3CC7H

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
total genus 38
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 3cc7H00
1Q82J 1QVGH 1KQSH 3CC7H 3CCSH 1NJIJ 1VQ7H 2ZJPJ 4WFBJ 2QEXH 1VQPH 1K8AJ 5GAEN 5MLCO 5HL7J 3CCLH 5AN9F 3G71H 4IOAJ 2ZJQJ 3CCJH 5DM7J 1W2BH 3CC4H 4U67J 1K73J 2ZJRJ 5H1SO 3CCEH 2QA4H 1KD1J 5GAGN 1YJ9H 1VQ4H 3CMEH 5JVHJ 1VQNH 1N8RJ 3CC2H 1VQ9H 1VQ6H 3CCRH 1VQ5H 3CCQH 3PIOJ 4WCEJ 3CMAH 3CCMH 3CCUH 1Q81J 5DM6J 1M90J 2OTLH 1KC8J 1VQKH 2OTJH 4WF9J 3CD6H 1Q7YJ 4IO9J 3I56H 3DLLJ 1YI2H 1YJWH 3OW2H 3CPWH 5GADN 3G4SH 1VQMH 3CCVH 3PIPJ 4IOCJ 1JJ2H 1VQ8H 1Y69K 3G6EH 3CXCH 1YJNH 1VQOH 3CF5J 1WKIA 1Q86J 5JVGJ 3J7ZM 4WFNJ 4WFAJ 1YITH 5GAHN 1S72H 3I55H 1VQLH 1K9MJ 4UY8M 2PA2A 1YHQH 1M1KJ 1QVFH 1YIJH
chains in the Genus database with same CATH superfamily
1Q82J 4I9AA 1SB3A 1QVGH 1KQSH 3AN1A 5HUOA 3CC7H 3CCSH 1NJIJ 1VQ7H 1DGJA 1V97A 4KWWA 2ZJPJ 4US9A 3L0GA 4WFBJ 3VMMA 4US8A 2QEXH 1VQPH 1K8AJ 1O4UA 1FFVB 1UOUA 2W54B 3WO0A 1YTDA 5GAEN 2QIEA 5EP8A 4C7ZA 2TPTA 5MLCO 5HL7J 1OTPA 3CCLH 4GA4A 5AN9F 1QPNA 3G71H 5EY3A 4IOAJ 1FFUB 2ZJQJ 3CCJH 5DM7J 1W2BH 1FM0E 4U67J 3CC4H 3C2EA 3RPFA 1K73J 1YTKA 2B7NA 4X46A 2ZJRJ 4XR5A 1QPQA 3SR6C 3WNZA 4EADA 3TQVA 3AMZA 2OMDA 5H1SO 3CCEH 2QA4H 1SIJA 1KD1J 4GA5A 3FAHA 5GAGN 1YJ9H 1VQ4H 4ZOHA 3CMEH 2I14A 1N60B 1N62B 5JVHJ 1FO4A 2JBMA 1VQNH 1N8RJ 3EUB4 3CC2H 3AM9A 1VQ9H 1QPOA 1VQ6H 1VDVA 1NVJA 4USAA 3NVZC 3CCRH 3NRZC 4EAFA 4YEKA 4GA6A 4AP8A 1VQ5H 3CCQH 2E3TA 2W55B 2Q5WE 4WCEJ 3PIOJ 3CMAH 3CCMH 5MPOC 3CCUH 1Q81J 4C7YA 1RM6A 3BIIE 3C2FA 3NVWC 5DM6J 1M90J 3C2RA 2OTLH 5HULA 1BRWA 1QAPA 4YYYA 1KC8J 1VQKH 2WK5A 3GNNA 1ZXIB 2OTJH 4WF9J 3CD6H 4C80A 4LHMA 1Q7YJ 3FC4A 4IO9J 2W3RB 3I56H 5HUPA 3DLLJ 1YI2H 5AYZA 2B7PA 1JRPB 1YJWH 2I1OA 3NS1C 2DSJA 3OW2H 3CPWH 1JROB 5GADN 3ETRC 3G4SH 1VQMH 1YTEA 2B7QA 3C2OA 3PAJA 2W3SB 3H5QA 3PIPJ 3CCVH 4IOCJ 1NVIE 1JJ2H 1VQ8H 2WK6A 1Y69K 1N63B 3G6EH 1FMAE 3CXCH 1YJNH 1VQOH 1WYGA 5AYYA 3CF5J 1QPRA 3NVYC 1WKIA 1Q86J 5JVGJ 1N5WB 2WP4A 1X1OA 3NVVC 1N5XA 4WFNJ 4WFAJ 3J7ZM 1YITH 3B9JC 5GAHN 1S72H 3C2VA 3I55H 1VQLH 4KWVA 1K9MJ 4UY8M 2J0FA 2PA2A 1YHQH 1FIQC 1AZYA 1VLBA 1N61B 3WO1A 1M1KJ 1QVFH 3L4PA 1YIJH 5AYXA
chains in the Genus database with same CATH topology
1Q82J 1QVGH 1KQSH 3CC7H 3CCSH 1NJIJ 1VQ7H 2ZJPJ 4WFBJ 2QEXH 1VQPH 1K8AJ 5GAEN 5MLCO 5HL7J 3CCLH 5AN9F 3G71H 4IOAJ 2ZJQJ 3CCJH 5DM7J 1W2BH 3CC4H 4U67J 1K73J 2ZJRJ 5H1SO 3CCEH 2QA4H 1KD1J 5GAGN 1YJ9H 1VQ4H 3CMEH 5JVHJ 1VQNH 1N8RJ 3CC2H 1VQ9H 1VQ6H 3CCRH 1VQ5H 3CCQH 3PIOJ 4WCEJ 3CMAH 3CCMH 3CCUH 1Q81J 5DM6J 1M90J 2OTLH 1KC8J 1VQKH 2OTJH 4WF9J 3CD6H 1Q7YJ 4IO9J 3I56H 3DLLJ 1YI2H 1YJWH 3OW2H 3CPWH 5GADN 3G4SH 1VQMH 3CCVH 3PIPJ 4IOCJ 1JJ2H 1VQ8H 1Y69K 3G6EH 3CXCH 1YJNH 1VQOH 3CF5J 1WKIA 1Q86J 5JVGJ 3J7ZM 4WFNJ 4WFAJ 1YITH 5GAHN 1S72H 3I55H 1VQLH 1K9MJ 4UY8M 2PA2A 1YHQH 1M1KJ 1QVFH 1YIJH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 J;  1QVG H;  1KQS H;  3CC7 H;  3CCS H;  1NJI J;  1VQ7 H;  2ZJP J;  4WFB J;  2QEX H;  1VQP H;  1K8A J;  5GAE N;  5MLC O;  5HL7 J;  3CCL H;  5AN9 F;  3G71 H;  4IOA J;  2ZJQ J;  3CCJ H;  5DM7 J;  1W2B H;  3CC4 H;  4U67 J;  1K73 J;  2ZJR J;  5H1S O;  3CCE H;  2QA4 H;  1KD1 J;  5GAG N;  1YJ9 H;  1VQ4 H;  3CME H;  5JVH J;  1VQN H;  1N8R J;  3CC2 H;  1VQ9 H;  1VQ6 H;  3CCR H;  1VQ5 H;  3CCQ H;  3PIO J;  4WCE J;  3CMA H;  3CCM H;  3CCU H;  1Q81 J;  5DM6 J;  1M90 J;  2OTL H;  1KC8 J;  1VQK H;  2OTJ H;  4WF9 J;  3CD6 H;  1Q7Y J;  4IO9 J;  3I56 H;  3DLL J;  1YI2 H;  1YJW H;  3OW2 H;  3CPW H;  5GAD N;  3G4S H;  1VQM H;  3CCV H;  3PIP J;  4IOC J;  1JJ2 H;  1VQ8 H;  1Y69 K;  3G6E H;  3CXC H;  1YJN H;  1VQO H;  3CF5 J;  1WKI A;  1Q86 J;  5JVG J;  3J7Z M;  4WFN J;  4WFA J;  1YIT H;  5GAH N;  1S72 H;  3I55 H;  1VQL H;  1K9M J;  4UY8 M;  2PA2 A;  1YHQ H;  1M1K J;  1QVF H;  1YIJ H; 
#chains in the Genus database with same CATH topology
 1Q82 J;  4I9A A;  1SB3 A;  1QVG H;  1KQS H;  3AN1 A;  5HUO A;  3CC7 H;  3CCS H;  1NJI J;  1VQ7 H;  1DGJ A;  1V97 A;  4KWW A;  2ZJP J;  4US9 A;  3L0G A;  4WFB J;  3VMM A;  4US8 A;  2QEX H;  1VQP H;  1K8A J;  1O4U A;  1FFV B;  1UOU A;  2W54 B;  3WO0 A;  1YTD A;  5GAE N;  2QIE A;  5EP8 A;  4C7Z A;  2TPT A;  5MLC O;  5HL7 J;  1OTP A;  3CCL H;  4GA4 A;  5AN9 F;  1QPN A;  3G71 H;  5EY3 A;  4IOA J;  1FFU B;  2ZJQ J;  3CCJ H;  5DM7 J;  1W2B H;  1FM0 E;  4U67 J;  3CC4 H;  3C2E A;  3RPF A;  1K73 J;  1YTK A;  2B7N A;  4X46 A;  2ZJR J;  4XR5 A;  1QPQ A;  3SR6 C;  3WNZ A;  4EAD A;  3TQV A;  3AMZ A;  2OMD A;  5H1S O;  3CCE H;  2QA4 H;  1SIJ A;  1KD1 J;  4GA5 A;  3FAH A;  5GAG N;  1YJ9 H;  1VQ4 H;  4ZOH A;  3CME H;  2I14 A;  1N60 B;  1N62 B;  5JVH J;  1FO4 A;  2JBM A;  1VQN H;  1N8R J;  3EUB 4;  3CC2 H;  3AM9 A;  1VQ9 H;  1QPO A;  1VQ6 H;  1VDV A;  1NVJ A;  4USA A;  3NVZ C;  3CCR H;  3NRZ C;  4EAF A;  4YEK A;  4GA6 A;  4AP8 A;  1VQ5 H;  3CCQ H;  2E3T A;  2W55 B;  2Q5W E;  4WCE J;  3PIO J;  3CMA H;  3CCM H;  5MPO C;  3CCU H;  1Q81 J;  4C7Y A;  1RM6 A;  3BII E;  3C2F A;  3NVW C;  5DM6 J;  1M90 J;  3C2R A;  2OTL H;  5HUL A;  1BRW A;  1QAP A;  4YYY A;  1KC8 J;  1VQK H;  2WK5 A;  3GNN A;  1ZXI B;  2OTJ H;  4WF9 J;  3CD6 H;  4C80 A;  4LHM A;  1Q7Y J;  3FC4 A;  4IO9 J;  2W3R B;  3I56 H;  5HUP A;  3DLL J;  1YI2 H;  5AYZ A;  2B7P A;  1JRP B;  1YJW H;  2I1O A;  3NS1 C;  2DSJ A;  3OW2 H;  3CPW H;  1JRO B;  5GAD N;  3ETR C;  3G4S H;  1VQM H;  1YTE A;  2B7Q A;  3C2O A;  3PAJ A;  2W3S B;  3H5Q A;  3PIP J;  3CCV H;  4IOC J;  1NVI E;  1JJ2 H;  1VQ8 H;  2WK6 A;  1Y69 K;  1N63 B;  3G6E H;  1FMA E;  3CXC H;  1YJN H;  1VQO H;  1WYG A;  5AYY A;  3CF5 J;  1QPR A;  3NVY C;  1WKI A;  1Q86 J;  5JVG J;  1N5W B;  2WP4 A;  1X1O A;  3NVV C;  1N5X A;  4WFN J;  4WFA J;  3J7Z M;  1YIT H;  3B9J C;  5GAH N;  1S72 H;  3C2V A;  3I55 H;  1VQL H;  4KWV A;  1K9M J;  4UY8 M;  2J0F A;  2PA2 A;  1YHQ H;  1FIQ C;  1AZY A;  1VLB A;  1N61 B;  3WO1 A;  1M1K J;  1QVF H;  3L4P A;  1YIJ H;  5AYX A; 
#chains in the Genus database with same CATH homology
 1Q82 J;  1QVG H;  1KQS H;  3CC7 H;  3CCS H;  1NJI J;  1VQ7 H;  2ZJP J;  4WFB J;  2QEX H;  1VQP H;  1K8A J;  5GAE N;  5MLC O;  5HL7 J;  3CCL H;  5AN9 F;  3G71 H;  4IOA J;  2ZJQ J;  3CCJ H;  5DM7 J;  1W2B H;  3CC4 H;  4U67 J;  1K73 J;  2ZJR J;  5H1S O;  3CCE H;  2QA4 H;  1KD1 J;  5GAG N;  1YJ9 H;  1VQ4 H;  3CME H;  5JVH J;  1VQN H;  1N8R J;  3CC2 H;  1VQ9 H;  1VQ6 H;  3CCR H;  1VQ5 H;  3CCQ H;  3PIO J;  4WCE J;  3CMA H;  3CCM H;  3CCU H;  1Q81 J;  5DM6 J;  1M90 J;  2OTL H;  1KC8 J;  1VQK H;  2OTJ H;  4WF9 J;  3CD6 H;  1Q7Y J;  4IO9 J;  3I56 H;  3DLL J;  1YI2 H;  1YJW H;  3OW2 H;  3CPW H;  5GAD N;  3G4S H;  1VQM H;  3CCV H;  3PIP J;  4IOC J;  1JJ2 H;  1VQ8 H;  1Y69 K;  3G6E H;  3CXC H;  1YJN H;  1VQO H;  3CF5 J;  1WKI A;  1Q86 J;  5JVG J;  3J7Z M;  4WFN J;  4WFA J;  1YIT H;  5GAH N;  1S72 H;  3I55 H;  1VQL H;  1K9M J;  4UY8 M;  2PA2 A;  1YHQ H;  1M1K J;  1QVF H;  1YIJ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...