3BTEI

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'DFCLEPPYTGPCEARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCLRTCGGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 3bteI00
4ISNB 4NTYB 1F7ZI 1K6UA 3T62D 1FY8I 1JC6A 1G6XA 1T8MB 1KIGI 1P2NB 1TAWB 1NAGA 3AUDA 3CI7A 1AAPA 5JB5A 3D65I 4WWYC 4DTGK 1BTHP 3M7QB 2KNTA 4PTIA 2UUYB 1LD5A 1D0DA 4WXVC 2DDIA 4ISLB 1LD6A 9PTIA 3AUHA 4Y11I 1JV8A 2FI3I 3BTKI 4Y10I 3FP8I 3BTDI 1Y62A 2CA7A 2JOTA 1CBWD 2FTMB 1BRCI 1BZ5A 2DDJA 1ADZA 1P2OB 1KUNA 1P2MB 4Y0ZI 3U1JE 4NTWB 3OFWA 3FP7J 1P2II 4BD9B 1YKTB 1SHPA 1KTHA 3BTHI 3AUGA 1T8LB 3FP6I 1OA55 3LDJA 5C67C 1T8NB 2J6DA 2PTCI 4Y0YI 2R9PE 1KNTA 1T7CB 1UUAA 1YC0I 1P2KI 3AUBA 2HEXA 2W8XA 1DTXA 1YLCB 1BTIA 1PITA 3L3TE 2ODYE 2UUXA 2TGPI 3P95E 3UOUB 1P2JI 4BQDA 5JB6A 1QLQA 2KAII 2KCRA 3AUEA 3P92E 3TGJI 5PTIA 2TPII 3BTTI 1B0CA 1TOCR 2FTLI 3UIRC 7PTIA 2LFKA 2FI5I 3WNYA 3BYBA 1BZXI 3BTGI 1P2QB 2ZVXA 1AALA 1F5RI 1UUBA 3AUIA 1TAPA 2IJOI 1MTND 1BPTA 5JB4A 1CA0D 3OTJI 1BPIA 1IRHA 3BTQI 1TPAI 3BTWI 3BTEI 1FAKI 1BIKA 1EAWB 4DG4C 8PTIA 1T8OB 2M01A 1BUNB 2LFLA 4U32X 3TGII 1BRBI 1CO7I 2FI4I 4BNRI 1D0DB 4U30W 3LDMA 3AUCA 1BHCA 1YLDB 1JV9A 1DEMA 2M99A 1DENA 1TCPA 3TGKI 1ZR0B 1BF0A 1EJMB 1FANA 3TPII 3L33E 5JB7A 1ZJDB 3BTMI 3LDIA 1OA65 2RA3C 6PTIA 4TPII 3GYMI 1DTKA 1TFXC 4NTXB 4ISOB 2ZJXA 3BTFI
chains in the Genus database with same CATH superfamily
4ISNB 4NTYB 1F7ZI 1K6UA 3T62D 1FY8I 1JC6A 1G6XA 1T8MB 1KIGI 1P2NB 1TAWB 1NAGA 3AUDA 3CI7A 1AAPA 5JB5A 3D65I 4WWYC 4DTGK 1BTHP 3M7QB 2KNTA 4PTIA 2UUYB 1LD5A 1D0DA 4WXVC 2DDIA 4ISLB 1LD6A 9PTIA 3AUHA 4Y11I 1JV8A 2FI3I 3BTKI 4Y10I 3FP8I 3BTDI 1Y62A 2CA7A 2JOTA 1CBWD 2FTMB 1BRCI 1BZ5A 2DDJA 1ADZA 1P2OB 1KUNA 1P2MB 4Y0ZI 3U1JE 4NTWB 3OFWA 3FP7J 1P2II 4BD9B 1YKTB 1SHPA 1KTHA 3BTHI 3AUGA 1T8LB 3FP6I 1OA55 3LDJA 5C67C 1T8NB 2J6DA 2PTCI 4Y0YI 2R9PE 1KNTA 1T7CB 1UUAA 1YC0I 1P2KI 3AUBA 2HEXA 2W8XA 1DTXA 1YLCB 1BTIA 1PITA 3L3TE 2ODYE 2UUXA 2TGPI 3P95E 3UOUB 1P2JI 4BQDA 5JB6A 1QLQA 2KAII 2KCRA 3AUEA 3P92E 3TGJI 5PTIA 2TPII 3BTTI 1B0CA 1TOCR 2FTLI 3UIRC 7PTIA 2LFKA 2FI5I 3WNYA 3BYBA 1BZXI 3BTGI 1P2QB 2ZVXA 1AALA 1F5RI 1UUBA 3AUIA 1TAPA 2IJOI 1MTND 1BPTA 5JB4A 1CA0D 3OTJI 1BPIA 1IRHA 3BTQI 1TPAI 3BTWI 3BTEI 1FAKI 1BIKA 1EAWB 4DG4C 8PTIA 1T8OB 2M01A 1BUNB 2LFLA 4U32X 3TGII 1BRBI 1CO7I 2FI4I 4BNRI 1D0DB 4U30W 3LDMA 3AUCA 1BHCA 1YLDB 1JV9A 1DEMA 2M99A 1DENA 1TCPA 3TGKI 1ZR0B 1BF0A 1EJMB 1FANA 3TPII 3L33E 5JB7A 1ZJDB 3BTMI 3LDIA 1OA65 2RA3C 6PTIA 4TPII 3GYMI 1DTKA 1TFXC 4NTXB 4ISOB 2ZJXA 3BTFI
chains in the Genus database with same CATH topology
4ISNB 4NTYB 1F7ZI 1K6UA 3T62D 1FY8I 1JC6A 1G6XA 1T8MB 1KIGI 1P2NB 1TAWB 1NAGA 3AUDA 3CI7A 1AAPA 5JB5A 3D65I 4WWYC 4DTGK 1BTHP 3M7QB 2KNTA 4PTIA 2UUYB 1LD5A 1D0DA 4WXVC 2DDIA 4ISLB 1LD6A 9PTIA 3AUHA 4Y11I 1JV8A 2FI3I 3BTKI 4Y10I 3FP8I 3BTDI 1Y62A 2CA7A 2JOTA 1CBWD 2FTMB 1BRCI 1BZ5A 2DDJA 1ADZA 1P2OB 1KUNA 1P2MB 4Y0ZI 3U1JE 4NTWB 3OFWA 3FP7J 1P2II 4BD9B 1YKTB 1SHPA 1KTHA 3BTHI 3AUGA 1T8LB 3FP6I 1OA55 3LDJA 5C67C 1T8NB 2J6DA 2PTCI 4Y0YI 2R9PE 1KNTA 1T7CB 1UUAA 1YC0I 1P2KI 3AUBA 2HEXA 2W8XA 1DTXA 1YLCB 1BTIA 1PITA 3L3TE 2ODYE 2UUXA 2TGPI 3P95E 3UOUB 1P2JI 4BQDA 5JB6A 1QLQA 2KAII 2KCRA 3AUEA 3P92E 3TGJI 5PTIA 2TPII 3BTTI 1B0CA 1TOCR 2FTLI 3UIRC 7PTIA 2LFKA 2FI5I 3WNYA 3BYBA 1BZXI 3BTGI 1P2QB 2ZVXA 1AALA 1F5RI 1UUBA 3AUIA 1TAPA 2IJOI 1MTND 1BPTA 5JB4A 1CA0D 3OTJI 1BPIA 1IRHA 3BTQI 1TPAI 3BTWI 3BTEI 1FAKI 1BIKA 1EAWB 4DG4C 8PTIA 1T8OB 2M01A 1BUNB 2LFLA 4U32X 3TGII 1BRBI 1CO7I 2FI4I 4BNRI 1D0DB 4U30W 3LDMA 3AUCA 1BHCA 1YLDB 1JV9A 1DEMA 2M99A 1DENA 1TCPA 3TGKI 1ZR0B 1BF0A 1EJMB 1FANA 3TPII 3L33E 5JB7A 1ZJDB 3BTMI 3LDIA 1OA65 2RA3C 6PTIA 4TPII 3GYMI 1DTKA 1TFXC 4NTXB 4ISOB 2ZJXA 3BTFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ISN B;  4NTY B;  1F7Z I;  1K6U A;  3T62 D;  1FY8 I;  1JC6 A;  1G6X A;  1T8M B;  1KIG I;  1P2N B;  1TAW B;  1NAG A;  3AUD A;  3CI7 A;  1AAP A;  5JB5 A;  3D65 I;  4WWY C;  4DTG K;  1BTH P;  3M7Q B;  2KNT A;  4PTI A;  2UUY B;  1LD5 A;  1D0D A;  4WXV C;  2DDI A;  4ISL B;  1LD6 A;  9PTI A;  3AUH A;  4Y11 I;  1JV8 A;  2FI3 I;  3BTK I;  4Y10 I;  3FP8 I;  3BTD I;  1Y62 A;  2CA7 A;  2JOT A;  1CBW D;  2FTM B;  1BRC I;  1BZ5 A;  2DDJ A;  1ADZ A;  1P2O B;  1KUN A;  1P2M B;  4Y0Z I;  3U1J E;  4NTW B;  3OFW A;  3FP7 J;  1P2I I;  4BD9 B;  1YKT B;  1SHP A;  1KTH A;  3BTH I;  3AUG A;  1T8L B;  3FP6 I;  1OA5 5;  3LDJ A;  5C67 C;  1T8N B;  2J6D A;  2PTC I;  4Y0Y I;  2R9P E;  1KNT A;  1T7C B;  1UUA A;  1YC0 I;  1P2K I;  3AUB A;  2HEX A;  2W8X A;  1DTX A;  1YLC B;  1BTI A;  1PIT A;  3L3T E;  2ODY E;  2UUX A;  2TGP I;  3P95 E;  3UOU B;  1P2J I;  4BQD A;  5JB6 A;  1QLQ A;  2KAI I;  2KCR A;  3AUE A;  3P92 E;  3TGJ I;  5PTI A;  2TPI I;  3BTT I;  1B0C A;  1TOC R;  2FTL I;  3UIR C;  7PTI A;  2LFK A;  2FI5 I;  3WNY A;  3BYB A;  1BZX I;  3BTG I;  1P2Q B;  2ZVX A;  1AAL A;  1F5R I;  1UUB A;  3AUI A;  1TAP A;  2IJO I;  1MTN D;  1BPT A;  5JB4 A;  1CA0 D;  3OTJ I;  1BPI A;  1IRH A;  3BTQ I;  1TPA I;  3BTW I;  3BTE I;  1FAK I;  1BIK A;  1EAW B;  4DG4 C;  8PTI A;  1T8O B;  2M01 A;  1BUN B;  2LFL A;  4U32 X;  3TGI I;  1BRB I;  1CO7 I;  2FI4 I;  4BNR I;  1D0D B;  4U30 W;  3LDM A;  3AUC A;  1BHC A;  1YLD B;  1JV9 A;  1DEM A;  2M99 A;  1DEN A;  1TCP A;  3TGK I;  1ZR0 B;  1BF0 A;  1EJM B;  1FAN A;  3TPI I;  3L33 E;  5JB7 A;  1ZJD B;  3BTM I;  3LDI A;  1OA6 5;  2RA3 C;  6PTI A;  4TPI I;  3GYM I;  1DTK A;  1TFX C;  4NTX B;  4ISO B;  2ZJX A;  3BTF I; 
#chains in the Genus database with same CATH topology
 4ISN B;  4NTY B;  1F7Z I;  1K6U A;  3T62 D;  1FY8 I;  1JC6 A;  1G6X A;  1T8M B;  1KIG I;  1P2N B;  1TAW B;  1NAG A;  3AUD A;  3CI7 A;  1AAP A;  5JB5 A;  3D65 I;  4WWY C;  4DTG K;  1BTH P;  3M7Q B;  2KNT A;  4PTI A;  2UUY B;  1LD5 A;  1D0D A;  4WXV C;  2DDI A;  4ISL B;  1LD6 A;  9PTI A;  3AUH A;  4Y11 I;  1JV8 A;  2FI3 I;  3BTK I;  4Y10 I;  3FP8 I;  3BTD I;  1Y62 A;  2CA7 A;  2JOT A;  1CBW D;  2FTM B;  1BRC I;  1BZ5 A;  2DDJ A;  1ADZ A;  1P2O B;  1KUN A;  1P2M B;  4Y0Z I;  3U1J E;  4NTW B;  3OFW A;  3FP7 J;  1P2I I;  4BD9 B;  1YKT B;  1SHP A;  1KTH A;  3BTH I;  3AUG A;  1T8L B;  3FP6 I;  1OA5 5;  3LDJ A;  5C67 C;  1T8N B;  2J6D A;  2PTC I;  4Y0Y I;  2R9P E;  1KNT A;  1T7C B;  1UUA A;  1YC0 I;  1P2K I;  3AUB A;  2HEX A;  2W8X A;  1DTX A;  1YLC B;  1BTI A;  1PIT A;  3L3T E;  2ODY E;  2UUX A;  2TGP I;  3P95 E;  3UOU B;  1P2J I;  4BQD A;  5JB6 A;  1QLQ A;  2KAI I;  2KCR A;  3AUE A;  3P92 E;  3TGJ I;  5PTI A;  2TPI I;  3BTT I;  1B0C A;  1TOC R;  2FTL I;  3UIR C;  7PTI A;  2LFK A;  2FI5 I;  3WNY A;  3BYB A;  1BZX I;  3BTG I;  1P2Q B;  2ZVX A;  1AAL A;  1F5R I;  1UUB A;  3AUI A;  1TAP A;  2IJO I;  1MTN D;  1BPT A;  5JB4 A;  1CA0 D;  3OTJ I;  1BPI A;  1IRH A;  3BTQ I;  1TPA I;  3BTW I;  3BTE I;  1FAK I;  1BIK A;  1EAW B;  4DG4 C;  8PTI A;  1T8O B;  2M01 A;  1BUN B;  2LFL A;  4U32 X;  3TGI I;  1BRB I;  1CO7 I;  2FI4 I;  4BNR I;  1D0D B;  4U30 W;  3LDM A;  3AUC A;  1BHC A;  1YLD B;  1JV9 A;  1DEM A;  2M99 A;  1DEN A;  1TCP A;  3TGK I;  1ZR0 B;  1BF0 A;  1EJM B;  1FAN A;  3TPI I;  3L33 E;  5JB7 A;  1ZJD B;  3BTM I;  3LDI A;  1OA6 5;  2RA3 C;  6PTI A;  4TPI I;  3GYM I;  1DTK A;  1TFX C;  4NTX B;  4ISO B;  2ZJX A;  3BTF I; 
#chains in the Genus database with same CATH homology
 4ISN B;  4NTY B;  1F7Z I;  1K6U A;  3T62 D;  1FY8 I;  1JC6 A;  1G6X A;  1T8M B;  1KIG I;  1P2N B;  1TAW B;  1NAG A;  3AUD A;  3CI7 A;  1AAP A;  5JB5 A;  3D65 I;  4WWY C;  4DTG K;  1BTH P;  3M7Q B;  2KNT A;  4PTI A;  2UUY B;  1LD5 A;  1D0D A;  4WXV C;  2DDI A;  4ISL B;  1LD6 A;  9PTI A;  3AUH A;  4Y11 I;  1JV8 A;  2FI3 I;  3BTK I;  4Y10 I;  3FP8 I;  3BTD I;  1Y62 A;  2CA7 A;  2JOT A;  1CBW D;  2FTM B;  1BRC I;  1BZ5 A;  2DDJ A;  1ADZ A;  1P2O B;  1KUN A;  1P2M B;  4Y0Z I;  3U1J E;  4NTW B;  3OFW A;  3FP7 J;  1P2I I;  4BD9 B;  1YKT B;  1SHP A;  1KTH A;  3BTH I;  3AUG A;  1T8L B;  3FP6 I;  1OA5 5;  3LDJ A;  5C67 C;  1T8N B;  2J6D A;  2PTC I;  4Y0Y I;  2R9P E;  1KNT A;  1T7C B;  1UUA A;  1YC0 I;  1P2K I;  3AUB A;  2HEX A;  2W8X A;  1DTX A;  1YLC B;  1BTI A;  1PIT A;  3L3T E;  2ODY E;  2UUX A;  2TGP I;  3P95 E;  3UOU B;  1P2J I;  4BQD A;  5JB6 A;  1QLQ A;  2KAI I;  2KCR A;  3AUE A;  3P92 E;  3TGJ I;  5PTI A;  2TPI I;  3BTT I;  1B0C A;  1TOC R;  2FTL I;  3UIR C;  7PTI A;  2LFK A;  2FI5 I;  3WNY A;  3BYB A;  1BZX I;  3BTG I;  1P2Q B;  2ZVX A;  1AAL A;  1F5R I;  1UUB A;  3AUI A;  1TAP A;  2IJO I;  1MTN D;  1BPT A;  5JB4 A;  1CA0 D;  3OTJ I;  1BPI A;  1IRH A;  3BTQ I;  1TPA I;  3BTW I;  3BTE I;  1FAK I;  1BIK A;  1EAW B;  4DG4 C;  8PTI A;  1T8O B;  2M01 A;  1BUN B;  2LFL A;  4U32 X;  3TGI I;  1BRB I;  1CO7 I;  2FI4 I;  4BNR I;  1D0D B;  4U30 W;  3LDM A;  3AUC A;  1BHC A;  1YLD B;  1JV9 A;  1DEM A;  2M99 A;  1DEN A;  1TCP A;  3TGK I;  1ZR0 B;  1BF0 A;  1EJM B;  1FAN A;  3TPI I;  3L33 E;  5JB7 A;  1ZJD B;  3BTM I;  3LDI A;  1OA6 5;  2RA3 C;  6PTI A;  4TPI I;  3GYM I;  1DTK A;  1TFX C;  4NTX B;  4ISO B;  2ZJX A;  3BTF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...