3CCEL

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
total genus 28
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3cceL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 3cceL01
1VQML 1Q86P 3CCVL 1QVFK 1VQOL 1VQ9L 1W2BK 2QEXL 1VQKL 3I55O 3G71O 3CCLL 1VQMO 3CXCK 3CCVO 3CCML 1VQOO 1YIJO 1Q86M 1K9MP 2OTJL 3CCRL 3G6EL 3CCSO 3CCUO 2QEXO 1VQKO 1M90M 3CC4L 1Q7YP 3CCLO 1VQ6L 3I56L 1M1KP 3CD6L 1YJNL 3CCMO 3CCEL 1VQ7L 1KQSN 2OTJO 3CCRO 1YI2L 1YJ9L 3G6EO 1K9MM 1VQ6O 3I56O 2OTLO 3G4SL 1Q82P 1Q7YM 1NJIM 3CD6O 1YJNO 1M1KM 3CCEO 1KC8P 3CC7L 1VQ7O 1YI2O 1JJ2N 3CMEL 1VQ9O 1YJ9O 1Q81P 3CPWN 1KD1P 1K8AP 3CC7O 1Q82M 1VQ4L 1KQSK 2QA4L 3CCJL 1W2BN 1YHQL 3CMEO 1N8RP 1VQNL 1S72L 3CCQL 1VQLL 3CC4O 1YJWL 1VQ4O 1VQPL 1K73P 2QA4O 3CCJO 1KD1M 1JJ2K 3CMAL 1QVGN 1K8AM 3CC2L 1VQLO 3CPWK 1N8RM 3OW2N 3G4SO 1YJWO 1VQPO 1YIJL 1VQ5L 1QVFN 3CMAO 1M90P 3CCSL 3CCUL 1K73M 1VQ8L 1KC8M 1YITL 3CC2O 1Q81M 3CXCN 1VQ5O 1QVGK 1VQ8O 1YHQO 1YITO 1VQNO 1S72O 3I55L 3CCQO 1NJIP 2OTLL 3G71L 3OW2K
chains in the Genus database with same CATH superfamily
1VQML 1Q86P 3CCVL 1QVFK 1VQOL 1VQ9L 4N06A 1W2BK 2QEXL 1VQKL 3I55O 3G71O 3CCLL 1VQMO 3CXCK 3CCVO 3CCML 1VQOO 1YIJO 1Q86M 1K9MP 2OTJL 3CCRL 3G6EL 3CCSO 3CCUO 2QEXO 1VQKO 1M90M 3CC4L 4W8KA 4QDLA 1Q7YP 3CCLO 3I56L 1VQ6L 1M1KP 3CD6L 1YJNL 5DLJA 3CCMO 3CCEL 1VQ7L 1KQSN 2OTJO 3CCRO 1YI2L 1YJ9L 3G6EO 1K9MM 1VQ6O 3I56O 2OTLO 5DS6A 3G4SL 1Q82P 1Q7YM 1NJIM 3CD6O 1YJNO 1M1KM 3CCEO 1KC8P 3CC7L 1VQ7O 5DS4A 5DS5A 1YI2O 1JJ2N 3CMEL 1VQ9O 1YJ9O 3GODA 1Q81P 3CPWN 1KD1P 1K8AP 3CC7O 1Q82M 1VQ4L 1KQSK 2QA4L 3CCJL 1W2BN 1YHQL 3CMEO 1N8RP 1VQNL 4XTKA 1S72L 3CCQL 2YZSA 1VQLL 3CC4O 5FCLA 1YJWL 1VQ4O 1VQPL 1K73P 2QA4O 3CCJO 1KD1M 1JJ2K 3CMAL 1QVGN 1K8AM 3NKDA 3CC2L 1VQLO 3CPWK 1N8RM 3OW2N 4P6IC 3G4SO 4WJ0A 1YJWO 1VQPO 5DQZA 1YIJL 1VQ5L 1QVFN 3CMAO 1M90P 3CCSL 3CCUL 1K73M 1VQ8L 1KC8M 1YITL 3CC2O 1Q81M 3CXCN 1VQ5O 1QVGK 1VQ8O 1YHQO 1YITO 1VQNO 1S72O 3I55L 3CCQO 1NJIP 2OTLL 5DQTA 3G71L 3OW2K
chains in the Genus database with same CATH topology
1VQML 1Q86P 3CCVL 1QVFK 1VQOL 1VQ9L 4N06A 1W2BK 2QEXL 1VQKL 3I55O 3G71O 3CCLL 1VQMO 3CXCK 3CCVO 3CCML 1VQOO 1YIJO 1Q86M 1K9MP 2OTJL 3CCRL 3G6EL 3CCSO 3CCUO 2QEXO 1VQKO 1M90M 3CC4L 4W8KA 4QDLA 1Q7YP 3CCLO 3I56L 1VQ6L 1M1KP 3CD6L 1YJNL 5DLJA 3CCMO 3CCEL 1VQ7L 1KQSN 2OTJO 3CCRO 1YI2L 1YJ9L 3G6EO 1K9MM 1VQ6O 3I56O 2OTLO 5DS6A 3G4SL 1Q82P 1Q7YM 1NJIM 3CD6O 1YJNO 1M1KM 3CCEO 1KC8P 3CC7L 1VQ7O 5DS4A 5DS5A 1YI2O 1JJ2N 3CMEL 1VQ9O 1YJ9O 3GODA 1Q81P 3CPWN 1KD1P 1K8AP 3CC7O 1Q82M 1VQ4L 1KQSK 2QA4L 3CCJL 1W2BN 1YHQL 3CMEO 1N8RP 1VQNL 4XTKA 1S72L 3CCQL 2YZSA 1VQLL 3CC4O 5FCLA 1YJWL 1VQ4O 1VQPL 1K73P 2QA4O 3CCJO 1KD1M 1JJ2K 3CMAL 1QVGN 1K8AM 3NKDA 3CC2L 1VQLO 3CPWK 1N8RM 3OW2N 4P6IC 3G4SO 4WJ0A 1YJWO 1VQPO 5DQZA 1YIJL 1VQ5L 1QVFN 3CMAO 1M90P 3CCSL 3CCUL 1K73M 1VQ8L 1KC8M 1YITL 3CC2O 1Q81M 3CXCN 1VQ5O 1QVGK 1VQ8O 1YHQO 1YITO 1VQNO 1S72O 3I55L 3CCQO 1NJIP 2OTLL 5DQTA 3G71L 3OW2K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM L;  1Q86 P;  3CCV L;  1QVF K;  1VQO L;  1VQ9 L;  1W2B K;  2QEX L;  1VQK L;  3I55 O;  3G71 O;  3CCL L;  1VQM O;  3CXC K;  3CCV O;  3CCM L;  1VQO O;  1YIJ O;  1Q86 M;  1K9M P;  2OTJ L;  3CCR L;  3G6E L;  3CCS O;  3CCU O;  2QEX O;  1VQK O;  1M90 M;  3CC4 L;  1Q7Y P;  3CCL O;  1VQ6 L;  3I56 L;  1M1K P;  3CD6 L;  1YJN L;  3CCM O;  3CCE L;  1VQ7 L;  1KQS N;  2OTJ O;  3CCR O;  1YI2 L;  1YJ9 L;  3G6E O;  1K9M M;  1VQ6 O;  3I56 O;  2OTL O;  3G4S L;  1Q82 P;  1Q7Y M;  1NJI M;  3CD6 O;  1YJN O;  1M1K M;  3CCE O;  1KC8 P;  3CC7 L;  1VQ7 O;  1YI2 O;  1JJ2 N;  3CME L;  1VQ9 O;  1YJ9 O;  1Q81 P;  3CPW N;  1KD1 P;  1K8A P;  3CC7 O;  1Q82 M;  1VQ4 L;  1KQS K;  2QA4 L;  3CCJ L;  1W2B N;  1YHQ L;  3CME O;  1N8R P;  1VQN L;  1S72 L;  3CCQ L;  1VQL L;  3CC4 O;  1YJW L;  1VQ4 O;  1VQP L;  1K73 P;  2QA4 O;  3CCJ O;  1KD1 M;  1JJ2 K;  3CMA L;  1QVG N;  1K8A M;  3CC2 L;  1VQL O;  3CPW K;  1N8R M;  3OW2 N;  3G4S O;  1YJW O;  1VQP O;  1YIJ L;  1VQ5 L;  1QVF N;  3CMA O;  1M90 P;  3CCS L;  3CCU L;  1K73 M;  1VQ8 L;  1KC8 M;  1YIT L;  3CC2 O;  1Q81 M;  3CXC N;  1VQ5 O;  1QVG K;  1VQ8 O;  1YHQ O;  1YIT O;  1VQN O;  1S72 O;  3I55 L;  3CCQ O;  1NJI P;  2OTL L;  3G71 L;  3OW2 K; 
#chains in the Genus database with same CATH topology
 1VQM L;  1Q86 P;  3CCV L;  1QVF K;  1VQO L;  1VQ9 L;  4N06 A;  1W2B K;  2QEX L;  1VQK L;  3I55 O;  3G71 O;  3CCL L;  1VQM O;  3CXC K;  3CCV O;  3CCM L;  1VQO O;  1YIJ O;  1Q86 M;  1K9M P;  2OTJ L;  3CCR L;  3G6E L;  3CCS O;  3CCU O;  2QEX O;  1VQK O;  1M90 M;  3CC4 L;  4W8K A;  4QDL A;  1Q7Y P;  3CCL O;  3I56 L;  1VQ6 L;  1M1K P;  3CD6 L;  1YJN L;  5DLJ A;  3CCM O;  3CCE L;  1VQ7 L;  1KQS N;  2OTJ O;  3CCR O;  1YI2 L;  1YJ9 L;  3G6E O;  1K9M M;  1VQ6 O;  3I56 O;  2OTL O;  5DS6 A;  3G4S L;  1Q82 P;  1Q7Y M;  1NJI M;  3CD6 O;  1YJN O;  1M1K M;  3CCE O;  1KC8 P;  3CC7 L;  1VQ7 O;  5DS4 A;  5DS5 A;  1YI2 O;  1JJ2 N;  3CME L;  1VQ9 O;  1YJ9 O;  3GOD A;  1Q81 P;  3CPW N;  1KD1 P;  1K8A P;  3CC7 O;  1Q82 M;  1VQ4 L;  1KQS K;  2QA4 L;  3CCJ L;  1W2B N;  1YHQ L;  3CME O;  1N8R P;  1VQN L;  4XTK A;  1S72 L;  3CCQ L;  2YZS A;  1VQL L;  3CC4 O;  5FCL A;  1YJW L;  1VQ4 O;  1VQP L;  1K73 P;  2QA4 O;  3CCJ O;  1KD1 M;  1JJ2 K;  3CMA L;  1QVG N;  1K8A M;  3NKD A;  3CC2 L;  1VQL O;  3CPW K;  1N8R M;  3OW2 N;  4P6I C;  3G4S O;  4WJ0 A;  1YJW O;  1VQP O;  5DQZ A;  1YIJ L;  1VQ5 L;  1QVF N;  3CMA O;  1M90 P;  3CCS L;  3CCU L;  1K73 M;  1VQ8 L;  1KC8 M;  1YIT L;  3CC2 O;  1Q81 M;  3CXC N;  1VQ5 O;  1QVG K;  1VQ8 O;  1YHQ O;  1YIT O;  1VQN O;  1S72 O;  3I55 L;  3CCQ O;  1NJI P;  2OTL L;  5DQT A;  3G71 L;  3OW2 K; 
#chains in the Genus database with same CATH homology
 1VQM L;  1Q86 P;  3CCV L;  1QVF K;  1VQO L;  1VQ9 L;  4N06 A;  1W2B K;  2QEX L;  1VQK L;  3I55 O;  3G71 O;  3CCL L;  1VQM O;  3CXC K;  3CCV O;  3CCM L;  1VQO O;  1YIJ O;  1Q86 M;  1K9M P;  2OTJ L;  3CCR L;  3G6E L;  3CCS O;  3CCU O;  2QEX O;  1VQK O;  1M90 M;  3CC4 L;  4W8K A;  4QDL A;  1Q7Y P;  3CCL O;  3I56 L;  1VQ6 L;  1M1K P;  3CD6 L;  1YJN L;  5DLJ A;  3CCM O;  3CCE L;  1VQ7 L;  1KQS N;  2OTJ O;  3CCR O;  1YI2 L;  1YJ9 L;  3G6E O;  1K9M M;  1VQ6 O;  3I56 O;  2OTL O;  5DS6 A;  3G4S L;  1Q82 P;  1Q7Y M;  1NJI M;  3CD6 O;  1YJN O;  1M1K M;  3CCE O;  1KC8 P;  3CC7 L;  1VQ7 O;  5DS4 A;  5DS5 A;  1YI2 O;  1JJ2 N;  3CME L;  1VQ9 O;  1YJ9 O;  3GOD A;  1Q81 P;  3CPW N;  1KD1 P;  1K8A P;  3CC7 O;  1Q82 M;  1VQ4 L;  1KQS K;  2QA4 L;  3CCJ L;  1W2B N;  1YHQ L;  3CME O;  1N8R P;  1VQN L;  4XTK A;  1S72 L;  3CCQ L;  2YZS A;  1VQL L;  3CC4 O;  5FCL A;  1YJW L;  1VQ4 O;  1VQP L;  1K73 P;  2QA4 O;  3CCJ O;  1KD1 M;  1JJ2 K;  3CMA L;  1QVG N;  1K8A M;  3NKD A;  3CC2 L;  1VQL O;  3CPW K;  1N8R M;  3OW2 N;  4P6I C;  3G4S O;  4WJ0 A;  1YJW O;  1VQP O;  5DQZ A;  1YIJ L;  1VQ5 L;  1QVF N;  3CMA O;  1M90 P;  3CCS L;  3CCU L;  1K73 M;  1VQ8 L;  1KC8 M;  1YIT L;  3CC2 O;  1Q81 M;  3CXC N;  1VQ5 O;  1QVG K;  1VQ8 O;  1YHQ O;  1YIT O;  1VQN O;  1S72 O;  3I55 L;  3CCQ O;  1NJI P;  2OTL L;  5DQT A;  3G71 L;  3OW2 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...