3CCEQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cceQ00
1VQ6Q 3CCLQ 3G4SQ 1YHQQ 1M90R 1YJ9Q 1K9MR 1VQLQ 3G6EQ 1YJNQ 3OW2P 1KQSP 3CCSQ 1VQ8Q 3CCEQ 3CD6Q 3CMEQ 1Q82R 1YI2Q 1VQPQ 1N8RR 1M1KR 1VQ5Q 1S72Q 3CMAQ 3CCJQ 1Q7YR 2QEXQ 1Q81R 3CCVQ 1VQ4Q 1YJWQ 1VQOQ 3CXCP 1KD1R 3CPWP 1Q86R 3CCMQ 2QA4Q 1JJ2P 1VQKQ 3G71Q 1K73R 1VQ9Q 1NJIR 1YIJQ 1VQ7Q 3CC7Q 1QVFP 1QVGP 1KC8R 1YITQ 3CC2Q 3CC4Q 3I55Q 2OTJQ 2OTLQ 3CCUQ 1VQMQ 1W2BP 3I56Q 1VQNQ 3CCQQ 3CCRQ 1K8AR
chains in the Genus database with same CATH superfamily
2K3BA 4KH0B 3MP8A 1X75C 1NBEB 1VQMA 1Q81R 3L2WA 2HNIA 1UHFA 3RESA 5GAMg 4WF2A 3GNGA 4M78F 3EFSA 4M77F 5GAMj 1GRIA 3JAME 2FL7A 3L1AA 4J9EA 4EDUA 4M7DF 1D0YA 4M75C 4PFZA 3KBGA 3VYHB 1VQNQ 2PUOB 1BK2A 2MIOA 1D3BB 2RJFA 1X01A 4NL3A 2LT1A 3PVLA 3PMIA 2YUOA 4BI3A 2A36A 3H0IA 1W70A 4HT8A 2JTFA 2JT4A 4RG8A 4LDUA 3C4SA 2XU8A 4EMKC 4XU1A 2K5LA 2J6KA 1K73C 1EFNA 3CCUQ 3TEEA 5GAMh 3CCLQ 2E64A 1VQ9A 1K4US 3EGUA 3EGDA 5FWCA 2Y90A 4KT0E 3OYFA 1YJ9A 2LNVA 2YHTA 2OX7A 4D8DA 5KH6A 2CGHA 3I5SA 3V7SA 1BKBA 2KDSA 1D1BA 2MAMA 4OMFB 4OGCA 3CCVT 3META 1WA7A 1PSEA 1CSKA 2R57A 4KGVB 2D8JA 3OBWA 3OB9A 4WCIA 5LJ5f 1Q7YR 5I2SA 3RMSA 2O01E 3EGXB 4OMPA 5I2MA 1RAHB 2EBPA 2X4JA 2EYYA 3E2UA 5GAN4 3QJ6A 4C5IA 3RNJA 2ZPGB 1VQ5A 1TUGB 2J06A 3JCMP 3QXEB 4PJOG 5I11A 1UTIA 1FMVA 4LDVA 3CCMA 2M0YA 3EGXA 1PD0A 4N0AA 1K73U 4JRIA 1JB0E 4N0AC 1YIJT 4LN2A 1TUCA 3J7AF 2A08A 2O88A 2RD1A 2FZKB 3OYDA 3JB9H 5L8RE 3UA6A 2OTJT 8ATCB 2RQUA 3RKXA 4OF1A 4JRQA 4JJDA 2EGAA 2OI3A 2PVGB 2QA4Q 4KUDK 3QWXX 3G1JA 2DX1A 3RIRA 3VS1A 1PKTA 1RUWA 2YT6A 1BIAA 2GF7A 4A4EA 2KT8A 3EG0A 2DJZA 2XDBA 5GAOm 5KYNA 1WFWA 3NGPA 3OQ5A 4HKEA 1VQMT 2XDDA 3JCMW 4FYXB 5IN1A 2EQIA 1U5SA 2FPFA 1RAEB 3A8LB 2RH2A 2X4XA 2BTTA 3M5AA 4QQGA 4TVRA 4E2FB 5GAOl 1FX7A 2K57A 4KULA 5AT1B 3JCMb 2DYBA 2HEQA 2YLCA 4O6JA 1H92A 2DKGA 4PJOE 5GANe 2AIRB 2R58A 4F04B 1U1SA 1XNIA 2H3JA 2QQ9A 3DLLA 4JJNK 4ZTJA 3URGA 1D0XA 3D7SB 1RL2A 2EW3A 3M0UA 3OS2A 4RG2A 3OYCA 4QVZA 2K7AA 1NM7A 1O75A 4MMLA 2LQWA 3ZBDA 2JTMA 1M2OA 4E7IA 2RA2A 4OP0A 2LJ3A 4RTUA 2C06A 3H41A 1SG5A 1YJ9T 1JEGA 4K11A 3JB9F 2I0NA 1E7OA 4BI8B 4LUDA 3MP1A 3HFOA 4J83A 3ULRB 3M55A 3JCMf 3UT1A 3EG1A 3PIOA 2LCCA 1Y0MA 4J7IA 4A53A 2ATCB 1M90C 2DO3A 3VRZA 1W4SA 1O9SA 2E4HA 3G6EA 1N8RC 3CCVQ 2EQUA 2KT1A 4PJLA 4A4HA 4FU6A 6AT1B 2BE7D 2EYWA 1RI0A 1VQ5T 5FU7C 3PE0A 2E1HA 4FYWB 2GFUA 4J9FA 4KGZB 2NUPB 2HSPA 2MCNA 5KYYB 3P8DA 1GCPA 5GAMe 3CCMT 5L23A 4IUTA 3H0HA 5CR2A 4NOYA 2RHYA 1FMKA 3QZ9B 1UGQB 3FIFA 2JXBA 1RLQC 2NUPA 3M58A 1YIJQ 3Q1JA 4JDSA 5KYYA 3MEWA 1HXDA 1LPLA 5GMKj 2OTJQ 2DXBA 2DL7A 2MYSA 3OYNA 2KY9A 1RI9A 1WXUA 1M4ZA 5LJ3d 4A54A 3A98A 2K3YA 1KQ1A 3CEYA 1VQ6A 3BW1A 4HXJA 3RBBB 2LQ8A 3WXMB 3H6ZA 1N8RU 4IURA 1UJ0A 4V2SA 1FXXA 2ENMA 4KBMB 1VQMQ 5KCOA 4IUUA 1QKWA 1UECA 2RHIA 4PJOA 2VYTA 4C8QD 5GMKh 4PJOC 4M7AG 3M9QA 1Q95G 2IIMA 2E70A 1VQNA 2E12A 1W6XA 3H9NA 1X2KA 2K2MA 3CPFA 1M8VA 2RJDA 3M53A 3FDRA 1K73R 2X35A 2EAYA 2DA9A 4RMOA 4CC2A 3OYBA 3BDUA 3VUBA 3OYMA 2P4TA 2L3PA 1W2BP 1Q86U 4OB0B 2D9TA 1T3SA 2MPXC 4XTXA 4L59A 2EKOA 3CCUA 1VYUA 2DK3A 3J81E 2F2WA 1IREB 3RKWA 3QHSA 3V8KA 1ZQ1A 4HCKA 2WSEE 3A5ZB 2FG0A 5GANd 3L2VA 1YJ9Q 1TU0B 4RTWA 4E6RA 4GY5A 2HZYA 2F5TX 3OA6A 1Y7XA 3QKJA 2LZ6B 1MMNA 4BY6B 1PKSA 2KRMA 3G6ET 1BI2A 3CQTA 4FW2A 1KG1A 1W2BS 5D6WA 3ZEHA 4DEXA 4QQDA 4M7AE 1UEBA 1C6VX 1U8RA 1VQ5Q 2MMPA 3NTKA 3CCRA 3M0PA 3H0FA 1MV3A 3S3NA 1ZBJA 1WQWA 2DL4A 1QWFA 2DFUA 1SSHA 2CT3A 3CCMQ 1HSQA 2D0NA 4C5EA 2O2OA 4D6WA 1NLPC 4LDXA 1QCFA 1P92A 2K2VA 3UA7A 2ESWA 5CAIA 3SFMA 2COZA 2IG0A 2C0OA 5HCKA 2GCXA 1OQKA 5KE3A 4PK4A 2RHXA 4YTLA 1GFCA 1MHNA 2YRCA 1HD3A 5GAMd 3AT1B 4M78G 2XI9A 4M77G 3CXCP 1VQ6T 2EQKA 4M7DG 3HHTB 4C8QF 4X1VA 2E6NA 3ME9A 5CQXA 3M0RA 5LJ5g 1KC8C 2LCLA 2J6OA 1M3AA 5LJ5j 1AWWA 5LJ3g 4RTYA 4AFSC 3CC4T 2PVOB 1G3SA 2O9SA 3KXTA 3O8VA 3NTHA 3J80E 2RJEA 3HP9A 3VUZA 1LCKA 1M1FA 4ZTFA 2DILA 2GBQA 1V76A 1AOJA 5DLOA 1OX8A 2A7YA 3MPUB 1M8MA 1TXQA 2JN0A 3ER0A 4M77D 1D1AA 1WIEA 4M7DD 1SHGA 1K9MC 1TH7A 3EHRA 1OZ3A 3C94A 3FLGA 3CXCS 5LJ5h 1Q82U 4B9XA 4EPCA 2K9GA 2FVUA 2D6FA 2FB7A 5D6XA 4F7UF 1ZA2B 4FW1A 1NJIC 2FRYA 3QSUA 2DYIA 3JCMX 4PJNA 1M90R 2QDYB 4B9WA 2LX7A 3G7ZA 1KC8U 3VJPA 1ACMB 3VKIA 1N8RR 3LLRA 2DZ9A 4M78E 1U1TA 2XHCA 4J6WA 4XU0A 5GMKe 1VUBA 4QW2A 1ABQA 1M30A 4M7AA 4CC7A 2O9VA 4FIBA 3S3OA 3LWIA 4M7AC 1ABOA 3F70A 1PHTA 4BE1A 1H8KA 2RF0A 5CCAA 4DBFA 4WTOB 3G6EQ 3V7RA 3VS2A 2LTOA 4DOWA 2RQRA 3GLXA 3I56A 3CCQA 4JS4A 3HRSA 2J7IA 2XIDA 3SDZA 4C0FA 1YWPA 3CCRT 4PNOA 4QKUA 5KYWB 1PM3A 4LD9K 1MMGA 2DZCA 2C0IA 2IVWA 1PRLC 1VQ4T 1NJIU 1LNXA 4X34A 1JQQA 5KYWA 4KRTA 4B6MA 2EWNA 2ZPBB 5GAN5 2MI6A 1YBYA 5FRMA 4RTZA 3JCMg 2DLPA 2OAUA 5C6SA 2CP0A 4OMNA 1R0BG 1BB9A 5AYFA 1MV0B 4BUGA 2F2XA 1G3YA 2QASA 1VQ6Q 1TTHB 5GJVB 2RI5A 3X26B 4IIMA 3VU3C 2A37A 3VS3A 4JUVA 4PLIA 4M75F 4C0DC 1TS9A 3BY7A 4Z02A 2AKLA 2BZYA 2DIGA 3RMQA 1I1JA 3REAB 2KMTA 1WQ7A 3DB3A 1FYNA 4LD6A 2NUTB 4NL2A 5GAN2 3NPFA 2DBMA 1M9SA 4XTVA 2QTVA 2ED0A 3EFRA 3JCMh 2DF6A 2F5KA 3QYGB 4M78B 4M77B 3A8HB 3THKA 5CIUA 5FLXE 2R5AA 3V7CA 4M7DB 4DQ2A 2HQEA 4AG1C 1XTDA 2B86A 1WXBA 1WDXA 2CZ7B 1D3BA 4A63B 1M2VB 4LXCA 4L5GA 4M78A 3I5RA 4M77A 1IHVA 3BFMA 2PUKB 4M78C 4BDYA 4OB3B 4M7DA 4F16A 1PG5B 4DBHA 3FJ5A 1ZSZB 1WHKA 4JZ4A 1X6GA 1ZUUA 2DVJA 3MKDA 1BI1A 3CPWA 1QP3A 2JW4A 4C92D 2CZ0B 1QLYA 2XICA 1OPLA 2VV5A 1KFZA 1U3OA 3JB9D 2L3RA 4FM4B 2DXUA 1V29B 1KIKA 1JO8A 3I56T 3CCQT 4E7KA 1UGRB 1G83A 2E3HA 2MK5A 4N4GA 3CD6T 1PC0A 1R8OB 3S3MA 4ME7A 1D09B 5LJ3e 2JZ2A 4ZGJB 4DOVA 2KXDA 3CCRQ 1X6BA 1RABB 4IUPA 2RPNA 1VQOT 1FMWA 3JCMc 5IXFA 2BIVA 4FYVB 4II1A 2EGEA 2A0FB 2DD5A 2Y4XA 3HSBA 3E1SA 1VQ4Q 3CCSA 1WX6A 4QVCA 1JJ2P 3ASKA 3T9NA 1IO6A 2DTHA 1WGSA 1HYOA 1KC8R 1NZ9A 3GP8A 1AWJA 3SEMA 3G71A 2RB6A 4AG2C 2QAZA 5GMKi 3OS0A 3FC3A 3OMCA 1X43A 2XD0A 2JS2A 4J9BA 4LDYA 1UJYA 4BDZA 4Z89A 3OSVA 1WPYA 4XU2A 4JJCA 2EYXA 4RTVA 4CC3A 3QDRB 5GAN7 3PIPA 4GLKA 1K9MR 1KSWA 1KJWA 3I55A 1XJWB 4UC4A 2RQTA 4FSXA 2DL3A 3FRNA 3TSZA 3JCMQ 1JJ2S 2VXEA 1VQ8A 5GJWB 1NJIR 2RO0A 2NYSA 2RQVA 4J9HA 2PTKA 3EHQA 1IHWA 1KQSP 2CKKA 3LGFA 3CC7T 2DNUA 2ED1A 4C92F 4OVAA 4C5GA 2JM9A 3CXCA 2WSFE 3SHWA 1GXIE 3SB2A 4J6XA 2QGFB 2VB6A 2KRSA 2YSQA 3QO3A 3FJPA 4IUVA 1YCYA 3C0CA 4XTWA 2CH4W 4BACA 2K3XA 2V8IA 1YITA 1MMDA 1SHFA 2E65A 3JCMe 1PWTA 2RI3A 2A3LA 3MEVA 1X6OA 4LDWA 1IZ6A 1K0SA 2FHDA 2SRCA 4R0KA 2NUZA 4HCCA 2PQWA 4ATOA 3I56Q 1B3QA 1QWEA 5FU6B 3CCQQ 1KQSS 1GFDA 4ZN3A 4BE2A 5GAN6 2XDPA 3CD6Q 3RUXA 3OYAA 1T0HA 2QYZA 1PCXA 4QQ6A 1TG0A 2JUFA 1VQOQ 2JVVA 1T3LA 2MF2A 4CRIA 3VS7A 4ZGEB 3X25B 4C8QG 1UFFA 3CCST 3EG2A 1Q86C 3M4YA 1UHCA 1SPKA 5LJ5d 3VS0A 2CP2A 1PRMC 2RQWA 4JJBA 3UATA 1AWOA 2V8KA 3G71T 4VUBA 5J39A 4ELYC 4E7SA 1G8XA 2PNIA 3VYGA 5GAOq 3X20B 5J3BA 2LMJA 3QYHB 2JOYA 4DEYA 3LWHA 1CKAA 2GFAA 1B7TA 2KEAA 4PJOF 1AZEA 2GQVA 4XU3A 1I5LA 2MWPA 3WVEB 1QKXA 4HCZA 1LVKA 3RR6A 1C1AA 3CC4A 2CP7A 4X9DA 5A2QE 1E6GA 5IH2A 1U06A 2DIQA 2YRVA 3I55T 2G6FX 3CBPA 2HBPA 4FCYA 4OB2B 3ZL7C 3OSSC 3A8GB 1VQ8T 1ZUYA 4F7UG 5DLQE 4Y28E 3LYIA 2HKQB 1M1GA 4XK8E 2W10A 1M3BA 5D7UA 2P84A 1GBRA 1ZX6A 3JRZA 4C8QE 2R5MA 1IGQA 4OGEA 3PFSA 2COYA 4XTYA 3OYLA 2EIFA 3M4GA 4JLGA 1NE8A 2KQWA 3IQLA 2K4YA 1VQ7A 1J3TA 2LCSA 5IHKA 3X24B 1YITT 3NTIA 3PMTA 3X28B 3G4SA 4DA4A 3R6NA 4AFUC 2COWA 1X27A 1OOTA 3MEUA 2LC4A 4JPBW 2VGMA 4E7ZA 3HL8A 3HFNA 4GBQA 3E9GA 3GF5A 4Y91A 2E6ZA 3FEOA 4BY6C 1BI3A 1UGVA 2F69A 1GBQA 2GTJA 4F7UE 2HL3A 3CCEA 1PNJA 2EYQA 2YWWA 3JCMd 2VUBA 3LH5A 1BYMA 1Q81U 1RLPC 3A8OB 3P8BB 4AFQC 1VQ4A 3E9FA 1UGPB 4J6YA 2DMOA 2ZZDA 3CCSQ 1ZBXA 2L8DA 1BBZA 4M75G 1TOVA 2X3WD 1YHQA 2IPOB 1Q82C 3G71Q 1YJNT 2ABLA 3NMZC 2LVMA 2CP3A 3UF4A 2KI7A 2JM8A 2X51A 1QVPA 4XTUA 1YP5A 2RN8A 2QQBA 1MGQA 2M02A 5GAOn 3OS1A 4C8QB 2K6DA 3UWNA 1H3HA 1G5VA 4AMCA 2EFIA 2QGGA 3CMAA 2EJGA 3PT9A 1Z9QA 3I55Q 2E10A 3L2UA 2NLUA 4M75D 1FWZA 2KK4A 4KH1B 4C8QA 4C8QC 3OW2P 1VQ8Q 4E7JA 4J9IA 2OTLA 2BUDA 4ZGDB 2BKDN 2RNAA 1UDLA 3TREA 2DVEA 2DETA 2DEQA 2HKNA 1Q7YU 2EGCA 1QW1A 5A0DA 1I0CA 3LH0A 1I5OB 2RK1A 3QWYA 4OMOA 2JTEA 2L0AA 2P0QA 1PD1A 4M75E 3EG9B 1QQJA 5A0GA 4Z8AA 1VQ7T 4M7AF 2CREA 3HTRA 5CKDA 4M77E 2GGRA 4LE9A 4F7UB 4M7DE 2OAWA 3G4ST 4E7HA 1R77A 3EG9A 3M59A 1YITQ 1UE9A 3VS6A 1KK7A 3M54A 4E7LA 2ZPHB 2LQKA 3OW2S 1WHLA 4F7UA 5CVIA 4J5YA 3SD4A 1Q86R 3CD6A 1G2BA 1Z9ZA 3CCET 4EMGA 1BI0A 1NYFA 3CCJT 2LJ0A 1VQOA 4CI0C 1B34B 2HSEB 3L2RA 2ZPFB 4OMMA 5A0LA 1AT1B 2E5QA 3L2QA 1WI7A 3JV3A 2HCKA 2NWMA 3SWNB 1B34A 4OB1B 1YHQT 1M27C 3EFOB 2KVQG 3C95A 2JMCA 3NHNA 5HK0A 3OYGA 3DB4A 4HVVA 4MDXA 2ROLA 2DBKA 3SWNA 1IB8A 3SWNC 2DPPB 1YWOA 2CP5A 1GL5A 3MP6A 2XK0A 1X69A 8AT1B 2X4WA 2KSSA 2YUQA 2H3EB 2CUBA 1QVGP 2HBWA 3M0TA 1Y71A 3CC4Q 4R55A 3RDVA 3CMAT 1N9SA 1JXOA 3M0QA 4A4KA 2DERA 4M75B 5GAN8 4JLIA 5CQYA 2PVDB 2DXTA 1VQKT 1AD5A 3BE3A 2HDAA 3RKYA 4C92G 1HK9A 4PJMA 3N5BB 3OYIA 1AWXA 4ZNXA 4MZTA 2OTLT 4PFOA 4D8KA 4X9CA 2NUTA 3VV0A 3PVQA 4M75A 1SKUB 3JB9G 1KD1C 3HRUA 3KFVA 3CBMA 2A28A 1UUEA 1YJWA 2CZ1B 2PZ1A 4FL6A 2ZAEA 4RCBA 1VIEA 2E3IA 4EMKB 3CC7A 4HA8A 4M77C 3EG3A 4M7DC 4LUEA 5EC7A 2FPDA 2DTIA 1M2VA 3EGDB 2LX9A 3QUIA 4EMKA 1QVGS 2YUPA 1D0ZA 3VRYA 1VQ7Q 1F1BB 4P5NA 2H8HA 1QCNA 1T0JA 4J9CA 1ZSZA 2DE0X 2CSQA 4ORZA 2B8AA 2E5KA 2GTOA 1ZSZC 2VKNA 4M4ZA 3G4SQ 1VYVA 2KE9A 2DL5A 2ROTA 2DAQA 1N6AA 1IXDA 2DM1A 4AFZC 1JU5C 3O5ZA 2Z0WA 2V26A 2EKHA 5LJ5e 3QPHA 2J05A 3JSCA 1ZUKA 1G3WA 5C0MA 4BD3A 1D1CA 2AK5A 3QDFA 1EZZB 9ATCB 1KD1U 2Y4YA 2HAXA 5KE2A 1W2BA 2D0QB 4C92E 3LW5E 3CC2A 5HY6A 1OYXA 1M3CA 3CCEQ 1Q82R 4ZN1A 2D8HA 3CCJQ 1BIBA 2VC8A 1JBMA 1QMCA 3E19A 3TU4K 2K5IA 5FW9A 4Z88A 5LJ3f 2RM4A 2EPDA 2DJQA 1QVFP 3JCMV 2VGNA 2YUNA 3BDLA 1IRXA 2YRDA 1OPKA 1YHQQ 2F2VA 1K8AC 1NPRA 3GOXA 1RAGB 1Y57A 1NEGA 5IXBA 3LGLA 2V8JA 1VQLA 1OI1A 2M16A 2CDTA 2QG9B 3MHXA 4BI4A 2FEIA 2DL8A 1S72A 3V8LA 3OBYA 4EIKA 1LJOA 4R56A 1AHJB 4C0ZA 5ECAA 2JMAA 5CK9A 4XQ3A 4ESRA 1SEMA 5KYXB 1C0MA 2K79A 4HCBA 2QDLA 7AT1B 4PJOD 3OYYA 3CMAQ 5DM7R 1VA7A 4AT1B 3M0SA 4N4HA 1VQKQ 1QVFS 3PGGA 3CMEA 1YI2A 3JCMJ 2BZ8A 2QXFA 4FT4A 5KYXA 2FO0A 4FYYB 2OTLQ 4C0GA 1MMAA 4LNPA 2RHZA 1YJWT 2CUDA 1JXMA 2L3QA 4F14A 2JJ9A 4OMQA 3UPUA 2MWOA 2MOXA 5GANf 2OJ2A 1K8AU 5CKHA 1JRIA 2RK2A 2FZGB 3QG1A 1HJDA 3M57A 1AEYA 2LT4A 4NS5A 2ZGWA 2AHJB 3RERA 2QK0A 1BU1A 2XMFA 4C92B 3CBOA 1WHMA 2KRNA 5IHNA 1TWBA 2EVRA 1H3ZA 2QI2A 2ZPIB 1VQ9T 4DBQA 5IHIA 4Q5WA 3REBB 5CO7A 4HVUA 1KHCA 1VOMA 4KUIA 4C92A 4C92C 1MUZA 3GNFB 4EMHA 2J6FA 5IAYA 1A0NB 3EH2A 4MMKA 1OZ2A 4RCCA 5M9OA 1BCOA 2D1XA 5FU7B 2RJCA 3OW2A 2BZXA 2PU9B 5FROA 2KYBA 2EQMA 3CC2T 3PNWC 4N4IA 3QIIA 1SRMA 1QP2A 1MNDA 5HK3A 3P8HA 1M1KC 1QCOA 2YLBA 5GAOp 3HPWA 5FU6C 2QEXA 3MO8A 1BCMA 5GAMf 2DXCA 3OMGA 2LP5A 5GAN3 3OS5A 4KGXB 3QBYA 2GNCA 1I8FA 3INZA 2CSIA 2XKOC 5J26A 2CZ6B 1B07A 1YJNA 1N5ZA 1WJRA 2CT4A 2W0ZA 4RKUE 1VQPA 1VQLT 4E47A 1SSFA 3PTAA 2VXFA 4F17A 4L6V5 1ZHIA 3KUFA 4JRPA 1YFNA 1S72T 1MNEA 2RHUA 2QQRA 3EH1A 1Y96B 1X2QA 1H641 2KR3A 2QQSA 2DTOA 4Y92A 2FYKA 1M90U 3M56A 4PJOB 1KD1R 2AZSA 3TCJA 5GMKm 1OU9A 3CPWP 1Y96A 1K1ZA 1M1KU 3VS5A 2P4RA 4BB7A 4QT7A 3CMET 1YI2T 1M5Q1 2L5QA 5GAOr 5KCHA 2KROA 5GMKl 1WHHA 4ANJA 4DBRA 1NLOC 2CYZB 3GIBA 1TSFA 2M0OA 1VIFA 5FRNA 2LJ1A 3OYEA 1YJWQ 5HKCA 1Q81C 2C0TA 4J7FA 3CC7Q 2KYMA 3LX7A 1I07A 1XOVA 4PFPA 3H8ZA 5D6YA 1ZLMA 2DRMA 1R0CB 2E41A 1NEBA 1WHGA 2KNBB 2RMOA 1RACB 2QQAA 2V1QA 1WLPB 3CCLA 1E6HA 2EQJA 2HQXA 3CPWS 4ELZC 3MEAA 2X9HA 4PL6A 3DKMA 1VYTA 4HVWA 1VQ9Q 2VWFA 2XG8D 1QVGA 1OU8A 2JS0A 1V1CA 4M7AD 2LQNA 2CP6A 1CKBA 4MZMA 4RTTA 3NFCA 2LRQA 5CKFA 1WJSA 1UG1A 3EAEA 1AZGB 1OEBA 2V1RA 3HKSA 2X3XD 1RAFB 4QVDA 2GQIA 4PKCC 5KYUB 3CC2Q 3CCJA 5FWBA 5I22A 1RADB 3FB9A 2KAFA 1OULA 2QEXT 1KHIA 4MDWA 1RAAB 2FZCB 4O5VA 1PSFA 1K8AR 1XQHA 1KQ2A 2AT1B 1NG2A 2G3RA 1UGSB 2VVKA 2ECZA 5KYUA 5IT9E 1AVZC 3MCAB 3A1PA 4JZ3A 4JS5A 2SEMA 2O4XB 1Q7YC 1G3TA 1WNLA 3OYJA 3OYKA 3OYHA 1VQPT 2QA4A 3DLMA 2YDLA 2I2LA 2L89A 4A4GA 2M9UA 1K76A 1VQLQ 2O4XA 1NYGA 3L2ZA 1S72Q 4FT2A 2JNGA 2RI2A 3JB9I 3MJXA 2BE9B 3ZFJA 3I9QA 3TVTA 2EJ9A 4RUGA 3AHUA 4PJJA 2HL5C 2L2PA 2AKKA 2WACA 2CS7A 1N9RA 4GLMA 1VQKA 1W1FA 4J9DA 2DRKA 4CC4B 3CMEQ 3C12A 1YI2Q 1ARKA 5LJ3j 1EIFA 5EG2A 2DEUA 1WYXA 1YNZA 2EYZA 2LDMA 2KXCA 1VQNT 1JJ2A 1QVFA 4IIOA 3QJYA 4OMLA 5CKEA 4M78D 4IKFA 3QZ5B 1WZOA 1WHJA 2VASA 1K0XA 1S1NA 1OX9A 2KGTA 5LL6S 1UB4A 1DJ7B 1WJQA 1RAIB 1I81A 3CCUT 1WXTA 2KBTA 3UDCA 5I21A 2M1HA 3CCLT 2HMAA 5LJ3h 1EX4A 2FRWA 2LNHB 2QTXA 3WVDB 2F1LA 2WSCE 2M51A 1ZA1B 4M7AB 2L3SA 1NPPA 3I35A 3A8MB 4J8OA 1OV3A 5CKBA 1YCSB 1M1KR 2FPEA 2EJFA 4MZPA 3S6WA 2CH4A 4A4FA 4J9GA 1SF9A 2K5FA 4HT9A 3R6OA 3JB9J 3CCVA 1I4K1 4XTZA 5GANg 2AZVA 4BE0A 2P0KA 3HRTA 1ZSGA 5GANj 3GPLA 1LOJA 1KQSA 2ZCFB 3L42A 3TSWA 4FSSA 2DD4A 3GBQA 2QEXQ 1K9MU 1Y07A 2ZPEB 2HQHA 5DY9A 1TUDA 4C5HA 1N27A 3TQ7P 1IGUA 1YIJA 4JRKA 1YJNQ 4RTXA 2QA4T 2OTJA 1VQPQ 2X4YA 2P0PA 3EFOA 2YXYA 1GCQA 3V8JA 1SRLA 5GANh 1GCQC 4XAXB 4C0DB 3VS4A 4IUQA 1K9AA 4PLLA 2HD0A 3OY9A 3U23A 2O31A 1YN8A
chains in the Genus database with same CATH topology
1VQ6Q 3CCLQ 3G4SQ 1YHQQ 1M90R 1YJ9Q 1K9MR 1VQLQ 3G6EQ 1YJNQ 3OW2P 1KQSP 3CCSQ 1VQ8Q 3CCEQ 3CD6Q 3CMEQ 1Q82R 1YI2Q 1VQPQ 1N8RR 1M1KR 1VQ5Q 1S72Q 3CMAQ 3CCJQ 1Q7YR 2QEXQ 1Q81R 3CCVQ 1VQ4Q 1YJWQ 1VQOQ 3CXCP 1KD1R 3CPWP 1Q86R 3CCMQ 2QA4Q 1JJ2P 1VQKQ 3G71Q 1K73R 1VQ9Q 1NJIR 1YIJQ 1VQ7Q 3CC7Q 1QVFP 1QVGP 1KC8R 1YITQ 3CC2Q 3CC4Q 3I55Q 2OTJQ 2OTLQ 3CCUQ 1VQMQ 1W2BP 3I56Q 1VQNQ 3CCQQ 3CCRQ 1K8AR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 Q;  3CCL Q;  3G4S Q;  1YHQ Q;  1M90 R;  1YJ9 Q;  1K9M R;  1VQL Q;  3G6E Q;  1YJN Q;  3OW2 P;  1KQS P;  3CCS Q;  1VQ8 Q;  3CCE Q;  3CD6 Q;  3CME Q;  1Q82 R;  1YI2 Q;  1VQP Q;  1N8R R;  1M1K R;  1VQ5 Q;  1S72 Q;  3CMA Q;  3CCJ Q;  1Q7Y R;  2QEX Q;  1Q81 R;  3CCV Q;  1VQ4 Q;  1YJW Q;  1VQO Q;  3CXC P;  1KD1 R;  3CPW P;  1Q86 R;  3CCM Q;  2QA4 Q;  1JJ2 P;  1VQK Q;  3G71 Q;  1K73 R;  1VQ9 Q;  1NJI R;  1YIJ Q;  1VQ7 Q;  3CC7 Q;  1QVF P;  1QVG P;  1KC8 R;  1YIT Q;  3CC2 Q;  3CC4 Q;  3I55 Q;  2OTJ Q;  2OTL Q;  3CCU Q;  1VQM Q;  1W2B P;  3I56 Q;  1VQN Q;  3CCQ Q;  3CCR Q;  1K8A R; 
#chains in the Genus database with same CATH topology
 2K3B A;  4KH0 B;  3MP8 A;  1X75 C;  1NBE B;  1VQM A;  1Q81 R;  3L2W A;  2HNI A;  1UHF A;  3RES A;  5GAM g;  4WF2 A;  3GNG A;  4M78 F;  3EFS A;  4M77 F;  5GAM j;  1GRI A;  3JAM E;  2FL7 A;  3L1A A;  4J9E A;  4EDU A;  4M7D F;  1D0Y A;  4M75 C;  4PFZ A;  3KBG A;  3VYH B;  1VQN Q;  2PUO B;  1BK2 A;  2MIO A;  1D3B B;  2RJF A;  1X01 A;  4NL3 A;  2LT1 A;  3PVL A;  3PMI A;  2YUO A;  4BI3 A;  2A36 A;  3H0I A;  1W70 A;  4HT8 A;  2JTF A;  2JT4 A;  4RG8 A;  4LDU A;  3C4S A;  2XU8 A;  4EMK C;  4XU1 A;  2K5L A;  2J6K A;  1K73 C;  1EFN A;  3CCU Q;  3TEE A;  5GAM h;  3CCL Q;  2E64 A;  1VQ9 A;  1K4U S;  3EGU A;  3EGD A;  5FWC A;  2Y90 A;  4KT0 E;  3OYF A;  1YJ9 A;  2LNV A;  2YHT A;  2OX7 A;  4D8D A;  5KH6 A;  2CGH A;  3I5S A;  3V7S A;  1BKB A;  2KDS A;  1D1B A;  2MAM A;  4OMF B;  4OGC A;  3CCV T;  3MET A;  1WA7 A;  1PSE A;  1CSK A;  2R57 A;  4KGV B;  2D8J A;  3OBW A;  3OB9 A;  4WCI A;  5LJ5 f;  1Q7Y R;  5I2S A;  3RMS A;  2O01 E;  3EGX B;  4OMP A;  5I2M A;  1RAH B;  2EBP A;  2X4J A;  2EYY A;  3E2U A;  5GAN 4;  3QJ6 A;  4C5I A;  3RNJ A;  2ZPG B;  1VQ5 A;  1TUG B;  2J06 A;  3JCM P;  3QXE B;  4PJO G;  5I11 A;  1UTI A;  1FMV A;  4LDV A;  3CCM A;  2M0Y A;  3EGX A;  1PD0 A;  4N0A A;  1K73 U;  4JRI A;  1JB0 E;  4N0A C;  1YIJ T;  4LN2 A;  1TUC A;  3J7A F;  2A08 A;  2O88 A;  2RD1 A;  2FZK B;  3OYD A;  3JB9 H;  5L8R E;  3UA6 A;  2OTJ T;  8ATC B;  2RQU A;  3RKX A;  4OF1 A;  4JRQ A;  4JJD A;  2EGA A;  2OI3 A;  2PVG B;  2QA4 Q;  4KUD K;  3QWX X;  3G1J A;  2DX1 A;  3RIR A;  3VS1 A;  1PKT A;  1RUW A;  2YT6 A;  1BIA A;  2GF7 A;  4A4E A;  2KT8 A;  3EG0 A;  2DJZ A;  2XDB A;  5GAO m;  5KYN A;  1WFW A;  3NGP A;  3OQ5 A;  4HKE A;  1VQM T;  2XDD A;  3JCM W;  4FYX B;  5IN1 A;  2EQI A;  1U5S A;  2FPF A;  1RAE B;  3A8L B;  2RH2 A;  2X4X A;  2BTT A;  3M5A A;  4QQG A;  4TVR A;  4E2F B;  5GAO l;  1FX7 A;  2K57 A;  4KUL A;  5AT1 B;  3JCM b;  2DYB A;  2HEQ A;  2YLC A;  4O6J A;  1H92 A;  2DKG A;  4PJO E;  5GAN e;  2AIR B;  2R58 A;  4F04 B;  1U1S A;  1XNI A;  2H3J A;  2QQ9 A;  3DLL A;  4JJN K;  4ZTJ A;  3URG A;  1D0X A;  3D7S B;  1RL2 A;  2EW3 A;  3M0U A;  3OS2 A;  4RG2 A;  3OYC A;  4QVZ A;  2K7A A;  1NM7 A;  1O75 A;  4MML A;  2LQW A;  3ZBD A;  2JTM A;  1M2O A;  4E7I A;  2RA2 A;  4OP0 A;  2LJ3 A;  4RTU A;  2C06 A;  3H41 A;  1SG5 A;  1YJ9 T;  1JEG A;  4K11 A;  3JB9 F;  2I0N A;  1E7O A;  4BI8 B;  4LUD A;  3MP1 A;  3HFO A;  4J83 A;  3ULR B;  3M55 A;  3JCM f;  3UT1 A;  3EG1 A;  3PIO A;  2LCC A;  1Y0M A;  4J7I A;  4A53 A;  2ATC B;  1M90 C;  2DO3 A;  3VRZ A;  1W4S A;  1O9S A;  2E4H A;  3G6E A;  1N8R C;  3CCV Q;  2EQU A;  2KT1 A;  4PJL A;  4A4H A;  4FU6 A;  6AT1 B;  2BE7 D;  2EYW A;  1RI0 A;  1VQ5 T;  5FU7 C;  3PE0 A;  2E1H A;  4FYW B;  2GFU A;  4J9F A;  4KGZ B;  2NUP B;  2HSP A;  2MCN A;  5KYY B;  3P8D A;  1GCP A;  5GAM e;  3CCM T;  5L23 A;  4IUT A;  3H0H A;  5CR2 A;  4NOY A;  2RHY A;  1FMK A;  3QZ9 B;  1UGQ B;  3FIF A;  2JXB A;  1RLQ C;  2NUP A;  3M58 A;  1YIJ Q;  3Q1J A;  4JDS A;  5KYY A;  3MEW A;  1HXD A;  1LPL A;  5GMK j;  2OTJ Q;  2DXB A;  2DL7 A;  2MYS A;  3OYN A;  2KY9 A;  1RI9 A;  1WXU A;  1M4Z A;  5LJ3 d;  4A54 A;  3A98 A;  2K3Y A;  1KQ1 A;  3CEY A;  1VQ6 A;  3BW1 A;  4HXJ A;  3RBB B;  2LQ8 A;  3WXM B;  3H6Z A;  1N8R U;  4IUR A;  1UJ0 A;  4V2S A;  1FXX A;  2ENM A;  4KBM B;  1VQM Q;  5KCO A;  4IUU A;  1QKW A;  1UEC A;  2RHI A;  4PJO A;  2VYT A;  4C8Q D;  5GMK h;  4PJO C;  4M7A G;  3M9Q A;  1Q95 G;  2IIM A;  2E70 A;  1VQN A;  2E12 A;  1W6X A;  3H9N A;  1X2K A;  2K2M A;  3CPF A;  1M8V A;  2RJD A;  3M53 A;  3FDR A;  1K73 R;  2X35 A;  2EAY A;  2DA9 A;  4RMO A;  4CC2 A;  3OYB A;  3BDU A;  3VUB A;  3OYM A;  2P4T A;  2L3P A;  1W2B P;  1Q86 U;  4OB0 B;  2D9T A;  1T3S A;  2MPX C;  4XTX A;  4L59 A;  2EKO A;  3CCU A;  1VYU A;  2DK3 A;  3J81 E;  2F2W A;  1IRE B;  3RKW A;  3QHS A;  3V8K A;  1ZQ1 A;  4HCK A;  2WSE E;  3A5Z B;  2FG0 A;  5GAN d;  3L2V A;  1YJ9 Q;  1TU0 B;  4RTW A;  4E6R A;  4GY5 A;  2HZY A;  2F5T X;  3OA6 A;  1Y7X A;  3QKJ A;  2LZ6 B;  1MMN A;  4BY6 B;  1PKS A;  2KRM A;  3G6E T;  1BI2 A;  3CQT A;  4FW2 A;  1KG1 A;  1W2B S;  5D6W A;  3ZEH A;  4DEX A;  4QQD A;  4M7A E;  1UEB A;  1C6V X;  1U8R A;  1VQ5 Q;  2MMP A;  3NTK A;  3CCR A;  3M0P A;  3H0F A;  1MV3 A;  3S3N A;  1ZBJ A;  1WQW A;  2DL4 A;  1QWF A;  2DFU A;  1SSH A;  2CT3 A;  3CCM Q;  1HSQ A;  2D0N A;  4C5E A;  2O2O A;  4D6W A;  1NLP C;  4LDX A;  1QCF A;  1P92 A;  2K2V A;  3UA7 A;  2ESW A;  5CAI A;  3SFM A;  2COZ A;  2IG0 A;  2C0O A;  5HCK A;  2GCX A;  1OQK A;  5KE3 A;  4PK4 A;  2RHX A;  4YTL A;  1GFC A;  1MHN A;  2YRC A;  1HD3 A;  5GAM d;  3AT1 B;  4M78 G;  2XI9 A;  4M77 G;  3CXC P;  1VQ6 T;  2EQK A;  4M7D G;  3HHT B;  4C8Q F;  4X1V A;  2E6N A;  3ME9 A;  5CQX A;  3M0R A;  5LJ5 g;  1KC8 C;  2LCL A;  2J6O A;  1M3A A;  5LJ5 j;  1AWW A;  5LJ3 g;  4RTY A;  4AFS C;  3CC4 T;  2PVO B;  1G3S A;  2O9S A;  3KXT A;  3O8V A;  3NTH A;  3J80 E;  2RJE A;  3HP9 A;  3VUZ A;  1LCK A;  1M1F A;  4ZTF A;  2DIL A;  2GBQ A;  1V76 A;  1AOJ A;  5DLO A;  1OX8 A;  2A7Y A;  3MPU B;  1M8M A;  1TXQ A;  2JN0 A;  3ER0 A;  4M77 D;  1D1A A;  1WIE A;  4M7D D;  1SHG A;  1K9M C;  1TH7 A;  3EHR A;  1OZ3 A;  3C94 A;  3FLG A;  3CXC S;  5LJ5 h;  1Q82 U;  4B9X A;  4EPC A;  2K9G A;  2FVU A;  2D6F A;  2FB7 A;  5D6X A;  4F7U F;  1ZA2 B;  4FW1 A;  1NJI C;  2FRY A;  3QSU A;  2DYI A;  3JCM X;  4PJN A;  1M90 R;  2QDY B;  4B9W A;  2LX7 A;  3G7Z A;  1KC8 U;  3VJP A;  1ACM B;  3VKI A;  1N8R R;  3LLR A;  2DZ9 A;  4M78 E;  1U1T A;  2XHC A;  4J6W A;  4XU0 A;  5GMK e;  1VUB A;  4QW2 A;  1ABQ A;  1M30 A;  4M7A A;  4CC7 A;  2O9V A;  4FIB A;  3S3O A;  3LWI A;  4M7A C;  1ABO A;  3F70 A;  1PHT A;  4BE1 A;  1H8K A;  2RF0 A;  5CCA A;  4DBF A;  4WTO B;  3G6E Q;  3V7R A;  3VS2 A;  2LTO A;  4DOW A;  2RQR A;  3GLX A;  3I56 A;  3CCQ A;  4JS4 A;  3HRS A;  2J7I A;  2XID A;  3SDZ A;  4C0F A;  1YWP A;  3CCR T;  4PNO A;  4QKU A;  5KYW B;  1PM3 A;  4LD9 K;  1MMG A;  2DZC A;  2C0I A;  2IVW A;  1PRL C;  1VQ4 T;  1NJI U;  1LNX A;  4X34 A;  1JQQ A;  5KYW A;  4KRT A;  4B6M A;  2EWN A;  2ZPB B;  5GAN 5;  2MI6 A;  1YBY A;  5FRM A;  4RTZ A;  3JCM g;  2DLP A;  2OAU A;  5C6S A;  2CP0 A;  4OMN A;  1R0B G;  1BB9 A;  5AYF A;  1MV0 B;  4BUG A;  2F2X A;  1G3Y A;  2QAS A;  1VQ6 Q;  1TTH B;  5GJV B;  2RI5 A;  3X26 B;  4IIM A;  3VU3 C;  2A37 A;  3VS3 A;  4JUV A;  4PLI A;  4M75 F;  4C0D C;  1TS9 A;  3BY7 A;  4Z02 A;  2AKL A;  2BZY A;  2DIG A;  3RMQ A;  1I1J A;  3REA B;  2KMT A;  1WQ7 A;  3DB3 A;  1FYN A;  4LD6 A;  2NUT B;  4NL2 A;  5GAN 2;  3NPF A;  2DBM A;  1M9S A;  4XTV A;  2QTV A;  2ED0 A;  3EFR A;  3JCM h;  2DF6 A;  2F5K A;  3QYG B;  4M78 B;  4M77 B;  3A8H B;  3THK A;  5CIU A;  5FLX E;  2R5A A;  3V7C A;  4M7D B;  4DQ2 A;  2HQE A;  4AG1 C;  1XTD A;  2B86 A;  1WXB A;  1WDX A;  2CZ7 B;  1D3B A;  4A63 B;  1M2V B;  4LXC A;  4L5G A;  4M78 A;  3I5R A;  4M77 A;  1IHV A;  3BFM A;  2PUK B;  4M78 C;  4BDY A;  4OB3 B;  4M7D A;  4F16 A;  1PG5 B;  4DBH A;  3FJ5 A;  1ZSZ B;  1WHK A;  4JZ4 A;  1X6G A;  1ZUU A;  2DVJ A;  3MKD A;  1BI1 A;  3CPW A;  1QP3 A;  2JW4 A;  4C92 D;  2CZ0 B;  1QLY A;  2XIC A;  1OPL A;  2VV5 A;  1KFZ A;  1U3O A;  3JB9 D;  2L3R A;  4FM4 B;  2DXU A;  1V29 B;  1KIK A;  1JO8 A;  3I56 T;  3CCQ T;  4E7K A;  1UGR B;  1G83 A;  2E3H A;  2MK5 A;  4N4G A;  3CD6 T;  1PC0 A;  1R8O B;  3S3M A;  4ME7 A;  1D09 B;  5LJ3 e;  2JZ2 A;  4ZGJ B;  4DOV A;  2KXD A;  3CCR Q;  1X6B A;  1RAB B;  4IUP A;  2RPN A;  1VQO T;  1FMW A;  3JCM c;  5IXF A;  2BIV A;  4FYV B;  4II1 A;  2EGE A;  2A0F B;  2DD5 A;  2Y4X A;  3HSB A;  3E1S A;  1VQ4 Q;  3CCS A;  1WX6 A;  4QVC A;  1JJ2 P;  3ASK A;  3T9N A;  1IO6 A;  2DTH A;  1WGS A;  1HYO A;  1KC8 R;  1NZ9 A;  3GP8 A;  1AWJ A;  3SEM A;  3G71 A;  2RB6 A;  4AG2 C;  2QAZ A;  5GMK i;  3OS0 A;  3FC3 A;  3OMC A;  1X43 A;  2XD0 A;  2JS2 A;  4J9B A;  4LDY A;  1UJY A;  4BDZ A;  4Z89 A;  3OSV A;  1WPY A;  4XU2 A;  4JJC A;  2EYX A;  4RTV A;  4CC3 A;  3QDR B;  5GAN 7;  3PIP A;  4GLK A;  1K9M R;  1KSW A;  1KJW A;  3I55 A;  1XJW B;  4UC4 A;  2RQT A;  4FSX A;  2DL3 A;  3FRN A;  3TSZ A;  3JCM Q;  1JJ2 S;  2VXE A;  1VQ8 A;  5GJW B;  1NJI R;  2RO0 A;  2NYS A;  2RQV A;  4J9H A;  2PTK A;  3EHQ A;  1IHW A;  1KQS P;  2CKK A;  3LGF A;  3CC7 T;  2DNU A;  2ED1 A;  4C92 F;  4OVA A;  4C5G A;  2JM9 A;  3CXC A;  2WSF E;  3SHW A;  1GXI E;  3SB2 A;  4J6X A;  2QGF B;  2VB6 A;  2KRS A;  2YSQ A;  3QO3 A;  3FJP A;  4IUV A;  1YCY A;  3C0C A;  4XTW A;  2CH4 W;  4BAC A;  2K3X A;  2V8I A;  1YIT A;  1MMD A;  1SHF A;  2E65 A;  3JCM e;  1PWT A;  2RI3 A;  2A3L A;  3MEV A;  1X6O A;  4LDW A;  1IZ6 A;  1K0S A;  2FHD A;  2SRC A;  4R0K A;  2NUZ A;  4HCC A;  2PQW A;  4ATO A;  3I56 Q;  1B3Q A;  1QWE A;  5FU6 B;  3CCQ Q;  1KQS S;  1GFD A;  4ZN3 A;  4BE2 A;  5GAN 6;  2XDP A;  3CD6 Q;  3RUX A;  3OYA A;  1T0H A;  2QYZ A;  1PCX A;  4QQ6 A;  1TG0 A;  2JUF A;  1VQO Q;  2JVV A;  1T3L A;  2MF2 A;  4CRI A;  3VS7 A;  4ZGE B;  3X25 B;  4C8Q G;  1UFF A;  3CCS T;  3EG2 A;  1Q86 C;  3M4Y A;  1UHC A;  1SPK A;  5LJ5 d;  3VS0 A;  2CP2 A;  1PRM C;  2RQW A;  4JJB A;  3UAT A;  1AWO A;  2V8K A;  3G71 T;  4VUB A;  5J39 A;  4ELY C;  4E7S A;  1G8X A;  2PNI A;  3VYG A;  5GAO q;  3X20 B;  5J3B A;  2LMJ A;  3QYH B;  2JOY A;  4DEY A;  3LWH A;  1CKA A;  2GFA A;  1B7T A;  2KEA A;  4PJO F;  1AZE A;  2GQV A;  4XU3 A;  1I5L A;  2MWP A;  3WVE B;  1QKX A;  4HCZ A;  1LVK A;  3RR6 A;  1C1A A;  3CC4 A;  2CP7 A;  4X9D A;  5A2Q E;  1E6G A;  5IH2 A;  1U06 A;  2DIQ A;  2YRV A;  3I55 T;  2G6F X;  3CBP A;  2HBP A;  4FCY A;  4OB2 B;  3ZL7 C;  3OSS C;  3A8G B;  1VQ8 T;  1ZUY A;  4F7U G;  5DLQ E;  4Y28 E;  3LYI A;  2HKQ B;  1M1G A;  4XK8 E;  2W10 A;  1M3B A;  5D7U A;  2P84 A;  1GBR A;  1ZX6 A;  3JRZ A;  4C8Q E;  2R5M A;  1IGQ A;  4OGE A;  3PFS A;  2COY A;  4XTY A;  3OYL A;  2EIF A;  3M4G A;  4JLG A;  1NE8 A;  2KQW A;  3IQL A;  2K4Y A;  1VQ7 A;  1J3T A;  2LCS A;  5IHK A;  3X24 B;  1YIT T;  3NTI A;  3PMT A;  3X28 B;  3G4S A;  4DA4 A;  3R6N A;  4AFU C;  2COW A;  1X27 A;  1OOT A;  3MEU A;  2LC4 A;  4JPB W;  2VGM A;  4E7Z A;  3HL8 A;  3HFN A;  4GBQ A;  3E9G A;  3GF5 A;  4Y91 A;  2E6Z A;  3FEO A;  4BY6 C;  1BI3 A;  1UGV A;  2F69 A;  1GBQ A;  2GTJ A;  4F7U E;  2HL3 A;  3CCE A;  1PNJ A;  2EYQ A;  2YWW A;  3JCM d;  2VUB A;  3LH5 A;  1BYM A;  1Q81 U;  1RLP C;  3A8O B;  3P8B B;  4AFQ C;  1VQ4 A;  3E9F A;  1UGP B;  4J6Y A;  2DMO A;  2ZZD A;  3CCS Q;  1ZBX A;  2L8D A;  1BBZ A;  4M75 G;  1TOV A;  2X3W D;  1YHQ A;  2IPO B;  1Q82 C;  3G71 Q;  1YJN T;  2ABL A;  3NMZ C;  2LVM A;  2CP3 A;  3UF4 A;  2KI7 A;  2JM8 A;  2X51 A;  1QVP A;  4XTU A;  1YP5 A;  2RN8 A;  2QQB A;  1MGQ A;  2M02 A;  5GAO n;  3OS1 A;  4C8Q B;  2K6D A;  3UWN A;  1H3H A;  1G5V A;  4AMC A;  2EFI A;  2QGG A;  3CMA A;  2EJG A;  3PT9 A;  1Z9Q A;  3I55 Q;  2E10 A;  3L2U A;  2NLU A;  4M75 D;  1FWZ A;  2KK4 A;  4KH1 B;  4C8Q A;  4C8Q C;  3OW2 P;  1VQ8 Q;  4E7J A;  4J9I A;  2OTL A;  2BUD A;  4ZGD B;  2BKD N;  2RNA A;  1UDL A;  3TRE A;  2DVE A;  2DET A;  2DEQ A;  2HKN A;  1Q7Y U;  2EGC A;  1QW1 A;  5A0D A;  1I0C A;  3LH0 A;  1I5O B;  2RK1 A;  3QWY A;  4OMO A;  2JTE A;  2L0A A;  2P0Q A;  1PD1 A;  4M75 E;  3EG9 B;  1QQJ A;  5A0G A;  4Z8A A;  1VQ7 T;  4M7A F;  2CRE A;  3HTR A;  5CKD A;  4M77 E;  2GGR A;  4LE9 A;  4F7U B;  4M7D E;  2OAW A;  3G4S T;  4E7H A;  1R77 A;  3EG9 A;  3M59 A;  1YIT Q;  1UE9 A;  3VS6 A;  1KK7 A;  3M54 A;  4E7L A;  2ZPH B;  2LQK A;  3OW2 S;  1WHL A;  4F7U A;  5CVI A;  4J5Y A;  3SD4 A;  1Q86 R;  3CD6 A;  1G2B A;  1Z9Z A;  3CCE T;  4EMG A;  1BI0 A;  1NYF A;  3CCJ T;  2LJ0 A;  1VQO A;  4CI0 C;  1B34 B;  2HSE B;  3L2R A;  2ZPF B;  4OMM A;  5A0L A;  1AT1 B;  2E5Q A;  3L2Q A;  1WI7 A;  3JV3 A;  2HCK A;  2NWM A;  3SWN B;  1B34 A;  4OB1 B;  1YHQ T;  1M27 C;  3EFO B;  2KVQ G;  3C95 A;  2JMC A;  3NHN A;  5HK0 A;  3OYG A;  3DB4 A;  4HVV A;  4MDX A;  2ROL A;  2DBK A;  3SWN A;  1IB8 A;  3SWN C;  2DPP B;  1YWO A;  2CP5 A;  1GL5 A;  3MP6 A;  2XK0 A;  1X69 A;  8AT1 B;  2X4W A;  2KSS A;  2YUQ A;  2H3E B;  2CUB A;  1QVG P;  2HBW A;  3M0T A;  1Y71 A;  3CC4 Q;  4R55 A;  3RDV A;  3CMA T;  1N9S A;  1JXO A;  3M0Q A;  4A4K A;  2DER A;  4M75 B;  5GAN 8;  4JLI A;  5CQY A;  2PVD B;  2DXT A;  1VQK T;  1AD5 A;  3BE3 A;  2HDA A;  3RKY A;  4C92 G;  1HK9 A;  4PJM A;  3N5B B;  3OYI A;  1AWX A;  4ZNX A;  4MZT A;  2OTL T;  4PFO A;  4D8K A;  4X9C A;  2NUT A;  3VV0 A;  3PVQ A;  4M75 A;  1SKU B;  3JB9 G;  1KD1 C;  3HRU A;  3KFV A;  3CBM A;  2A28 A;  1UUE A;  1YJW A;  2CZ1 B;  2PZ1 A;  4FL6 A;  2ZAE A;  4RCB A;  1VIE A;  2E3I A;  4EMK B;  3CC7 A;  4HA8 A;  4M77 C;  3EG3 A;  4M7D C;  4LUE A;  5EC7 A;  2FPD A;  2DTI A;  1M2V A;  3EGD B;  2LX9 A;  3QUI A;  4EMK A;  1QVG S;  2YUP A;  1D0Z A;  3VRY A;  1VQ7 Q;  1F1B B;  4P5N A;  2H8H A;  1QCN A;  1T0J A;  4J9C A;  1ZSZ A;  2DE0 X;  2CSQ A;  4ORZ A;  2B8A A;  2E5K A;  2GTO A;  1ZSZ C;  2VKN A;  4M4Z A;  3G4S Q;  1VYV A;  2KE9 A;  2DL5 A;  2ROT A;  2DAQ A;  1N6A A;  1IXD A;  2DM1 A;  4AFZ C;  1JU5 C;  3O5Z A;  2Z0W A;  2V26 A;  2EKH A;  5LJ5 e;  3QPH A;  2J05 A;  3JSC A;  1ZUK A;  1G3W A;  5C0M A;  4BD3 A;  1D1C A;  2AK5 A;  3QDF A;  1EZZ B;  9ATC B;  1KD1 U;  2Y4Y A;  2HAX A;  5KE2 A;  1W2B A;  2D0Q B;  4C92 E;  3LW5 E;  3CC2 A;  5HY6 A;  1OYX A;  1M3C A;  3CCE Q;  1Q82 R;  4ZN1 A;  2D8H A;  3CCJ Q;  1BIB A;  2VC8 A;  1JBM A;  1QMC A;  3E19 A;  3TU4 K;  2K5I A;  5FW9 A;  4Z88 A;  5LJ3 f;  2RM4 A;  2EPD A;  2DJQ A;  1QVF P;  3JCM V;  2VGN A;  2YUN A;  3BDL A;  1IRX A;  2YRD A;  1OPK A;  1YHQ Q;  2F2V A;  1K8A C;  1NPR A;  3GOX A;  1RAG B;  1Y57 A;  1NEG A;  5IXB A;  3LGL A;  2V8J A;  1VQL A;  1OI1 A;  2M16 A;  2CDT A;  2QG9 B;  3MHX A;  4BI4 A;  2FEI A;  2DL8 A;  1S72 A;  3V8L A;  3OBY A;  4EIK A;  1LJO A;  4R56 A;  1AHJ B;  4C0Z A;  5ECA A;  2JMA A;  5CK9 A;  4XQ3 A;  4ESR A;  1SEM A;  5KYX B;  1C0M A;  2K79 A;  4HCB A;  2QDL A;  7AT1 B;  4PJO D;  3OYY A;  3CMA Q;  5DM7 R;  1VA7 A;  4AT1 B;  3M0S A;  4N4H A;  1VQK Q;  1QVF S;  3PGG A;  3CME A;  1YI2 A;  3JCM J;  2BZ8 A;  2QXF A;  4FT4 A;  5KYX A;  2FO0 A;  4FYY B;  2OTL Q;  4C0G A;  1MMA A;  4LNP A;  2RHZ A;  1YJW T;  2CUD A;  1JXM A;  2L3Q A;  4F14 A;  2JJ9 A;  4OMQ A;  3UPU A;  2MWO A;  2MOX A;  5GAN f;  2OJ2 A;  1K8A U;  5CKH A;  1JRI A;  2RK2 A;  2FZG B;  3QG1 A;  1HJD A;  3M57 A;  1AEY A;  2LT4 A;  4NS5 A;  2ZGW A;  2AHJ B;  3RER A;  2QK0 A;  1BU1 A;  2XMF A;  4C92 B;  3CBO A;  1WHM A;  2KRN A;  5IHN A;  1TWB A;  2EVR A;  1H3Z A;  2QI2 A;  2ZPI B;  1VQ9 T;  4DBQ A;  5IHI A;  4Q5W A;  3REB B;  5CO7 A;  4HVU A;  1KHC A;  1VOM A;  4KUI A;  4C92 A;  4C92 C;  1MUZ A;  3GNF B;  4EMH A;  2J6F A;  5IAY A;  1A0N B;  3EH2 A;  4MMK A;  1OZ2 A;  4RCC A;  5M9O A;  1BCO A;  2D1X A;  5FU7 B;  2RJC A;  3OW2 A;  2BZX A;  2PU9 B;  5FRO A;  2KYB A;  2EQM A;  3CC2 T;  3PNW C;  4N4I A;  3QII A;  1SRM A;  1QP2 A;  1MND A;  5HK3 A;  3P8H A;  1M1K C;  1QCO A;  2YLB A;  5GAO p;  3HPW A;  5FU6 C;  2QEX A;  3MO8 A;  1BCM A;  5GAM f;  2DXC A;  3OMG A;  2LP5 A;  5GAN 3;  3OS5 A;  4KGX B;  3QBY A;  2GNC A;  1I8F A;  3INZ A;  2CSI A;  2XKO C;  5J26 A;  2CZ6 B;  1B07 A;  1YJN A;  1N5Z A;  1WJR A;  2CT4 A;  2W0Z A;  4RKU E;  1VQP A;  1VQL T;  4E47 A;  1SSF A;  3PTA A;  2VXF A;  4F17 A;  4L6V 5;  1ZHI A;  3KUF A;  4JRP A;  1YFN A;  1S72 T;  1MNE A;  2RHU A;  2QQR A;  3EH1 A;  1Y96 B;  1X2Q A;  1H64 1;  2KR3 A;  2QQS A;  2DTO A;  4Y92 A;  2FYK A;  1M90 U;  3M56 A;  4PJO B;  1KD1 R;  2AZS A;  3TCJ A;  5GMK m;  1OU9 A;  3CPW P;  1Y96 A;  1K1Z A;  1M1K U;  3VS5 A;  2P4R A;  4BB7 A;  4QT7 A;  3CME T;  1YI2 T;  1M5Q 1;  2L5Q A;  5GAO r;  5KCH A;  2KRO A;  5GMK l;  1WHH A;  4ANJ A;  4DBR A;  1NLO C;  2CYZ B;  3GIB A;  1TSF A;  2M0O A;  1VIF A;  5FRN A;  2LJ1 A;  3OYE A;  1YJW Q;  5HKC A;  1Q81 C;  2C0T A;  4J7F A;  3CC7 Q;  2KYM A;  3LX7 A;  1I07 A;  1XOV A;  4PFP A;  3H8Z A;  5D6Y A;  1ZLM A;  2DRM A;  1R0C B;  2E41 A;  1NEB A;  1WHG A;  2KNB B;  2RMO A;  1RAC B;  2QQA A;  2V1Q A;  1WLP B;  3CCL A;  1E6H A;  2EQJ A;  2HQX A;  3CPW S;  4ELZ C;  3MEA A;  2X9H A;  4PL6 A;  3DKM A;  1VYT A;  4HVW A;  1VQ9 Q;  2VWF A;  2XG8 D;  1QVG A;  1OU8 A;  2JS0 A;  1V1C A;  4M7A D;  2LQN A;  2CP6 A;  1CKB A;  4MZM A;  4RTT A;  3NFC A;  2LRQ A;  5CKF A;  1WJS A;  1UG1 A;  3EAE A;  1AZG B;  1OEB A;  2V1R A;  3HKS A;  2X3X D;  1RAF B;  4QVD A;  2GQI A;  4PKC C;  5KYU B;  3CC2 Q;  3CCJ A;  5FWB A;  5I22 A;  1RAD B;  3FB9 A;  2KAF A;  1OUL A;  2QEX T;  1KHI A;  4MDW A;  1RAA B;  2FZC B;  4O5V A;  1PSF A;  1K8A R;  1XQH A;  1KQ2 A;  2AT1 B;  1NG2 A;  2G3R A;  1UGS B;  2VVK A;  2ECZ A;  5KYU A;  5IT9 E;  1AVZ C;  3MCA B;  3A1P A;  4JZ3 A;  4JS5 A;  2SEM A;  2O4X B;  1Q7Y C;  1G3T A;  1WNL A;  3OYJ A;  3OYK A;  3OYH A;  1VQP T;  2QA4 A;  3DLM A;  2YDL A;  2I2L A;  2L89 A;  4A4G A;  2M9U A;  1K76 A;  1VQL Q;  2O4X A;  1NYG A;  3L2Z A;  1S72 Q;  4FT2 A;  2JNG A;  2RI2 A;  3JB9 I;  3MJX A;  2BE9 B;  3ZFJ A;  3I9Q A;  3TVT A;  2EJ9 A;  4RUG A;  3AHU A;  4PJJ A;  2HL5 C;  2L2P A;  2AKK A;  2WAC A;  2CS7 A;  1N9R A;  4GLM A;  1VQK A;  1W1F A;  4J9D A;  2DRK A;  4CC4 B;  3CME Q;  3C12 A;  1YI2 Q;  1ARK A;  5LJ3 j;  1EIF A;  5EG2 A;  2DEU A;  1WYX A;  1YNZ A;  2EYZ A;  2LDM A;  2KXC A;  1VQN T;  1JJ2 A;  1QVF A;  4IIO A;  3QJY A;  4OML A;  5CKE A;  4M78 D;  4IKF A;  3QZ5 B;  1WZO A;  1WHJ A;  2VAS A;  1K0X A;  1S1N A;  1OX9 A;  2KGT A;  5LL6 S;  1UB4 A;  1DJ7 B;  1WJQ A;  1RAI B;  1I81 A;  3CCU T;  1WXT A;  2KBT A;  3UDC A;  5I21 A;  2M1H A;  3CCL T;  2HMA A;  5LJ3 h;  1EX4 A;  2FRW A;  2LNH B;  2QTX A;  3WVD B;  2F1L A;  2WSC E;  2M51 A;  1ZA1 B;  4M7A B;  2L3S A;  1NPP A;  3I35 A;  3A8M B;  4J8O A;  1OV3 A;  5CKB A;  1YCS B;  1M1K R;  2FPE A;  2EJF A;  4MZP A;  3S6W A;  2CH4 A;  4A4F A;  4J9G A;  1SF9 A;  2K5F A;  4HT9 A;  3R6O A;  3JB9 J;  3CCV A;  1I4K 1;  4XTZ A;  5GAN g;  2AZV A;  4BE0 A;  2P0K A;  3HRT A;  1ZSG A;  5GAN j;  3GPL A;  1LOJ A;  1KQS A;  2ZCF B;  3L42 A;  3TSW A;  4FSS A;  2DD4 A;  3GBQ A;  2QEX Q;  1K9M U;  1Y07 A;  2ZPE B;  2HQH A;  5DY9 A;  1TUD A;  4C5H A;  1N27 A;  3TQ7 P;  1IGU A;  1YIJ A;  4JRK A;  1YJN Q;  4RTX A;  2QA4 T;  2OTJ A;  1VQP Q;  2X4Y A;  2P0P A;  3EFO A;  2YXY A;  1GCQ A;  3V8J A;  1SRL A;  5GAN h;  1GCQ C;  4XAX B;  4C0D B;  3VS4 A;  4IUQ A;  1K9A A;  4PLL A;  2HD0 A;  3OY9 A;  3U23 A;  2O31 A;  1YN8 A; 
#chains in the Genus database with same CATH homology
 1VQ6 Q;  3CCL Q;  3G4S Q;  1YHQ Q;  1M90 R;  1YJ9 Q;  1K9M R;  1VQL Q;  3G6E Q;  1YJN Q;  3OW2 P;  1KQS P;  3CCS Q;  1VQ8 Q;  3CCE Q;  3CD6 Q;  3CME Q;  1Q82 R;  1YI2 Q;  1VQP Q;  1N8R R;  1M1K R;  1VQ5 Q;  1S72 Q;  3CMA Q;  3CCJ Q;  1Q7Y R;  2QEX Q;  1Q81 R;  3CCV Q;  1VQ4 Q;  1YJW Q;  1VQO Q;  3CXC P;  1KD1 R;  3CPW P;  1Q86 R;  3CCM Q;  2QA4 Q;  1JJ2 P;  1VQK Q;  3G71 Q;  1K73 R;  1VQ9 Q;  1NJI R;  1YIJ Q;  1VQ7 Q;  3CC7 Q;  1QVF P;  1QVG P;  1KC8 R;  1YIT Q;  3CC2 Q;  3CC4 Q;  3I55 Q;  2OTJ Q;  2OTL Q;  3CCU Q;  1VQM Q;  1W2B P;  3I56 Q;  1VQN Q;  3CCQ Q;  3CCR Q;  1K8A R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...