A 4EM3A 1E1MA 1VG9A 1NEKA 3BHKA 1H84A 4TM0A 1L9DA 4UP3A 1YQ3A 2O9ZA 2WOWA 5M10A 2EQ7A 4AOXA 1ELIA 3DJGX 1Q1WA 4H7UA 4U8IA 3VR9A 1CJ2A 1UKVG 2YAUA 4UDQA 5KWFA 4N9XA 2ARDA 3C96A 3KKJA 1PBDA 5U25A 2YVFA 2V61A 4OVIA 3AE4A 3SFEA 1CHUA 2W0HA 2ZZBA 3BNMA 3FMWA 4GRTA 1CC2A 2H88A 1NDAA 4OPDA 2XLTA 4WX1A 2B76A 3UOVA 1ZMCA 3P4SA 3V3OA 2YLWA 3CPJG 1GETA 1E6EA 4ZCDA 2C72A 2Q6UA 2WESA 4CCQA 4Z43A 1ZMDA 2JB3A 3IHMA 1CL0A 1F8RA 2JB2A 3ADAB 4A65A 3BI4A 4REKA 1V59A 2B9YA 3H8LA 3FBSA 2BS2A 2YWLA 4TM1A 4YSHA 3RP7A 4EMIA 1JRZA 1GOSA 1GRGA 1ZY8A 2H89A 1VQWA 3VQRA 1Q1RA 2EQ9A 3SGLA 3AD9B 4U2SA 1JNZA 3L8KA 4YSZA 4B64A 4U8KA 4K5SA 4U8PA 1PDHA 2WP6A 3C4NA 2YR4A 3LADA 5EOWA 3V76A 4GDEA 3M13A 1YQZA 2E1MA 1LV0A 4I59A 4J2WA 2WQYA 1DJQA 3IF9A 5M0ZA 1O94A 1PBEA 2X8HA 3GRSA 5ER0A 2YQUA 2YR6A 4NTEA 4BV6A 2DKIA 1P2EA 4USRA 3CNJA 1L9CA 4GR1A 3GMCA 3UTEA 2GRTA 1TDNA 3ZDNA 2GEWA 2GMJA 2YR5A 5IQ4A 2XCGA 3AYLA 1NHSA 3CGEA 2F5ZA 2CULA 1GESA 1K4QA 4D04A 3AE9A 2XDOA 4Z44A 1M64A 5KOWA 1JEHA 3AYJA 3GSIA 1Q9IA 4K8DA 4PABA 4PAAA 4A9WA 3SM8A 2WS3A 1KDGA 1EL9A 4C5OA 3C4AA 3VR8A 1PBBA 2FJBA 5EB4A 1KSSA 4A6NA 4H50A 1N4WA 2YLXA 2WPCA 5FS8A 3ATQA 2E4GA 1IUVA 2QA2A 3D8XA 4OPLA 1MO9A 4DNAA 3AEBA 2HQMA 4TM3A 4J34A 4A79A 4GUVA 4Z2TA 1OJTA 1XPQA 3AE7A 3ABVA 4YKFA 3E1TA 4EIQA 1DJNA 1NPXA 2XVFA 3AEEA 4CCRA 1GV4A 2WDRA 4RG3A 3RHAA 4J57A 4BK3A 3GYJA 1XANA 4LIIA 1TDEA 2GR2A 2X99A 1GXFA 2PYXA 1H6VA 4IV9A 3UP4A 1D7LA 5U1OA 3UTHA 1RSGA 1GERA 1GNDA 3GWFA 2BCGG 3LB8A 2VQ7A 4NZHA 5HY5A 4U8LA 3CPHG 1DOEA 5J7XA 4YXDA 1YY5A 4U2LA 4Z24A 1ZK7A 1O95A 3CGBA 3ITJA 4YSXA 4AT0A 3RP6A 3GDNA 4XWZA 2OLNA 4H2QA 4IVMB 2BXSA 3P9UA 2FJEA 2BACA 4EMWA 3R9UA 2WEUA 2OA1A 2XLRA 5BVAA 2BK5A 3QSMA 3HZLA 3AEFA 2Y6RA 2ZBWA 3VRBA 4BJZA 2Z5YA 5FS7A 3GYIA 3M0OA 3NTDA 1LQUA 2V3BA 3NG7X 5LV9A 1N1PA 4H4YA 1GPEA 4DGKA 3FPZA 1H82A 4A7AA 2BXRA 1FECA 1FEAA 2EQ6A 5KVHA 4BURA 2WETA 3GRTA 3NIXA 4Y4MA 5TR3A 1JRXA 1AOGA 1PBFA 4O5UA 5JCKA 1COYA 3NYEA 1TDFA 2CVJA 4K22A 1NHPA 3REDA 1E1LA 1YKJA 3K7TA 4KX6A 5C3JA 3AWIA 2YG6A 3CGCA 3GD3A 4ZCCA 2B7RA 4Z26A 2A89A 1ZX9A 3S5WA 3BI2A 3NN6X 4NEWA 5JCIA 3LOVA 1K0IA 2NVKX 1CF3A 1FL2A 1Z6LA 2X50A 3KPFA 4GDPA 1B4VA 3PVCA 4EQSA 4JY3A 1KFYA 4YTPA 2WDQA 3DJJA 2JKCA 2WDVA 3DK9A 5DBJA 3IHGA 3KVEA 4CNJA 2GR3A 2V3AA 5EBKA 1FOHA 2C73A 2WPFA 4A5LA 2IVEA 2APGA 2YVGA 2BS4A 3KA7A 2WPEA 1GTEA 3CN8A 1F8SA 1B37A 4J31A 2QA1A 4XXGA 2R45A 5IQ1A 4AP1A 4RSLA 3AE5A 2C75A 1H81A 1PN0A 1K0JA 3DMEA 1CJCA 1DOBA 2C3CA 4Y4NA 2C7GA 1JU2A 3UKHA 3WE0A 2BC0A 1KSUA 2AQJA 1NHQA 1GRFA 3CIRA 4U2TA 4Z2RA 4ICYA 3EPTA 4B65A 4D03A 1ZP0A 2CDUA 2GH5A 3ALMA 1BF3A 2YG3A 3ICRA 3NK2X 3CNSA 3M12A 2OLOA 1NHRA 3NT6A 3P4QA 3D1CA 2C67A 3P4PA 2FJDA 4LU6A 1BGJA 4FK1A 4AOSA 3NH3X 3JSKA 3RNMA 4H4TA 5C2TA 1F6MA 3NRNA 2GAGB 4IA6A 4OCGA 3ZYXA 1REOA 1OJCA 5FMHA 1LTXR 4H4UA 2B9XA 2YG4A 4Z2UA 2DKHA 4EQWA 3AEDA 1TYPA 3GDPA 2V60A 4H4ZA 3DH9A 3K7QX 4YKGA 4X9MA 2YLTA 4DSGA 2Q0KA 3NYCA 3O0HA 4B66A 2JAEA 4OPTA 2TPRA 2X3NA 3BI5A 2ACZA 3AE3A 2QAEA 2A8XA 2OAMA 4U8NA 4ECHA 2R0PA 5HXIA 4B67A
chains in the Genus database with same CATH superfamily
3IC9A 2WHDA 4TM4A 1EL8A 3AE8A 3T2ZA 1PBCA 3T31A 3UKKA 1JNRA 2V5ZA 4ZN0A 1Y56A 3UP5A 3LJPA 4YJHA 1TRBA 3AYIA 3NK0X 2YG7A 1BWCA 2OALA 3AEAA 1NG3A 1EVIA 2B7SA 2YG5A 3QJ4A 3COXA 3WGTA 3CTYA 3AXBA 5KVIA 3T14A 5J60A 2JK6A 2XVJA 3EF6A 2Q0LA 4J36A 1NG4A 4A99A 5BULA 4FK1C 2BCPA 4G6HA 4MJWA 3AE2A 3UOYA 3QSEA 4GF7A 1E39A 1H83A 4IVOB 3DGZA 3DJDA 3GMBA 3NTAA 3K30A 4AT2A 1PXAA 4BK2A 1GREA 1IUTA 2BABA 4X9NA 1GRBA 2C65A 5FS6A 3KU9A 1XDIA 3Q6JA 3QVPA 4NNJA 2VRMA 4EQRA 2GVCA 2XVHA 4USQA 2X8CA 2GAHB 4II3A 4U8MA 3UCLA 1NAAA 2IIDA 4BJYA 2C70A 3BNUA 3V3NA 3NKSA 1Y0PA 4G73A 2YM2A 1BZLA 5HYMA 2BYBA 1VRQB 2XVEA 2JB1A 1M6IA 2B9WA 4B1BA 1Y56B 2RGJA 2J3NA 3ZNPA 1QLBA 3SQPA 2E48A 3BHFA 2XFNA 4AP3A 1GT8A 5CKUA 1FEBA 2GR1A 4K5RA 1PS9A 3FG2P 5EB5A 3T2YA 4DSHA 2Z5XA 3SY4A 3CPIG 4O5QA 3DK4A 2WBAA 1KF6A 1D4DA 1H86A 3G5SA 2X8GA 4GAVA 5U63A 4Z25A 2NPXA 3UKPA 2VVLG 4YJFA 1IUSA 1VE9A 3ICSA 2YLZA 3EANA 1DDOA 1ZDLA 5IPYA 1D5TA 2YLSA 4X4JA 3QFBA 3LZWA 2IVDA 1CJ3A 1HYUA 1P2HA 5KXJA 1FCDA 1QO8A 3L1RA 1S2YA 4I58A 3CGDA 1VG0A 4OPCA 3SX6A 3UKLA 3GYXA 1RYIA 2Y6QA 2BA9A 1E1NA 1NENA 2EQ8A 2VRLA 3AEGA 3NHOX 4APNA 4CBQA 1DNCA 2XYOA 2R4JA 3GD4A 1DOCA 2JBVA 3QVRA 1GRTA 4JDRA 4JN9A 2BS3A 1TDOA 1D7YA 1EL7A 5HHFA 2R0CA 2BC1A 1SEZA 2R4EA 2GQFA 4TLZA 2RGHA 1MOKA 3FIMB 3KLJA 4Y4LA 1EBDA 4G74A 4H4RA 4WCTA 2XLPA 3AECA 4RG4A 3URHA 1IJHA 1DAOA 1B8SA 3OC4A 2XFUA 2I0ZA 2A87A 4H4WA 4J56A 1ZOYA 4B69A 1N4VA 3VRDB 3UKAA 3UOXA 4BK1A 1GEUA 4ADWA 4CRTA 4EMJA 1PJ6A 4EQXA 2VOUA 1YQ4A 4KPRA 4HA6A 1GALA 2YM1A 3EAOA 4H4QA 4E0VA 3DGHA 3GWDA 4M52A 3SYIA 4YT0A 1PJ5A 1LPFA 2XLUA 1LJ1A 4YSYA 2C3DA 1JRYA 3OZ2A 2AR8A 5GSNA 3RP8A 3II4A 3UKQA 4JY2A 2PHHA 2GR0A 2VQBA 2WU2A 2VZ2A 2XLSA 2VVMA 4C74A 4CY6A 1X31B 1QJDA 1RP0A 4YTNA 1PXBA 1LQTA 4H2NA 2WU5A 5JCMA 1CC4A 1E1KA 2ZZCA 2GQWA 4GCMA 2QCUA 3G5QA 1OJAA 5BRTA 4U8JA 2YLRA 1LVLA 1MXTA 1IUWA 2Q7VA 3F8PA 2RGOA 1H7XA 1IUUA 3NGCX 2BK4A 4JQ9A 3H4KA 3I3LA 3QFAA 2FBWA 4K7ZA 1PHHA 2RABA 2R0GA 5FS9A 1F8WA 4U8OA 4CNKA 2C4CA 3UOZA 2R46A 4NEVA 5CQFA 4P9SA 3ICTA 3P1WA 3AE1A 4UDPA 4B63A 1KNPA 2E5VA 4B68A 3AD8B 3B3RA 1BKWA 3F8RA 1ZOVA 1TDKA 4YWOA 3CNTA 3NNEA 3VRAA 2AAQA 1F3PA 1C0LA 3K7MX 4OPUA 1D4CA 1K0LA 1DXLA 2XVIA 2CFYA 3AD7B 2V6OA 3PS9A 3ZNOA 1ZKQA 1VDCA 2TMDA 4UDRA 1B5QA 1S3BA 3UKFA 4NTCA 1CC6A 2WOVA 3NK1X 3ATRA 3B6DA 5KMSA 2UZZA 5BUKA 3G5RA 4H4XA 4J33A 1TYTA 4NTDA 3DA1A 1E7PA 1O5WA 5KRQA 5GRTA 2WP9A 1XHCA 1PXCA 2GF3A 1GTHA 3P4RA 4EM4A 2BK3A 3NYFA 4LA1A 2VVLA 3UTGA 4H2RA 1CBOA 3AE6A 3H8IA 3T0KA 3Q9TA 3ZNQA 1JOAA 3S61A 4FDCB 4K2XA 5JCNA 4JNAA 1BGNA 3NN0X 2WP5A 2C64A 3LZXA 1L9EA 1OJDA 2XFOA 4FX9A 2R9ZA 4IA5A 4OPGA 3ISHA 2GV8A 4G9KA 3DJEA 3UTFA 3CNDA 1PJ7A 2WOIA 3AB1A 3SFDA 2FJAA 4H4PA 3F8DA 2GB0A 4C3YA 1D4EA 2XFQA 3LXDA 1DODA 2DU8A 4OPIA 2YVJA 2GMHA 4G6GA 4A6NB 3I6DA 1KNRA 1S3EA 3IWAA 5KOXA 4HB9A 1EL5A 4YTMA 3QSSA 1OJ9A 2XFPA 3NLCA 3ALLA 1GRHA 3PO7A 4C3XA 4C77A 1W4XA 5JCLA 4JNQA 1L0VA 4H4VA 3CMMA 1ONFA 2C66A 1H7WA 4CY8A 4EIPA 4TLXA 3CNPA 2C76A 1N4UA 4H4SA 4XWRA 4H2PA 5L46A 3ALJA 3DK8A 3T37A 1CJ4A 1IUXA 1GRAA 1GSNA 3KD9A 1S2QA 2ZZ0A 4EM3A 1E1MA 1VG9A 1NEKA 3BHKA 1H84A 4TM0A 4YJDA 1L9DA 4UP3A 1YQ3A 2O9ZA 2WOWA 3SZ0A 5M10A 2EQ7A 4AOXA 1ELIA 3DJGX 1Q1WA 4H7UA 4U8IA 3VR9A 1CJ2A 1UKVG 2YAUA 4UDQA 5KWFA 4N9XA 2ARDA 3C96A 3KKJA 1PBDA 5U25A 2YVFA 2V61A 4OVIA 3AE4A 3SFEA 1CHUA 2W0HA 2ZZBA 3BNMA 3FMWA 4GRTA 1CC2A 2H88A 1NDAA 4OPDA 2XLTA 4WX1A 2B76A 3UOVA 1ZMCA 3P4SA 3V3OA 2YLWA 3CPJG 1GETA 1E6EA 4ZCDA 2C72A 2Q6UA 4YJGB 2WESA 4CCQA 4Z43A 1ZMDA 2JB3A 3IHMA 1CL0A 1C0IA 1F8RA 3ADAB 2JB2A 4A65A 3BI4A 4REKA 1V59A 2B9YA 3H8LA 3FBSA 2BS2A 2YWLA 4TM1A 4YSHA 3RP7A 4EMIA 1JRZA 3VQRA 1GRGA 1GOSA 1ZY8A 1VQWA 2H89A 1Q1RA 3SGLA 2EQ9A 3AD9B 4U2SA 1JNZA 3L8KA 4YSZA 4B64A 4U8KA 4K5SA 4U8PA 1PDHA 2WP6A 3C4NA 2YR4A 3LADA 5EOWA 3V76A 4GDEA 3M13A 1YQZA 2E1MA 1LV0A 4I59A 4J2WA 2WQYA 1DJQA 3IF9A 3HYWA 5M0ZA 1C0PA 1O94A 1PBEA 2X8HA 3GRSA 5ER0A 2YQUA 2YR6A 4NTEA 4BV6A 2DKIA 1P2EA 4USRA 3SXIA 3CNJA 1L9CA 4GR1A 3GMCA 3W4IA 3UTEA 2GRTA 1TDNA 3ZDNA 2GEWA 2GMJA 2YR5A 3HYVA 2XCGA 3AYLA 1NHSA 3HYXA 5IQ4A 3CGEA 2F5ZA 2CULA 1GESA 1K4QA 3CUKA 4D04A 3AE9A 2XDOA 5KMQA 5KMRA 4Z44A 1M64A 5KOWA 3GSIA 1JEHA 3AYJA 1Q9IA 4K8DA 4PABA 4PAAA 4A9WA 3SM8A 2WS3A 1KDGA 1EL9A 4C5OA 3C4AA 3VR8A 1PBBA 2FJBA 5EB4A 1KSSA 4A6NA 4H50A 1N4WA 2YLXA 2WPCA 5FS8A 3ATQA 2E4GA 1IUVA 4GAPA 2QA2A 3D8XA 4OPLA 1MO9A 4DNAA 3AEBA 2HQMA 4TM3A 3SZFA 4J34A 4A79A 4GUVA 4Z2TA 1OJTA 5KMPA 1XPQA 3AE7A 3ABVA 4YKFA 3E1TA 4EIQA 1DJNA 1NPXA 2XVFA 3AEEA 4CCRA 1GV4A 2WDRA 3KPKA 4RG3A 3RHAA 4J57A 4BK3A 3GYJA 2BRAA 1XANA 4LIIA 1TDEA 2GR2A 2X99A 1GXFA 2PYXA 4NWZA 1H6VA 4QFCA 4IV9A 3UP4A 1D7LA 5U1OA 3UTHA 1RSGA 1GERA 1GNDA 2E49A 3GWFA 2BCGG 3G3EA 2VQ7A 3LB8A 4NZHA 5HY5A 4U8LA 3CPHG 1DOEA 5J7XA 4YXDA 1YY5A 4U2LA 4Z24A 1ZK7A 1O95A 3CGBA 3ITJA 4YSXA 4AT0A 3RP6A 1AN9A 4XWZA 2OLNA 4H2QA 3GDNA 4IVMB 2BXSA 3P9UA 4II2A 2FJEA 3T2KA 2BACA 4YJGA 4YJHB 4EMWA 3R9UA 2WEUA 2OA1A 2XLRA 5BVAA 2BK5A 3QSMA 3HZLA 3AEFA 4BJZA 2Y6RA 2ZBWA 3VRBA 2Z5YA 5FS7A 3GYIA 3M0OA 3NTDA 1LQUA 2V3BA 3NG7X 5LV9A 1N1PA 4H4YA 1GPEA 4DGKA 3FPZA 1H82A 4A7AA 2BXRA 1FECA 1FEAA 2EQ6A 5KVHA 4BURA 2WETA 3GRTA 3NIXA 4Y4MA 5TR3A 1JRXA 1AOGA 1PBFA 4O5UA 5JCKA 1COYA 3NYEA 1TDFA 2CVJA 4K22A 1NHPA 3REDA 1E1LA 1YKJA 3K7TA 4KX6A 5C3JA 3AWIA 2YG6A 3CGCA 3GD3A 4ZCCA 2B7RA 4Z26A 2A89A 1ZX9A 3S5WA 3BI2A 3NN6X 4NEWA 5JCIA 3LOVA 1K0IA 2NVKX 1CF3A 1FL2A 1Z6LA 2X50A 3KPFA 4GDPA 1B4VA 3PVCA 4EQSA 4JY3A 1KFYA 4YTPA 2WDQA 3DJJA 2JKCA 2WDVA 3DK9A 5DBJA 3IHGA 3KVEA 1C0KA 4CNJA 2GR3A 2V3AA 5EBKA 1FOHA 2C73A 2WPFA 4A5LA 2IVEA 2APGA 2YVGA 2BS4A 3KA7A 2WPEA 1GTEA 3CN8A 1F8SA 1B37A 4J31A 2QA1A 4XXGA 2R45A 5IQ1A 4AP1A 2E4AA 4RSLA 3AE5A 2C75A 1H81A 3W4KA 4YJFB 1PN0A 1K0JA 3DMEA 1DOBA 1CJCA 2C3CA 4Y4NA 2C7GA 1JU2A 3UKHA 3WE0A 2BC0A 1KSUA 2AQJA 1NHQA 1GRFA 3CIRA 4U2TA 4Z2RA 4ICYA 3EPTA 4B65A 4D03A 1ZP0A 2CDUA 2GH5A 3ALMA 1BF3A 2YG3A 3ICRA 3NK2X 3ZNNA 3CNSA 3M12A 2OLOA 1NHRA 3NT6A 3P4QA 3D1CA 2C67A 3P4PA 3SZCA 2FJDA 4LU6A 1BGJA 4FK1A 5KNLA 1KIFA 3NH3X 4AOSA 3JSKA 3RNMA 4H4TA 2BRYA 5C2TA 1F6MA 4IA6A 2GAGB 3NRNA 4OCGA 3ZYXA 3W4JA 4QFDA 1OJCA 1REOA 5FMHA 1LTXR 4H4UA 2B9XA 2YG4A 4Z2UA 2DKHA 3SZWA 4EQWA 3AEDA 1TYPA 3GDPA 2V60A 4H4ZA 3DH9A 3K7QX 4YKGA 4X9MA 2YLTA 4DSGA 2Q0KA 3NYCA 3O0HA 4B66A 2JAEA 4OPTA 2TPRA 2X3NA 3BI5A 2ACZA 3AE3A 2QAEA 2A8XA 2OAMA 4U8NA 4ECHA 2R0PA 5HXIA 4B67A 2E82A
chains in the Genus database with same CATH topology
3IC9A 2WHDA 4TM4A 1EL8A 3AE8A 3T2ZA 1PBCA 3T31A 3UKKA 1JNRA 2V5ZA 4ZN0A 1Y56A 3UP5A 3LJPA 1TRBA 3AYIA 3NK0X 2YG7A 1BWCA 2OALA 3AEAA 1NG3A 2B7SA 2YG5A 3QJ4A 3COXA 3CTYA 3AXBA 5KVIA 3T14A 5J60A 2JK6A 2XVJA 3EF6A 2Q0LA 4J36A 1NG4A 4A99A 5BULA 4FK1C 2BCPA 4G6HA 4MJWA 3AE2A 3UOYA 1E39A 4GF7A 1H83A 3QSEA 4IVOB 3DGZA 3GMBA 3DJDA 3NTAA 3K30A 4AT2A 1PXAA 4BK2A 1GREA 1IUTA 2BABA 2C65A 1GRBA 4X9NA 5FS6A 3KU9A 1XDIA 3Q6JA 3QVPA 4NNJA 2VRMA 4EQRA 2GVCA 2XVHA 4USQA 2X8CA 2GAHB 4II3A 4U8MA 3UCLA 1NAAA 2IIDA 4BJYA 2C70A 3BNUA 3V3NA 3NKSA 1Y0PA 4G73A 2YM2A 1BZLA 5HYMA 2BYBA 1VRQB 2XVEA 2JB1A 1M6IA 2B9WA 4B1BA 2RGJA 1Y56B 2J3NA 3SQPA 1QLBA 3BHFA 2XFNA 4AP3A 1GT8A 5CKUA 1FEBA 2GR1A 4K5RA 1PS9A 3FG2P 5EB5A 3T2YA 4DSHA 2Z5XA 3SY4A 3CPIG 4O5QA 3DK4A 2WBAA 1KF6A 1D4DA 1H86A 3G5SA 2X8GA 4GAVA 5U63A 4Z25A 2NPXA 3UKPA 2VVLG 1IUSA 3ICSA 2YLZA 3EANA 1ZDLA 5IPYA 1D5TA 2YLSA 4X4JA 3QFBA 3LZWA 2IVDA 1CJ3A 1HYUA 1P2HA 5KXJA 1FCDA 1QO8A 3L1RA 1S2YA 4I58A 3CGDA 1VG0A 4OPCA 3SX6A 3UKLA 3GYXA 1RYIA 2Y6QA 2BA9A 1E1NA 1NENA 2EQ8A 2VRLA 3AEGA 3NHOX 4APNA 4CBQA 1DNCA 2XYOA 2R4JA 3GD4A 1DOCA 2JBVA 3QVRA 1GRTA 4JDRA 4JN9A 2BS3A 1TDOA 1D7YA 1EL7A 5HHFA 2R0CA 2BC1A 1SEZA 2GQFA 2R4EA 4TLZA 1MOKA 2RGHA 3FIMB 3KLJA 4Y4LA 1EBDA 4G74A 4H4RA 4RG4A 2XLPA 3AECA 4WCTA 3URHA 1IJHA 1B8SA 3OC4A 4C77A 2XFUA 2I0ZA 2A87A 4H4WA 4J56A 1ZOYA 4B69A 1N4VA 3VRDB 3UKAA 3UOXA 4BK1A 1GEUA 4ADWA 4CRTA 4EMJA 1PJ6A 4EQXA 2VOUA 1YQ4A 4KPRA 4HA6A 1GALA 2YM1A 3EAOA 4H4QA 4E0VA 3DGHA 3GWDA 4M52A 3SYIA 4YT0A 1PJ5A 1LPFA 2XLUA 1LJ1A 4YSYA 2C3DA 1JRYA 3OZ2A 2AR8A 5GSNA 3RP8A 3II4A 3UKQA 4JY2A 2PHHA 2GR0A 2VQBA 2WU2A 2VZ2A 2XLSA 2VVMA 4C74A 4CY6A 1QJDA 1X31B 1RP0A 4YTNA 1PXBA 1LQTA 4H2NA 2WU5A 5JCMA 1E1KA 1CC4A 2ZZCA 2GQWA 4GCMA 2QCUA 3G5QA 1OJAA 5BRTA 4U8JA 2YLRA 1LVLA 1MXTA 1IUWA 2Q7VA 3F8PA 2RGOA 1H7XA 1IUUA 3NGCX 2BK4A 4JQ9A 3H4KA 3I3LA 3QFAA 2FBWA 4K7ZA 1PHHA 2RABA 2R0GA 5FS9A 1F8WA 4U8OA 4CNKA 2C4CA 3UOZA 2R46A 4NEVA 5CQFA 4P9SA 3ICTA 3P1WA 3AE1A 4UDPA 4B63A 1KNPA 2E5VA 4B68A 3AD8B 3B3RA 1BKWA 3F8RA 1ZOVA 1TDKA 4YWOA 3CNTA 3NNEA 3VRAA 2AAQA 1F3PA 4OPUA 3K7MX 1D4CA 1K0LA 1DXLA 2XVIA 2CFYA 2V6OA 3AD7B 3PS9A 2TMDA 1ZKQA 1VDCA 4UDRA 1B5QA 1S3BA 3UKFA 4NTCA 1CC6A 2WOVA 3NK1X 3ATRA 3B6DA 5KMSA 2UZZA 5BUKA 3G5RA 4H4XA 4J33A 1TYTA 4NTDA 3DA1A 1E7PA 1O5WA 5KRQA 5GRTA 2WP9A 1XHCA 1PXCA 2GF3A 1GTHA 3P4RA 4EM4A 2BK3A 3NYFA 4LA1A 2VVLA 3UTGA 4H2RA 1CBOA 3AE6A 3H8IA 3T0KA 3Q9TA 1JOAA 3S61A 4FDCB 4K2XA 5JCNA 4JNAA 1BGNA 3NN0X 2WP5A 2C64A 3LZXA 1L9EA 1OJDA 2XFOA 4FX9A 2R9ZA 4IA5A 4OPGA 3ISHA 2GV8A 4G9KA 3DJEA 3UTFA 3CNDA 1PJ7A 2WOIA 3AB1A 3SFDA 2FJAA 4H4PA 3F8DA 2GB0A 4C3YA 1D4EA 2XFQA 3LXDA 1DODA 4OPIA 2YVJA 2GMHA 4G6GA 4A6NB 3I6DA 1KNRA 1S3EA 3IWAA 5KOXA 4HB9A 1EL5A 4YTMA 1OJ9A 2XFPA 3NLCA 3PO7A 3ALLA 1GRHA 3QSSA 4C3XA 1W4XA 5JCLA 4JNQA 1L0VA 4H4VA 3CMMA 1ONFA 2C66A 1H7WA 4CY8A 4EIPA 4TLXA 3CNPA 2C76A 1N4UA 4H4SA 4XWRA 4H2PA 3T37A 3ALJA 3DK8A 5L46A 1CJ4A 1IUXA 1GRAA 1GSNA 3KD9A 1S2QA 2ZZ0A 4EM3A 1E1MA 1VG9A 1NEKA 3BHKA 1H84A 4TM0A 1L9DA 4UP3A 1YQ3A 2O9ZA 2WOWA 3SZ0A 5M10A 2EQ7A 4AOXA 1ELIA 3DJGX 1Q1WA 4H7UA 4U8IA 3VR9A 1CJ2A 1UKVG 2YAUA 4UDQA 5KWFA 4N9XA 2ARDA 3C96A 3KKJA 1PBDA 5U25A 2YVFA 2V61A 4OVIA 3AE4A 3SFEA 1CHUA 2W0HA 2ZZBA 3BNMA 3FMWA 4GRTA 1CC2A 2H88A 1NDAA 4OPDA 2XLTA 4WX1A 2B76A 3UOVA 1ZMCA 3P4SA 3V3OA 2YLWA 3CPJG 1GETA 1E6EA 4ZCDA 2C72A 2Q6UA 2WESA 4CCQA 4Z43A 1ZMDA 2JB3A 3IHMA 1CL0A 1F8RA 2JB2A 3ADAB 4A65A 3BI4A 4REKA 1V59A 2B9YA 3H8LA 3FBSA 2BS2A 2YWLA 4TM1A 4YSHA 3RP7A 4EMIA 1JRZA 1GOSA 1GRGA 1ZY8A 2H89A 1VQWA 3VQRA 1Q1RA 2EQ9A 3SGLA 3AD9B 4U2SA 1JNZA 3L8KA 4YSZA 4B64A 4U8KA 4K5SA 4U8PA 1PDHA 2WP6A 3C4NA 2YR4A 3LADA 5EOWA 3V76A 4GDEA 3M13A 1YQZA 2E1MA 1LV0A 4I59A 4J2WA 2WQYA 1DJQA 3HYWA 3IF9A 5M0ZA 1O94A 1PBEA 2X8HA 3GRSA 5ER0A 2YQUA 2YR6A 4NTEA 4BV6A 2DKIA 1P2EA 4USRA 3SXIA 3CNJA 1L9CA 4GR1A 3GMCA 3UTEA 2GRTA 1TDNA 3ZDNA 2GEWA 2GMJA 2YR5A 3HYVA 2XCGA 3AYLA 1NHSA 3HYXA 5IQ4A 3CGEA 2F5ZA 2CULA 1GESA 1K4QA 4D04A 5KMRA 3AE9A 2XDOA 5KMQA 4Z44A 1M64A 5KOWA 1JEHA 3AYJA 3GSIA 1Q9IA 4K8DA 4PABA 4PAAA 4A9WA 3SM8A 2WS3A 1KDGA 1EL9A 4C5OA 3C4AA 3VR8A 1PBBA 2FJBA 5EB4A 1KSSA 4A6NA 4H50A 1N4WA 2YLXA 2WPCA 5FS8A 3ATQA 2E4GA 1IUVA 4GAPA 2QA2A 3D8XA 4OPLA 1MO9A 4DNAA 3AEBA 2HQMA 4TM3A 3SZFA 4J34A 4A79A 4GUVA 4Z2TA 1OJTA 5KMPA 1XPQA 3AE7A 3ABVA 4YKFA 3E1TA 4EIQA 1DJNA 1NPXA 2XVFA 3AEEA 4CCRA 1GV4A 2WDRA 3KPKA 4RG3A 3RHAA 4J57A 4BK3A 3GYJA 2BRAA 1XANA 4LIIA 1TDEA 2GR2A 2X99A 1GXFA 2PYXA 4NWZA 1H6VA 4IV9A 3UP4A 1D7LA 5U1OA 3UTHA 1RSGA 1GERA 1GNDA 3GWFA 2BCGG 3LB8A 2VQ7A 4NZHA 5HY5A 4U8LA 3CPHG 1DOEA 5J7XA 4YXDA 1YY5A 4U2LA 4Z24A 1ZK7A 1O95A 3CGBA 3ITJA 4YSXA 4AT0A 3RP6A 3GDNA 4XWZA 2OLNA 4H2QA 4IVMB 2BXSA 3P9UA 4II2A 2FJEA 3T2KA 2BACA 4EMWA 3R9UA 2WEUA 2OA1A 2XLRA 5BVAA 2BK5A 3QSMA 3HZLA 3AEFA 4BJZA 2Y6RA 2ZBWA 3VRBA 2Z5YA 5FS7A 3GYIA 3M0OA 3NTDA 1LQUA 2V3BA 3NG7X 5LV9A 1N1PA 4H4YA 1GPEA 4DGKA 3FPZA 1H82A 4A7AA 2BXRA 1FECA 1FEAA 2EQ6A 5KVHA 4BURA 2WETA 3GRTA 3NIXA 4Y4MA 5TR3A 1JRXA 1AOGA 1PBFA 4O5UA 5JCKA 1COYA 3NYEA 1TDFA 2CVJA 4K22A 1NHPA 3REDA 1E1LA 1YKJA 3K7TA 4KX6A 5C3JA 3AWIA 2YG6A 3CGCA 3GD3A 4ZCCA 2B7RA 4Z26A 2A89A 1ZX9A 3S5WA 3BI2A 3NN6X 4NEWA 5JCIA 3LOVA 1K0IA 2NVKX 1CF3A 1FL2A 1Z6LA 2X50A 3KPFA 4GDPA 1B4VA 3PVCA 4EQSA 4JY3A 1KFYA 4YTPA 2WDQA 3DJJA 2JKCA 2WDVA 3DK9A 5DBJA 3IHGA 3KVEA 4CNJA 2GR3A 2V3AA 5EBKA 1FOHA 2C73A 2WPFA 4A5LA 2IVEA 2APGA 2YVGA 2BS4A 3KA7A 2WPEA 1GTEA 3CN8A 1F8SA 1B37A 4J31A 2QA1A 4XXGA 2R45A 5IQ1A 4AP1A 4RSLA 3AE5A 2C75A 1H81A 1PN0A 1K0JA 3DMEA 1CJCA 1DOBA 2C3CA 4Y4NA 2C7GA 1JU2A 3UKHA 3WE0A 2BC0A 1KSUA 2AQJA 1NHQA 1GRFA 3CIRA 4U2TA 4Z2RA 4ICYA 3EPTA 4B65A 4D03A 1ZP0A 2CDUA 2GH5A 3ALMA 1BF3A 2YG3A 3ICRA 3NK2X 3CNSA 3M12A 2OLOA 1NHRA 3NT6A 3P4QA 3D1CA 2C67A 3P4PA 3SZCA 2FJDA 4LU6A 1BGJA 4FK1A 5KNLA 4AOSA 3NH3X 3JSKA 3RNMA 4H4TA 2BRYA 5C2TA 1F6MA 4IA6A 2GAGB 3NRNA 4OCGA 3ZYXA 1REOA 1OJCA 5FMHA 1LTXR 4H4UA 2B9XA 2YG4A 4Z2UA 2DKHA 3SZWA 4EQWA 3AEDA 1TYPA 3GDPA 2V60A 4H4ZA 3DH9A 3K7QX 4YKGA 4X9MA 2YLTA 4DSGA 2Q0KA 3NYCA 3O0HA 4B66A 2JAEA 4OPTA 2TPRA 2X3NA 3BI5A 2ACZA 3AE3A 2QAEA 2A8XA 2OAMA 4U8NA 4ECHA 2R0PA 5HXIA 4B67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IC9 A;  2WHD A;  4TM4 A;  1EL8 A;  3AE8 A;  4ZN0 A;  1PBC A;  3UKK A;  1JNR A;  2V5Z A;  1Y56 A;  3UP5 A;  3LJP A;  1TRB A;  3AYI A;  3NK0 X;  2YG7 A;  1BWC A;  2OAL A;  3AEA A;  1NG3 A;  2B7S A;  2YG5 A;  3QJ4 A;  3COX A;  3CTY A;  3AXB A;  5KVI A;  5J60 A;  2JK6 A;  2XVJ A;  3EF6 A;  2Q0L A;  4J36 A;  1NG4 A;  4A99 A;  5BUL A;  4FK1 C;  2BCP A;  4MJW A;  3AE2 A;  3UOY A;  1E39 A;  4GF7 A;  1H83 A;  3QSE A;  4IVO B;  3DGZ A;  3GMB A;  3DJD A;  3NTA A;  3K30 A;  4AT2 A;  1PXA A;  1GRE A;  4BK2 A;  1IUT A;  2BAB A;  2C65 A;  1GRB A;  4X9N A;  5FS6 A;  3KU9 A;  1XDI A;  3Q6J A;  3QVP A;  4EQR A;  2VRM A;  2GVC A;  2XVH A;  4USQ A;  2X8C A;  2GAH B;  4U8M A;  3UCL A;  1NAA A;  2IID A;  3BNU A;  2C70 A;  3V3N A;  4BJY A;  3NKS A;  1Y0P A;  2YM2 A;  1BZL A;  2BYB A;  4B1B A;  1VRQ B;  2XVE A;  2JB1 A;  1M6I A;  2B9W A;  5HYM A;  1Y56 B;  2J3N A;  2RGJ A;  3SQP A;  1QLB A;  3BHF A;  2XFN A;  4AP3 A;  1GT8 A;  5CKU A;  1FEB A;  2GR1 A;  4K5R A;  1PS9 A;  3FG2 P;  5EB5 A;  4DSH A;  2Z5X A;  3CPI G;  4O5Q A;  3DK4 A;  2WBA A;  1KF6 A;  1D4D A;  1H86 A;  3G5S A;  2X8G A;  5U63 A;  4Z25 A;  2NPX A;  3UKP A;  2VVL G;  1IUS A;  3ICS A;  2YLZ A;  3EAN A;  1ZDL A;  5IPY A;  1D5T A;  2YLS A;  4X4J A;  3QFB A;  3LZW A;  2IVD A;  1CJ3 A;  1HYU A;  1P2H A;  5KXJ A;  1FCD A;  1QO8 A;  3L1R A;  1S2Y A;  4I58 A;  3CGD A;  1VG0 A;  4OPC A;  3UKL A;  1RYI A;  2Y6Q A;  2BA9 A;  1E1N A;  1NEN A;  2EQ8 A;  2VRL A;  3AEG A;  3NHO X;  4APN A;  4CBQ A;  1DNC A;  2XYO A;  2R4J A;  3GD4 A;  1DOC A;  2JBV A;  3QVR A;  1GRT A;  4JDR A;  4JN9 A;  2BS3 A;  1TDO A;  1D7Y A;  1EL7 A;  5HHF A;  2R0C A;  2BC1 A;  1SEZ A;  2GQF A;  2R4E A;  4TLZ A;  1MOK A;  2RGH A;  3FIM B;  3KLJ A;  4Y4L A;  1EBD A;  4H4R A;  4RG4 A;  2XLP A;  3AEC A;  4WCT A;  3URH A;  1IJH A;  1B8S A;  3OC4 A;  4C77 A;  2XFU A;  2I0Z A;  2A87 A;  4H4W A;  4J56 A;  1ZOY A;  4B69 A;  1N4V A;  3VRD B;  3UKA A;  3UOX A;  4BK1 A;  1GEU A;  4ADW A;  4CRT A;  4EMJ A;  1PJ6 A;  4EQX A;  1YQ4 A;  2VOU A;  4KPR A;  4HA6 A;  1GAL A;  2YM1 A;  3EAO A;  4H4Q A;  4E0V A;  3DGH A;  3GWD A;  4M52 A;  4YT0 A;  1PJ5 A;  1LPF A;  2XLU A;  1LJ1 A;  4YSY A;  2C3D A;  1JRY A;  3OZ2 A;  2AR8 A;  5GSN A;  3RP8 A;  3II4 A;  3UKQ A;  4JY2 A;  2PHH A;  2GR0 A;  2VQB A;  2WU2 A;  2VZ2 A;  2XLS A;  2VVM A;  4C74 A;  4CY6 A;  1QJD A;  1X31 B;  1RP0 A;  4YTN A;  1PXB A;  1LQT A;  4H2N A;  2WU5 A;  5JCM A;  1E1K A;  1CC4 A;  2ZZC A;  2GQW A;  4GCM A;  2QCU A;  3G5Q A;  1OJA A;  5BRT A;  4U8J A;  2YLR A;  1LVL A;  1MXT A;  1IUW A;  2Q7V A;  3F8P A;  2RGO A;  1H7X A;  1IUU A;  3NGC X;  2BK4 A;  4JQ9 A;  3H4K A;  3I3L A;  3QFA A;  2FBW A;  4K7Z A;  1PHH A;  2RAB A;  2R0G A;  5FS9 A;  1F8W A;  4U8O A;  4CNK A;  3UOZ A;  2R46 A;  4NEV A;  5CQF A;  4P9S A;  3ICT A;  3P1W A;  3AE1 A;  4UDP A;  4B63 A;  1KNP A;  2E5V A;  4B68 A;  3AD8 B;  3B3R A;  1BKW A;  3F8R A;  1ZOV A;  1TDK A;  4YWO A;  3CNT A;  3NNE A;  3VRA A;  2AAQ A;  1F3P A;  4OPU A;  3K7M X;  1D4C A;  1K0L A;  1DXL A;  2XVI A;  2CFY A;  2V6O A;  3AD7 B;  3PS9 A;  2TMD A;  1ZKQ A;  1VDC A;  4UDR A;  1B5Q A;  1S3B A;  3UKF A;  4NTC A;  1CC6 A;  2WOV A;  3NK1 X;  3ATR A;  3B6D A;  2UZZ A;  5BUK A;  3G5R A;  4H4X A;  4J33 A;  1TYT A;  4NTD A;  3DA1 A;  1E7P A;  1O5W A;  5KRQ A;  5GRT A;  2WP9 A;  1XHC A;  1PXC A;  2GF3 A;  1GTH A;  3P4R A;  4EM4 A;  2BK3 A;  3NYF A;  4LA1 A;  2VVL A;  3UTG A;  4H2R A;  1CBO A;  3AE6 A;  3H8I A;  3Q9T A;  1JOA A;  3S61 A;  4FDC B;  4K2X A;  5JCN A;  4JNA A;  1BGN A;  3NN0 X;  2WP5 A;  2C64 A;  3LZX A;  1L9E A;  1OJD A;  2XFO A;  4FX9 A;  2R9Z A;  4IA5 A;  4OPG A;  3ISH A;  2GV8 A;  3DJE A;  3UTF A;  3CND A;  1PJ7 A;  2WOI A;  3AB1 A;  3SFD A;  2FJA A;  4H4P A;  3F8D A;  2GB0 A;  4C3Y A;  1D4E A;  2XFQ A;  3LXD A;  1DOD A;  4OPI A;  2YVJ A;  2GMH A;  4A6N B;  3I6D A;  1KNR A;  1S3E A;  3IWA A;  5KOX A;  4HB9 A;  1EL5 A;  4YTM A;  1OJ9 A;  2XFP A;  3NLC A;  3PO7 A;  3ALL A;  1GRH A;  3QSS A;  4C3X A;  1W4X A;  5JCL A;  4JNQ A;  1L0V A;  4H4V A;  1ONF A;  2C66 A;  1H7W A;  4CY8 A;  4EIP A;  4TLX A;  3CNP A;  2C76 A;  1N4U A;  4H4S A;  4XWR A;  4H2P A;  3T37 A;  3ALJ A;  3DK8 A;  5L46 A;  1CJ4 A;  1IUX A;  1GRA A;  1GSN A;  3KD9 A;  1S2Q A;  2ZZ0 A;  4EM3 A;  1E1M A;  1VG9 A;  1NEK A;  3BHK A;  1H84 A;  4TM0 A;  1L9D A;  4UP3 A;  1YQ3 A;  2O9Z A;  2WOW A;  5M10 A;  2EQ7 A;  4AOX A;  1ELI A;  3DJG X;  1Q1W A;  4H7U A;  4U8I A;  3VR9 A;  1CJ2 A;  1UKV G;  2YAU A;  4UDQ A;  5KWF A;  4N9X A;  2ARD A;  3C96 A;  3KKJ A;  1PBD A;  5U25 A;  2YVF A;  2V61 A;  4OVI A;  3AE4 A;  3SFE A;  1CHU A;  2W0H A;  2ZZB A;  3BNM A;  3FMW A;  4GRT A;  1CC2 A;  2H88 A;  1NDA A;  4OPD A;  2XLT A;  4WX1 A;  2B76 A;  3UOV A;  1ZMC A;  3P4S A;  3V3O A;  2YLW A;  3CPJ G;  1GET A;  1E6E A;  4ZCD A;  2C72 A;  2Q6U A;  2WES A;  4CCQ A;  4Z43 A;  1ZMD A;  2JB3 A;  3IHM A;  1CL0 A;  1F8R A;  2JB2 A;  3ADA B;  4A65 A;  3BI4 A;  4REK A;  1V59 A;  2B9Y A;  3H8L A;  3FBS A;  2BS2 A;  2YWL A;  4TM1 A;  4YSH A;  3RP7 A;  4EMI A;  1JRZ A;  1GOS A;  1GRG A;  1ZY8 A;  2H89 A;  1VQW A;  3VQR A;  1Q1R A;  2EQ9 A;  3SGL A;  3AD9 B;  4U2S A;  1JNZ A;  3L8K A;  4YSZ A;  4B64 A;  4U8K A;  4K5S A;  4U8P A;  1PDH A;  2WP6 A;  3C4N A;  2YR4 A;  3LAD A;  5EOW A;  3V76 A;  4GDE A;  3M13 A;  1YQZ A;  2E1M A;  1LV0 A;  4I59 A;  4J2W A;  2WQY A;  1DJQ A;  3IF9 A;  5M0Z A;  1O94 A;  1PBE A;  2X8H A;  3GRS A;  5ER0 A;  2YQU A;  2YR6 A;  4NTE A;  4BV6 A;  2DKI A;  1P2E A;  4USR A;  3CNJ A;  1L9C A;  4GR1 A;  3GMC A;  3UTE A;  2GRT A;  1TDN A;  3ZDN A;  2GEW A;  2GMJ A;  2YR5 A;  5IQ4 A;  2XCG A;  3AYL A;  1NHS A;  3CGE A;  2F5Z A;  2CUL A;  1GES A;  1K4Q A;  4D04 A;  3AE9 A;  2XDO A;  4Z44 A;  1M64 A;  5KOW A;  1JEH A;  3AYJ A;  3GSI A;  1Q9I A;  4K8D A;  4PAB A;  4PAA A;  4A9W A;  3SM8 A;  2WS3 A;  1KDG A;  1EL9 A;  4C5O A;  3C4A A;  3VR8 A;  1PBB A;  2FJB A;  5EB4 A;  1KSS A;  4A6N A;  4H50 A;  1N4W A;  2YLX A;  2WPC A;  5FS8 A;  3ATQ A;  2E4G A;  1IUV A;  2QA2 A;  3D8X A;  4OPL A;  1MO9 A;  4DNA A;  3AEB A;  2HQM A;  4TM3 A;  4J34 A;  4A79 A;  4GUV A;  4Z2T A;  1OJT A;  1XPQ A;  3AE7 A;  3ABV A;  4YKF A;  3E1T A;  4EIQ A;  1DJN A;  1NPX A;  2XVF A;  3AEE A;  4CCR A;  1GV4 A;  2WDR A;  4RG3 A;  3RHA A;  4J57 A;  4BK3 A;  3GYJ A;  1XAN A;  4LII A;  1TDE A;  2GR2 A;  2X99 A;  1GXF A;  2PYX A;  1H6V A;  4IV9 A;  3UP4 A;  1D7L A;  5U1O A;  3UTH A;  1RSG A;  1GER A;  1GND A;  3GWF A;  2BCG G;  3LB8 A;  2VQ7 A;  4NZH A;  5HY5 A;  4U8L A;  3CPH G;  1DOE A;  5J7X A;  4YXD A;  1YY5 A;  4U2L A;  4Z24 A;  1ZK7 A;  1O95 A;  3CGB A;  3ITJ A;  4YSX A;  4AT0 A;  3RP6 A;  3GDN A;  4XWZ A;  2OLN A;  4H2Q A;  4IVM B;  2BXS A;  3P9U A;  2FJE A;  2BAC A;  4EMW A;  3R9U A;  2WEU A;  2OA1 A;  2XLR A;  5BVA A;  2BK5 A;  3QSM A;  3HZL A;  3AEF A;  2Y6R A;  2ZBW A;  3VRB A;  4BJZ A;  2Z5Y A;  5FS7 A;  3GYI A;  3M0O A;  3NTD A;  1LQU A;  2V3B A;  3NG7 X;  5LV9 A;  1N1P A;  4H4Y A;  1GPE A;  4DGK A;  3FPZ A;  1H82 A;  4A7A A;  2BXR A;  1FEC A;  1FEA A;  2EQ6 A;  5KVH A;  4BUR A;  2WET A;  3GRT A;  3NIX A;  4Y4M A;  5TR3 A;  1JRX A;  1AOG A;  1PBF A;  4O5U A;  5JCK A;  1COY A;  3NYE A;  1TDF A;  2CVJ A;  4K22 A;  1NHP A;  3RED A;  1E1L A;  1YKJ A;  3K7T A;  4KX6 A;  5C3J A;  3AWI A;  2YG6 A;  3CGC A;  3GD3 A;  4ZCC A;  2B7R A;  4Z26 A;  2A89 A;  1ZX9 A;  3S5W A;  3BI2 A;  3NN6 X;  4NEW A;  5JCI A;  3LOV A;  1K0I A;  2NVK X;  1CF3 A;  1FL2 A;  1Z6L A;  2X50 A;  3KPF A;  4GDP A;  1B4V A;  3PVC A;  4EQS A;  4JY3 A;  1KFY A;  4YTP A;  2WDQ A;  3DJJ A;  2JKC A;  2WDV A;  3DK9 A;  5DBJ A;  3IHG A;  3KVE A;  4CNJ A;  2GR3 A;  2V3A A;  5EBK A;  1FOH A;  2C73 A;  2WPF A;  4A5L A;  2IVE A;  2APG A;  2YVG A;  2BS4 A;  3KA7 A;  2WPE A;  1GTE A;  3CN8 A;  1F8S A;  1B37 A;  4J31 A;  2QA1 A;  4XXG A;  2R45 A;  5IQ1 A;  4AP1 A;  4RSL A;  3AE5 A;  2C75 A;  1H81 A;  1PN0 A;  1K0J A;  3DME A;  1CJC A;  1DOB A;  2C3C A;  4Y4N A;  2C7G A;  1JU2 A;  3UKH A;  3WE0 A;  2BC0 A;  1KSU A;  2AQJ A;  1NHQ A;  1GRF A;  3CIR A;  4U2T A;  4Z2R A;  4ICY A;  3EPT A;  4B65 A;  4D03 A;  1ZP0 A;  2CDU A;  2GH5 A;  3ALM A;  1BF3 A;  2YG3 A;  3ICR A;  3NK2 X;  3CNS A;  3M12 A;  2OLO A;  1NHR A;  3NT6 A;  3P4Q A;  3D1C A;  2C67 A;  3P4P A;  2FJD A;  4LU6 A;  1BGJ A;  4FK1 A;  4AOS A;  3NH3 X;  3JSK A;  3RNM A;  4H4T A;  5C2T A;  1F6M A;  3NRN A;  2GAG B;  4IA6 A;  4OCG A;  3ZYX A;  1REO A;  1OJC A;  5FMH A;  1LTX R;  4H4U A;  2B9X A;  2YG4 A;  4Z2U A;  2DKH A;  4EQW A;  3AED A;  1TYP A;  3GDP A;  2V60 A;  4H4Z A;  3DH9 A;  3K7Q X;  4YKG A;  4X9M A;  2YLT A;  4DSG A;  2Q0K A;  3NYC A;  3O0H A;  4B66 A;  2JAE A;  4OPT A;  2TPR A;  2X3N A;  3BI5 A;  2ACZ A;  3AE3 A;  2QAE A;  2A8X A;  2OAM A;  4U8N A;  4ECH A;  2R0P A;  5HXI A;  4B67 A; 
#chains in the Genus database with same CATH topology
 3IC9 A;  2WHD A;  4TM4 A;  1EL8 A;  3AE8 A;  3T2Z A;  1PBC A;  3T31 A;  3UKK A;  1JNR A;  2V5Z A;  4ZN0 A;  1Y56 A;  3UP5 A;  3LJP A;  4YJH A;  1TRB A;  3AYI A;  3NK0 X;  2YG7 A;  1BWC A;  2OAL A;  3AEA A;  1NG3 A;  1EVI A;  2B7S A;  2YG5 A;  3QJ4 A;  3COX A;  3WGT A;  3CTY A;  3AXB A;  5KVI A;  3T14 A;  5J60 A;  2JK6 A;  2XVJ A;  3EF6 A;  2Q0L A;  4J36 A;  1NG4 A;  4A99 A;  5BUL A;  4FK1 C;  2BCP A;  4G6H A;  4MJW A;  3AE2 A;  3UOY A;  3QSE A;  4GF7 A;  1E39 A;  1H83 A;  4IVO B;  3DGZ A;  3DJD A;  3GMB A;  3NTA A;  3K30 A;  4AT2 A;  1PXA A;  4BK2 A;  1GRE A;  1IUT A;  2BAB A;  4X9N A;  1GRB A;  2C65 A;  5FS6 A;  3KU9 A;  1XDI A;  3Q6J A;  3QVP A;  4NNJ A;  2VRM A;  4EQR A;  2GVC A;  2XVH A;  4USQ A;  2X8C A;  2GAH B;  4II3 A;  4U8M A;  3UCL A;  1NAA A;  2IID A;  4BJY A;  2C70 A;  3BNU A;  3V3N A;  3NKS A;  1Y0P A;  4G73 A;  2YM2 A;  1BZL A;  5HYM A;  2BYB A;  1VRQ B;  2XVE A;  2JB1 A;  1M6I A;  2B9W A;  4B1B A;  1Y56 B;  2RGJ A;  2J3N A;  3ZNP A;  1QLB A;  3SQP A;  2E48 A;  3BHF A;  2XFN A;  4AP3 A;  1GT8 A;  5CKU A;  1FEB A;  2GR1 A;  4K5R A;  1PS9 A;  3FG2 P;  5EB5 A;  3T2Y A;  4DSH A;  2Z5X A;  3SY4 A;  3CPI G;  4O5Q A;  3DK4 A;  2WBA A;  1KF6 A;  1D4D A;  1H86 A;  3G5S A;  2X8G A;  4GAV A;  5U63 A;  4Z25 A;  2NPX A;  3UKP A;  2VVL G;  4YJF A;  1IUS A;  1VE9 A;  3ICS A;  2YLZ A;  3EAN A;  1DDO A;  1ZDL A;  5IPY A;  1D5T A;  2YLS A;  4X4J A;  3QFB A;  3LZW A;  2IVD A;  1CJ3 A;  1HYU A;  1P2H A;  5KXJ A;  1FCD A;  1QO8 A;  3L1R A;  1S2Y A;  4I58 A;  3CGD A;  1VG0 A;  4OPC A;  3SX6 A;  3UKL A;  3GYX A;  1RYI A;  2Y6Q A;  2BA9 A;  1E1N A;  1NEN A;  2EQ8 A;  2VRL A;  3AEG A;  3NHO X;  4APN A;  4CBQ A;  1DNC A;  2XYO A;  2R4J A;  3GD4 A;  1DOC A;  2JBV A;  3QVR A;  1GRT A;  4JDR A;  4JN9 A;  2BS3 A;  1TDO A;  1D7Y A;  1EL7 A;  5HHF A;  2R0C A;  2BC1 A;  1SEZ A;  2R4E A;  2GQF A;  4TLZ A;  2RGH A;  1MOK A;  3FIM B;  3KLJ A;  4Y4L A;  1EBD A;  4G74 A;  4H4R A;  4WCT A;  2XLP A;  3AEC A;  4RG4 A;  3URH A;  1IJH A;  1DAO A;  1B8S A;  3OC4 A;  2XFU A;  2I0Z A;  2A87 A;  4H4W A;  4J56 A;  1ZOY A;  4B69 A;  1N4V A;  3VRD B;  3UKA A;  3UOX A;  4BK1 A;  1GEU A;  4ADW A;  4CRT A;  4EMJ A;  1PJ6 A;  4EQX A;  2VOU A;  1YQ4 A;  4KPR A;  4HA6 A;  1GAL A;  2YM1 A;  3EAO A;  4H4Q A;  4E0V A;  3DGH A;  3GWD A;  4M52 A;  3SYI A;  4YT0 A;  1PJ5 A;  1LPF A;  2XLU A;  1LJ1 A;  4YSY A;  2C3D A;  1JRY A;  3OZ2 A;  2AR8 A;  5GSN A;  3RP8 A;  3II4 A;  3UKQ A;  4JY2 A;  2PHH A;  2GR0 A;  2VQB A;  2WU2 A;  2VZ2 A;  2XLS A;  2VVM A;  4C74 A;  4CY6 A;  1X31 B;  1QJD A;  1RP0 A;  4YTN A;  1PXB A;  1LQT A;  4H2N A;  2WU5 A;  5JCM A;  1CC4 A;  1E1K A;  2ZZC A;  2GQW A;  4GCM A;  2QCU A;  3G5Q A;  1OJA A;  5BRT A;  4U8J A;  2YLR A;  1LVL A;  1MXT A;  1IUW A;  2Q7V A;  3F8P A;  2RGO A;  1H7X A;  1IUU A;  3NGC X;  2BK4 A;  4JQ9 A;  3H4K A;  3I3L A;  3QFA A;  2FBW A;  4K7Z A;  1PHH A;  2RAB A;  2R0G A;  5FS9 A;  1F8W A;  4U8O A;  4CNK A;  2C4C A;  3UOZ A;  2R46 A;  4NEV A;  5CQF A;  4P9S A;  3ICT A;  3P1W A;  3AE1 A;  4UDP A;  4B63 A;  1KNP A;  2E5V A;  4B68 A;  3AD8 B;  3B3R A;  1BKW A;  3F8R A;  1ZOV A;  1TDK A;  4YWO A;  3CNT A;  3NNE A;  3VRA A;  2AAQ A;  1F3P A;  1C0L A;  3K7M X;  4OPU A;  1D4C A;  1K0L A;  1DXL A;  2XVI A;  2CFY A;  3AD7 B;  2V6O A;  3PS9 A;  3ZNO A;  1ZKQ A;  1VDC A;  2TMD A;  4UDR A;  1B5Q A;  1S3B A;  3UKF A;  4NTC A;  1CC6 A;  2WOV A;  3NK1 X;  3ATR A;  3B6D A;  5KMS A;  2UZZ A;  5BUK A;  3G5R A;  4H4X A;  4J33 A;  1TYT A;  4NTD A;  3DA1 A;  1E7P A;  1O5W A;  5KRQ A;  5GRT A;  2WP9 A;  1XHC A;  1PXC A;  2GF3 A;  1GTH A;  3P4R A;  4EM4 A;  2BK3 A;  3NYF A;  4LA1 A;  2VVL A;  3UTG A;  4H2R A;  1CBO A;  3AE6 A;  3H8I A;  3T0K A;  3Q9T A;  3ZNQ A;  1JOA A;  3S61 A;  4FDC B;  4K2X A;  5JCN A;  4JNA A;  1BGN A;  3NN0 X;  2WP5 A;  2C64 A;  3LZX A;  1L9E A;  1OJD A;  2XFO A;  4FX9 A;  2R9Z A;  4IA5 A;  4OPG A;  3ISH A;  2GV8 A;  4G9K A;  3DJE A;  3UTF A;  3CND A;  1PJ7 A;  2WOI A;  3AB1 A;  3SFD A;  2FJA A;  4H4P A;  3F8D A;  2GB0 A;  4C3Y A;  1D4E A;  2XFQ A;  3LXD A;  1DOD A;  2DU8 A;  4OPI A;  2YVJ A;  2GMH A;  4G6G A;  4A6N B;  3I6D A;  1KNR A;  1S3E A;  3IWA A;  5KOX A;  4HB9 A;  1EL5 A;  4YTM A;  3QSS A;  1OJ9 A;  2XFP A;  3NLC A;  3ALL A;  1GRH A;  3PO7 A;  4C3X A;  4C77 A;  1W4X A;  5JCL A;  4JNQ A;  1L0V A;  4H4V A;  3CMM A;  1ONF A;  2C66 A;  1H7W A;  4CY8 A;  4EIP A;  4TLX A;  3CNP A;  2C76 A;  1N4U A;  4H4S A;  4XWR A;  4H2P A;  5L46 A;  3ALJ A;  3DK8 A;  3T37 A;  1CJ4 A;  1IUX A;  1GRA A;  1GSN A;  3KD9 A;  1S2Q A;  2ZZ0 A;  4EM3 A;  1E1M A;  1VG9 A;  1NEK A;  3BHK A;  1H84 A;  4TM0 A;  4YJD A;  1L9D A;  4UP3 A;  1YQ3 A;  2O9Z A;  2WOW A;  3SZ0 A;  5M10 A;  2EQ7 A;  4AOX A;  1ELI A;  3DJG X;  1Q1W A;  4H7U A;  4U8I A;  3VR9 A;  1CJ2 A;  1UKV G;  2YAU A;  4UDQ A;  5KWF A;  4N9X A;  2ARD A;  3C96 A;  3KKJ A;  1PBD A;  5U25 A;  2YVF A;  2V61 A;  4OVI A;  3AE4 A;  3SFE A;  1CHU A;  2W0H A;  2ZZB A;  3BNM A;  3FMW A;  4GRT A;  1CC2 A;  2H88 A;  1NDA A;  4OPD A;  2XLT A;  4WX1 A;  2B76 A;  3UOV A;  1ZMC A;  3P4S A;  3V3O A;  2YLW A;  3CPJ G;  1GET A;  1E6E A;  4ZCD A;  2C72 A;  2Q6U A;  4YJG B;  2WES A;  4CCQ A;  4Z43 A;  1ZMD A;  2JB3 A;  3IHM A;  1CL0 A;  1C0I A;  1F8R A;  3ADA B;  2JB2 A;  4A65 A;  3BI4 A;  4REK A;  1V59 A;  2B9Y A;  3H8L A;  3FBS A;  2BS2 A;  2YWL A;  4TM1 A;  4YSH A;  3RP7 A;  4EMI A;  1JRZ A;  3VQR A;  1GRG A;  1GOS A;  1ZY8 A;  1VQW A;  2H89 A;  1Q1R A;  3SGL A;  2EQ9 A;  3AD9 B;  4U2S A;  1JNZ A;  3L8K A;  4YSZ A;  4B64 A;  4U8K A;  4K5S A;  4U8P A;  1PDH A;  2WP6 A;  3C4N A;  2YR4 A;  3LAD A;  5EOW A;  3V76 A;  4GDE A;  3M13 A;  1YQZ A;  2E1M A;  1LV0 A;  4I59 A;  4J2W A;  2WQY A;  1DJQ A;  3IF9 A;  3HYW A;  5M0Z A;  1C0P A;  1O94 A;  1PBE A;  2X8H A;  3GRS A;  5ER0 A;  2YQU A;  2YR6 A;  4NTE A;  4BV6 A;  2DKI A;  1P2E A;  4USR A;  3SXI A;  3CNJ A;  1L9C A;  4GR1 A;  3GMC A;  3W4I A;  3UTE A;  2GRT A;  1TDN A;  3ZDN A;  2GEW A;  2GMJ A;  2YR5 A;  3HYV A;  2XCG A;  3AYL A;  1NHS A;  3HYX A;  5IQ4 A;  3CGE A;  2F5Z A;  2CUL A;  1GES A;  1K4Q A;  3CUK A;  4D04 A;  3AE9 A;  2XDO A;  5KMQ A;  5KMR A;  4Z44 A;  1M64 A;  5KOW A;  3GSI A;  1JEH A;  3AYJ A;  1Q9I A;  4K8D A;  4PAB A;  4PAA A;  4A9W A;  3SM8 A;  2WS3 A;  1KDG A;  1EL9 A;  4C5O A;  3C4A A;  3VR8 A;  1PBB A;  2FJB A;  5EB4 A;  1KSS A;  4A6N A;  4H50 A;  1N4W A;  2YLX A;  2WPC A;  5FS8 A;  3ATQ A;  2E4G A;  1IUV A;  4GAP A;  2QA2 A;  3D8X A;  4OPL A;  1MO9 A;  4DNA A;  3AEB A;  2HQM A;  4TM3 A;  3SZF A;  4J34 A;  4A79 A;  4GUV A;  4Z2T A;  1OJT A;  5KMP A;  1XPQ A;  3AE7 A;  3ABV A;  4YKF A;  3E1T A;  4EIQ A;  1DJN A;  1NPX A;  2XVF A;  3AEE A;  4CCR A;  1GV4 A;  2WDR A;  3KPK A;  4RG3 A;  3RHA A;  4J57 A;  4BK3 A;  3GYJ A;  2BRA A;  1XAN A;  4LII A;  1TDE A;  2GR2 A;  2X99 A;  1GXF A;  2PYX A;  4NWZ A;  1H6V A;  4QFC A;  4IV9 A;  3UP4 A;  1D7L A;  5U1O A;  3UTH A;  1RSG A;  1GER A;  1GND A;  2E49 A;  3GWF A;  2BCG G;  3G3E A;  2VQ7 A;  3LB8 A;  4NZH A;  5HY5 A;  4U8L A;  3CPH G;  1DOE A;  5J7X A;  4YXD A;  1YY5 A;  4U2L A;  4Z24 A;  1ZK7 A;  1O95 A;  3CGB A;  3ITJ A;  4YSX A;  4AT0 A;  3RP6 A;  1AN9 A;  4XWZ A;  2OLN A;  4H2Q A;  3GDN A;  4IVM B;  2BXS A;  3P9U A;  4II2 A;  2FJE A;  3T2K A;  2BAC A;  4YJG A;  4YJH B;  4EMW A;  3R9U A;  2WEU A;  2OA1 A;  2XLR A;  5BVA A;  2BK5 A;  3QSM A;  3HZL A;  3AEF A;  4BJZ A;  2Y6R A;  2ZBW A;  3VRB A;  2Z5Y A;  5FS7 A;  3GYI A;  3M0O A;  3NTD A;  1LQU A;  2V3B A;  3NG7 X;  5LV9 A;  1N1P A;  4H4Y A;  1GPE A;  4DGK A;  3FPZ A;  1H82 A;  4A7A A;  2BXR A;  1FEC A;  1FEA A;  2EQ6 A;  5KVH A;  4BUR A;  2WET A;  3GRT A;  3NIX A;  4Y4M A;  5TR3 A;  1JRX A;  1AOG A;  1PBF A;  4O5U A;  5JCK A;  1COY A;  3NYE A;  1TDF A;  2CVJ A;  4K22 A;  1NHP A;  3RED A;  1E1L A;  1YKJ A;  3K7T A;  4KX6 A;  5C3J A;  3AWI A;  2YG6 A;  3CGC A;  3GD3 A;  4ZCC A;  2B7R A;  4Z26 A;  2A89 A;  1ZX9 A;  3S5W A;  3BI2 A;  3NN6 X;  4NEW A;  5JCI A;  3LOV A;  1K0I A;  2NVK X;  1CF3 A;  1FL2 A;  1Z6L A;  2X50 A;  3KPF A;  4GDP A;  1B4V A;  3PVC A;  4EQS A;  4JY3 A;  1KFY A;  4YTP A;  2WDQ A;  3DJJ A;  2JKC A;  2WDV A;  3DK9 A;  5DBJ A;  3IHG A;  3KVE A;  1C0K A;  4CNJ A;  2GR3 A;  2V3A A;  5EBK A;  1FOH A;  2C73 A;  2WPF A;  4A5L A;  2IVE A;  2APG A;  2YVG A;  2BS4 A;  3KA7 A;  2WPE A;  1GTE A;  3CN8 A;  1F8S A;  1B37 A;  4J31 A;  2QA1 A;  4XXG A;  2R45 A;  5IQ1 A;  4AP1 A;  2E4A A;  4RSL A;  3AE5 A;  2C75 A;  1H81 A;  3W4K A;  4YJF B;  1PN0 A;  1K0J A;  3DME A;  1DOB A;  1CJC A;  2C3C A;  4Y4N A;  2C7G A;  1JU2 A;  3UKH A;  3WE0 A;  2BC0 A;  1KSU A;  2AQJ A;  1NHQ A;  1GRF A;  3CIR A;  4U2T A;  4Z2R A;  4ICY A;  3EPT A;  4B65 A;  4D03 A;  1ZP0 A;  2CDU A;  2GH5 A;  3ALM A;  1BF3 A;  2YG3 A;  3ICR A;  3NK2 X;  3ZNN A;  3CNS A;  3M12 A;  2OLO A;  1NHR A;  3NT6 A;  3P4Q A;  3D1C A;  2C67 A;  3P4P A;  3SZC A;  2FJD A;  4LU6 A;  1BGJ A;  4FK1 A;  5KNL A;  1KIF A;  3NH3 X;  4AOS A;  3JSK A;  3RNM A;  4H4T A;  2BRY A;  5C2T A;  1F6M A;  4IA6 A;  2GAG B;  3NRN A;  4OCG A;  3ZYX A;  3W4J A;  4QFD A;  1OJC A;  1REO A;  5FMH A;  1LTX R;  4H4U A;  2B9X A;  2YG4 A;  4Z2U A;  2DKH A;  3SZW A;  4EQW A;  3AED A;  1TYP A;  3GDP A;  2V60 A;  4H4Z A;  3DH9 A;  3K7Q X;  4YKG A;  4X9M A;  2YLT A;  4DSG A;  2Q0K A;  3NYC A;  3O0H A;  4B66 A;  2JAE A;  4OPT A;  2TPR A;  2X3N A;  3BI5 A;  2ACZ A;  3AE3 A;  2QAE A;  2A8X A;  2OAM A;  4U8N A;  4ECH A;  2R0P A;  5HXI A;  4B67 A;  2E82 A; 
#chains in the Genus database with same CATH homology
 3IC9 A;  2WHD A;  4TM4 A;  1EL8 A;  3AE8 A;  3T2Z A;  1PBC A;  3T31 A;  3UKK A;  1JNR A;  2V5Z A;  4ZN0 A;  1Y56 A;  3UP5 A;  3LJP A;  1TRB A;  3AYI A;  3NK0 X;  2YG7 A;  1BWC A;  2OAL A;  3AEA A;  1NG3 A;  2B7S A;  2YG5 A;  3QJ4 A;  3COX A;  3CTY A;  3AXB A;  5KVI A;  3T14 A;  5J60 A;  2JK6 A;  2XVJ A;  3EF6 A;  2Q0L A;  4J36 A;  1NG4 A;  4A99 A;  5BUL A;  4FK1 C;  2BCP A;  4G6H A;  4MJW A;  3AE2 A;  3UOY A;  1E39 A;  4GF7 A;  1H83 A;  3QSE A;  4IVO B;  3DGZ A;  3GMB A;  3DJD A;  3NTA A;  3K30 A;  4AT2 A;  1PXA A;  4BK2 A;  1GRE A;  1IUT A;  2BAB A;  2C65 A;  1GRB A;  4X9N A;  5FS6 A;  3KU9 A;  1XDI A;  3Q6J A;  3QVP A;  4NNJ A;  2VRM A;  4EQR A;  2GVC A;  2XVH A;  4USQ A;  2X8C A;  2GAH B;  4II3 A;  4U8M A;  3UCL A;  1NAA A;  2IID A;  4BJY A;  2C70 A;  3BNU A;  3V3N A;  3NKS A;  1Y0P A;  4G73 A;  2YM2 A;  1BZL A;  5HYM A;  2BYB A;  1VRQ B;  2XVE A;  2JB1 A;  1M6I A;  2B9W A;  4B1B A;  2RGJ A;  1Y56 B;  2J3N A;  3SQP A;  1QLB A;  3BHF A;  2XFN A;  4AP3 A;  1GT8 A;  5CKU A;  1FEB A;  2GR1 A;  4K5R A;  1PS9 A;  3FG2 P;  5EB5 A;  3T2Y A;  4DSH A;  2Z5X A;  3SY4 A;  3CPI G;  4O5Q A;  3DK4 A;  2WBA A;  1KF6 A;  1D4D A;  1H86 A;  3G5S A;  2X8G A;  4GAV A;  5U63 A;  4Z25 A;  2NPX A;  3UKP A;  2VVL G;  1IUS A;  3ICS A;  2YLZ A;  3EAN A;  1ZDL A;  5IPY A;  1D5T A;  2YLS A;  4X4J A;  3QFB A;  3LZW A;  2IVD A;  1CJ3 A;  1HYU A;  1P2H A;  5KXJ A;  1FCD A;  1QO8 A;  3L1R A;  1S2Y A;  4I58 A;  3CGD A;  1VG0 A;  4OPC A;  3SX6 A;  3UKL A;  3GYX A;  1RYI A;  2Y6Q A;  2BA9 A;  1E1N A;  1NEN A;  2EQ8 A;  2VRL A;  3AEG A;  3NHO X;  4APN A;  4CBQ A;  1DNC A;  2XYO A;  2R4J A;  3GD4 A;  1DOC A;  2JBV A;  3QVR A;  1GRT A;  4JDR A;  4JN9 A;  2BS3 A;  1TDO A;  1D7Y A;  1EL7 A;  5HHF A;  2R0C A;  2BC1 A;  1SEZ A;  2GQF A;  2R4E A;  4TLZ A;  1MOK A;  2RGH A;  3FIM B;  3KLJ A;  4Y4L A;  1EBD A;  4G74 A;  4H4R A;  4RG4 A;  2XLP A;  3AEC A;  4WCT A;  3URH A;  1IJH A;  1B8S A;  3OC4 A;  4C77 A;  2XFU A;  2I0Z A;  2A87 A;  4H4W A;  4J56 A;  1ZOY A;  4B69 A;  1N4V A;  3VRD B;  3UKA A;  3UOX A;  4BK1 A;  1GEU A;  4ADW A;  4CRT A;  4EMJ A;  1PJ6 A;  4EQX A;  2VOU A;  1YQ4 A;  4KPR A;  4HA6 A;  1GAL A;  2YM1 A;  3EAO A;  4H4Q A;  4E0V A;  3DGH A;  3GWD A;  4M52 A;  3SYI A;  4YT0 A;  1PJ5 A;  1LPF A;  2XLU A;  1LJ1 A;  4YSY A;  2C3D A;  1JRY A;  3OZ2 A;  2AR8 A;  5GSN A;  3RP8 A;  3II4 A;  3UKQ A;  4JY2 A;  2PHH A;  2GR0 A;  2VQB A;  2WU2 A;  2VZ2 A;  2XLS A;  2VVM A;  4C74 A;  4CY6 A;  1QJD A;  1X31 B;  1RP0 A;  4YTN A;  1PXB A;  1LQT A;  4H2N A;  2WU5 A;  5JCM A;  1E1K A;  1CC4 A;  2ZZC A;  2GQW A;  4GCM A;  2QCU A;  3G5Q A;  1OJA A;  5BRT A;  4U8J A;  2YLR A;  1LVL A;  1MXT A;  1IUW A;  2Q7V A;  3F8P A;  2RGO A;  1H7X A;  1IUU A;  3NGC X;  2BK4 A;  4JQ9 A;  3H4K A;  3I3L A;  3QFA A;  2FBW A;  4K7Z A;  1PHH A;  2RAB A;  2R0G A;  5FS9 A;  1F8W A;  4U8O A;  4CNK A;  2C4C A;  3UOZ A;  2R46 A;  4NEV A;  5CQF A;  4P9S A;  3ICT A;  3P1W A;  3AE1 A;  4UDP A;  4B63 A;  1KNP A;  2E5V A;  4B68 A;  3AD8 B;  3B3R A;  1BKW A;  3F8R A;  1ZOV A;  1TDK A;  4YWO A;  3CNT A;  3NNE A;  3VRA A;  2AAQ A;  1F3P A;  4OPU A;  3K7M X;  1D4C A;  1K0L A;  1DXL A;  2XVI A;  2CFY A;  2V6O A;  3AD7 B;  3PS9 A;  2TMD A;  1ZKQ A;  1VDC A;  4UDR A;  1B5Q A;  1S3B A;  3UKF A;  4NTC A;  1CC6 A;  2WOV A;  3NK1 X;  3ATR A;  3B6D A;  5KMS A;  2UZZ A;  5BUK A;  3G5R A;  4H4X A;  4J33 A;  1TYT A;  4NTD A;  3DA1 A;  1E7P A;  1O5W A;  5KRQ A;  5GRT A;  2WP9 A;  1XHC A;  1PXC A;  2GF3 A;  1GTH A;  3P4R A;  4EM4 A;  2BK3 A;  3NYF A;  4LA1 A;  2VVL A;  3UTG A;  4H2R A;  1CBO A;  3AE6 A;  3H8I A;  3T0K A;  3Q9T A;  1JOA A;  3S61 A;  4FDC B;  4K2X A;  5JCN A;  4JNA A;  1BGN A;  3NN0 X;  2WP5 A;  2C64 A;  3LZX A;  1L9E A;  1OJD A;  2XFO A;  4FX9 A;  2R9Z A;  4IA5 A;  4OPG A;  3ISH A;  2GV8 A;  4G9K A;  3DJE A;  3UTF A;  3CND A;  1PJ7 A;  2WOI A;  3AB1 A;  3SFD A;  2FJA A;  4H4P A;  3F8D A;  2GB0 A;  4C3Y A;  1D4E A;  2XFQ A;  3LXD A;  1DOD A;  4OPI A;  2YVJ A;  2GMH A;  4G6G A;  4A6N B;  3I6D A;  1KNR A;  1S3E A;  3IWA A;  5KOX A;  4HB9 A;  1EL5 A;  4YTM A;  1OJ9 A;  2XFP A;  3NLC A;  3PO7 A;  3ALL A;  1GRH A;  3QSS A;  4C3X A;  1W4X A;  5JCL A;  4JNQ A;  1L0V A;  4H4V A;  3CMM A;  1ONF A;  2C66 A;  1H7W A;  4CY8 A;  4EIP A;  4TLX A;  3CNP A;  2C76 A;  1N4U A;  4H4S A;  4XWR A;  4H2P A;  3T37 A;  3ALJ A;  3DK8 A;  5L46 A;  1CJ4 A;  1IUX A;  1GRA A;  1GSN A;  3KD9 A;  1S2Q A;  2ZZ0 A;  4EM3 A;  1E1M A;  1VG9 A;  1NEK A;  3BHK A;  1H84 A;  4TM0 A;  1L9D A;  4UP3 A;  1YQ3 A;  2O9Z A;  2WOW A;  3SZ0 A;  5M10 A;  2EQ7 A;  4AOX A;  1ELI A;  3DJG X;  1Q1W A;  4H7U A;  4U8I A;  3VR9 A;  1CJ2 A;  1UKV G;  2YAU A;  4UDQ A;  5KWF A;  4N9X A;  2ARD A;  3C96 A;  3KKJ A;  1PBD A;  5U25 A;  2YVF A;  2V61 A;  4OVI A;  3AE4 A;  3SFE A;  1CHU A;  2W0H A;  2ZZB A;  3BNM A;  3FMW A;  4GRT A;  1CC2 A;  2H88 A;  1NDA A;  4OPD A;  2XLT A;  4WX1 A;  2B76 A;  3UOV A;  1ZMC A;  3P4S A;  3V3O A;  2YLW A;  3CPJ G;  1GET A;  1E6E A;  4ZCD A;  2C72 A;  2Q6U A;  2WES A;  4CCQ A;  4Z43 A;  1ZMD A;  2JB3 A;  3IHM A;  1CL0 A;  1F8R A;  2JB2 A;  3ADA B;  4A65 A;  3BI4 A;  4REK A;  1V59 A;  2B9Y A;  3H8L A;  3FBS A;  2BS2 A;  2YWL A;  4TM1 A;  4YSH A;  3RP7 A;  4EMI A;  1JRZ A;  1GOS A;  1GRG A;  1ZY8 A;  2H89 A;  1VQW A;  3VQR A;  1Q1R A;  2EQ9 A;  3SGL A;  3AD9 B;  4U2S A;  1JNZ A;  3L8K A;  4YSZ A;  4B64 A;  4U8K A;  4K5S A;  4U8P A;  1PDH A;  2WP6 A;  3C4N A;  2YR4 A;  3LAD A;  5EOW A;  3V76 A;  4GDE A;  3M13 A;  1YQZ A;  2E1M A;  1LV0 A;  4I59 A;  4J2W A;  2WQY A;  1DJQ A;  3HYW A;  3IF9 A;  5M0Z A;  1O94 A;  1PBE A;  2X8H A;  3GRS A;  5ER0 A;  2YQU A;  2YR6 A;  4NTE A;  4BV6 A;  2DKI A;  1P2E A;  4USR A;  3SXI A;  3CNJ A;  1L9C A;  4GR1 A;  3GMC A;  3UTE A;  2GRT A;  1TDN A;  3ZDN A;  2GEW A;  2GMJ A;  2YR5 A;  3HYV A;  2XCG A;  3AYL A;  1NHS A;  3HYX A;  5IQ4 A;  3CGE A;  2F5Z A;  2CUL A;  1GES A;  1K4Q A;  4D04 A;  5KMR A;  3AE9 A;  2XDO A;  5KMQ A;  4Z44 A;  1M64 A;  5KOW A;  1JEH A;  3AYJ A;  3GSI A;  1Q9I A;  4K8D A;  4PAB A;  4PAA A;  4A9W A;  3SM8 A;  2WS3 A;  1KDG A;  1EL9 A;  4C5O A;  3C4A A;  3VR8 A;  1PBB A;  2FJB A;  5EB4 A;  1KSS A;  4A6N A;  4H50 A;  1N4W A;  2YLX A;  2WPC A;  5FS8 A;  3ATQ A;  2E4G A;  1IUV A;  4GAP A;  2QA2 A;  3D8X A;  4OPL A;  1MO9 A;  4DNA A;  3AEB A;  2HQM A;  4TM3 A;  3SZF A;  4J34 A;  4A79 A;  4GUV A;  4Z2T A;  1OJT A;  5KMP A;  1XPQ A;  3AE7 A;  3ABV A;  4YKF A;  3E1T A;  4EIQ A;  1DJN A;  1NPX A;  2XVF A;  3AEE A;  4CCR A;  1GV4 A;  2WDR A;  3KPK A;  4RG3 A;  3RHA A;  4J57 A;  4BK3 A;  3GYJ A;  2BRA A;  1XAN A;  4LII A;  1TDE A;  2GR2 A;  2X99 A;  1GXF A;  2PYX A;  4NWZ A;  1H6V A;  4IV9 A;  3UP4 A;  1D7L A;  5U1O A;  3UTH A;  1RSG A;  1GER A;  1GND A;  3GWF A;  2BCG G;  3LB8 A;  2VQ7 A;  4NZH A;  5HY5 A;  4U8L A;  3CPH G;  1DOE A;  5J7X A;  4YXD A;  1YY5 A;  4U2L A;  4Z24 A;  1ZK7 A;  1O95 A;  3CGB A;  3ITJ A;  4YSX A;  4AT0 A;  3RP6 A;  3GDN A;  4XWZ A;  2OLN A;  4H2Q A;  4IVM B;  2BXS A;  3P9U A;  4II2 A;  2FJE A;  3T2K A;  2BAC A;  4EMW A;  3R9U A;  2WEU A;  2OA1 A;  2XLR A;  5BVA A;  2BK5 A;  3QSM A;  3HZL A;  3AEF A;  4BJZ A;  2Y6R A;  2ZBW A;  3VRB A;  2Z5Y A;  5FS7 A;  3GYI A;  3M0O A;  3NTD A;  1LQU A;  2V3B A;  3NG7 X;  5LV9 A;  1N1P A;  4H4Y A;  1GPE A;  4DGK A;  3FPZ A;  1H82 A;  4A7A A;  2BXR A;  1FEC A;  1FEA A;  2EQ6 A;  5KVH A;  4BUR A;  2WET A;  3GRT A;  3NIX A;  4Y4M A;  5TR3 A;  1JRX A;  1AOG A;  1PBF A;  4O5U A;  5JCK A;  1COY A;  3NYE A;  1TDF A;  2CVJ A;  4K22 A;  1NHP A;  3RED A;  1E1L A;  1YKJ A;  3K7T A;  4KX6 A;  5C3J A;  3AWI A;  2YG6 A;  3CGC A;  3GD3 A;  4ZCC A;  2B7R A;  4Z26 A;  2A89 A;  1ZX9 A;  3S5W A;  3BI2 A;  3NN6 X;  4NEW A;  5JCI A;  3LOV A;  1K0I A;  2NVK X;  1CF3 A;  1FL2 A;  1Z6L A;  2X50 A;  3KPF A;  4GDP A;  1B4V A;  3PVC A;  4EQS A;  4JY3 A;  1KFY A;  4YTP A;  2WDQ A;  3DJJ A;  2JKC A;  2WDV A;  3DK9 A;  5DBJ A;  3IHG A;  3KVE A;  4CNJ A;  2GR3 A;  2V3A A;  5EBK A;  1FOH A;  2C73 A;  2WPF A;  4A5L A;  2IVE A;  2APG A;  2YVG A;  2BS4 A;  3KA7 A;  2WPE A;  1GTE A;  3CN8 A;  1F8S A;  1B37 A;  4J31 A;  2QA1 A;  4XXG A;  2R45 A;  5IQ1 A;  4AP1 A;  4RSL A;  3AE5 A;  2C75 A;  1H81 A;  1PN0 A;  1K0J A;  3DME A;  1CJC A;  1DOB A;  2C3C A;  4Y4N A;  2C7G A;  1JU2 A;  3UKH A;  3WE0 A;  2BC0 A;  1KSU A;  2AQJ A;  1NHQ A;  1GRF A;  3CIR A;  4U2T A;  4Z2R A;  4ICY A;  3EPT A;  4B65 A;  4D03 A;  1ZP0 A;  2CDU A;  2GH5 A;  3ALM A;  1BF3 A;  2YG3 A;  3ICR A;  3NK2 X;  3CNS A;  3M12 A;  2OLO A;  1NHR A;  3NT6 A;  3P4Q A;  3D1C A;  2C67 A;  3P4P A;  3SZC A;  2FJD A;  4LU6 A;  1BGJ A;  4FK1 A;  5KNL A;  4AOS A;  3NH3 X;  3JSK A;  3RNM A;  4H4T A;  2BRY A;  5C2T A;  1F6M A;  4IA6 A;  2GAG B;  3NRN A;  4OCG A;  3ZYX A;  1REO A;  1OJC A;  5FMH A;  1LTX R;  4H4U A;  2B9X A;  2YG4 A;  4Z2U A;  2DKH A;  3SZW A;  4EQW A;  3AED A;  1TYP A;  3GDP A;  2V60 A;  4H4Z A;  3DH9 A;  3K7Q X;  4YKG A;  4X9M A;  2YLT A;  4DSG A;  2Q0K A;  3NYC A;  3O0H A;  4B66 A;  2JAE A;  4OPT A;  2TPR A;  2X3N A;  3BI5 A;  2ACZ A;  3AE3 A;  2QAE A;  2A8X A;  2OAM A;  4U8N A;  4ECH A;  2R0P A;  5HXI A;  4B67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...