3BIPA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
444
structure length
444
Chain Sequence
LNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords FACT complex subunit SPT16
total genus 158
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bipA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bipA02
1QXZA 2GU7A 2BWUA 2ZSGA 1QZYA 2B3KA 2EVOA 2Q93A 3CTZA 1KQ9A 3S6BA 3PKCA 2BWVA 3L24A 3PEBA 5D6EA 2V3YA 2EVMA 2GG9A 3BITA 2Q94A 4OOKA 2EVCA 1R5HA 3L7GA 5CDVA 2GGBA 3IL0A 3Q6DA 3MX6A 4IKTA 3PKBA 1XGSA 1BOAA 1C21A 5E2CA 1YJ3A 3MATA 3QOCA 2B3HA 2V6CA 4S2TP 3IU9A 3PN9A 1B6AA 3MR1A 4IU6A 2BWSA 1W7VA 2BHAA 1C24A 1YVMA 1QXWA 3BIPA 2BWTA 1CHMA 3BIQA 1XNZA 4U6EA 4U73A 4U6ZA 2GG7A 3IU7A 5CNXA 2OAZA 4FLLA 2ADUA 2GG0A 1KQ0A 1B59A 2HOWA 1R58A 4U71A 3RVAA 2Q92A 2NQ7A 2Q8KA 2GG5A 3IU8A 4U6CA 3OOOA 2EA2A 4FO7A 4IKSA 4ZWPA 1YW9A 4FO8A 1XGNA 1N51A 4PNCA 4U76A 4FUKA 1O0XA 1QXYA 2GG8A 4A6VA 4FLJA 2GU5A 3FM3A 4A6WA 2Q95A 4KM3A 4RZZA 4S01A 4ZNGA 4S2RP 3FMRA 1C27A 2G6PA 1M35A 2V3XA 4MATA 5FCHA 4PV4A 1XGOA 2BWYA 3TB5A 1A16A 3I7MA 4EGEA 2GU4A 2BWXA 2P99A 4IDYA 4IECA 2P98A 2BB7A 4FKCA 5CLSA 3PKAA 5CDLA 3PKDA 3FMQA 4U70A 3O5VA 4IKRA 4U6JA 5CE6A 1BN5A 2BWWA 5CIKA 4U69A 2BHBA 5CDEA 4U6WA 4RGZ1 3D27A 2BHCA 5JI6A 1MATA 2IW2A 5D6FA 2GG3A 1WKMA 5JHUA 4S00A 1WL9A 2P9AA 2BHDA 5JFRA 2EA4A 2BH3A 2BN7A 1YW8A 2GA2A 4QR8A 2GG2A 2V3ZA 4Z7MA 4U75A 4ZWOA 1JAWA 4IF7A 3TAVA 4JUQA 2NQ6A 1PV9A 3IG4A 2GZ5A 1R5GA 1WY2A 4U1BA 4R60A 2MATA 3PKEA 1WLRA 1Y1NA 2DFIA 2GTXA 2B3LA 4FLIA 1W2MA 5FCFA 1WN1A 2OKNA 1YW7A 1WL6A 1KP0A 4RZYA 3CB6A 5E5BA 1C23A 3CB5A 4HXXA 3RORA 1WBQA 4IKUA 2Q96A 2GU6A 1XGMA 1C22A 3OVKA 4FLKA 4ZWUA 4IPAA 4B28A 2GGCA
chains in the Genus database with same CATH superfamily
1QXZA 2GU7A 2BWUA 2ZSGA 1QZYA 2B3KA 2EVOA 2Q93A 3CTZA 1KQ9A 3S6BA 3PKCA 2BWVA 3L24A 3PEBA 5D6EA 2V3YA 2EVMA 2GG9A 3BITA 2Q94A 4OOKA 2EVCA 1R5HA 3L7GA 5CDVA 2GGBA 3IL0A 3Q6DA 3MX6A 4IKTA 3PKBA 1XGSA 1BOAA 1C21A 5E2CA 1YJ3A 3MATA 3QOCA 2B3HA 2V6CA 4S2TP 3IU9A 3PN9A 1B6AA 3MR1A 4IU6A 2BWSA 1W7VA 2BHAA 1C24A 1YVMA 1QXWA 3BIPA 2BWTA 1CHMA 3BIQA 1XNZA 4U6EA 4U73A 4U6ZA 2GG7A 3IU7A 5CNXA 2OAZA 4FLLA 2ADUA 2GG0A 1KQ0A 1B59A 2HOWA 1R58A 4U71A 3RVAA 2Q92A 2NQ7A 2Q8KA 2GG5A 3IU8A 4U6CA 3OOOA 2EA2A 4FO7A 4IKSA 4ZWPA 1YW9A 4FO8A 1XGNA 1N51A 4PNCA 4U76A 4FUKA 1O0XA 1QXYA 2GG8A 4A6VA 4FLJA 2GU5A 3FM3A 4A6WA 2Q95A 4KM3A 4RZZA 4S01A 4ZNGA 4S2RP 3FMRA 1C27A 2G6PA 1M35A 2V3XA 4MATA 5FCHA 4PV4A 1XGOA 2BWYA 3TB5A 1A16A 3I7MA 4EGEA 2GU4A 2BWXA 2P99A 4IDYA 4IECA 2P98A 2BB7A 4FKCA 5CLSA 3PKAA 5CDLA 3PKDA 3FMQA 4U70A 3O5VA 4IKRA 4U6JA 5CE6A 1BN5A 2BWWA 5CIKA 4U69A 2BHBA 5CDEA 4U6WA 4RGZ1 3D27A 2BHCA 5JI6A 1MATA 2IW2A 5D6FA 2GG3A 1WKMA 5JHUA 4S00A 1WL9A 2P9AA 2BHDA 5JFRA 2EA4A 2BH3A 2BN7A 1YW8A 2GA2A 4QR8A 2GG2A 2V3ZA 4Z7MA 4U75A 4ZWOA 1JAWA 4IF7A 3TAVA 4JUQA 2NQ6A 1PV9A 3IG4A 2GZ5A 1R5GA 1WY2A 4U1BA 4R60A 2MATA 3PKEA 1WLRA 1Y1NA 2DFIA 2GTXA 2B3LA 4FLIA 1W2MA 5FCFA 1WN1A 2OKNA 1YW7A 1WL6A 1KP0A 4RZYA 3CB6A 5E5BA 1C23A 3CB5A 4HXXA 3RORA 1WBQA 4IKUA 2Q96A 2GU6A 1XGMA 1C22A 3OVKA 4FLKA 4ZWUA 4IPAA 4B28A 2GGCA
chains in the Genus database with same CATH topology
1QXZA 2GU7A 2BWUA 2ZSGA 1QZYA 2B3KA 2EVOA 2Q93A 3CTZA 1KQ9A 3S6BA 3PKCA 2BWVA 3L24A 3PEBA 5D6EA 2V3YA 2EVMA 2GG9A 3BITA 2Q94A 4OOKA 2EVCA 1R5HA 3L7GA 5CDVA 2GGBA 3IL0A 3Q6DA 3MX6A 4IKTA 3PKBA 1XGSA 1BOAA 1C21A 5E2CA 1YJ3A 3MATA 3QOCA 2B3HA 2V6CA 4S2TP 3IU9A 3PN9A 1B6AA 3MR1A 4IU6A 2BWSA 1W7VA 2BHAA 1C24A 1YVMA 1QXWA 3BIPA 2BWTA 1CHMA 3BIQA 1XNZA 4U6EA 4U73A 4U6ZA 2GG7A 3IU7A 5CNXA 2OAZA 4FLLA 2ADUA 2GG0A 1KQ0A 1B59A 2HOWA 1R58A 4U71A 3RVAA 2Q92A 2NQ7A 2Q8KA 2GG5A 3IU8A 4U6CA 3OOOA 2EA2A 4FO7A 4IKSA 4ZWPA 1YW9A 4FO8A 1XGNA 1N51A 4PNCA 4U76A 4FUKA 1O0XA 1QXYA 2GG8A 4A6VA 4FLJA 2GU5A 3FM3A 4A6WA 2Q95A 4KM3A 4RZZA 4S01A 4ZNGA 4S2RP 3FMRA 1C27A 2G6PA 1M35A 2V3XA 4MATA 5FCHA 4PV4A 1XGOA 2BWYA 3TB5A 1A16A 3I7MA 4EGEA 2GU4A 2BWXA 2P99A 4IDYA 4IECA 2P98A 2BB7A 4FKCA 5CLSA 3PKAA 5CDLA 3PKDA 3FMQA 4U70A 3O5VA 4IKRA 4U6JA 5CE6A 1BN5A 2BWWA 5CIKA 4U69A 2BHBA 5CDEA 4U6WA 4RGZ1 3D27A 2BHCA 5JI6A 1MATA 2IW2A 5D6FA 2GG3A 1WKMA 5JHUA 4S00A 1WL9A 2P9AA 2BHDA 5JFRA 2EA4A 2BH3A 2BN7A 1YW8A 2GA2A 4QR8A 2GG2A 2V3ZA 4Z7MA 4U75A 4ZWOA 1JAWA 4IF7A 3TAVA 4JUQA 2NQ6A 1PV9A 3IG4A 2GZ5A 1R5GA 1WY2A 4U1BA 4R60A 2MATA 3PKEA 1WLRA 1Y1NA 2DFIA 2GTXA 2B3LA 4FLIA 1W2MA 5FCFA 1WN1A 2OKNA 1YW7A 1WL6A 1KP0A 4RZYA 3CB6A 5E5BA 1C23A 3CB5A 4HXXA 3RORA 1WBQA 4IKUA 2Q96A 2GU6A 1XGMA 1C22A 3OVKA 4FLKA 4ZWUA 4IPAA 4B28A 2GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXZ A;  2GU7 A;  2BWU A;  2ZSG A;  1QZY A;  2B3K A;  2EVO A;  2Q93 A;  3CTZ A;  1KQ9 A;  3S6B A;  3PKC A;  2BWV A;  3L24 A;  3PEB A;  5D6E A;  2V3Y A;  2EVM A;  2GG9 A;  3BIT A;  2Q94 A;  4OOK A;  2EVC A;  1R5H A;  3L7G A;  5CDV A;  2GGB A;  3IL0 A;  3Q6D A;  3MX6 A;  4IKT A;  3PKB A;  1XGS A;  1BOA A;  1C21 A;  5E2C A;  1YJ3 A;  3MAT A;  3QOC A;  2B3H A;  2V6C A;  4S2T P;  3IU9 A;  3PN9 A;  1B6A A;  3MR1 A;  4IU6 A;  2BWS A;  1W7V A;  2BHA A;  1C24 A;  1YVM A;  1QXW A;  3BIP A;  2BWT A;  1CHM A;  3BIQ A;  1XNZ A;  4U6E A;  4U73 A;  4U6Z A;  2GG7 A;  3IU7 A;  5CNX A;  2OAZ A;  4FLL A;  2ADU A;  2GG0 A;  1KQ0 A;  1B59 A;  2HOW A;  1R58 A;  4U71 A;  3RVA A;  2Q92 A;  2NQ7 A;  2Q8K A;  2GG5 A;  3IU8 A;  4U6C A;  3OOO A;  2EA2 A;  4FO7 A;  4IKS A;  4ZWP A;  1YW9 A;  4FO8 A;  1XGN A;  1N51 A;  4PNC A;  4U76 A;  4FUK A;  1O0X A;  1QXY A;  2GG8 A;  4A6V A;  4FLJ A;  2GU5 A;  3FM3 A;  4A6W A;  2Q95 A;  4KM3 A;  4RZZ A;  4S01 A;  4ZNG A;  4S2R P;  3FMR A;  1C27 A;  2G6P A;  1M35 A;  2V3X A;  4MAT A;  5FCH A;  4PV4 A;  1XGO A;  2BWY A;  3TB5 A;  1A16 A;  3I7M A;  4EGE A;  2GU4 A;  2BWX A;  2P99 A;  4IDY A;  4IEC A;  2P98 A;  2BB7 A;  4FKC A;  5CLS A;  3PKA A;  5CDL A;  3PKD A;  3FMQ A;  4U70 A;  3O5V A;  4IKR A;  4U6J A;  5CE6 A;  1BN5 A;  2BWW A;  5CIK A;  4U69 A;  2BHB A;  5CDE A;  4U6W A;  4RGZ 1;  3D27 A;  2BHC A;  5JI6 A;  1MAT A;  2IW2 A;  5D6F A;  2GG3 A;  1WKM A;  5JHU A;  4S00 A;  1WL9 A;  2P9A A;  2BHD A;  5JFR A;  2EA4 A;  2BH3 A;  2BN7 A;  1YW8 A;  2GA2 A;  4QR8 A;  2GG2 A;  2V3Z A;  4Z7M A;  4U75 A;  4ZWO A;  1JAW A;  4IF7 A;  3TAV A;  4JUQ A;  2NQ6 A;  1PV9 A;  3IG4 A;  2GZ5 A;  1R5G A;  1WY2 A;  4U1B A;  4R60 A;  2MAT A;  3PKE A;  1WLR A;  1Y1N A;  2DFI A;  2GTX A;  2B3L A;  4FLI A;  1W2M A;  5FCF A;  1WN1 A;  2OKN A;  1YW7 A;  1WL6 A;  1KP0 A;  4RZY A;  3CB6 A;  5E5B A;  1C23 A;  3CB5 A;  4HXX A;  3ROR A;  1WBQ A;  4IKU A;  2Q96 A;  2GU6 A;  1XGM A;  1C22 A;  3OVK A;  4FLK A;  4ZWU A;  4IPA A;  4B28 A;  2GGC A; 
#chains in the Genus database with same CATH topology
 1QXZ A;  2GU7 A;  2BWU A;  2ZSG A;  1QZY A;  2B3K A;  2EVO A;  2Q93 A;  3CTZ A;  1KQ9 A;  3S6B A;  3PKC A;  2BWV A;  3L24 A;  3PEB A;  5D6E A;  2V3Y A;  2EVM A;  2GG9 A;  3BIT A;  2Q94 A;  4OOK A;  2EVC A;  1R5H A;  3L7G A;  5CDV A;  2GGB A;  3IL0 A;  3Q6D A;  3MX6 A;  4IKT A;  3PKB A;  1XGS A;  1BOA A;  1C21 A;  5E2C A;  1YJ3 A;  3MAT A;  3QOC A;  2B3H A;  2V6C A;  4S2T P;  3IU9 A;  3PN9 A;  1B6A A;  3MR1 A;  4IU6 A;  2BWS A;  1W7V A;  2BHA A;  1C24 A;  1YVM A;  1QXW A;  3BIP A;  2BWT A;  1CHM A;  3BIQ A;  1XNZ A;  4U6E A;  4U73 A;  4U6Z A;  2GG7 A;  3IU7 A;  5CNX A;  2OAZ A;  4FLL A;  2ADU A;  2GG0 A;  1KQ0 A;  1B59 A;  2HOW A;  1R58 A;  4U71 A;  3RVA A;  2Q92 A;  2NQ7 A;  2Q8K A;  2GG5 A;  3IU8 A;  4U6C A;  3OOO A;  2EA2 A;  4FO7 A;  4IKS A;  4ZWP A;  1YW9 A;  4FO8 A;  1XGN A;  1N51 A;  4PNC A;  4U76 A;  4FUK A;  1O0X A;  1QXY A;  2GG8 A;  4A6V A;  4FLJ A;  2GU5 A;  3FM3 A;  4A6W A;  2Q95 A;  4KM3 A;  4RZZ A;  4S01 A;  4ZNG A;  4S2R P;  3FMR A;  1C27 A;  2G6P A;  1M35 A;  2V3X A;  4MAT A;  5FCH A;  4PV4 A;  1XGO A;  2BWY A;  3TB5 A;  1A16 A;  3I7M A;  4EGE A;  2GU4 A;  2BWX A;  2P99 A;  4IDY A;  4IEC A;  2P98 A;  2BB7 A;  4FKC A;  5CLS A;  3PKA A;  5CDL A;  3PKD A;  3FMQ A;  4U70 A;  3O5V A;  4IKR A;  4U6J A;  5CE6 A;  1BN5 A;  2BWW A;  5CIK A;  4U69 A;  2BHB A;  5CDE A;  4U6W A;  4RGZ 1;  3D27 A;  2BHC A;  5JI6 A;  1MAT A;  2IW2 A;  5D6F A;  2GG3 A;  1WKM A;  5JHU A;  4S00 A;  1WL9 A;  2P9A A;  2BHD A;  5JFR A;  2EA4 A;  2BH3 A;  2BN7 A;  1YW8 A;  2GA2 A;  4QR8 A;  2GG2 A;  2V3Z A;  4Z7M A;  4U75 A;  4ZWO A;  1JAW A;  4IF7 A;  3TAV A;  4JUQ A;  2NQ6 A;  1PV9 A;  3IG4 A;  2GZ5 A;  1R5G A;  1WY2 A;  4U1B A;  4R60 A;  2MAT A;  3PKE A;  1WLR A;  1Y1N A;  2DFI A;  2GTX A;  2B3L A;  4FLI A;  1W2M A;  5FCF A;  1WN1 A;  2OKN A;  1YW7 A;  1WL6 A;  1KP0 A;  4RZY A;  3CB6 A;  5E5B A;  1C23 A;  3CB5 A;  4HXX A;  3ROR A;  1WBQ A;  4IKU A;  2Q96 A;  2GU6 A;  1XGM A;  1C22 A;  3OVK A;  4FLK A;  4ZWU A;  4IPA A;  4B28 A;  2GGC A; 
#chains in the Genus database with same CATH homology
 1QXZ A;  2GU7 A;  2BWU A;  2ZSG A;  1QZY A;  2B3K A;  2EVO A;  2Q93 A;  3CTZ A;  1KQ9 A;  3S6B A;  3PKC A;  2BWV A;  3L24 A;  3PEB A;  5D6E A;  2V3Y A;  2EVM A;  2GG9 A;  3BIT A;  2Q94 A;  4OOK A;  2EVC A;  1R5H A;  3L7G A;  5CDV A;  2GGB A;  3IL0 A;  3Q6D A;  3MX6 A;  4IKT A;  3PKB A;  1XGS A;  1BOA A;  1C21 A;  5E2C A;  1YJ3 A;  3MAT A;  3QOC A;  2B3H A;  2V6C A;  4S2T P;  3IU9 A;  3PN9 A;  1B6A A;  3MR1 A;  4IU6 A;  2BWS A;  1W7V A;  2BHA A;  1C24 A;  1YVM A;  1QXW A;  3BIP A;  2BWT A;  1CHM A;  3BIQ A;  1XNZ A;  4U6E A;  4U73 A;  4U6Z A;  2GG7 A;  3IU7 A;  5CNX A;  2OAZ A;  4FLL A;  2ADU A;  2GG0 A;  1KQ0 A;  1B59 A;  2HOW A;  1R58 A;  4U71 A;  3RVA A;  2Q92 A;  2NQ7 A;  2Q8K A;  2GG5 A;  3IU8 A;  4U6C A;  3OOO A;  2EA2 A;  4FO7 A;  4IKS A;  4ZWP A;  1YW9 A;  4FO8 A;  1XGN A;  1N51 A;  4PNC A;  4U76 A;  4FUK A;  1O0X A;  1QXY A;  2GG8 A;  4A6V A;  4FLJ A;  2GU5 A;  3FM3 A;  4A6W A;  2Q95 A;  4KM3 A;  4RZZ A;  4S01 A;  4ZNG A;  4S2R P;  3FMR A;  1C27 A;  2G6P A;  1M35 A;  2V3X A;  4MAT A;  5FCH A;  4PV4 A;  1XGO A;  2BWY A;  3TB5 A;  1A16 A;  3I7M A;  4EGE A;  2GU4 A;  2BWX A;  2P99 A;  4IDY A;  4IEC A;  2P98 A;  2BB7 A;  4FKC A;  5CLS A;  3PKA A;  5CDL A;  3PKD A;  3FMQ A;  4U70 A;  3O5V A;  4IKR A;  4U6J A;  5CE6 A;  1BN5 A;  2BWW A;  5CIK A;  4U69 A;  2BHB A;  5CDE A;  4U6W A;  4RGZ 1;  3D27 A;  2BHC A;  5JI6 A;  1MAT A;  2IW2 A;  5D6F A;  2GG3 A;  1WKM A;  5JHU A;  4S00 A;  1WL9 A;  2P9A A;  2BHD A;  5JFR A;  2EA4 A;  2BH3 A;  2BN7 A;  1YW8 A;  2GA2 A;  4QR8 A;  2GG2 A;  2V3Z A;  4Z7M A;  4U75 A;  4ZWO A;  1JAW A;  4IF7 A;  3TAV A;  4JUQ A;  2NQ6 A;  1PV9 A;  3IG4 A;  2GZ5 A;  1R5G A;  1WY2 A;  4U1B A;  4R60 A;  2MAT A;  3PKE A;  1WLR A;  1Y1N A;  2DFI A;  2GTX A;  2B3L A;  4FLI A;  1W2M A;  5FCF A;  1WN1 A;  2OKN A;  1YW7 A;  1WL6 A;  1KP0 A;  4RZY A;  3CB6 A;  5E5B A;  1C23 A;  3CB5 A;  4HXX A;  3ROR A;  1WBQ A;  4IKU A;  2Q96 A;  2GU6 A;  1XGM A;  1C22 A;  3OVK A;  4FLK A;  4ZWU A;  4IPA A;  4B28 A;  2GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...