3BJLA

Loc, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in ammonium sulfate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
ESVLTQPPSASGTPGQRVTISCSGSSSNIGENSVTWYQHLSGTAPKLLIYEDNSRASGVSDRFSASKSGTSASLAISGLQPEDETDYYCAAWDDSLDVAVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three quaternary structures for a single protein.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords LOC - LAMBDA 1 TYPE LIGHT-CHAIN DIMER
total genus 41
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bjlA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bjlA01
5EB9A 1UVQB 4E5XB 1N8ZB 4M6NL 2ZSVA 4XPHH 3BT2H 4IOIB 2GSGA 4C4KO 1WLHA 4NNYB 2I25N 3EDKA 4P9HH 4LU5H 3FQUB 2PXYD 1MCHA 1K6QH 3F7VB 3C60B 2F5BL 1XZ0A 4K8RH 4APQB 5E5UB 4P2OC 1H8OA 4MAUH 2FGZA 1MIEL 5I15H 1OSZA 4ZSOE 1IE5A 4DUXA 5LBSH 2APFA 1KLGB 4D0BB 4NUJB 5E1HB 4RX4A 3QAZB 4FG6C 2D4DA 2QSCL 2MTPA 2AEWA 5DK0B 4AEIH 1PEZA 4NNXA 2OJZL 4KWUA 4MAUL 1FHGA 2ZNWA 4LQ1A 1WAAF 3QHFH 2X41A 1EEYA 3IFLH 1ZLUK 1A1OA 1BJ1H 4WENB 2FDBP 3E1F1 5EOQL 2DAVA 3MTRA 4HWEH 4W6XB 5J6HA 2NPLX 2PXYC 2Y7QB 3WKMH 1OAYL 4BZ1H 4KRPC 1GHFH 3S37H 4NNPH 3HE7D 3QPQC 3CUPA 1CXFA 4YHKL 4KTDL 4LDLB 1OGAE 1Q9WB 4IDLA 4IIQB 3W0WA 5KJRH 1TFHA 4LCCB 4NKDB 3S36L 3D0VA 4KDWA 4NNXB 4ZQKA 1FH5L 2IADA 4GQ9L 5D6DA 4Z78A 3RPIA 4Y1AA 3KPSE 3QDMB 5JHDB 1BVZA 1Z2KA 2VXSL 1HK6A 5DRZB 3HNVH 4NRYA 1UWXK 4NN7B 4NZRL 2VLRA 3OAZH 2H26B 3LKOB 1TZGH 2R2HA 1W0VA 4G6AD 5F93C 4YBLB 4ZFZB 2OL3A 2NX5A 4DW2L 4D0DB 1RZGB 3GRWL 1G6VK 4QHLB 5F8QC 1MNUH 2VDNH 3AXLA 2J7LA 3LCYA 3MGOA 1CFVL 1N5AA 3QB7C 3U7YH 4Z8FL 5CGTA 1IGTA 5BS0E 3K8LA 3NIFF 4XBGB 3SKNB 1G7QB 5C07D 4Q9QH 5AAWA 1AJ7L 4MA3A 3L3IA 4NYLA 25C8H 3Q48A 3DRTB 4L8BA 3RZWA 2ZCKH 3THMH 4KRPD 3VXPB 1T7YA 2VN4A 1TQBB 4JDVA 4RISL 1C5BH 4KI5C 4NHUB 3NCBB 5CZVH 4O2EA 4JJHA 3WLWD 5K9QI 4OV5A 3PE9A 3R8BB 1QEWA 3TH2T 1LNUB 1YDPA 2ENYA 2EE2A 4TQEH 4C58B 5HHPA 1H8NA 3RKDC 1CD0A 1YQ2A 4CN4A 1RVFH 4M8QB 2YWZA 1I7TB 2VKWA 3IDIB 2ARJA 1I8KA 3RRQA 3A6BL 5CBEB 2XA8L 4PD4J 4P5TD 2IF7A 2V17L 1OLZA 3DOSA 4Q9RH 3MMEA 3WLBB 5A2FA 3UPRA 4PB0H 5F44A 1HSBB 4YGVB 4O2FB 1ZGLM 5CJXA 5LGJB 2YC1B 1YN7B 3WXWH 4D9RE 3G6JE 1J7VR 5HBBA 1NUNB 3CFEB 4HWEL 3HE7B 2YR3A 3LRHA 2JIXD 3KR3L 1QP1A 4M6MH 3O8XA 1F58L 3G04A 4M1GL 4Z7NF 4ZD3H 1HHGB 2GJZA 1DANU 3PQYA 1O7SA 4KHTH 2P5EA 1QKZH 1U8NB 4HHAA 3UZEA 4P23A 4J1UB 3TWCL 1Y18A 2CLRB 2EIDA 1KT2A 3FRUB 3CDGB 2QTEA 4BSVB 4JKKA 2ESVE 2BRRL 4FOMA 3JBG7 1C5CL 5EORH 4M1GH 1KB5A 2VERN 3D5OF 2A0LC 3ARYA 1B6UA 2F54A 5I8OL 5DD5L 4JQIL 3TVMB 4DKFL 1MWAL 5CSGA 3X12A 4CADB 1LP9F 1UZ6F 3WBDA 3EYQC 5GS1A 4K9EL 5BMFL 1KNOB 1UB5A 3KNBA 3FOMA 3QBTB 3DVGB 2PXYB 3SCMA 5D7IE 2HN7B 4KVNH 2X70A 2B0SL 4D9LL 4GFTB 1FYHB 3C08H 5EPMA 5CEYB 3NABH 2BFVL 1S9XA 1RJCA 2XACC 3GMPB 3OKNB 4NHCL 43CAA 4OLWH 3BAEH 3BKCL 4OD1L 3V0WL 3F7YA 2BVUA 3LPFA 1ZLSH 2NY6B 4HIEA 3B2UD 4P4KC 1NLDL 3D39B 5CFHA 1UM6H 4MXVF 5GGTA 3H7BB 3VGDA 2MHAB 3PGDB 2X4NA 3DYMA 4NQXA 4YFLI 3PGFH 4OIIH 5KOMC 3P0GB 5EC1B 4IIQC 3KYMA 4ZTOL 5HGBB 1EXUA 1FVEA 5IF0B 3C09C 2IPKB 3C2AL 3TT1H 1XGRA 1DN2A 3QIUD 3VDAA 4JPWH 1FFQA 3B9EA 4HKBB 3DX6B 3RTQB 3GMNA 4H26A 3I6GB 4ODBD 1U6AH 1KYOJ 1VPOL 2OK0L 2CKBA 4NQCD 2GCYB 3E2HC 2C26A 2HVJB 4KJPD 4LSPL 4UUJB 5F9JB 2RHEA 3EFFA 3OGCB 3AM8A 4JQVC 1B88A 2BNQE 4U6HB 4YUEL 1IM9A 1FNGA 1NL0L 2AXGB 5HHVL 2JCCF 2ICEA 1WWAX 3LN4B 1ZKAA 3ZTNL 1K9TA 4H1LA 5C9JA 1U3ZA 4MXQC 1PG7L 5I1DA 1T1WB 1FFNB 4UV4H 1QLRB 4HBQA 5BJTA 1FPTL 3LZFH 1M7DA 5KVMC 3I75B 3ARSA 4NQEE 3KWWB 5LQBL 2B1AL 1CBVH 3FT3B 3WV0A 1GOGA 2OR8A 5E7BA 4XHJC 4XVJL 1BZ7B 1JUFB 4M6OH 4H8WH 1EEZB 5EO0B 3CXHJ 2A9ML 4QRPE 1UEYA 3EDDA 3L9RA 3HUJF 2H32A 4MA7L 4EXPX 4L9DA 1OB1B 4O58H 1EHLH 8FABA 4QTHA 5SWQA 1G1YA 3JV5A 2OR7A 1AKJB 4FQQA 2ZCLH 2BSRA 4WU5B 3T65A 2IH3B 5IHUL 1T21A 4WI5A 3ZKND 3LQAC 3WNLA 4I0KA 4WWKB 2C7UA 3BP7B 1A6VL 4X8XA 3MUGB 1KEGL 3TFKD 4OF8A 4X5LA 5EUKB 32C2A 5T3XL 3ZE0F 2Z8VC 3H7LA 3CVIH 3IU4L 4Y19A 1CQKA 2OYPA 4X6CA 4PGJA 4XNMA 5FYLH 1XF5B 2W60A 3MXVH 3OAYK 3NZHH 4LKCA 1FSKB 1K3ZA 2Q7NA 5HHOB 5CIPH 5C1MB 1YMMA 3TJEH 1T5XA 4J3OC 1MCPH 2OP4L 4L3CA 3T04D 4Z0XA 2X4QB 4TVPH 1WAAE 3WL9A 2CR3A 1KCSL 5GZND 2EIZB 1JF1A 3IKCB 4MHHI 4QRQA 2V2XB 5IVXA 1S5HA 1I9RH 3Q3GA 4EN3D 4OIIL 4ODWB 2WM0A 3QQ3A 3PDOB 3T0VA 5DVOA 1B4JL 5HI3D 5SX5K 4OZFH 3HI1A 2F5AL 4GG6B 1NMAL 4Q6YA 1GJIA 4IRZH 1G9EA 2BXYA 2H1PH 4K3GA 1IAIM 2IFGA 1IKNA 1TZIA 3LQAL 4FFWC 4H0GA 3VI3F 1CFSB 1QQDA 2DB8A 4OCSL 2WP3O 2CIKA 3UTZB 1Q94A 5SWQB 1H5BC 1MQKH 2G75B 8FABB 1X4XA 3REWB 1HHHB 4M61B 1CFTB 3VGGA 2IBBA 3HN3A 5CMAB 4R7NA 3MNWA 3ARDD 1UYWH 2MFNA 4M3JA 4J7RA 2VXUH 4WEBH 5KSVA 2Q8BH 1OAZL 3UTOA 4FQHA 4O9HL 1JTTA 1S7UA 5DD3L 5DD0H 3U4BL 4POYA 3FQNB 3SY0B 4OSUH 3O2VL 1A7NH 1FQ9C 2VXTL 4NFDA 4DJMA 4OT1L 1Z3GL 2FJHB 4ZUTB 5D7JD 4PY8J 1QRNB 2MMXA 2UUDH 4Z7VA 2VL5B 5TDOA 4G6JH 5F3BB 1HINH 4NT6A 5DRWA 4LDEB 2BOBB 3HI5H 4OD3H 4X9IA 1FCGA 2AK4D 3U0PB 4JFFE 2OCFD 4EN3C 4X7TA 3ARBD 3HPJB 4QHUB 5FGCE 1OSPL 1G0DA 3EYQD 4HUKB 3HE6D 1HNFA 5INCA 2ZCHL 1OTSC 2R0LL 4L5FL 4OCXH 1CD8A 4J3WA 1MJUH 2AJZA 3MOAH 4X9BA 4EI5B 1MY5A 4IHOA 3EHBD 1QO3B 4LFHD 1OW0A 5CP7A 1BX2B 3UTQA 1BD2E 4QRUB 1RUPH 1IGCL 1GH7A 3TH4T 3QHTC 3BKJL 1XF3A 1BFVL 5BCAA 2E6QA 3SKOB 4WW2A 1NFDE 5SV3A 2A2QT 4PRBA 5E2UL 2Q86B 4BSJA 4TSCH 3EOAA 5E8EA 5LBSL 3BJ91 1F3DJ 4XTRC 5KS9B 3ARTA 3F7RA 4NM8L 4X98A 3EO1B 3WD5H 1FAIH 1VESA 3M8OL 4Y4HB 1QSEB 2PO6D 3FO2B 2J88H 4GRLC 2OMNA 1Q9LA 1C12A 3BGMA 4Z7UA 5F7WC 3VA2C 3SCMB 3WHE0 2GSIB 1P4IL 4HUWA 1J5OH 1E4JA 3BO8A 5D1QC 2EIEA 4GAJL 4Q97A 4XPGH 4ONGH 2YEZB 1CR9H 4X7TB 3UBXB 3OB0K 5TF1L 4YFEA 3QJFA 1Y18B 4WUKL 5LVEA 2GHWB 4Y8AA 4FA8A 4PLJC 1FFOB 5E6IB 5IMLA 1NKRA 1GAFH 5IMOA 4FXGA 3W39B 5TDOB 2NTFA 4JZJC 1WFTA 3B9AA 2D0HA 4G6AC 4WW1B 4OJFL 1XGYL 3QFJA 3HZYA 4GMSL 4L29A 4ZPTB 4ODVL 4PJDA 4S0TD 3BW9B 3G6JB 2P8MB 3GSQB 1DQTA 1ZA6B 2J8UF 2ZWLT 4D0CA 5I75B 3CX2A 4K3EL 4MCYA 4YGVA 5D7IF 4AL8H 4L9LA 1HSAB 3T4YB 4HIHA 2C4FT 2W0LA 1VACA 4JG0L 4BZ1L 3QCVH 3REWA 1DLHA 1KCVH 3ZTNH 1G7JB 3MV8A 3TNNB 2HTKD 4G6ML 1NAKH 5GGSY 3P40A 1MLBB 1K85A 3MRGB 3ULUD 3QQ4A 4WEMB 1CI5A 4XP6H 1RJLA 4XTRD 1NCBH 2X9YA 1FDLH 5HHNA 4C56E 4CGTA 2ZOKB 2FO4B 3NA9H 3U6RA 3MGAA 5A1AA 5DQDH 5HHPB 4URTB 2GUOB 4E0RB 3JWOL 4QRTB 3WIHL 4OD1H 3JV4B 1IAKA 2F8XC 1MOEA 1Q9OA 1R24A 1EMTH 1F2XK 5HYJB 3WHXB 3FB6A 2YD7A 4NO3B 2H3NB 4OM1L 4PJEE 1A7QL 2GTZA 1URLA 1CK0L 3G6AB 2NY4C 4PS4H 5FYKD 3RP1A 3LRGA 3ARRA 4L1HA 5EUKA 1DVFD 3SE8H 4B53A 5D2NB 2VDPL 1V7MH 3WUWA 2J8UA 3T09A 3O6LH 1K2DA 1OY3B 1RURH 4EVNB 5J3HD 5EZIH 2HA1A 2YRPA 3ZKSD 2IC2A 3OAUL 1LEGB 1AE6H 3RWGA 3EYUH 1E6JL 2VDPH 5I1LA 5ETUA 3IRPX 4JPVH 1KN4L 5SWSE 2WQRA 4B5EA 5HVHC 5DWUH 1RJYA 4O2CB 2P8PA 4U7SA 4DAGL 1M7IA 3CFDB 3IJYB 2R1WB 4MX7B 1VFBA 3OKYA 5HDQH 5I8EB 1DR9A 2DF3A 2Y36H 5HI4C 2A9NL 1OT1A 4JB9L 5DJ2A 1CU4L 1LQSR 4YHYC 3HZKB 5F1IB 3HNSH 5FXCH 4XRCA 1BBJB 1ES0B 3DVIA 5BRZB 3V5HB 5MEQB 4MQTB 4NJAH 3O6FB 1RZJC 5HGHA 4G9DA 3RJQB 4GXUN 4U6HA 4LNRB 2CH8A 1KJ2H 3EFFB 4MNGA 1PKQE 5BOZG 4CMMB 4QLRA 1CFNA 4OB5H 4R3SA 4ZO6A 2YD8A 5HPMB 3BD3A 1G9MC 1KB9K 5CP3H 3BPCB 4YHOH 1CXKA 2VB5A 4G42B 2DWEB 3GMOA 1I8IA 1RIVL 5C6TL 1UZ8B 5EWIH 1NQBA 3NCCB 2F58L 1OW0C 5E4EC 4XVTH 1XCQA 4D0BA 2NY6C 4HF5L 5A16B 3KYAA 1EFQA 1IKNC 1WBYA 1P84K 4WI2A 1SJVA 1JHKH 5CINH 4M7LH 2VKXA 4HS3B 3RZCC 2HLAB 2BY2A 4OGXH 1I9EA 4ZTOH 4YHMH 4HMDA 2BNRB 3PWPE 1FZMB 1Q72H 5I8EA 5HYSB 2P44B 5IESL 5DFTA 4OI7A 2D2OA 4M9OA 5DZLA 1P9MA 3BDXA 5ICZA 4G6KL 5K59E 2GT9B 3JWDC 4YQXH 4CRPA 5EC2B 2V2TA 1KCLA 2VZSA 4AMKH 2BVQA 4IJ3B 2HT2C 1A22B 5DJ8B 5CD3A 3NCJH 5F7HA 4ELMA 5MERB 1ZGLP 4I0CC 3JTSB 3L3KA 4POZD 2H1PL 3MR9A 3GSXB 2R2BA 2FX7H 4LVHC 4TNVK 4OUUA 4U49A 1AQDB 1NFIB 3CH1A 1OAKH 5FUOH 3GJEB 2YMXL 3T0WA 2V5MA 2ATPA 1L6ZA 3QWOB 4XGZB 3VRJB 2J88L 1P4BH 3GGWA 1MLBA 4X0KA 5J13C 5DYOB 3QFJE 1YNKL 1X5AA 4FZEH 2QR0A 3H9SE 2PYEA 4PJCA 5EO9A 5FECB 5EULV 3TA3B 4PYHA 4PD4K 1DBJL 3AY4A 5LCVH 4J3TA 3PHOA 3HI6L 5TDPB 1D5IL 3VGBA 3UBXI 1R5WA 2GTWB 2AJ3A 3RGVC 3SOBH 1R3HB 4OQ1A 3HG1B 4WJ5A 5DSCB 4TSBH 3OXSB 2CLZB 3QA3A 4Q2ZB 6FABL 3OJVC 4ETYA 3ULVD 3U9PH 1P6AB 3MJGX 4ZPTA 4Y4KA 4XAKE 3H9ZA 5GZNC 3D3VA 4F80A 2GKIA 1X4YA 5FECA 1JWMB 2VLLB 4W6WB 3T0DA 2VLKE 3KPRA 4PGZA 1GC1C 5KSBB 5DD5H 2IAMA 4GXVL 4BUGA 2E9JA 5EWIL 2HTLC 3VGAB 5JW3L 5JQHC 1FFOA 4RRPA 3QWOA 5E6IA 5TF0A 5JIIA 2PCPB 1TVHA 3BDBA 1I1FA 3LDBC 3DX9A 1AGEA 2EKSB 4XAKD 1MLCA 1X6NA 1B9ZA 4XH2B 5GS2H 1U2CA 5D7LB 3I3BA 2R29L 5E8NA 1RUKH 1ZAGA 3BP4A 3LPWA 3MFFA 4LCCC 4I5BA 3J8F7 2JJTA 4PJBA 2CRYA 3CXDL 1PKOA 3EO9H 4ELMB 4RAHA 1BHGA 2YN3A 4MXQD 2EDHA 4FTVB 1QSEA 3T1FB 4YR6A 1MFNA 1C5DA 1FBIH 1JZ4A 3CFBB 3SKNA 1KELL 4F7MB 4I3GA 1FAIL 2ENSA 3EOTH 5B39A 3H3PL 5KG9B 4BYHA 3CH1B 4PRPB 1BJ1J 2D4FA 2EICA 4JFYA 4PJ5E 1RZGA 1MI5A 4L4VA 1X44A 3WO3B 4G6FB 4BSWB 3N9GL 2B39A 5I1KL 4U6XB 3CSYB 4XPAH 5IBTL 3HAEH 3H42L 2BSED 3QDMA 3IDMA 4XNXL 1JNHA 1NMBH 3BSZH 2HWZL 2FIRT 3E8UL 2CDFA 4GAYA 3SPVB 4MS8C 3RVWD 1DEDA 2ZKHH 1XT5A 4M93B 2VMFA 4OKDA 1FZKB 2YN5A 4OZIA 4NC1E 2XA8H 4AQ1B 5BMFH 2QADB 3TO2A 4NQTA 4BQ6A 1QO3A 2EDJA 5B8CA 4CVXA 1ROWA 4PRID 2P24A 4JG0H 4L5FH 5AZEH 5ANMA 4JFDB 4GW4A 1NDMA 3ZYZA 3QRGH 1JGUH 1MFEH 4YGAB 2QKIA 2W0KA 3DX8A 5GIRB 1BGXH 2AK1L 4X8JB 4F58L 2J12B 4HGMA 1KG0A 5DD6A 4JHWL 1JBJA 3LKNB 4AENA 5D7KD 4YC2B 5JDSA 2FO1A 4LK4A 1DBKH 3O8XC 4JRXA 4K9EC 4GKZB 3NOIA 2ED9A 4RFNC 1XZ0B 1DQJB 5DQDL 3RNQB 2C3VB 5C0FB 3O6FA 4MA8H 2FWOA 4H88L 4JFPA 4HGWB 2VLJD 3NCMA 2I27N 1ZA3A 3VG0H 1P9MC 1OAXH 3S5LG 1BIHA 3FZUD 1YMMD 4IRJA 5D1ZB 1NMCB 3RDTB 2W9EL 2OXGA 2DBLH 4PJ8B 1B90A 3STBA 1R5VA 3W0WD 1D5BA 1ONQA 4KVNL 4Z0XB 5T1MB 5EBLA 4GBXB 1T5XB 4J3SA 4JFEE 9CGTA 1XIWA 5BXFA 3EJJX 5HPOA 2MCPH 5HYJA 1A2YA 3TM6A 3VMOA 1YQVL 3UROR 2EE3A 1DCLA 3BQUB 5LQBH 1S5HB 5I6XB 3P9LA 4NWUH 4AG4L 4EI6A 4KKAC 3GMMA 4YBLC 1NBYB 1GC1L 5FF6B 1K2DB 2K1MA 2NR6C 3QCUH 5B38B 5IMKB 1EJOH 5FHAH 4YDKH 3DMMA 1UACH 4CJ0A 4K8RC 3PWUA 2IH3A 1KENH 1CDUA 1XF1A 3KYNB 3V4VH 2I9TB 3OXRB 3O41B 4OD2B 5KSAB 3CDCA 4PJ7F 4KK8D 4OM0H 5D71L 1JPTL 3HC4H 3LH2H 2VITB 2MNUA 4NJAL 3REVB 5DD3H 2NXYD 1NUDA 4UDTA 5FF6A 1HZHH 2FO4A 2W9LA 1J12A 2I26N 4XNYL 3NIFE 4ZNCD 1VGEH 3BUYB 1UKSA 3MLRH 4ZS7L 1QLRA 1FFNA 2VDKH 5CSZA 5CHNB 2FEEI 2BNUB 3DHJA 3MLWH 3DUUB 1XGPA 3JV0A 1IKFL 4GAGL 1MHCB 4C56D 2CMRL 1MCPL 2CJUH 4GBXA 1FNGB 5GS0H 4M7LT 4O02L 4F58H 2K3TA 2L4OA 3U0WL 4ZAKD 4KJQC 2DBJA 5MEND 5EO0A 3UO1H 2PYFB 3QXDA 4P5KA 5AG9A 4NQCE 2VDKL 5D1ZA 4WHYH 4TSBL 1BD2A 1JWSB 1I1YB 2AJVL 1AHWB 1JHKL 2FEDC 1ZGLB 3SDDB 1IFHL 4JVPA 1UM5H 4FQLH 4PJBE 3C6LB 4APQC 1QPXA 1NDMB 2ZG2A 4N8VA 1QNZL 3GRWH 1SY6A 2C3VA 2YUXA 4K7FA 1WIUA 4RMQA 3ZYIA 3OAUH 2OR9L 5EU6E 5H8DA 5E03A 5F7EL 5J9PA 4YWGL 3NFPA 3GB7B 5FYKU 1HHIA 4OZ4B 5LGHH 3CSGA 2DM4A 4PLKD 4R4NC 3O11B 43CAB 3QNZA 1KPRB 1JPSL 5FV1L 2W0PA 2R4RH 4KV5E 4Q0XL 5C0IA 2EDWA 5ERWB 2NY4B 4E41D 2AEQL 3ZSTA 1D6EB 3RY6C 5ESAB 5K9QG 4TOYL 1UCTA 2JIXA 3P9MB 5BV7B 4N9GA 1OAKL 4DFHA 3PGDA 5DJAA 1HH6B 1BP3B 3HR5A 4Y2DD 2AV7A 3VFNB 5EN2B 2BFVH 2EDRA 5JOEA 1MCDA 3Q6GH 4KDVA 4LOUD 3QH3A 3DECA 3ZHLA 2R0LH 3TNMA 4RDQF 2X10A 1HXMB 3L3JA 3CFJB 1BVKA 5ALBL 4OUOA 1JNHB 1MCQA 5IBTH 1F6AB 2Y1VA 2VL4A 1ORQA 3DVGA 4UB0L 3SN6N 5D6CB 3MLXL 1KXQE 3QUMB 1U8HA 5JPNA 1AC6A 1CU4H 3RQ3A 2G9HB 4OGAD 4MNHB 1Z9MA 3U2SB 5IJKC 2V7NB 4Y16A 5IG7B 5TPWL 3QUYA 3BPOC 2EE9A 2YXFA 2WWMC 1G7LA 1CDJA 1WWWX 3ZLQC 6CGTA 2BNQB 3UTPE 1CXIA 3KPQB 3DX9B 4D94A 5B39B 3MRJB 1KBGH 2YUVA 4C56A 1MFAL 2ZUXA 2NY1B 2XZAL 1HHHA 3PQYB 1RZ7L 1FORH 4XPTL 4FTVA 1OGAD 3P0VH 2VZUA 5C0CD 3RUGA 3IVKB 3V8CA 3S34H 3WIIL 1KTDB 1SJXA 3MO1B 4PJXA 3GMQA 4DK3A 1S9VB 1H3WM 2H9GB 3T0EB 1YPZA 3VWJD 1PG7W 2ZUQB 4NGHL 4LSQH 2C3XA 4MQ7B 3OKEB 2DQFA 4U1GB 4OM1H 3RWFA 5CMAA 1GAFL 4YNYB 4CVZA 4R97C 5CINL 5ITFB 3GSWB 3MJ9A 3QG6A 5C2UB 5IVZB 4KDTC 3ETBF 1SEQH 4M7KH 5IQ7L 1T2QL 3ET9F 5IW6B 2RQ8A 1INDL 5LWYL 3BWUC 2XWTA 5I30H 4GW1A 4ZXBB 4YDJA 4FRWA 4B7IA 1MREH 3MV9B 4G8FA 2FRGP 4H1LH 3GIVA 3OB8A 4K71B 3VXNA 3KXFE 1RUQH 5DMKA 2ED8A 1SEBB 4Y5XA 4QRQB 4KKCD 3BFOA 2BC4B 4DGYL 5F88B 4QNPE 2R2BB 2UVEA 2BHUA 3LRSA 4WY7H 1DBBH 3BPNB 1A6TB 1QYGL 4P4KA 1EVTC 2IPTL 4PBWD 2E9BA 3MLSL 3X13B 2ZUTA 5CD3B 4I9WD 3MV9E 4U1SB 3FAXA 4QTHB 2Z93A 1FL6B 1NGYA 1Z9LA 1H3GA 3GGWB 3PWNB 3ULUH 3NPSB 4JREC 1JL8A 1IAOA 4GKSB 5IB4A 4P46C 3C6LC 3GJFA 5ALBH 3VG9B 1OP5K 1YNKH 5CZXD 5FO7A 3B9KA 1LD9B 4OCRH 4AIOA 1JMXA 1KLUA 3QRGL 1H15B 2ADGA 2W91A 2RAMA 1BQLL 3V95A 2IAND 35C8L 4R2GD 2UV3A 4W4OC 5IHBA 1FPTH 3LZFL 2J5LB 1T1WA 5F8RC 4XZUB 5DQJB 2ITCB 2YS4A 3QIWB 4YHOL 1AXTL 3GSNH 2HT3C 4PS4L 5BZDA 3U0TA 2V9RA 1FVDA 1R5IB 3FQXA 4H20L 3MBXL 4HWBH 3MCKB 4GBXD 4HPOL 3W0WB 4YDLC 1MUJA 4DVBA 2VR4A 1FNEB 1HWHB 2E9IA 2IAMD 3AAZA 2JB5H 1HHKB 4UT7H 1J8HB 1HQ4B 3IDJB 3ARGD 2HG5B 2A77L 2ITDB 1IL1A 3T3ME 1IAII 3RU8L 5IHUH 3EHBC 2PTUA 3QO0A 2EDLA 4BELD 4LCWD 1KN4H 3MRKA 1WBYB 4F2MA 4H1LB 5C9JB 5JXAL 5K9KA 1P7QD 1FNAA 3ARDC 2VLJB 5ESVB 3DURB 1DQLH 1ZTXH 4DGVL 1KJMB 1R3JB 4HV8A 3BIKA 2AI0L 1GGBL 3MUJA 5IMMA 1IGYA 3CSPA 1RUKL 3PNWB 2BZDA 4XRCB 2FNBA 1PX4A 1KTRL 3RU8H 1O0VA 4LLYB 1X5XA 5HVWA 1HHKA 5I9QB 1FLRH 5J1TC 1A6UL 3BXNA 2VLJE 3RY6A 5GRUL 4X83A 2XKUA 4JRYA 2BHYA 1GGBH 3HC3L 5EPMB 7CGTA 4LCUB 4MNGB 5JDJA 2FCBA 4JVWA 4EEEA 3HC0A 1CLZH 3QT2A 4A6YB 3OHXA 4R2GC 3CSYA 3VXQB 5GRUH 3VXRB 1LEGA 1QBLL 2D7MA 3A6CH 4IOIA 1PKQA 3X12B 2EIBA 3DIFA 5I1KH 1H15A 4RWYH 5HY9B 1UWGH 3DETD 4XPBH 3S36H 3MPCA 5CCKH 3MA7A 4AT6A 1H3XA 5FA4A 4GLRH 1DEEB 5LCVL 1SY6L 3C5ZB 5DI8B 4NO0B 2WNGA 5A2IH 4QOKE 5FKPB 2W59A 3TYFB 3GI8L 1C5DB 2G5BB 3MREA 1EEUA 4H8WL 3MUY1 3G04B 4ZS6D 2BOCA 5A2LH 3HA0A 3IETB 1S7WA 5FUZL 5T1LA 3TVMA 4HH9B 3TYGH 5E8NB 1RFDH 5EOCJ 2Y25A 2X40A 5C09A 4FMFA 3KPRD 3MRFB 1Q0YH 4XC3H 3SDYL 1OQXA 2XKNB 2CLRA 3AUVA 1CGSL 4LIQH 3UPRB 4Q9QL 1JGUL 1ZT4A 1EJ6A 2CLVB 4PP1D 3WFDL 1KCRH 5D1XA 3RWEB 4TULL 4IRSD 2JELH 3SGDI 1IC7H 1JNLH 3S4SA 4P46A 1S7VA 5I2IA 4HWBA 4ZS6C 4R96B 2OQJB 2HYMA 1OVZA 4X4ZA 1EBAA 5FFLA 1EUTA 4XCEA 1F4YH 5LGJA 2ZSWB 1KCRL 1U93A 4TQEL 3SJVB 2RFXB 5I18H 1FORL 3NPSC 3TLRA 3L5XH 4DKAA 1AD0A 1FRGL 3PHOB 1AGFB 3H3PH 1F3JA 4J6RH 4JANA 1TETH 3SO3B 4EDXB 5KTEH 4LHQB 1A0QL 5GHWL 4TTDD 4M8QA 3MRFA 3BESR 4XP6L 3NPZB 4UQ2B 5DDHA 4E9LA 5I18L 2VTFA 1C8PA 3KXFA 2ESVB 4QOKB 1YJDH 3MV11 1UXWB 4MDIB 4RRPG 3U7YL 4Z8FH 1T80A 4Y4FA 4QHLA 1PAMA 2DWDB 3TYFA 5LWYH 1CL7I 1P69B 5FAAA 1CT8B 4P49A 3VXMB 1I9JL 12E8H 1A4JB 5D96B 1QR1A 4ELKB 4OKVB 1MCIA 4HLZH 3TA3D 3RL1A 3T3MF 4ZFFB 3UJTH 5DHVH 4Q74A 4LF3A 3I2CH 1A6VH 4IEFB 3AXLB 4NO2A 5CUSH 4YDLB 1KN2H 1U95A 5CD5D 3HC4L 3MJ9L 3QIBA 3QH3B 4A6YA 1FZMA 1Y0LB 1QD0A 1R3LA 3U7WH 3BZFA 1WICA 1BLNA 1TVBB 4G9FD 5T3ZD 3LEYH 4V1DD 2VLKA 1DL7L 4QRRA 4RQQA 4RZCA 1F11A 4CW1B 5C0RL 3O2DA 1WZMA 4JN2A 4AY0A 4P3CL 2NZ9C 1YYLH 5ESAA 1T5WA 1XCQB 3X3GH 3JV6B 1I9RL 5C71A 4P3DA 5L2JB 3F7PC 4HGKC 1LK3H 1PBYA 4LKXB 4OZFG 4S1QL 5GGVY 3TPKA 1KPRA 2ADJA 4LEOB 3AS1A 4LCIL 4ZSOA 3BEWB 3BPOB 3TV3H 4G42A 4PJ5A 1ND0A 3WN5C 4ZFOB 2GJ6B 1Q9KA 1CYGA 2CK0L 3C60C 1XF2A 4S1DC 3WFZA 4LL9A 1NGZB 3D87B 3DETC 4CMHC 3SGJA 1ZVYA 5TQ0H 2VL5A 4KHTL 2Y5TA 1U0QA 3SE9H 4L9LC 1UKQA 5HGHB 1G7MA 5ALCH 4TUJB 1L9MA 2CUHA 2Q3AA 4AH2A 2FHCA 4NZJA 3VGFA 4JFEA 4WW2C 5D1QD 4I13B 4LSTH 3DUSB 4WDIB 5DJYA 3GBMH 3LEVL 5L8LB 1VEOA 5I71C 1DBMH 3MCKA 5E6YA 1J1PL 3H6JA 3MNWB 4S11A 3K4AA 4FFVC 3ABZA 5IHZB 2QLVB 4K9EH 1Y6NR 1TQBC 3CFDA 4CN6A 3AU1A 4HWZB 3VXRE 1N5YL 3V6FB 3JWOC 1Y6KR 5C86A 3FQUA 1HYSC 4MDJB 4PY7B 4N0CC 4GG6A 3DXAD 1QFUH 4JZJA 4NKMA 3FFCD 1OM3H 5I1JH 5CSZB 4K2UL 1JYWA 4I18A 1ZK9A 3NAAH 3ZHDA 1F90L 2EH8H 4LLDB 3MCLL 1U42A 5F6IB 3VD4A 5CEXA 2C5DC 1DQDH 1JHTA 5F97E 5D2LB 4Q6IC 2AV1B 2FGWL 3L5WA 4QXGH 5ID0B 5I8KL 4JDZB 4K2UH 4IMKA 4MA7H 5B3NA 4M03A 1ZSDB 2HKHL 2Y6SD 5HI5C 2XY2A 4H88H 4F7TB 2EH7H 2ZUYA 2W60B 1ZVHA 4AIZA 5D7SL 5IBUB 2EKJA 4MYWB 2XZAH 1KPVA 3FFDB 3MNZA 4AEFA 3V5DA 3FFCB 1WFNA 1MAJA 3LOWA 1S9YA 1YEFH 2R1XA 3MLVL 1EEQA 1D5MA 5JO5B 4PJIF 4Y4FC 1Q0XL 1JF1B 2VLKD 3L3GA 2OSLA 3U0WH 2O5XH 2X4OB 5E00A 3U1SL 3OR6A 1RU9L 5INDA 1W72A 4PBVC 3UJJL 3LVEA 3GMLB 1H5BA 5IT2L 1OARL 5C70A 3QQ4B 5C8JA 5HVGB 4IOSD 4MXVE 1OPGL 2FHFA 4LOUC 1RD6A 2PF6A 3R4DA 4KGJA 1QFWI 4JAMA 5KOVC 1S7QB 4E42B 5L2KA 3CFCH 5F96L 3MA9H 1INDH 2JKXA 3B9KD 3FQWA 4OZHE 3SDAB 1IBGL 3ECBA 1J8HE 3SDYH 4HF5H 1RZ8B 1YY8B 3QAZC 4X6EA 4YZFE 4BH7B 3B5GA 2OR9H 3DBXB 5J0BA 5KN5A 3CX5K 2Q76B 3N85H 5IVXF 4P5MA 3G6JA 1V7ML 1I8MA 3WKML 2R0ZL 4NWTH 3K1DA 3G9VA 3K2MC 3O9WB 5LGHL 4GRWF 3NFNB 1JWUB 2YPLE 3PIQA 4ODVH 4PRNB 2Q3ZA 5I1AA 1JN6A 5BV7C 4FQ2L 4Q6IB 2VQUA 1E4XH 1K8DA 1T04A 4XPHL 1LP9B 3KPOB 3C8KA 4TSCL 1F6LL 3G08A 5T1KA 4AL8L 5JW5B 3WDHA 5C0JB 2YOCA 2BSTA 3K46A 1CFQA 3WO4B 3PHQA 2CKNA 4X8JA 1NC2B 5F21B 2OTUA 1MIMH 5GIRA 3O6KH 3GJFK 2W65A 4QF1A 3U82B 2XTJC 4ZNEA 1EO8H 1G0XA 5IR1A 2Y36L 3MYZA 2HVKB 4YXLH 1S8DA 2ADJB 2EXWD 2B1HH 3BZEA 4NN5B 3HFMH 5C0GA 5SX5H 1OTUC 4AEHH 4CU8A 5TQ2L 1AXTH 1K4CB 3AS3A 4HT1L 4HJGA 1QLFB 1QVOB 1T89C 5E6ID 3HR5B 1B4JH 4WW2B 5F7NC 1LEIB 5AZ2H 4RSVA 5KW9L 3VXMD 3DARA 1IGJA 3O3EA 4HX1A 4LARL 4ZFGH 3HFML 2C3WA 3OKOA 2ZPKL 1T20B 3KYMB 1G7IB 3LQAH 3SCMD 3QUKA 3NTCL 4I48A 1IGJB 4HX1B 1BZ9B 3W9EA 4PJAB 5KVDL 2AXHA 1U95B 3SE8L 2EEDA 1J05B 4EI5A 4QOKD 4DGIL 4Y4HD 5DUBB 1DANT 4TVPE 2YD9A 3F5WB 4TULH 2HMID 1A8JH 2DLIA 3H9SB 3CZFB 3QEHB 5C0AA 5I1EH 1NCWL 2I9LB 3MUZ1 4BK4A 3MRPB 1S8DB 5C0DB 4NKOB 2GIYA 4Y5YB 5I1AB 3VFUA 4PRNA 1ITCA 4HS6A 3W5MA 5L9DL 1ORSB 1U8NA 4HHAB 2DTSA 4N0UA 5D5ME 3WIFB 3MRCB 2DQEH 1CZ8H 1E4KC 3HRZB 5SWSA 1FDLL 3T1FA 3VD3A 4ZYKA 4PRAA 1NAML 1G0YR 1JTOA 5HDQL 4EI5D 3QEGL 3LV3B 4IRSB 4H25A 2A73B 1WFOA 4HBCH 4KQ3L 1HHJA 4NCDA 4I3SL 1MAKA 5LXGH 2N7BA 4JAMB 3M1BA 3MX0A 4ZOBA 4K3JL 3ZL4H 4FQJH 1AD0B 3G5VA 4ZUWB 4N0CD 3O2DL 1FYTB 2VH5H 3KPRB 2IFFH 1XGTB 3DBXA 5D9SA 5D7JB 2X05A 1HKLH 4PRHA 4LLUB 1MIML 5E24E 4BKLB 4LPYA 4HS8L 4K7PY 4JFDE 2B2XL 4EOWL 5GRVL 1QEWB 3EYUL 5FYKE 2F58H 2MOVA 3V5DB 3EDEA 1MCJA 5F7MC 3C5ZD 3DYOA 5DA0B 5GGSA 5GSVA 4WTZA 3ARDB 4AJ0A 3M8OH 3K2UH 4GOSA 2ERJC 2D7OA 2AVGA 3CZJA 5JPMB 3WIIH 4HS8H 4XBEH 4M7LL 5I76A 4GKNB 2DL9A 1ADQH 1UQSB 1FO0B 1ULVA 1NCNA 4PGBA 3GMMB 4XVSH 2B7DT 3RBGA 3VXRD 1VFUA 4BQBA 3IETA 2QHLA 4JFQB 4WUKH 1AGCB 4Z76B 2IAMC 1UM6L 4CKVX 5IEHB 4F33B 3GSNL 4AIZB 3B43A 4EN3B 4PRPE 4GW5A 4MXWH 2G60L 5IB2A 3CCHA 2AAVA 4UNTA 3IXAA 3FO0H 5FUCC 4OM0L 5D71H 5DRXA 5TPWH 3QI9A 2AV1A 1UH3A 2AK4A 1K8IB 2H26A 3LKOA 2Q6WA 3ULUC 1OF2A 4ZOAA 4KJYA 3CFIC 4LLDA 4I3RH 5FV2A 1PY4A 1WIPA 1XFPA 4MXWL 1MJ7H 1HH9B 1Q0XH 2GT9A 4TUKL 5E94A 5K9JH 1UWXH 1IILE 2FEDD 1WC7B 4PUBH 3HHRB 2L7JA 1OP5H 1N59B 3RVTD 4LCCA 3LSOA 1FBIL 4XMKH 4KAQL 2JJTC 1P7QB 1G7MB 4WWKD 3Q6FA 1BPVA 3BHBB 3AROA 2B0SH 3IFOA 4G43A 1FL5B 4XP5L 2DMKA 1I1AC 2R56H 2YRZA 4WI6A 2DBLL 1HEZA 4PJIB 2ZUUA 4MA1B 1J11A 4E41E 1ZS8B 2QHRL 2DKUA 3MRRB 3MNVA 3DUSA 4WDIA 5TFSL 1D7FA 3BISA 4FQJL 4JFEB 3WDIA 2XT1B 5BV7L 3QIWD 4K23H 4JFOB 3BPCA 5GHWH 1OM3L 1D5ZA 1UGNA 5JOPE 3RTQA 1NMBL 1E0OB 4IJ3C 1R3IH 4PP1C 1IRAY 5I0ZA 4LP5A 4R2GB 1MRFL 2Y5TB 4JM4H 4LPUA 4ZDHA 1PVHA 4J8RB 5J6HB 2ATKA 4HMEA 1RUAH 3KVQA 4PGDB 1E4KA 1ZT1B 2X7LA 2WUBL 3NZ8A 4QO1A 3ULVC 3VWJA 5ICYA 1KIUA 1RUQL 1QSVA 1MUJB 5CCKL 2Q8AL 2AKRA 3D2UA 3R0NA 2MHAA 4MHHG 4Z77A 1OAYH 1JV5A 1BZQK 1YEDB 3MRRA 1V5JA 5TE4L 3QDJE 2J6EH 5GGRY 5I9QC 1HH9A 1J1XL 1JPSH 4F9PA 2XZCH 1F4XL 4P4RA 2HT3D 5FCSH 3IJHB 3U4EB 3F7YB 4OF7A 1BF8A 2R0KH 3JSSA 1OGTB 4HIXH 4Z9KB 3UYPA 5L7XL 3MRHB 2Q6WB 4W70A 1LK3L 4S1QH 4FQCL 3ULSA 1DQLL 2NY1C 4UV4L 2DLFH 4XP1L 3QIUB 2R4SH 2I5YH 3OPZL 2V6HA 1NJ9A 3QRFM 1UB5B 4BFIA 1MH5B 2XZQH 1WC7A 1KTLB 5HTSA 1L7IH 5JZ7C 1JK8A 1AXIB 1JZ8A 3U30C 1AP2B 3QPQD 3TBVA 1CGTA 4WV1B 5IB4B 4OF5A 1CICD 2H45A 4LBEA 3ARED 3WNPA 5EU7E 1U58A 4LARH 4ZFGL 4OFYD 2Z93B 3RL1B 1HYSD 1UQSA 1LE5B 4NC2B 1BQHA 1TPXB 3V7AE 2DJSA 4NO5A 4RMTA 5FYKL 1DFBL 25C8L 4LLQB 3RVXC 1DE4A 5IBLD 5CP3A 4AM0A 3MRQB 1MFCL 5IJVA 2YBRA 5E8PB 3VXNB 2A83B 3T0ED 1OTTD 1YEEH 2OJEB 3UAJC 4M5YH 5C0CB 4XPFH 1VPOH 3TVMD 1OGAB 1KBGL 3BKMH 3BYYA 1I7ZB 1DFBH 2HLFD 2AEIT 3EO0A 3QEQB 2Y07L 4JHAL 3FT4A 5I76B 1JIBA 5JPMA 1EV2E 1RUML 1EUUA 4X6BA 5IVZA 4YUEH 2VDLL 1IJ9A 3P0VL 4EIGB 1QFPA 4P57A 3WNMA 2K7PA 2RFXA 3ULVE 1HILA 1D5XA 1Q1JH 4MLIA 4V2BA 5FOBA 1Y6MR 1MF2H 4S1RH 4BZ2H 4NPYA 1FLRL 5I8KH 3MODH 3UTPD 1PDKA 1R3IL 1I9IL 4YPGB 3QDGB 1PZUB 1WIOA 3FJTA 2DOCA 4OCXL 4U1JB 1LNUA 1YDPB 4NN6B 2NX5E 2NY7L 6FABH 2FATH 5DK2A 4X0KB 2NW3B 4BQCA 1IGCH 2IQAA 1EX0A 3AREC 5B4MD 4NDMA 1E27A 1N6UA 2YD1A 3KPQA 5C08E 3P77B 3DI3B 4NC1C 4JFFB 5E99H 1MJJA 5EIQA 2DM3A 3EYOA 2W9DH 4M43L 4Y2DB 4OZGE 2A83A 2CPCA 3GKWL 3RX8A 1SQ2N 1J1OH 1CGWA 5T3XH 3QUMA 1QYGH 5D6CA 2GSIA 3V52H 2V2TB 3EYFB 4PJ9C 2NY4D 4XBEL 4HS6B 5HDOA 3QFDA 5I1EL 1T20A 5CGYD 4FFZH 4OLXH 3OJ2C 1IAMA 4OIAA 3KJ6L 4NRYB 1W0WB 4Y19E 3FN0H 1A7OL 3VH8B 2NYYC 3ROOB 2ZCHH 4Y5YC 5KS9A 2NY0C 3P4LA 5C07B 1BIIB 4RA3A 4DZBA 1HN1A 3EJYC 3ZTJG 3D0LA 2A9MH 4B7LA 1HH6A 2YK1H 2EDOA 3O2WL 4NHCH 2A1WH 5DMJB 4LRNL 1UFUA 1RK1B 3C6LD 4OTXH 1BX2A 3QO0B 2QJDA 3L3OB 4KXZH 3MBEA 4EUPA 5ENWA 5MI0C 3O11A 1BOYA 3KJ4B 5K9JL 3VDCA 1FNEA 3ZKNC 2D7QA 2RR3A 4WO4C 2R1YB 3X14B 4NRXA 3KYKH 2AJSH 1UYWL 4R7DB 2HFFB 5DJ0A 4UQ3A 4ZAKB 3PNWA 1AGDB 1PJ9A 3CFKA 3GSNA 3MACH 5MHSD 4NQEB 1MCLA 1NPUA 2DKMA 5EU6D 1NC4D 1HEZB 1FVCA 3E6HA 5EA0L 4K7FB 2OK0H 3ZE1F 2DQHH 4OCMC 2DQTL 4NBZB 4O02H 2PYED 4X80H 5AUMA 4HAFA 2VQ1B 1XR9B 4L8SA 5B39G 1IL1B 3CAFA 2HJLB 3MCLH 4YK4B 1NGQH 4KZDH 5ADPL 5DJ2B 1ETZB 5CKGA 2BSTB 2NXYB 2XI9A 3VFOA 2VC2L 1FE8L 2Z31B 2VLME 5IJKA 1KGCD 2B20A 3GSVB 3FB7B 3P4NA 4Y5XC 3FT2A 1ITBB 2CK0H 5KSAD 3MLZL 3ILQD 1XGYH 2DM2A 4PREB 4N0FB 4L4TD 3DV6B 2DIBA 2WUBH 5DRXB 4RA0C 5EO1A 4L8CB 4X6DE 1VA9A 3BUYA 4IBLT 4UBDD 4LEXL 4XNUH 3TBWA 5D7IB 4EN3A 3O6LL 3BQUD 4UI2A 2X1PA 2VE6A 5MENE 3OKMA 3NN8A 5CILH 4OCWL 4P59H 2R9HC 1N0XH 4MMZC 5DO2C 4OZHA 5FDWA 3ES6B 3BP6B 4IS6A 4MJ5B 1Z3GH 3CU7A 4HUXA 4Y4KC 4PJ8D 3PWPD 4P2CG 1UWEH 4OZGF 3T2NL 1PLGL 3PWVA 5DF0A 3CCHB 1YMMB 5E9DD 2Q1EA 4MJ5A 5J06A 4YBHA 3Q1SH 1NCWH 2PETA 3QFJD 1X7QA 1ZHLA 2A77H 2DRUA 1H3PH 2F19L 3KDMB 1TDQA 2DQFB 1AGCA 4LRNH 5HHNB 2IFFL 3BZ4A 5JW4M 2MQCA 2X4UB 3WIHH 1OT2A 2E6JA 3CSBA 5JR1H 2OJZH 4WWKA 2BVOA 4PGBB 3TIEA 4PJFB 2R0WH 4YX2H 4K7PX 1A7RH 3EAKA 1ONQB 2BSRB 1AKJA 4FQQB 3KPPB 4WEUD 2EDYA 2I24N 2WBJD 5E08H 3FRPG 4QYOA 3T2OA 4QRPA 4LPCA 3HS0B 1JGEB 1MRCL 2QQKH 3MACL 1INQA 2BRRH 3D3VE 3EZ8A 1DBBL 1QZ1A 4GG6F 1N3NB 1RUAL 4K3JH 4RMVA 4OCLC 3STZB 5GGVL 3B2VL 4F7CA 5F6IC 1CLYL 3QZWA 1BQHG 1OD7A 3Q5OA 3QPXL 2PTTA 3RIAF 4X5XB 2NY2B 3L5XL 3O3AB 4M48L 1DQJA 3CLEL 2FJGB 2NZIA 2YKLH 2QADD 3M17B 2KPNA 4UAOB 2VXSH 2Y23A 4HKJB 1T66C 4CVWA 1QFUL 1WQVT 4N1CA 3BRGC 3IGAA 1A7BA 2Z92A 4F7PA 3OG6B 1ERNA 1U3YA 4PJXE 1RI8A 3LDBB 2BP3A 2ZG1A 5C0AB 3TH3T 1B0RA 5DJCA 4H25B 1NEUA 1EFXA 2NY7H 4PRDB 3TP4A 4AH2B 2V2WA 4LHJB 4TUJA 1J8KA 4JRYD 1I85A 3ARGC 3NMEA 4M4RA 5IG7A 4TTDC 4HH8A 3BDYL 3IDYC 4EUPB 5SWSB 1MCEA 1GVIA 1DBAH 2QV2A 1UXSA 5I30L 1BZ9A 2X4SB 2XICA 3CVHH 1NDGB 3MV01 7FABL 1UB6A 4TNWK 4G8GA 5HHXH 3UP1A 2BVTA 4GG8A 4IMLA 1LEIA 3G5ZB 2VDRH 4KKCC 4RBPH 2CRMA 3B5HA 1UKTA 4G80A 1T5WB 5EN2A 2EXWC 4FQXB 1HOCA 4B41A 3WIHA 2A6IA 5F7LB 4ZTPL 4PGEA 4FTVD 4M6NH 1GPOL 1J05A 4NP4H 2YUZA 3O6ML 3IFPA 4PJAA 3HUJA 4KKBC 1T1ZA 1VFAB 5D6DC 3BN9D 3P9WB 1QR1B 4RFEB 4K23L 1FNLA 4JVUA 3S3PA 4LLWB 1GYAA 5DWUL 1AY1H 1F4YL 4PRDA 1FJ1B 3RKPA 4QF1B 5BVPL 3MRDB 4ZAKC 1UJ3B 3OBAA 5D70H 5C08B 1QRNE 2FYYA 5DMGC 2JK5B 3IF1B 1HHIB 4OZ4A 4LGRB 4O51B 2EDDA 3GHEL 4PJHB 3UTTB 4XP5H 2Z8SA 4JB9H 5DMIH 4U1KA 5KW9H 4G5ZL 4HKJA 5J6GA 3ARBA 2X89A 4OTXL 3W11D 1AGBB 4RGND 1A3LL 3RKDD 3ZTJH 5IFAH 4YEEA 2R8SL 4K07A 4PJ5D 4H8WC 1DN0A 2VABA 3TCLB 5D7LA 5D96C 2FX7L 3RVTC 3MGTA 5KSVB 2FJGA 2GYSA 4MDIA 1MEXL 1UXWA 3MBED 4WW2F 2H32H 1I1YA 5IVOA 1BD2B 4UU9A 2APTA 4LVOB 4PLJD 3ZSSA 5EZIL 5JW5A 4M61A 4YPGA 4I0PC 4QYOB 4U1HB 3GI9H 3SDAA 3MLSH 1CE6B 3R8QA 1A3RL 3MRNB 4LRIA 2YD6A 1JZ2A 2MKWA 1F3JB 4P57B 3PG2A 3DUUA 4F8TA 1DUYB 4KZDL 4P5MB 3FN3A 2Q76A 4H0HB 1EGJL 1S3KL 2X4UA 4I2XA 1W72L 2ZSWA 4G6MH 3OR6B 1W8NA 4F8QA 4PP2A 4OFKA 3IKCA 2OJEA 3B9VA 2NY3C 2F8OA 2R4SL 4L3CB 3N9GH 2MJWA 3ZYJA 1XCTA 3QIBC 3CLFL 3KDMA 4QRSB 3CDFA 2CLVA 4W4OA 4Z7WB 2Z4QB 3O6FC 3VE0A 1MPAL 3ULUF 4RWHA 2BVEA 4X6CB 4Y19B 4L8SC 1YJDC 4N68A 3L5WB 4N8PA 1M05A 1BFSA 1INEH 3C2AH 3GIZH 4EDWL 1JGDB 3RDTA 3ES6A 4IS6B 4JCLA 3OJMB 3MLTA 1QA9A 4C83B 1JYXA 4GUPB 1PZ5A 4R8WH 1U6AL 4WFFD 3BIAX 3LN9A 1CVRA 4E41A 3GHBH 3MREB 5L9DH 4MLSA 4G9FA 4ZPVA 1NJ9B 1YZZA 2C1PA 5ILTH 2D7PA 3T2NH 4PY7A 4HD9A 2H32B 4R4FH 5EU4A 5CJOH 4M7JH 3FT2B 1DBML 1RVFL 4NKQB 2FJFB 5FA4B 3S34L 3T8XB 5KAQG 4PJ8A 3LKQB 5I66A 4FQ1L 5JDSB 4V2CB 1DSFH 3VFOB 1KFAH 4X6FB 4MAYA 4QWWC 4X4YA 2CDGB 1RZKL 4HMCA 3W9DA 5BJTB 5F7UA 1IT9H 3DPBA 3VXUA 4PG2A 5DJDB 3S8WA 4L8SB 3GSOA 3VXQA 2FWOB 5J89A 5F9WC 2EDNA 3O6FD 3HMWL 5DJXB 4NCC2 2W9DL 2WWKT 3DSFH 3ZMRA 1FVCB 1XGUB 1G84A 3OGCA 3AB0C 4PTUB 2DQIL 3E8UH 4PY8I 4YIQB 1VDGA 3TO2B 4U4BA 1RIUL 1F3DH 3B8YA 1D5ZB 3TBYB 5SV4A 3U30B 1FL3B 1T4KA 2VDOH 3MRIB 5E2VH 1M6OA 3P0YL 3N1QC 1ED3A 1VGKB 2EDBA 2EYSB 4QEGA 3QIUC 4NUJA 2CR6A 4BFGA 5DK3A 4J6RL 2ICWB 1F11B 3V5HA 2HTLD 3HMXA 2AABH 4C54A 4Y89A 1N64H 4OGYL 2X4PB 5CGMA 4APQA 1HQ4A 1QLEL 3IDJA 3WXVH 1DDHB 1CG9A 4LSVH 1U8LB 3BZFB 1PQZA 5HGDB 4WUUB 3BEWA 1NFKA 2CGRH 1DVFB 3S3JA 1W0WA 3PL6A 4K94L 2A6JA 5GS0D 3GJFB 3QUZB 2LU7A 3O45A 2YUWA 1UVQA 4E5XA 1ZLSL 2FH8A 4MA8L 1ZANH 3KHQA 3HLAA 1U8IA 4YR6B 1D9KA 3IXAB 5T3ZE 1LO0L 3KXFD 4G8IA 5F9WB 4JFXA 5D4QA 3VXMA 2ZJSL 4HUVA 1A9EB 1XR8A 4XNXH 1HE7A 1MAML 2F54B 5GISH 1KB5B 1WCBA 1RMFL 4NSKA 2IMNA 3UTSD 1X5IA 2VAJA 1A6WL 2IANE 2VXUL 3IFNH 2VIRA 2IMMA 4WO4A 5HHQB 3OL2A 4NO3A 1HHGA 4GW1B 4NDMB 2WV3A 1X9QA 5I16A 3WYRA 4E0RA 3OPZH 1C08A 2NXZD 2A38A 3WJLC 4NWUL 4AG4H 2DWDA 4RBPK 3WUWG 3HE7A 2VZ1A 3HI5L 2H6PA 4JM2C 5E9DE 3ZE2F 5F71A 4YDVB 4LCYA 5H2BA 1CGXA 1QSFD 1Z0MA 4DKEH 2EDQA 5I17B 2GTWA 3QEUA 1I4FA 1PYWB 3MFGB 3HRPA 3V4VL 4JHWH 4I77H 3LIZH 4HEPG 3C5JA 1NEZG 2CK2A 1FC2D 3UJTL 3TO4B 4I0PB 4ZMAT 1SVZA 3C5JB 3QG7L 5DYOA 4CNIB 2FL5A 3W81A 3GJFH 5EZLB 3VFTB 4GO6B 1MFCH 2CLZA 4Q2ZA 2HT2D 1MFDL 3EO0B 1OP9A 3MJ9H 5IT2H 4LQFH 1F4WH 1DE4B 1U91B 4NQUA 1MRDH 2PO6B 1QSED 1YA5A 1IM3A 3AFLA 3RUGB 5J7CC 3LN5A 4NQSA 2QR0B 5F9OH 4LASL 4FXGB 3W39A 2CGRL 4Y19D 4LMQE 3PF2A 3GZKA 2DLEA 5D72H 4YHNA 5DI8A 1QBML 5E56A 1BWMA 1NLBH 3VW3H 3BWAB 3KPMA 3CFJA 3MLUL 3C5SB 1P4IH 1WZ1L 5C09B 3QEHA 3SDCA 1KTLA 4P5TC 3H9SA 5GRXG 1ZEAH 3RAJH 2E5EA 5B4MC 3HCVA 2JJSC 5ICXA 3I85A 2V7NA 3QIUA 3QXAA 2PR4L 4MNHA 5TQ0L 5DJ8A 5DR5L 4ERSL 5CWSA 3ALXA 1YNLH 4NM4H 2Q87A 5FKPA 4XCYB 5EU3A 1OTUD 5I8CA 3HE6B 3WMSA 3SE4A 1N6QH 4LSRL 4KUZL 3FHQA 1VENA 1VGKA 2EDXA 1BBDL 3IFNL 1F5WA 4Z77B 3KPSA 4PG2C 4XMLL 4TVSa 1RZJH 2JCCA 2UY6A 2VAAA 3BD4A 4YX2L 1XF3B 4HSQA 4M62H 2R2EB 4ZG1A 3SEPA 5IKCA 3DO7A 3JVGA 4F3FA 3N1FC 2AV7B 4HS3A 1BD2D 5DEGB 3BN3B 5J9PB 2CKBH 3FMGH 3LS5L 2ZKHL 3ARQA 5CP7B 4WEBL 1RY7B 3L1OH 1AI1H 1G9MH 3LKSB 5EBMA 4DWHA 1R3JA 3AMLA 5DO2D 4XXDA 4U33A 5HDBF 3IKKA 5CS7A 2P8LB 1A7NL 2VXTH 5FKAB 5MEQA 1X4ZA 4J8RA 4MJIE 1AH1A 4JFHD 2P1YA 3QPXH 3KPLB 2L0DA 1RHHA 2DS4A 3LS5H 2ARWA 4QHUA 5FUCE 3RDTC 1JFQH 1A3QA 3GBNH 1CFQB 4LSUL 3KPNA 3M07A 3K74B 4KQ4L 3MRLA 4MZ2A 3H8NA 2EO1A 5F3BA 5I71B 3ZKXC 4LSDA 5DQ9B 3BOVA 3WO4C 1S7XB 2YXMA 4Q6IA 5C08D 5F89A 1FG9C 3FQNA 1TCRB 3SY0A 2GW5A 5D7SH 2VLJA 4MNQD 5ESVA 1MHCA 1P84J 1U92A 4LQFL 4L4VE 5I1LB 1GPOH 4NP4L 2FLBT 4EBQH 5K9OA 2YPLA 4JZNB 5F7EH 2Q8AH 3I2CL 3RVVD 4YC2C 4F7EB 5ALCL 3AAZB 2NXYC 1WCQA 4BH7A 5AYUL 2VAAB 3VFGH 5HYIA 5I66B 2J8UB 3WKNA 4D9LH 1WBZB 5HHOD 1KB9J 1KCVL 2EYTB 5L2KB 4HIXL 5IWLC 1G7HA 1T1XA 1KB5H 4UT6L 2XG4A 4XBPB 4DVRH 3QUYC 3BP5A 5EOCH 5T33H 2E27L 1NEZA 2EZ0D 3CPLA 4V1DA 3FN0L 5E2WL 2MPAH 1K6QL 5JHLH 1NCBL 4KFZC 4XMKL 3VRIB 5SWSD 3NBNA 2A6DB 4PRIA 4YHIA 3FO9A 2R0WL 4EUPG 4OGZA 5I1JL 3LEXB 4OI9A 1WISA 3TV3L 5GGUA 1IFHH 2XWJA 35C8H 5C0AD 4YHNB 2VUYA 5IQ9B 2XPGB 3GFUA 1CXEA 1SYVA 3PWNA 1WK0A 3OXRA 4P2QB 3QI9D 4KRNA 2ORBL 1IAKB 5EBLB 4HFWA 1T3FA 32C2B 4JFZL 4JRXE 4O4YL 1A6TA 4P4KB 2PUQT 4JZOB 3TWCH 2OI9B 3QG6B 3KS0J 4ONHA 1U91A 3GM0A 2H2PC 3QXWA 4IRJB 5HHVH 4MCYB 1U3HB 4PJ7B 4NQVB 4MJIA 3RWIB 3P4OB 1AIFB 2DQGL 3DXAE 1ADQL 1JRHI 3VD5A 4KMTH 4YDJB 5HI5D 5T1LD 3FTGA 2IBGA 3LD8C 4Y8DC 3UJJH 4U31A 2LU3A 2J6EL 1XGTA 5DS8A 2WBJB 1ZHNB 4XVJH 5CJXC 1II4E 5DEFA 3VFMA 4KTYA 4ZO8A 3RZCD 3DWTA 2PW1A 5GGRA 2BERA 4Z7OF 1MELA 3QJFB 1J0JA 1SBSL 4U1LB 1BECA 3QULB 4XXCC 1WBXA 3TBTB 5I1DB 3QCTL 1BWWA 5FEBA 3U48A 1DN0B 4IRSA 3C6SA 1QBBA 1Z9SA 2SEBA 2FD6L 3QFJB 4I3RL 3OMZA 4L8DB 1N26A 2NY6D 5E7FA 1J0YA 1ACYH 2DTML 4WO4B 3K0WA 1ORQB 4N1EA 1V05A 1TJGL 3AMKA 3CVIL 5CJQH 4S1SL 2N4IA 4N8CL 4O51A 1MWAB 3C9NA 4JM2A 1A6AB 1T0MB 1BVLA 5KVGL 1JE6A 4ZSOB 1WJ3A 4ODUB 4ONFH 3U83A 1YYML 2DQDL 3GNML 4B50A 1A4KB 1RJZA 4R4BA 3RGVB 3TJEL 5C0NC 5AD0B 3VDBA 2CDFB 1T0PB 4GAYB 4Z7UF 1G7LB 4ZUSB 3SPVA 4JFDA 1ACYL 4G8GB 1KV3A 1MFAH 2YA1A 1SMOA 1Q9LB 3BGMB 1F4HA 3G5XA 4U0RB 2VLRD 5E5MB 3IAQA 2HH0H 4O5LL 1PFCA 3SE4C 4WV1C 4OFDA 2IPTH 4JO1H 1IT9L 1IGMH 4LLMB 4U1NB 2IWGA 4X6DB 5KSBE 1YEGL 3Q5TA 3HTLX 4M1CC 1E6JH 1XEDA 4F3FB 1HI6B 4OQTA 1YPZF 5BOPA 2DI9A 3DSFL 2DLTA 2VISB 3I6LE 4WVRA 3S96B 1LE9A 3RGVA 4OZIE 2B1AH 1QVOA 3OF6A 3HPJA 1T6VN 5MI0B 1NDGA 2HN7A 3T0XA 4NT6B 5DRWB 5I1HL 2UWEE 1T2QH 3C09B 1DSFL 4LLMA 3CGTA 4U6XA 3SGDH 4NWTL 2ZPKH 3WN5B 2JIXB 2W92A 4ZD3L 1NGWA 1QOKA 1J9CT 4YHLH 2JLLA 3BKYL 5A3ID 3PP4L 1M6OB 3C6LA 1J0KA 1KIPA 1WBXB 3TBTA 3MBXH 5FYJE 3VWKB 3QNZB 5EU6B 1BVLB 4PUBL 1A6AA 1N3NA 3W5NA 4UTBL 1V7NH 4MQXD 4P5TB 1MCFA 2PW1B 3NFPB 5GGRB 4PLKC 3NACH 4KTDH 4J3UA 2RBLA 1JCKA 2C3GA 4GKOA 4WI9A 3O3UN 4NQSB 5C0ND 2VLLA 2A6KB 1NAMB 3O3AA 1NSNL 1WFUA 4I5BB 5E4IA 1JWUA 5FIEA 4FABL 5ID1B 4G8GE 4PJFA 2RB8A 2AQ2A 4YXKH 1S7UB 1HNGA 1J1OL 4Z7UE 1DTUA 2W07A 1MJUL 4XI5D 1S5IH 1ZGLA 1ZHKB 1YC8A 2VC2H 1U93B 4AK1A 2IH1B 2PCPA 1L7TL 4IMKC 3NABL 3QNYB 1IC4L 5I73B 5AG8A 2WINB 1A6UH 3V6OE 1KENL 4KRPB 2WQ8A 3VFMB 1VCAA 3REVA 3O3BA 3RA7L 1YN6B 3GIZL 4EDWH 2NY5C 1MCCA 4PJCB 4M1DL 2X1OA 1KEML 4L1DA 4OD2A 2XPGA 5DVKA 1GZQB 3WE6B 3QO1B 1FNSL 3VD9A 2R1XB 2P5WE 4LU5L 1OWWA 1SYSA 2KH2B 2LVCA 1T7VA 2BMKA 5IVXB 1ZANL 4PJ9D 4NHUA 3IT8D 5TH2B 3GI9L 4UDTB 4UT7L 1LMKA 5I15L 4HH9A 2BMKB 1TNMA 3MLWL 3HNTL 3ULVH 4JFFD 5AEAA 5HI3C 2VITA 4C4KT 3T65B 5JHDD 5HJ3A 4XP1H 4HIIA 3WJJA 5JHLL 5HVHB 1XF5A 3I50H 4EUPH 1G7QA 2APXA 2AI0H 2EE6A 1MHEB 4HIJB 5I73C 5BS0D 3V5KA 2XWJB 2QHRH 3EJYD 4PJDF 3GSVA 4RAUA 3MUGA 4DOHE 3OV6A 4I2XE 3V4UL 5DGQA 2DQHL 1OAUH 5ECJE 4EI6B 3C5ZC 3ARFC 2N7AA 4MDJA 4YFDB 5H37H 3OX8A 4PV8B 4NZTL 1D9KB 3I6KA 2F8VA 4F7EA 1CLCA 5JORA 4HXBH 4RGMC 3EFDL 4POZC 4JO3H 3N1PC 2PKDA 5F1KC 4KK5C 3ZT6A 4YDIH 5JHDA 1NBZA 5GRYA 1CLZL 1UENA 2PW2B 5T1MA 3WLWC 3RIFF 3HNSL 3DHMA 3QCVL 4J12A 4HCRL 4BH8A 1KJVB 5D5MF 3K8MA 5T5NF 3BKJH 3EFDH 3QEQD 3HNVL 2CKBB 3LKPA 4CAGA 4C55A 4QRPD 5L8KB 3F7QA 4ZO9A 4APQD 4UILH 1LO2H 1OTSD 2BY3A 1N2RA 2O5ZL 1OL0A 4PJEA 3T0AA 3DV4A 2JB5L 4M4PA 3O81A 5E8OB 3T0EC 4HQQL 5F89B 2VWEC 1S7XA 2PR4H 2DMBA 4PJEB 1GCFA 2HVJA 1PY9A 5BZWA 1LEKA 5H94B 4UT6H 3NCFB 5JXAH 5F72S 1OP3K 1LGVA 4YE4L 5DJ0B 3D6GA 3D39A 1BIIA 2APBA 4XB8A 5C07A 3CXHK 4DZ8A 3GMNB 4H26B 5A2JH 4NQDD 3FCTA 2DQCL 3GK8H 4JM2D 1FVEB 5IF0A 3HE6A 3ROLA 1PW3A 5GGQH 1E4WL 3LKSA 1T1ZB 1VFAA 2P7TA 3VFPA 3HUJB 3CVHL 2C3HA 5CWSB 4A2LA 4PGCA 3GBML 3LEVH 4PJXF 1RK0B 4LMQI 3H3BC 5GS1B 4YQXL 5TE7L 2KQNA 3DO7B 3G5XB 4OFYA 5E70A 5AYQA 4G80B 1N8ZA 1EH9A 5DD1L 3GKWH 3VXUE 1D6VL 4DTGL 3HPLB 2R1WA 4MD5A 3G9AB 3H0TB 1I7RA 4HDIB 1KT2B 2VSDA 2UWEA 3A67L 4J1UA 4JKPH 1I1AB 3N0PB 1MFBL 3IDMB 3OGOE 3EW3B 2DD8L 2NR6D 1U2HA 3SKUD 4PLNC 2D9CA 1HCFX 1D6VH 4DTGH 4OKVA 3S6CA 1S7SB 4KI1A 5DVMA 4P48A 5J57B 5MHSE 2V2WB 2PO6A 5CEZH 4P3CH 5JW4Q 2CUMA 5CZKA 3U46A 3BX7C 1GGUA 3FB5A 1F8TL 1L7IL 4XX1E 3QCUL 1FG2B 1AFVH 1KUMA 2HT4D 2EDKA 3GSUA 1M05B 4JFED 5D1QA 5J11C 3CDGA 5HYSG 1GGIH 2IQAB 1G6RB 2WBJC 1DBJH 4O2FA 4Y4KD 1WV7T 1SBSH 4X4ME 2E7BA 3B83A 3V4PL 2A74A 4FNLL 1E4XI 2GK0A 3SJVE 5EIIB 2QL1A 1I1RA 4EDXA 1CN4A 4UZGA 5IW6A 4EI5C 4WGWB 3U7AA 4PTTB 4YHZL 1GGIL 4MJ4A 5FYKH 5GPRA 1ZT7A 1IEAB 1MQ8A 3JWDL 3RWFB 1S7VB 4K94C 4MNQE 1UCBL 1YN7A 1EO7A 1MVUA 2YPVL 4XCEB 3V6OA 1Q8MA 3KLAA 3VFTA 4GAFB 4MD4A 1IC5L 2IANA 1C08B 1NLBL 3VW3L 2X4RA 3CU1A 2NW2B 5EUOB 4P9HL 4XB7A 2ZUQC 4NM8H 1NANI 2ARJB 5C0RH 5F96H 5C9KA 4J23A 2DMCA 2NTFB 4OLYH 3MV8D 4ELMF 4MA3B 2HH0L 3NFSH 3T4YA 4K94H 4BFEA 4BUHA 4MB5A 5B38G 3MXVL 1BFOB 1A0QH 2AJYL 4Z7WE 3BRFA 5L8JB 1FG2A 4U3XA 3NAAL 2G5BA 3MLPA 2YZ1A 1N7ML 3EDJA 3GSXA 1MY7A 3ZDXF 4PV9A 1A1MB 3RFZC 2AEPL 3RWDA 1MCSA 2WWKO 3IAGC 5DURB 3DRTA 4L8BB 2GK0B 3QG7H 2BJMH 3O8XD 5AAMA 5DRZA 2RJMA 2W0FA 1I9JH 1I1AA 1UEMA 4P2OD 2XKSA 3EOAB 5E8EB 2YD3A 3VD7A 2IADB 4MD0A 5DUPL 4ZQKB 4B0MM 4LLVB 3GRWA 1WCBB 4D0DA 5D7IA 1T2XA 5ELIA 5HGDA 3SDCD 3F58L 3HI6H 2YPLB 4JZNA 4P2RD 4P2RB 1RU9H 5I1IH 2ZP0T 1ZTXL 5K9OB 2VDLH 4XNZB 5FA3B 3V52L 2XG5A 3OHXB 1Z5LB 4X4XB 4XWOC 2JTDA 4PB9H 4Q7DA 1LP9E 1FYTD 1CDIA 3Q5YA 4LPTA 4HDIA 4K8RD 1HXYB 4BZ2L 1I7RB 3F58H 3VWJC 3SE3C 4CL7A 4IOFD 4RGOL 2DLHA 5FOJA 1IGYB 3HMXL 4ODUA 3MRLB 5BQ7B 3MROA 4M5ZL 4Z95H 4LHUA 1T4KB 2DIJA 1V3JA 1DLFL 1S5IL 1T0NA 4M7ZB 4OLUH 5DURD 5KS9F 1UXSB 3NTCH 2ATKB 2X6MA 4OFIA 3NA4A 4DN3L 2VDRL 2BNRE 1IC4H 1J8HA 2NCMA 1VSCA 3ARZA 2DYPD 2QQKL 5D5MB 3BI9X 3UBXG 3A6CL 1SM3H 4Z0BH 3MRKB 1E28B 5K9KB 3PUCA 5GS3A 5C07E 2MSPA 3OKKA 1VERA 5DEGA 1H0DA 4NRXB 1AO7B 2WW8A 5DLMH 3W9DB 1IEBA 3H9SD 5ACZB 3HE6C 1CCZA 4Y2OA 3ZDZF 4DVBB 5BZDB 2OI9C 2BOBA 2D9QB 1SY6H 4PJCE 3ARUA 1CFTA 4J4PA 4ZUVA 4KV5F 1X5GA 3IDGA 1RZ7H 5IFJA 1WZKA 4QTIH 2AW2A 1IC1A 1P4BL 1G9NC 1U8JA 3B3IA 1EIBA 4X5XA 4FFZL 2XYCA 4OLXL 1P7QA 3D1MC 2NY0B 1UT9A 2K9UA 4RNRA 4Z18A 4FQIH 1WZ1H 5I1HH 5ANME 3FAWA 5E1AB 4F33A 4NNYA 3CFCL 4HBCL 3QUXA 4QXWA 5IEHA 3VXUB 1N7MH 3RI5F 4XNZC 3RWIA 4WNQA 2CD0A 5DA4A 3WNNA 1E6OH 2K7QA 2BJML 3RTQC 3BJLA 4G3YL 2EIZA 1TENA 4YXHH 2DM7A 3G6AA 4IOFC 3FB8B 5BS0A 4GW5B 2AP2A 3FO1A 1NGYB 1HKLL 5T3XE 3HI1B 1LO0H 3NACL 1QFWM 4QY8A 2CRIA 3JV4A 1P7KA 3TBSB 4JFQA 5JW3H 4J3VA 5TGBA 1NC2D 2EH7L 1IGFH 1MJJB 4JGUA 4GT7A 1KLFA 1JNNL 2M26A 4GMTH 2G2RA 2X2YA 5DMKB 5J8OA 3E0GA 4X4MA 2E7HA 3TO4C 1RIUH 2ILLA 3LMJL 4HUXB 4DKFH 1S9WA 2H2SD 1R0AH 4XNMB 1FO0L 5ADOL 1GOFA 3TO4A 3SGEH 1CDCA 2NMSA 1F6FB 3LQMA 3MRNA 4PJGB 3ME0A 3FL7A 4M7ZC 3E3QE 2FECL 2A73A 3B6SB 1WTGT 4YK4C 4S10A 2IH1A 1FO0H 5DJZA 4LHUG 5AZ2L 3LHPH 1ZA6A 1IVLA 3SDAD 3V4PH 2GITA 3FQTB 3FQRB 2EC9T 1CDYA 3VXSB 1MVFA 1ORSA 4DKDC 3NA9L 4KK6D 5JTWA 1YN6A 5T5NG 3ARWA 4U1HA 2DQUL 1JUFA 4OIBA 1NCDH 3EYVA 1RIHH 5IMLB 3NIDE 2F5BH 4K8RL 5C0EA 3I3DA 3KJ4C 2VDML 4PJ9A 4OCWH 4HC1H 1RHHB 1KJ3H 4ODXA 5C08A 5T3XD 4AYFA 4Z7OE 2E7MA 2F54E 4GBXC 4U6YA 3SBWC 3AS2A 1DL7H 2ICEB 2Y4SA 1G7IA 3E6HB 2YKLL 5GZOD 2IEPA 1JI1A 3VJ6A 5JPNB 3DX7B 3QUZC 3PV6A 1XAUA 4L3AA 4U1KB 2FBJH 2GCYA 1U58B 1T1YB 4R7DA 4ZAKA 5HD8C 1WF5A 1K5NB 4NQCA 4X6DF 4YDIL 4HUNB 4JPVL 1J18A 3IDNA 3LQZB 2F5AH 2JCCB 1JK8B 4D8PA 3ZKMD 4HUWB 3CK0L 5HVFB 2XWBB 4OAWA 1FAKT 5KJRL 3DXAB 1RK1A 4LIQL 4RFOH 5EU3B 3KGRA 2XWBA 3IFPB 2XOTA 4OBRA 4DZBB 5DMYA 1MCNA 1LILA 1T22B 4RCAA 2ADFH 4UOW0 1MI5B 3QQ9D 1BQSA 1N0LA 4OFPA 1YEDA 5T5FL 4OCYH 1B0RB 5DJCB 3SE3A 4D8PB 5HYEA 3WS3B 2JJVA 3VJ6B 1UB6B 3WSQH 4JR9L 2I07A 3DGCR 4JO1L 3K2UL 3QDHA 5FYLL 4NN6C 1FV1B 5C6PB 2O61B 3L7EA 2MCPL 4PJ9B 2DJ4A 4KH2A 5HYQB 1EFXB 3PDDA 4FQHB 1U8KA 3G08B 5T1KB 5DFWH 4PJ7E 4G8EA 4LSUH 2L7UA 3EOTL 3TGXA 2LVEA 1SHMA 3TVMC 3QJHA 3INUH 1ZMYA 5HDLA 4X6FA 3PIQB 1HSBA 4GS7C 2R23B 4EXKA 3WLBA 2IG2H 4NZUH 3VXSA 3D18B 1KIQB 4X7SL 3WUZA 3V0WH 2R39A 1YMHA 2V7HB 5KSBA 1CDBA 1Q94B 5CHNA 2CIKB 4LSQL 4TUOB 5K93A 4XVUD 3IFOB 1QQDB 4G43B 1KOAA 1A6WH 4NC0B 2B5IB 3L3GB 3FTGB 1I3RB 4HC1L 2EEAA 4G9FB 4ZPVB 3QQ9C 1MCWW 1P4LA 1H8SA 2NLJB 4KPHL 3UEZA 4MJIB 4ODWA 1E4WH 3P2TA 4C83A 4BJLA 5F9AC 3F62A 1N6VA 3HE7C 4O00A 3B9KC 1IQDA 1S9WB 3ARFB 3U36B 1UWGL 4XPBL 4R9HA 5MENA 3KPPA 5I16B 3SKJH 5J11B 5EOCL 4GAGH 1W72B 2OTPA 3BN9C 3VXPA 4X6CE 3UDWA 4NFCA 4P2QA 4DGYH 3T77A 1AY1L 5C2BL 3RUGE 5I19L 1ADQA 5JMOC 3UXFA 5DHYA 2VIRB 2JJWA 5JO5A 3TA3C 3VWKD 3PDOA 5M94B 4F9LC 1AI1L 1UJTA 2XQBH 1CLOH 3X3FH 4I18B 3QUXD 1WAAA 2FATL 2J8HA 1A9BA 3QXUA 5M7QA 4NOFA 4UNVA 1GGCL 3FO1B 5CKAA 1IGIH 3VXTB 4OJFH 2VXQH 3UYRH 2ESVD 4JFXB 3RA7H 4G8IB 1YEIL 4JY5L 1MRFH 2J5LC 3KPSD 4M8VA 5IIEB 4NYLB 3ARDA 1NEZB 3L3IB 2HJFB 1VKXA 4UINL 4WRLA 3TZVB 3WNOA 4LVOC 4W81A 2FB4L 3V79C 3PHSA 3RWCA 3PXHA 4QGYA 1WBZA 2ED7A 3SJVD 2QSQA 3EZJB 3QHZH 3D0VB 4XMPL 1IC7L 2JE8A 1YUHA 4P0DA 5L6YH 3D69B 2WBWB 3C08L 1U8LA 1CG9B 4U1GC 4WNQB 4XP4H 3ZDYE 1M71A 4WU5A 1R6VA 5IFJB 2VLRB 4GKZA 1CVSC 2FIKB 3MLUH 4KAQH 5IHZA 1ZWIB 5CJ8A 5CJOL 2I5YL 3L9RB 3VCLB 1NLDH 3RGVD 4WHCA 3FN9A 3P4NB 1ACZA 4OLZH 1FE8H 4FZ8L 4GJTB 3N50A 2GEEA 1UJ3C 4X7SH 3LKNA 4AENB 3JV6A 1U8MB 4WO4D 5LG1A 4CVUA 4DQOL 2DQJH 5EU7C 1FV1A 1N6QL 3GO1H 1XR9A 3V6BR 4QRRB 5FHAL 1A7PH 4LLWA 5ANMB 4M62L 3RWJB 1ZLUH 1JHLH 4FQXC 3OKLB 4MCZA 3SGJC 2P42B 1MCRA 1QRKA 1V3KA 4MAYC 2OBGA 3N1MC 3FONA 5BRZE 1HOCB 4FQXA 4ONFL 2CDGA 3IRZA 3RZCB 1S7TB 4XPFL 1LO4L 2M8XA 2AXJA 3SDXA 5IB5B 3GHBL 4Z7QF 5HGAB 2OXHA 4YHYB 3I50L 1VGEL 3MJ8A 4L3EB 1BJMA 1OARH 3GBNL 4KUCF 1JPGB 5L7XH 3DRQB 3FZUC 2O5YH 1P6FA 2GSGB 4MD0B 1NGPL 4IRJD 3X11B 5IVXE 1EERB 1KFAL 2X4TA 3ZDYF 1R0AL 1PZ5B 2UZXB 2WWMD 3EGSB 5ACLA 2YPKB 4NZTH 5FB8A 4WFGE 4Y2DA 4P4KD 3OKNA 1SM3L 4Z0BL 4NQDA 2HP4A 2WIIB 5LAXA 3QI9B 4P2QD 3OTTA 3V9FA 5KG9A 2LV4A 4HZLA 3DTXA 2GTZB 3QDJD 3MFFB 3D9AL 1TXKA 2Z4QA 2W65B 4KMLB 2BXZA 4NUGH 5BVJB 1TITA 1BBDH 2ZNXA 3LN5B 4LCWB 4JLRB 5EZJA 5E99L 3IYLW 5C0EB 3MLYH 5CGYC 2XTJE 4PV9B 1QR4A 3ARGB 1CIUA 4DVRL 5E2VL 3LS4L 4RX4D 3U6RB 1B4RA 2IAMB 2Y6SC 4UTBH 4P46B 3DVFA 3STZA 4ENEC 1I3GL 4GH7B 1KELH 2DJUA 3VXSE 3KHOA 4PPTA 3DMMC 1JNLL 4HJ0C 4OLVH 4U1IA 2XNAA 5IBUG 4FFWD 3MRGA 5IM7A 5J1AB 1DUYA 1W2KT 4Q0XH 5L2KD 5LGKA 2VYRE 2XTJB 4S2SB 4QHNA 4Y4FD 5IBLC 4HFUH 2AS5M 1CD1A 3B6SA 4G6KH 4S1DD 3EKCA 2IANB 2OX5A 4AEHL 2APVA 3FQWB 1I4FB 3O4OB 1CD1B 1OCWH 1T89A 5D9SB 4R90L 1VFOA 1QFHA 3ARBC 1JP5A 2AJ3B 3DROB 3R06A 1U3HC 1X7QB 1ZHLB 3VRLE 3NCJL 2VABB 3Q2CA 3HB3D 4D3CH 4PTTA 5D1XC 5TDNA 5TF1H 5J12B 4X9FA 2Q8BL 5TE7H 4L4TA 4JY4A 1AGBA 3S35L 4N5UA 3EJZD 1A02N 5C09E 3KS0H 1G6RH 1IGTB 3O4LE 3P30L 2P5WD 2E3VA 4U2ZA 5H2BB 4LCYB 2BOCB 1G9NL 2E9WA 4KU1A 4HCRA 3IS0X 5CILL 3HNTH 2BVQB 1A5FH 4QXUL 1KB5L 1FJ1A 5EA0H 4F7TA 4HAGA 5IROC 4JDVB 3TYGL 3JTSA 1P1ZA 4MWFA 1FH5H 3VFWA 4NKOA 4Q9RL 4ZXBD 3ZDXE 1P5UA 3O0RH 1V7NL 1S78C 3HPLA 5IB5A 4MB3A 5T1DH 1LDPH 3SDXB 3EO1A 3MOQA 4XBGA 2BNRA 2Z31C 3VFRA 1ZV5A 4OLUL 4GRLB 2UWEB 4Y4HC 1PKQB 4TPRH 3DYPA 4PJEF 1L9NA 4NN5C 4BFIB 3DRQA 4IIQA 1JPGA 4I77L 3TPUA 1JVKA 1W0VB 3VWJB 4X99A 3V6ZA 1CFBA 3ROLB 7FABH 3AU1B 4A2MA 2EEBA 4HKZA 5CJ5A 1DP0A 2Z91A 3FCTB 5KVDH 2ITDA 3JWDH 4D9RD 4KJPC 4FQLL 3BYTA 4D9QD 1T7ZA 2J3SA 3PQYD 5FCUL 4KRMB 5TE4H 1F00I 3RVUC 2VDQH 4JQIH 3STLA 4RWYL 4ODSL 2HFFA 3SO5A 3EO9L 4HWUA 4XP4L 1B3JA 5GSRB 4UV7L 2V9TA 2X7LB 3O4LB 4KI5F 1CGVA 3QIWA 4TRPL 2CKBL 3FMGL 1NFDF 5ISZD 5F3HB 4PB9L 1FL5A 3EIFA 1PLGH 2VDMH 2OZ4H 3L7FB 5F1IA 2NX5D 3QHFL 3C60A 2DI7A 5J4MA 1U8MA 2F53B 3PP3K 3DV4B 2LE9A 3D69A 2JB6A 1IAIH 4QGTA 5BRZA 3V0VB 4BFBD 3RNKB 1ZEAL 3RAJL 5F1OB 5IWLA 1S78D 4F15B 2VZ3A 3GO1L 3LD8B 4XCFL 4PYGA 1RULH 5EBWA 1VHPA 3TO4D 3PWPA 1QFOA 1Z5LA 2ORBH 1I8MB 2ITCA 5F6HJ 4MX7A 1KJVA 4FXLA 1M7IB 2FJFA 3BHBA 2Y06L 2EDEA 3ORJA 4Q9CA 4LSRH 2VXVL 3VXTA 4Y2DC 5ETUB 2KKQA 1QSFB 2J4WH 4E41B 1I7UA 3ZDZE 1H9VA 1KJ2L 5KSUB 2NXZB 3VXME 3MLTB 4ODTL 4JFHE 5HHMB 4ESKA 5T3ZL 4RDQG 1YECL 2JJUA 4U1SA 3NH7H 3O6MH 4R4FL 5D2NA 2DICA 4R4ND 2X4QA 2XXCB 3L5IA 2ZUWA 1MFEL 1SVCP 1OWRM 3DVNB 3F12B 4FQIL 3K1KC 5TH2A 2H8PA 4FQ1H 2OLDA 3UTSB 3MODL 1AJ7H 1XCTB 5JXEA 4LPVA 3DROA 3PL6C 3R06B 4KROD 3HUJE 4LVNC 1KTKE 4XCCH 2F54D 3SO3C 4RAVA 3A0OA 1FGNL 1B0WA 4FMKA 4HQQH 3KXFB 1LWRA 1C5BL 1HKFA 4BKLA 3QUYD 1XF4B 2FX8H 1JGDA 1ZE3C 2P43B 4TSAH 5AWNL 3TNNA 2P5ED 2C4FU 2MQ3A 1GZQA 3WE6A 2VSCA 5MENB 4ZUWA 3G5VB 1A1NA 1BFVH 4KC3B 1KIQA 3U79A 4ODSH 5IV2A 4C56B 3HZVA 3LKRB 2VWEE 3T08A 4HXAH 3O3BB 1KF9B 1EEZA 4WUUD 5F70A 5JMRA 4R0LA 3BW9A 1SJHB 3QNYA 3LV3A 4BK5A 3T0EA 1JGLL 3GMQB 3AC0A 4L9LB 5ID1A 4QRRE 4D0CB 1B2WH 1MJ8L 2JJSA 1U8PA 1BAFH 3ZKXB 3U2SA 4AM0B 2HJKA 4TUOA 5BVJA 4KK5D 5GS1C 4CU6A 4KGLA 4OGYH 2X9WA 2C9AA 2DIAA 4P5TA 5DHXB 1F6AA 5D7KE 1NCAL 5BO1H 5IGXL 2KZ1B 3MRJA 1CR9L 4CJ1A 3PL6D 4WY7L 5D70L 3GSUB 4PJFE 3WS3A 4YLQT 1X5HA 1HHJB 2QSTA 2FGWH 3BEVA 3BO8B 4FZEL 4UQ3B 4Y1AD 5TFSH 3L6FB 5J13B 4RFOL 1HDMA 2YPKA 5FB8B 3BE1H 3VI3E 4J2XA 3VFNA 2FYYB 4PRAB 4DN4L 5IGXH 1P5VA 4N8VG 4GMSH 1A3LH 3DGGB 3P9MA 1Q9KB 2Y72A 3BKYH 2GJ6A 1MPAH 2ZJSH 4KI5D 2ARJQ 4OCYL 1TPXC 1RQ5A 4Y4HA 3D85B 3SE9L 2WIIA 5LAXB 3CZFA 3H7BA 3P30H 4XVTL 1KYOK 3BRDA 5I1CH 1S7TA 3OZ9L 3CC5B 4Q58C 3RDTD 3PGCB 2EXYD 2X4TB 5D1ZD 3BZDA 5KVGH 3X11A 2EDFA 2CDEA