3BIQA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
443
structure length
441
Chain Sequence
NIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDSKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords FACT complex subunit SPT16
total genus 161
structure length 441
sequence length 443
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3biqA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3biqA02
2ADUA 2GU5A 4S2RP 1KP0A 1W7VA 4R60A 3IU9A 2G6PA 2P9AA 4IPAA 4U76A 1YJ3A 4FO7A 1C27A 1WKMA 4MATA 1MATA 1C23A 2BB7A 4HXXA 2GA2A 2BWUA 3OOOA 3TAVA 3PKEA 3OVKA 4IF7A 1QXZA 1YW8A 2Q92A 2IW2A 1XGSA 2Q93A 4FKCA 5CNXA 1XGNA 3CB6A 2MATA 3RORA 5CE6A 1BOAA 1XNZA 5CDEA 2Q96A 2EA4A 4IKSA 2V3ZA 4EGEA 3IU8A 2Q95A 4S2TP 2GG8A 2GG3A 4S00A 3I7MA 4IU6A 1JAWA 4IKRA 3Q6DA 2V6CA 1R5GA 4Z7MA 2BHBA 1WY2A 2V3YA 2P99A 3MX6A 5D6EA 2GG9A 5JI6A 3IL0A 2GGCA 3RVAA 1QZYA 1B6AA 3QOCA 3D27A 2GG7A 4U6EA 4U71A 1BN5A 1O0XA 1QXYA 1M35A 5E5BA 4U6CA 2P98A 4A6WA 5CIKA 4U6ZA 1WLRA 1YW7A 2DFIA 2EA2A 2BWSA 4RGZ1 3PN9A 4PV4A 2B3LA 2ZSGA 2GU7A 3CB5A 4FLIA 4IKUA 1KQ9A 2BWVA 2BHCA 2B3HA 5CDVA 3BITA 2GU4A 5JHUA 3FMRA 4IECA 4ZWPA 2GG0A 2GGBA 5CLSA 4S01A 5FCFA 1C22A 1PV9A 1Y1NA 1W2MA 3PKAA 5JFRA 1KQ0A 3MR1A 2BWWA 4IKTA 2OKNA 3CTZA 3FM3A 2EVCA 3S6BA 4U75A 4FLKA 5D6FA 3TB5A 1B59A 1XGMA 4U6WA 3PKBA 1WL9A 1WN1A 4FLLA 4JUQA 1WBQA 1R5HA 1N51A 2GG2A 4FO8A 4U73A 4A6VA 4QR8A 1WL6A 4KM3A 2Q8KA 3IU7A 3L7GA 2BWXA 5CDLA 2EVMA 4U69A 2B3KA 2BHDA 3PEBA 4ZWOA 2BH3A 1YVMA 1QXWA 2V3XA 3MATA 4RZYA 1R58A 2OAZA 4IDYA 4U1BA 2NQ6A 4U70A 4B28A 2BWTA 1CHMA 4ZWUA 2BHAA 3IG4A 2GTXA 2Q94A 2GU6A 3PKCA 4PNCA 4U6JA 3BIQA 4RZZA 1A16A 2GG5A 2BWYA 2GZ5A 3FMQA 4FUKA 4OOKA 1YW9A 2EVOA 4FLJA 2BN7A 3O5VA 3L24A 1C21A 1C24A 3PKDA 5FCHA 2HOWA 2NQ7A 4ZNGA 3BIPA 1XGOA 5E2CA
chains in the Genus database with same CATH superfamily
2ADUA 2GU5A 4S2RP 1KP0A 1W7VA 4R60A 3IU9A 2G6PA 2P9AA 4IPAA 4U76A 1YJ3A 4FO7A 1C27A 1WKMA 4MATA 1MATA 1C23A 2BB7A 4HXXA 2GA2A 2BWUA 3OOOA 3TAVA 3PKEA 3OVKA 4IF7A 1QXZA 1YW8A 2Q92A 2IW2A 1XGSA 2Q93A 4FKCA 5CNXA 1XGNA 3CB6A 2MATA 3RORA 5CE6A 1BOAA 1XNZA 5CDEA 2Q96A 2EA4A 4IKSA 2V3ZA 4EGEA 3IU8A 2Q95A 4S2TP 2GG8A 2GG3A 4S00A 3I7MA 4IU6A 1JAWA 4IKRA 3Q6DA 2V6CA 1R5GA 4Z7MA 2BHBA 1WY2A 2V3YA 2P99A 3MX6A 5D6EA 2GG9A 5JI6A 3IL0A 2GGCA 3RVAA 1QZYA 1B6AA 3QOCA 3D27A 2GG7A 4U6EA 4U71A 1BN5A 1O0XA 1QXYA 1M35A 5E5BA 4U6CA 2P98A 4A6WA 5CIKA 4U6ZA 1WLRA 1YW7A 2DFIA 2EA2A 2BWSA 4RGZ1 3PN9A 4PV4A 2B3LA 2ZSGA 2GU7A 3CB5A 4FLIA 4IKUA 1KQ9A 2BWVA 2BHCA 2B3HA 5CDVA 3BITA 2GU4A 5JHUA 3FMRA 4IECA 4ZWPA 2GG0A 2GGBA 5CLSA 4S01A 5FCFA 1C22A 1PV9A 1Y1NA 1W2MA 3PKAA 5JFRA 1KQ0A 3MR1A 2BWWA 4IKTA 2OKNA 3CTZA 3FM3A 2EVCA 3S6BA 4U75A 4FLKA 5D6FA 3TB5A 1B59A 1XGMA 4U6WA 3PKBA 1WL9A 1WN1A 4FLLA 4JUQA 1WBQA 1R5HA 1N51A 2GG2A 4FO8A 4U73A 4A6VA 4QR8A 1WL6A 4KM3A 2Q8KA 3IU7A 3L7GA 2BWXA 5CDLA 2EVMA 4U69A 2B3KA 2BHDA 3PEBA 4ZWOA 2BH3A 1YVMA 1QXWA 2V3XA 3MATA 4RZYA 1R58A 2OAZA 4IDYA 4U1BA 2NQ6A 4U70A 4B28A 2BWTA 1CHMA 4ZWUA 2BHAA 3IG4A 2GTXA 2Q94A 2GU6A 3PKCA 4PNCA 4U6JA 3BIQA 4RZZA 1A16A 2GG5A 2BWYA 2GZ5A 3FMQA 4FUKA 4OOKA 1YW9A 2EVOA 4FLJA 2BN7A 3O5VA 3L24A 1C21A 1C24A 3PKDA 5FCHA 2HOWA 2NQ7A 4ZNGA 3BIPA 1XGOA 5E2CA
chains in the Genus database with same CATH topology
2ADUA 2GU5A 4S2RP 1KP0A 1W7VA 4R60A 3IU9A 2G6PA 2P9AA 4IPAA 4U76A 1YJ3A 4FO7A 1C27A 1WKMA 4MATA 1MATA 1C23A 2BB7A 4HXXA 2GA2A 2BWUA 3OOOA 3TAVA 3PKEA 3OVKA 4IF7A 1QXZA 1YW8A 2Q92A 2IW2A 1XGSA 2Q93A 4FKCA 5CNXA 1XGNA 3CB6A 2MATA 3RORA 5CE6A 1BOAA 1XNZA 5CDEA 2Q96A 2EA4A 4IKSA 2V3ZA 4EGEA 3IU8A 2Q95A 4S2TP 2GG8A 2GG3A 4S00A 3I7MA 4IU6A 1JAWA 4IKRA 3Q6DA 2V6CA 1R5GA 4Z7MA 2BHBA 1WY2A 2V3YA 2P99A 3MX6A 5D6EA 2GG9A 5JI6A 3IL0A 2GGCA 3RVAA 1QZYA 1B6AA 3QOCA 3D27A 2GG7A 4U6EA 4U71A 1BN5A 1O0XA 1QXYA 1M35A 5E5BA 4U6CA 2P98A 4A6WA 5CIKA 4U6ZA 1WLRA 1YW7A 2DFIA 2EA2A 2BWSA 4RGZ1 3PN9A 4PV4A 2B3LA 2ZSGA 2GU7A 3CB5A 4FLIA 4IKUA 1KQ9A 2BWVA 2BHCA 2B3HA 5CDVA 3BITA 2GU4A 5JHUA 3FMRA 4IECA 4ZWPA 2GG0A 2GGBA 5CLSA 4S01A 5FCFA 1C22A 1PV9A 1Y1NA 1W2MA 3PKAA 5JFRA 1KQ0A 3MR1A 2BWWA 4IKTA 2OKNA 3CTZA 3FM3A 2EVCA 3S6BA 4U75A 4FLKA 5D6FA 3TB5A 1B59A 1XGMA 4U6WA 3PKBA 1WL9A 1WN1A 4FLLA 4JUQA 1WBQA 1R5HA 1N51A 2GG2A 4FO8A 4U73A 4A6VA 4QR8A 1WL6A 4KM3A 2Q8KA 3IU7A 3L7GA 2BWXA 5CDLA 2EVMA 4U69A 2B3KA 2BHDA 3PEBA 4ZWOA 2BH3A 1YVMA 1QXWA 2V3XA 3MATA 4RZYA 1R58A 2OAZA 4IDYA 4U1BA 2NQ6A 4U70A 4B28A 2BWTA 1CHMA 4ZWUA 2BHAA 3IG4A 2GTXA 2Q94A 2GU6A 3PKCA 4PNCA 4U6JA 3BIQA 4RZZA 1A16A 2GG5A 2BWYA 2GZ5A 3FMQA 4FUKA 4OOKA 1YW9A 2EVOA 4FLJA 2BN7A 3O5VA 3L24A 1C21A 1C24A 3PKDA 5FCHA 2HOWA 2NQ7A 4ZNGA 3BIPA 1XGOA 5E2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADU A;  2GU5 A;  4S2R P;  1KP0 A;  1W7V A;  4R60 A;  3IU9 A;  2G6P A;  2P9A A;  4IPA A;  4U76 A;  1YJ3 A;  4FO7 A;  1C27 A;  1WKM A;  4MAT A;  1MAT A;  1C23 A;  2BB7 A;  4HXX A;  2GA2 A;  2BWU A;  3OOO A;  3TAV A;  3PKE A;  3OVK A;  4IF7 A;  1QXZ A;  1YW8 A;  2Q92 A;  2IW2 A;  1XGS A;  2Q93 A;  4FKC A;  5CNX A;  1XGN A;  3CB6 A;  2MAT A;  3ROR A;  5CE6 A;  1BOA A;  1XNZ A;  5CDE A;  2Q96 A;  2EA4 A;  4IKS A;  2V3Z A;  4EGE A;  3IU8 A;  2Q95 A;  4S2T P;  2GG8 A;  2GG3 A;  4S00 A;  3I7M A;  4IU6 A;  1JAW A;  4IKR A;  3Q6D A;  2V6C A;  1R5G A;  4Z7M A;  2BHB A;  1WY2 A;  2V3Y A;  2P99 A;  3MX6 A;  5D6E A;  2GG9 A;  5JI6 A;  3IL0 A;  2GGC A;  3RVA A;  1QZY A;  1B6A A;  3QOC A;  3D27 A;  2GG7 A;  4U6E A;  4U71 A;  1BN5 A;  1O0X A;  1QXY A;  1M35 A;  5E5B A;  4U6C A;  2P98 A;  4A6W A;  5CIK A;  4U6Z A;  1WLR A;  1YW7 A;  2DFI A;  2EA2 A;  2BWS A;  4RGZ 1;  3PN9 A;  4PV4 A;  2B3L A;  2ZSG A;  2GU7 A;  3CB5 A;  4FLI A;  4IKU A;  1KQ9 A;  2BWV A;  2BHC A;  2B3H A;  5CDV A;  3BIT A;  2GU4 A;  5JHU A;  3FMR A;  4IEC A;  4ZWP A;  2GG0 A;  2GGB A;  5CLS A;  4S01 A;  5FCF A;  1C22 A;  1PV9 A;  1Y1N A;  1W2M A;  3PKA A;  5JFR A;  1KQ0 A;  3MR1 A;  2BWW A;  4IKT A;  2OKN A;  3CTZ A;  3FM3 A;  2EVC A;  3S6B A;  4U75 A;  4FLK A;  5D6F A;  3TB5 A;  1B59 A;  1XGM A;  4U6W A;  3PKB A;  1WL9 A;  1WN1 A;  4FLL A;  4JUQ A;  1WBQ A;  1R5H A;  1N51 A;  2GG2 A;  4FO8 A;  4U73 A;  4A6V A;  4QR8 A;  1WL6 A;  4KM3 A;  2Q8K A;  3IU7 A;  3L7G A;  2BWX A;  5CDL A;  2EVM A;  4U69 A;  2B3K A;  2BHD A;  3PEB A;  4ZWO A;  2BH3 A;  1YVM A;  1QXW A;  2V3X A;  3MAT A;  4RZY A;  1R58 A;  2OAZ A;  4IDY A;  4U1B A;  2NQ6 A;  4U70 A;  4B28 A;  2BWT A;  1CHM A;  4ZWU A;  2BHA A;  3IG4 A;  2GTX A;  2Q94 A;  2GU6 A;  3PKC A;  4PNC A;  4U6J A;  3BIQ A;  4RZZ A;  1A16 A;  2GG5 A;  2BWY A;  2GZ5 A;  3FMQ A;  4FUK A;  4OOK A;  1YW9 A;  2EVO A;  4FLJ A;  2BN7 A;  3O5V A;  3L24 A;  1C21 A;  1C24 A;  3PKD A;  5FCH A;  2HOW A;  2NQ7 A;  4ZNG A;  3BIP A;  1XGO A;  5E2C A; 
#chains in the Genus database with same CATH topology
 2ADU A;  2GU5 A;  4S2R P;  1KP0 A;  1W7V A;  4R60 A;  3IU9 A;  2G6P A;  2P9A A;  4IPA A;  4U76 A;  1YJ3 A;  4FO7 A;  1C27 A;  1WKM A;  4MAT A;  1MAT A;  1C23 A;  2BB7 A;  4HXX A;  2GA2 A;  2BWU A;  3OOO A;  3TAV A;  3PKE A;  3OVK A;  4IF7 A;  1QXZ A;  1YW8 A;  2Q92 A;  2IW2 A;  1XGS A;  2Q93 A;  4FKC A;  5CNX A;  1XGN A;  3CB6 A;  2MAT A;  3ROR A;  5CE6 A;  1BOA A;  1XNZ A;  5CDE A;  2Q96 A;  2EA4 A;  4IKS A;  2V3Z A;  4EGE A;  3IU8 A;  2Q95 A;  4S2T P;  2GG8 A;  2GG3 A;  4S00 A;  3I7M A;  4IU6 A;  1JAW A;  4IKR A;  3Q6D A;  2V6C A;  1R5G A;  4Z7M A;  2BHB A;  1WY2 A;  2V3Y A;  2P99 A;  3MX6 A;  5D6E A;  2GG9 A;  5JI6 A;  3IL0 A;  2GGC A;  3RVA A;  1QZY A;  1B6A A;  3QOC A;  3D27 A;  2GG7 A;  4U6E A;  4U71 A;  1BN5 A;  1O0X A;  1QXY A;  1M35 A;  5E5B A;  4U6C A;  2P98 A;  4A6W A;  5CIK A;  4U6Z A;  1WLR A;  1YW7 A;  2DFI A;  2EA2 A;  2BWS A;  4RGZ 1;  3PN9 A;  4PV4 A;  2B3L A;  2ZSG A;  2GU7 A;  3CB5 A;  4FLI A;  4IKU A;  1KQ9 A;  2BWV A;  2BHC A;  2B3H A;  5CDV A;  3BIT A;  2GU4 A;  5JHU A;  3FMR A;  4IEC A;  4ZWP A;  2GG0 A;  2GGB A;  5CLS A;  4S01 A;  5FCF A;  1C22 A;  1PV9 A;  1Y1N A;  1W2M A;  3PKA A;  5JFR A;  1KQ0 A;  3MR1 A;  2BWW A;  4IKT A;  2OKN A;  3CTZ A;  3FM3 A;  2EVC A;  3S6B A;  4U75 A;  4FLK A;  5D6F A;  3TB5 A;  1B59 A;  1XGM A;  4U6W A;  3PKB A;  1WL9 A;  1WN1 A;  4FLL A;  4JUQ A;  1WBQ A;  1R5H A;  1N51 A;  2GG2 A;  4FO8 A;  4U73 A;  4A6V A;  4QR8 A;  1WL6 A;  4KM3 A;  2Q8K A;  3IU7 A;  3L7G A;  2BWX A;  5CDL A;  2EVM A;  4U69 A;  2B3K A;  2BHD A;  3PEB A;  4ZWO A;  2BH3 A;  1YVM A;  1QXW A;  2V3X A;  3MAT A;  4RZY A;  1R58 A;  2OAZ A;  4IDY A;  4U1B A;  2NQ6 A;  4U70 A;  4B28 A;  2BWT A;  1CHM A;  4ZWU A;  2BHA A;  3IG4 A;  2GTX A;  2Q94 A;  2GU6 A;  3PKC A;  4PNC A;  4U6J A;  3BIQ A;  4RZZ A;  1A16 A;  2GG5 A;  2BWY A;  2GZ5 A;  3FMQ A;  4FUK A;  4OOK A;  1YW9 A;  2EVO A;  4FLJ A;  2BN7 A;  3O5V A;  3L24 A;  1C21 A;  1C24 A;  3PKD A;  5FCH A;  2HOW A;  2NQ7 A;  4ZNG A;  3BIP A;  1XGO A;  5E2C A; 
#chains in the Genus database with same CATH homology
 2ADU A;  2GU5 A;  4S2R P;  1KP0 A;  1W7V A;  4R60 A;  3IU9 A;  2G6P A;  2P9A A;  4IPA A;  4U76 A;  1YJ3 A;  4FO7 A;  1C27 A;  1WKM A;  4MAT A;  1MAT A;  1C23 A;  2BB7 A;  4HXX A;  2GA2 A;  2BWU A;  3OOO A;  3TAV A;  3PKE A;  3OVK A;  4IF7 A;  1QXZ A;  1YW8 A;  2Q92 A;  2IW2 A;  1XGS A;  2Q93 A;  4FKC A;  5CNX A;  1XGN A;  3CB6 A;  2MAT A;  3ROR A;  5CE6 A;  1BOA A;  1XNZ A;  5CDE A;  2Q96 A;  2EA4 A;  4IKS A;  2V3Z A;  4EGE A;  3IU8 A;  2Q95 A;  4S2T P;  2GG8 A;  2GG3 A;  4S00 A;  3I7M A;  4IU6 A;  1JAW A;  4IKR A;  3Q6D A;  2V6C A;  1R5G A;  4Z7M A;  2BHB A;  1WY2 A;  2V3Y A;  2P99 A;  3MX6 A;  5D6E A;  2GG9 A;  5JI6 A;  3IL0 A;  2GGC A;  3RVA A;  1QZY A;  1B6A A;  3QOC A;  3D27 A;  2GG7 A;  4U6E A;  4U71 A;  1BN5 A;  1O0X A;  1QXY A;  1M35 A;  5E5B A;  4U6C A;  2P98 A;  4A6W A;  5CIK A;  4U6Z A;  1WLR A;  1YW7 A;  2DFI A;  2EA2 A;  2BWS A;  4RGZ 1;  3PN9 A;  4PV4 A;  2B3L A;  2ZSG A;  2GU7 A;  3CB5 A;  4FLI A;  4IKU A;  1KQ9 A;  2BWV A;  2BHC A;  2B3H A;  5CDV A;  3BIT A;  2GU4 A;  5JHU A;  3FMR A;  4IEC A;  4ZWP A;  2GG0 A;  2GGB A;  5CLS A;  4S01 A;  5FCF A;  1C22 A;  1PV9 A;  1Y1N A;  1W2M A;  3PKA A;  5JFR A;  1KQ0 A;  3MR1 A;  2BWW A;  4IKT A;  2OKN A;  3CTZ A;  3FM3 A;  2EVC A;  3S6B A;  4U75 A;  4FLK A;  5D6F A;  3TB5 A;  1B59 A;  1XGM A;  4U6W A;  3PKB A;  1WL9 A;  1WN1 A;  4FLL A;  4JUQ A;  1WBQ A;  1R5H A;  1N51 A;  2GG2 A;  4FO8 A;  4U73 A;  4A6V A;  4QR8 A;  1WL6 A;  4KM3 A;  2Q8K A;  3IU7 A;  3L7G A;  2BWX A;  5CDL A;  2EVM A;  4U69 A;  2B3K A;  2BHD A;  3PEB A;  4ZWO A;  2BH3 A;  1YVM A;  1QXW A;  2V3X A;  3MAT A;  4RZY A;  1R58 A;  2OAZ A;  4IDY A;  4U1B A;  2NQ6 A;  4U70 A;  4B28 A;  2BWT A;  1CHM A;  4ZWU A;  2BHA A;  3IG4 A;  2GTX A;  2Q94 A;  2GU6 A;  3PKC A;  4PNC A;  4U6J A;  3BIQ A;  4RZZ A;  1A16 A;  2GG5 A;  2BWY A;  2GZ5 A;  3FMQ A;  4FUK A;  4OOK A;  1YW9 A;  2EVO A;  4FLJ A;  2BN7 A;  3O5V A;  3L24 A;  1C21 A;  1C24 A;  3PKD A;  5FCH A;  2HOW A;  2NQ7 A;  4ZNG A;  3BIP A;  1XGO A;  5E2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...